Superfood, Super You

Comments

Transcription

Superfood, Super You
Dr. Josh Axe
Introduction
,VQnWLWIULJKWHQLQJWROHDUQDORYHGRQHKDVDVHULRXVKHDOWKSUREOHPOLNHFDQFHU
KHDUW GLVHDVH RU GLDEHWHV" )LYH RI VL[ $PHULFDQV GLH RI KHDUW GLVHDVH RU FDQFHU
GLDEHWHVKDVWULSOHGLQWKHSDVWWHQ\HDUVDQGE\LWnVHVWLPDWHGWKDWRIDOO
$PHULFDQVZLOOEHREHVH3HRSOHDUHLQJUHDWGDQJHUWRGD\DQGGHVSHUDWHO\QHHG
DKHUR7KDWKHURLV6XSHUIRRG
:KDW ERGLO\ 9LOODLQ DUH \RX EDWWOLQJ"
:HLJKW*DLQ"/DFNRI(QHUJ\"'LJHVWLYH
3UREOHPV" 1R PDWWHU WKH LVVXH
6XSHUIRRGVFDQKHOS\RXZLQ
6DGO\HYHQWKRXJKVKHZDVGLDJQRVHGDVEHLQJKHDOWK\DIWHUKHUWUHDWPHQWVVKHZDV
VLFNHUWKDQHYHU0\PRPVWUXJJOHGZLWKFKURQLFIDWLJXHGHSUHVVLRQFRQVWLSDWLRQ
DQGZDVVLFNDOOWKHWLPH6KHFRQWLQXHGWRKDYHWKHVHSUREOHPVIRUDQRWKHUWHQ
\HDUVXQWLORQHGD\,UHFHLYHGDFDOOIURPKHU6KHnGMXVWEHHQWROGE\KHUGRFWRU
WKDWWKH\IRXQGDFPPDVVRQKHUOXQJVDQGIURPWKHVFDQWKH\EHOLHYHGLWZDV
FDQFHU7KH\ZHUHUHFRPPHQGLQJVXUJHU\DQGUDGLDWLRQEXWWKLVWLPHVKHZDQWHG
WRGRVRPHWKLQJPRUHQDWXUDO
,Q WKLV H%RRN \RXnOO OHDUQ H[DFWO\ ZKLFK
6XSHUIRRGV FDQ KHOS \RX FRQTXHU DQG
DFKLHYH\RXUKHDOWKJRDOV0D\EH\RXnYH
WULHGHYHU\ZHLJKWORVVSURJUDPSURGXFW
DQG SLOO RQ WKH SODQHW EXW WKH ZHLJKW
ZRQnW FRPH RII RU LW MXVW NHHSV FRPLQJ
EDFN,KDYHVRPHJUHDWQHZVIRU\RX
5DWKHU WKDQ JRLQJ WKH
WUDGLWLRQDO PHGLFDO URXWH
VKH GHFLGHG WR IROORZ P\
DGYLFH DQG WDNH D QDWXUDO
DSSURDFK 7KH ELJJHVW WKLQJ
P\ PRP FKDQJHG ZDV KHU
GLHW 3UHYLRXVO\ VKH WKRXJKW
WKH WKUHH PDLQ IRRG JURXSV
ZHUH IDVW IUR]HQ DQG LQVWDQW
:HFKDQJHGWKDWWR.HILU.DOH
DQG%OXHEHUULHV
I’m Dr. Josh Axe, and I’m here to help you become a super-­you! ,nYH
VHHQ WKRXVDQGV RI SHRSOH DFKLHYH WKHLU
KHDOWK JRDOV WKURXJK P\ UDGLR VKRZ
ERRNV DQG VHPLQDUV (YHU\RQH IURP
VWD\DWKRPH PRPnV WR 2O\PSLF OHYHO
DWKOHWHV ,nP DOVR D ZHOOQHVV SK\VLFLDQ
DQGWULDWKOHWHEXWPRVWO\,nPSDVVLRQDWH
DERXW KHOSLQJ SHRSOH WUDQVIRUP WKHLU
KHDOWKDQGOLYHV
$UH\RXUHDG\WREHFRPHDVXSHU\RX"
0\PRPPDGHDWULSWRWKHGRFWRUZKHUHWKH\UHFRPPHQGHGVXUJHU\DQG
&KHPRWKHUDS\ 7DNLQJ WKHLU DGYLFH VKH ZHQW WKURXJK DOO WKH WUDGLWLRQDO PHGLFDO
WUHDWPHQWV,VWLOOUHPHPEHUZDWFKLQJKHUKDLUIDOORXWDQGWKLQNLQJVKHKDGDJHG
\HDUVLQWZRZHHNVDIWHUJRLQJWKURXJKKHUFKHPRWUHDWPHQWV6KHSUHVVHGRQ
WKURXJKKHUWUHDWPHQWVOLNHVRPDQ\GRWRGD\DQGDIWHUEDWWOLQJIRUPRQWKVVKH
ZDVGLDJQRVHGDVFDQFHUIUHHDQGÆKHDOWK\È
Dr. Josh Axe, Nashville Triathlon, TN
Mom’s Victory with Superfoods
6HYHQWHHQ\HDUVDJRP\PRPZDVGLDJQRVHGZLWKEUHDVWFDQFHU7KDWZDVDFUD]\
UHDOLW\IRUP\IDPLO\DWWKHWLPHEHFDXVHVKHZDVDJ\PWHDFKHUVZLPLQVWUXFWRU
DQGDQDFWLYHPRPZKRORRNHGKHDOWK\+RZFRXOGVRPHRQHVRDFWLYHHQGXSZLWK
FDQFHUDW",ZDVWKLUWHHQ\HDUVROGDQGUHPHPEHUDVNLQJP\VHOIWKLVTXHVWLRQ
EXWKDYLQJQRDQVZHU
6KH ZHQW EDFN IRU D FKHFNXS
IRXU PRQWKV ODWHU DQG WR WKH
GRFWRUnV DPD]HPHQW WKH
My mom and dad after she placed 2nd in her 5K
WXPRUV KDG VKUXQN LQ KDOI
2QH\HDUODWHUWKHWXPRUVZHUHFRPSOHWHO\JRQH6KHQHHGHGD6XSHUKHURDQGZH
JLYHDOOWKHJORU\WR*RGIRUKHDOLQJKHUEXWZHNQRZWKDW*RGFUHDWHG6XSHUIRRGV
WRJLYHKHUKHDOWKEDFN7RGD\VKHnVLQWKHEHVWVKDSHRIKHUOLIH
6KHDFWXDOO\MXVWUDFHGKHUILUVW.ODVW\HDUDQGILQLVKHGVHFRQGLQKHUDJHJURXSDW
\HDUVROG6KHZHQWIURP6XSHUVLFNWR6XSHUVWDUE\HDWLQJ6XSHUIRRGV&DQ\RX
VHHZKHUHVXSHUIRRGVFRXOGSRVVLEO\KHOSDORYHGRQH\RXNQRZ":RXOGQnWLWEHRI
JUHDWYDOXHWRWKHPIRU\RXWRVKDUHWKLVLQIRUPDWLRQ"2QFH\RXUHDGWKLVH%RRN
\RXFDQVKDUHWKHVHWHDFKLQJVDQGEHDKHURWRVRPHRQHHOVH
What are Superfoods?
6XSHUIRRGV DUH QDWXUDO QXWULHQWGHQVH FRPSRXQGV WKDW FRQWDLQ KLJK
FRQFHQWUDWLRQV RI HVVHQWLDO QXWULHQWV ZLWK SURYHQ KHDOWK EHQHILWV 7KH\nUH KLJK LQ
YLWDPLQVPLQHUDOVRPHJDIDWW\DFLGVSURELRWLFVRUDQWLR[LGDQWVMXVWWRQDPH
DIHZ
2YHU WKH SDVW VHYHUDO \HDUV ,nYH ZRUNHG ZLWK D UDQJH RI 2O\PSLF OHYHO
DWKOHWHVDQGWKH\DOOKDYHWKHVDPHWKLQJLQFRPPRQWKH\nUHVLPSO\WKHEHVWDW
ZKDWWKH\GR,OLNHWRWKLQNRI6XSHU)RRGVOLNH2O\PSLFFRPSHWLWRUV,I\RXnUHSLFNLQJ
VRPHRQHWREHRQ\RXU
UHOD\ IRU VZLPPLQJ
GR \RX ZDQW -RH
6FKPRH ZKRnV QHYHU
VZDPDGD\LQKLVOLIH
RU 0LFKDHO 3KHOSV"
,WnV REYLRXV 0LFKDHO
3KHOSV LV D VXSHULRU
DWKOHWHDQGLI\RXZDQW
WR ZLQ \RX ZDQW KLP
RQ \RXU WHDP ,WnV WKH
VDPHZLWKIRRG
,I \RX ZDQW
WR DJH VORZHU DQG OLYH
ORQJHU \RX FDQ SLFN
Dr. Axe, Ryan Lochte
GRQXWV RU EOXHEHUULHV
U.S. Swimming National Championships
WR EH RQ \RXU WHDP ,I
\RXZDQWWRZLQJRZLWKEOXHEHUULHVEHFDXVHWKH\KDYHVXSHUDQWLR[LGDQWVIRUDQWL
DJLQJ,nPQRWVD\LQJ\RXFDQHDWDVSHFLILFVXSHUEHUU\RQFHDGD\IROORZHGE\D
GRXEOHEDFRQFKHHVHEXUJHUDQGVWLOOH[SHFWSHDNUHVXOWV6XSHU)RRGVZRUNEHWWHU
DVDWHDP/LNHWKH$YHQJHUV;0HQRU3RZHU5DQJHUVE\WKHLUSRZHUVFRPELQHG
<RXFDQDFKLHYHVXSHUKHDOWKUHVXOWVE\FRPELQLQJFHUWDLQ6XSHU)RRGVWRJHWKHU
$IULFDQ0DQJR$PDVDL&KLD 6XSHU:HLJKW/RVV
:KDWnV\RXUELJJHVWKHDOWKJRDO",VLWWRORVHZHLJKWGHWR[DJHVORZHU
EXLOGPXVFOHRULQFUHDVHDWKOHWLFSHUIRUPDQFH"'HSHQGLQJRQZKDWW\SHRIVXSHU
UHVXOWV\RXZDQWWRVHH\RXnUHJRLQJWRQHHGDVXSHUSODQ,NQRZHYHU\RQHKDV
GLIIHUHQWKHDOWKJRDOVVR,FUHDWHGWUDFNVIRU\RXWRIROORZ
“Let thy SuperFood be thy SuperHero!”
4 PLANS FOR FAST RESULTS
,GLYLGHGWKHVXSHUIRRGVLQWRIRXUVHFWLRQVEXWDOOWKHVHVXSHUIRRGVFDQKHOS\RXLQ
DOODUHDV)RULQVWDQFHWKHVXSHUIRRG$PDVDLKHOSV\RXORVHERG\IDWEXLOGPXVFOH
DJHVORZHU$1'GHWR[,SHUVRQDOO\FRQVXPHDOOWKHVXSHUIRRGVVRUHDGWKURXJK
HDFKVHFWLRQWKHQSLFN\RXUSODQDWWKHHQG5HDG\"8SXSDQGDZD\
1. Weight Loss
2. Detox
3. Anti-Aging
4. Muscle Building
THE SUPERFOOD LIST
+2ORZ7'6ZDWHU
&XOWXUHG'DLU\$PDVDL.HILU%HWD&DVHLQ$)UHH
.DOH
%HUULHV%OXH5DVS,QGLDQ*RRVHEHUU\
&KLDDQG)OD[VHHGV
%URFFROL
:LOG6DOPRQ
$IULFDQ0DQJR
3DVWXUHG(JJV
$OJDH*UHHQ%URZQ%OXH*UHHQ
5DZ*UHHQ)HG&KHHVH
$YRFDGR
&LQQDPRQ
&RFRQXW
*UHHQIHG%HHI
*DUOLF
7XUPHULF
)HUPHQWHG:KH\
&RFRD
$OPRQGV
Super Weight Loss
African Mango
Coconut
GreenFed Dairy
Cinnamon
Kale
7KH VWDWLVWLFV DUH VWXQQLQJ RI $PHULFDQV DUH REHVH DQG DUH
RYHUZHLJKW7KDWPHDQVH[DFWO\RI$PHULFDQVQHHGWRORVHZHLJKW
2EHVLW\KDVGRXEOHGVLQFH(National Center for Health Statistics)
RI NLGV DUH RYHUZHLJKW DQG RI $PHULFDQ FKLOGUHQ DUH DOUHDG\ REHVH
(Center for Disease Control 2009)
:HGRQnWMXVWQHHGWRORVHZHLJKWWRORRNJRRGLQDVZLPVXLWZHQHHGWR
ORVHZHLJKWWROLYHDQGIXOILOORXU*RGJLYHQPLVVLRQV5HVHDUFKVKRZVWKDWREHVLW\
GRXEOHV\RXUULVNRIKHDUWIDLOXUHDQGWULSOHVWKHULVNRIEUHDVWFDQFHULQZRPHQ7KH
DYHUDJHPLGGOHDJHZHLJKWJDLQRIOEVLQFUHDVHV\RXUULVNRIDKHDUWDWWDFNE\
%XWWKLQNDERXWWKHIOLSVLGH
If you lose 22 lbs, you decrease your
risk of heart attack by 75%
and risk of cancer by 50%!
(Okinawa Diet 2004, Bradley)
%\ HDWLQJ WKH ULJKW 6XSHUIRRGV
\RX ZRQnW MXVW ORVH ZHLJKW
EXW \RXnOO EH FKDQJLQJ
\RXUOLIH\RXUOHJDF\DQG
FKDQJLQJ\RXUZRUOG
6R OHWnV MXPS LQWR WKH
QXWULHQWVWKDWKDYHEHHQ
VFLHQWLILFDOO\ SURYHQ WR
KHOS \RXU ERG\ EXUQ
IDWDQGORVHZHLJKW
AFRICAN MANGO
$IULFDQ0DQJRFDQKHOS\RXORVHZHLJKWLQDIODVK7KHSRZHUIXOEHQHILWVRI
$IULFDQ0DQJRDUHQRZZHOOSXEOLFL]HGWKDQNVWR'U2]5HFHQWO\KHIHDWXUHGLWRQ
WKH2SUDK:LQIUH\VKRZDQGH[WROOHGWKHYLUWXHVRIWKLVVXSHUIRRGDVDZHLJKWORVV
DLGDQGQDWXUDOIDWEXUQHU
,QDFRQWUROOHGVWXG\SXEOLVKHGLQWKH Journal of Nutrition 2008KXPDQV
WDNLQJWKLVQHZFRPSRXQGORVWSRXQGVRYHUDZHHNSHULRGFRPSDUHGWROHVV
WKDQSRXQGVLQWKHSODFHERJURXS'LIIHUHQWWKDQRWKHUZHLJKWORVVVWXGLHVWKDW
PDQGDWHDWOHDVWVRPHPRGHUDWLRQLQIRRGLQWDNHWKHVHVWXG\SDUWLFLSDQWVGLGQRW
DOWHUWKHLUGLHWLQDQ\ZD\
7KH VSHFLILF FRPSRXQG LQ $IULFDQ 0DQJR ZKLFK VXSSRUWV ZHLJKW ORVV
LV FDOOHG ,UYLQJLD 7KLV FRPSRXQG KDV VKRZQ EHWWHU ZHLJKW ORVV UHVXOWV WKDQ DQ\
KRUPRQHGUXJRUIRRGLQPHGLFDOKLVWRU\
(YHQLI\RXGRQnWQHHGWRORVHZHLJKW$IULFDQ0DQJRLVKLJKO\EHQHILFLDODV
LWFRQWDLQVQXWULHQWVWKDWQDWXUDOO\KHOSORZHU/'/FKROHVWHURO
7KH$IULFDQ0DQJRLVIRXQGLQ&DPHURRQ$IULFDZKHUHLWVIUXLWDQGVHHGV
KDYHEHHQXVHGIRUKXQGUHGVRI\HDUVIRUWKHLUPHGLFDOEHQHILWV2WKHUQDPHVIRU
$IULFDQ0DQJRDUHo,UYLQJLD*DFRQHVLVpZKLOHQDWLYHVFDOOLWo'LNND1XWVp
$IULFDQ0DQJR,UYLQJLDZRUNVLQ)DQWDVWLFZD\V
:RUNVZLWKDGLSRQHFWLQWRLQFUHDVHLQVXOLQVHQVLWLYLW\
%DODQFHVWKHKRUPRQH/HSWLQZKLFKVLJQDOV\RXUEUDLQWREXUQIDW
'HFUHDVHVWKHDPRXQWRIEORRGJOXFRVHWKDWWXUQVLQWRIDW
%ORFNVWKHHQ]\PHDP\ODVHIURPGLJHVWLQJVWDUFKHVWKDWZRXOGKDYH
RWKHUZLVHEHFRPHVXJDU
,Q WKH PRVW SRSXODU FOLQLFDO VWXGLHV GRQH RQ ,UYLQJLD $IULFDQ 0DQJR
PJ ZDV WDNHQ WZLFH GDLO\ DQG SDUWLFLSDQWV ORVW SRXQGV LQ ZHHNV DQG
SRXQGVLQZHHNV,SHUVRQDOO\GULQNRQHVHUYLQJGDLO\ZLWKPJRI$IULFDQ
0DQJR PLQXWHV EHIRUH PHDOV RU [ GDLO\ WR JHW WKH IDQWDVWLF UHVXOWV RI
$IULFDQ0DQJR
Super Weight Loss
COCONUT
(YHUZRQGHUKRZVXSHUKHURHVOLNH:RQGHU:RPDQDOZD\VORRNVR
JRRG LQ VSDQGH[" ,W FRXOG EH IURP FRQVXPLQJ FRFRQXW )RU \HDUV FRFRQXW KDV
WDNHQWKHEODPHIRUFRQWDLQLQJVDWXUDWHGIDW%XWUHFHQWUHVHDUFKLVSURYLQJWKDW
FHUWDLQW\SHVRIVDWXUDWHGIDWDUHDFWXDOO\JRRGDQGFDQKHOS\RXUERG\EXUQIDW
DQGORVHZHLJKW
GREEN-FED DAIRY (CLA) :DQWWRNQRZZKHUH0LJKW\0RXVHJRWDOOKLV
0RMR":HOOZKDWGRPLFHORYHPRVW"&KHHVH&KHHVHDQGRWKHUGDLU\SURGXFWV
OLNH$PDVDLPLONDQGEXWWHUFRQWDLQ&/$&RQMXJDWHG/LQROHLF$FLGDIDWW\DFLG
WKDWEXUQVIDW%XWLWFDQnWEHMXVWDQ\FKHHVHRUGDLU\SURGXFW,QRUGHUIRUGDLU\WR
KDYHKLJKDPRXQWVRI&/$WKHFRZPXVWEHIHGJUDVVDQGQRWJUDLQV
&RFRQXWFRQWDLQVKHDOWK\IDWVFDOOHGPHGLXPFKDLQIDWW\DFLGV0&7nV
$ VWXG\ SXEOLVKHG LQ WKH International Journal of Obesity IRXQG WKDW 0&7nV
LQFUHDVH OLSLG IDW R[LGDWLRQ ZKLFK PHDQV FRFRQXW ZLOO EXUQ XS H[FHVV FDORULHV
DQG KHOS \RX ORVH ZHLJKW &RFRQXW KDV DOVR EHHQ VKRZQ WR UHGXFH FKROHVWHURO
WULJO\FHULGHVSKRVSKROLSLGVDQG/'/FKROHVWHUROOHYHOV
q
q
q
q
q
q
q
3RZHUIXOIDWEXUQHU
,PSURYHVGLJHVWLRQ
%XLOGVPXVFOH
5HFRYHU\IURPIRRGSRLVRQLQJ
5LGVWKHERG\RISDUDVLWHV
%UHDNVGRZQNLGQH\VWRQHV
/HVVHQVWKHV\PSWRPVRIJO\FHPLD
,IFRFRQXWRLOLVWDNHQDWWKHVDPHWLPHVDVRPHJDIDWW\DFLGVLWFDQPDNH
WKHPWZLFHDVHIIHFWLYHDVWKH\DUHUHDGLO\DYDLODEOHWREHGLJHVWHGDQGXVHGE\WKH
ERG\
$WKOHWHVKDYHIRXQGWKDWFRFRQXWOLTXLGHQKDQFHVWKHLUSHUIRUPDQFHDQG
K\GUDWLRQ1%$VXSHUVWDU.HYLQ*DUQHWWKDVSDUWQHUHGZLWK0DGRQQDWRLQYHVWLQD
FRFRQXWZDWHUFRPSDQ\VHHLQJLWDVoQDWXUHnVVSRUWVGULQNp&RFRQXWOLTXLGKDVWKH
VDPHILYHHOHFWURO\WHVLQWKHVDPHOHYHOVDVKXPDQEORRGVRGLXPSKRVSKRURXV
FDOFLXPPDJQHVLXPDQGSRWDVVLXPPDNLQJLWDJUHDWVXSHUIRRGFRQWHQGHU
7KH 0&7nV IRXQG LQ FRFRQXW DUH DOVR XVHG LQ SRSXODU PXVFOH EXLOGLQJ
SURGXFWVOLNH0XVFOH0LON0RVWFRPSDQLHVXVHSURFHVVHG0&7nVEXWLI\RXHDWUHDO
FRFRQXW\RXnUHJHWWLQJKLJKTXDOLW\0&7nV7KH\DUHQnWMXVWJRRGIRUEXUQLQJIDW
WKH\nUHDOVRJUHDWIRUEXLOGLQJPXVFOH
&RFRQXWDOVRLPSURYHVGLJHVWLRQDVLWKHOSVWKHERG\DEVRUEIDWVROXEOH
YLWDPLQVFDOFLXPDQGPDJQHVLXP,WnVDSRZHUIXODLGWR\RXULPPXQHV\VWHPDQG
FDQILJKWRIIEDFWHULDYLUXVHVDQGIXQJDORYHUJURZWKVXFKDVFDQGLGD:KHQEX\LQJ
FRFRQXWRLOPDNHVXUHWRJHWoXQUHILQHGp,WKLQN&RFRQXWPLJKWEHWKHVHFUHWIRU
KRZ&KULVWLDQ%DOHJRWWKRVHDEVIRUWKH%DWPDQPRYLHV
GRASSfed VS Greenfed
GRASS-fed cows only have to eat grass 30% of the year.
GREEN-fed cows eat grass, herbs, legumes and other
greens 100% of the year.
*UHHQIHGLVWKHKLJKHVWVWDQGDUGDQGW\SLFDOO\FRQWDLQVWKHODUJHVWDPRXQW
RI&/$$FFRUGLQJWRDVWXG\DW&DOLIRUQLD6WDWH8QLYHUVLW\JUDVVIHGEHHIDQGGDLU\
FRQWDLQWKUHHWLPHVPRUH&/$WKDQJUDLQIHGEHHIDQGGDLU\
,WnVEHHQVKRZQWRSURPRWHZHLJKWORVVEXUQIDWILJKW
FDQFHUDQGHYHQUHGXFHWKHULVNRIKHDUWGLVHDVHDFFRUGLQJ
WRWKHAmerican Journal of Clinical Nutrition0D\
$VWXG\RXWRIWKHJournal of Animal
Sciences IRXQG WKDW JUDVVIHG FRZV PD\
SURGXFH PRUH &/$ WKDQ FRZV IHG
FRUQDQGJUDLQV
2YHU FOLQLFDO VWXGLHV KDYH EHHQ
GRQH RQ &/$ GLVSOD\LQJ LWnV DPD]LQJ DELOLW\
WR DLG WKH ERG\ LQ EXUQLQJ IDW DQG EXLOGLQJ
PXVFOH7KHUHDUHGLIIHUHQWW\SHVRI&/$DQG
PRVW FRPPHUFLDO VXSSOHPHQWV IRXQG LQ KHDOWK IRRG
VWRUHVWRGD\FRQWDLQRQO\<RXFRXOGVSHQGDPRQWKRQ
WKLVVXSSOHPHQWKRZHYHUWKHEHVWVRXUFHIRU&/$LVWRFRQVXPH
KLJKTXDOLW\JUDVVIHGRUJUHHQIHGPHDWDQGGDLU\
Super Weight Loss
CINNAMON&DQ\RXQDPHDVXSHUIRRGWKDWLVYHU\KLJKLQFDOFLXP\HWLVQRW
DGDLU\SURGXFWKLJKLQILEHULURQDQGPDQJDQHVH"7KHRQO\IRRGWKDWWLFNVDOO
WKHVHER[HVLVFLQQDPRQ(YHQEHWWHULWLVLQH[SHQVLYHKDVQRVLGHHIIHFWVDQGKDV
DKRVWRIKHDOWKEHQHILWV,WVHVVHQWLDORLOVPDNHLWYDOXHGIRULWVZDUPLQJTXDOLWLHV
DVLWDLGVIDWEXUQLQJDVZHOO
$ZHHNVWXG\RXWRI/RQGRQIRXQGWKDW&LQQDPRQGURSV$FOHYHOVLQ
'LDEHWLFVE\(Journal of British Diabetic Association)7KHSDUWLFLSDQWVLQWKH
VWXG\WRRNJRIFLQQDPRQGDLO\DQGLWQRWRQO\KHOSHGZLWKEORRGVXJDUEXWLWDOVR
VLJQLILFDQWO\UHGXFHGEORRGSUHVVXUH
Regulates blood sugar
Lowers A1c levels in Diabetics
Powerful Anti-­Oxidant
Protects against free radical damage
$QRWKHU VWXG\ IRXQG WKDW FLQQDPRQ LQFUHDVHG JOXFRVH PHWDEROLVP E\
DERXWWLPHVZKLFKZRXOGPDNHDKXJHGLIIHUHQFHLQ\RXUERG\EHLQJDEOHWR
UHJXODWHEORRGVXJDU
&LQQDPRQ ZRUNV LQ WKUHH GLIIHUHQW ZD\V )LUVW LW VORZV WKH HPSW\LQJ RI
\RXU VWRPDFK WR UHGXFH VKDUS ULVHV LQ EORRG VXJDU 6HFRQG LW LQFUHDVHV LQVXOLQ
VHQVLWLYLW\7KLUGFLQQDPRQHQKDQFHV\RXUDQWLR[LGDQWGHIHQVHV
$ UHFHQW VWXG\ IRXQG WKDW WKHUH DUH DQWLR[LGDQWV IRXQG LQ FLQQDPRQ
FDOOHGSRO\SKHQROVDQGELRIODYDQRLGVZKLFKPD\EHUHVSRQVLEOHIRUDOOWKHKHDOWK
EHQHILWV $QWLR[LGDQWV FDQ ZRUN LQ PDQ\ GLIIHUHQW ZD\V OLNH SURWHFWLQJ \RXU FHOOV
DJDLQVWIUHHUDGLFDOGDPDJHWKDWFDQFDXVHDJLQJ%XWWKHVHDQWLR[LGDQWVVHHPWR
UHJXODWHEORRGVXJDUZKLFKFDQKHOS\RXUERG\EXUQIDWDQGORVHZHLJKW
)URPDOOWKHUHVHDUFKZHnYHVHHQ&LQQDPRQKDVEHHQVKRZQWRKHOSGLDEHWLFV
ORZHUEORRGSUHVVXUHDQGERRVW\RXUPHWDEROLVP:KRNQHZWKLVVZHHWWDVWLQJ
KHUEFRXOGKDYHVXFKDVZHHWHIIHFWRQ\RXUERG\
KALE
,WnVDELUGLWnVDSODQHQRLWnV.DOH"$FFRUGLQJWR-RHO)XKUPDQDXWKRU
RI (DW WR /LYH .DOH LV .LQJ LQ WKH YHJHWDEOH .LQJGRP 7KRXJK .DOH RQO\ KDV FDORULHVSHUVHUYLQJLWLVSDFNHGZLWK&DOFLXP0DJQHVLXP9LWDPLQ%/XWHLQDQG
%HWDFDURWHQH3OXVLWGHOLYHUVRIWKHGDLO\UHTXLUHPHQWVRI9LWDPLQ$
RI 9LWDPLQ & DQG RI 9LWDPLQ . ZKLFK KHOSV EXLOG VWURQJ ERQHV LPSURYH
YLVLRQDQGDLGLQGLJHVWLRQ
“We’re overfed,
but undernourished.”
0DQ\SHRSOHWRGD\VSHQGWLPHFRXQWLQJWKHLUFDORULHVZKHQWKH\VKRXOG
EHFRXQWLQJWKHLUQXWULHQWVLQVWHDG$PHULFDQVQHHGPRUHQXWULHQWGHQVHIRRGV
DQGJUHHQOHDI\YHJHWDEOHVOLNH.DOHDUHWKHPRVWQXWULHQWGHQVHIRRGVRQWKH
SODQHW
5HVXOWV RI D VWXG\ LQ WKH British Medical Journal UHYLHZHG VL[ VWXGLHV
FRYHULQJ PRUH WKDQ SHRSOH
FRQFOXGLQJ WKDW RQH DQG RQH KDOI
VHUYLQJVRIJUHHQOHDI\YHJHWDEOHV
SHU GD\ ORZHUHG WKH ULVN RI 7\SH
,, GLDEHWHV E\ DQG
ERRVWHGPHWDEROLVP
.DOH FDQ EH
HDWHQUDZRUFRRNHGDQG
, UHFRPPHQG LW VDXWHHG
LQFRFRQXWRLOZLWKJDUOLF
RQLRQV DQG VHD VDOW LQ D
VDODGRUSXWLQWRD*UHHQ6XSHU
6PRRWKLH :LWK 1XPEHUV OLNH
WKHVH LWnV QR ZRQGHU ZK\ .DOH
LV .LQJ LQ WKH YHJHWDEOH NLQJGRP 6WDUW
HDWLQJ.DOHWRGD\WRVRDUWRQHZKHLJKWVLQ
KHDOWK
Meal Plan Super Weight Loss
WEIGHT LOSS MEAL PLAN
Morning
%HUU\6PRRWKLH
9HJHWDEOH2PHOHW
&RFRQXW%HUU\6KDNH
*UDLQOHVV*UDQRODZLWKR]$PDVDL
Mid-morning
$IULFDQ0DQJRPJ
Lunch
6XSHUIRRG6DODG
*UHHQIHG%HHI6WLU)U\
6DODGZLWK&KLFNHQ6DOPRQRU(JJV
*UHHQIHG+RW'RJVZLWK6DXWHHG3HSSHUVDQG2QLRQV
9HJHWDEOH6RXS
Afternoon
R]5DZ&KHHVH
FXS$OPRQGVRU3XPSNLQ6HHGV
FXS+XPPXVRU*XDFDPROHZLWK9HJHWDEOHV
$PDVDLRU&RFRQXW0LONZLWK&KLD6HHGV
Pre-Dinner
$IULFDQ0DQJRPJ
Dinner
:LOG6DOPRQZLWK%URFFROL&DXOLIORZHUDQG&DUURWPHGOH\
*UHHQIHG%XUJHUZ5DZ&KHGGDUDQG6DXWHHG*UHHQV
2UJDQLF)UHH5DQJH&KLFNHQ7HQGHUVZLWK0L[HG9HJHWDEOHV
*UHHQIHG&KLOLZLWK0DVKHG&DXOLIORZHU)DX[WDWRHV
&KLFNHQ6DODG/HWWXFH:UDSV
SUPER SIMPLE EXERCISE
,I\RXZDQWWREXUQIDWDQGORVHZHLJKWIDVW\RXQHHGWRGRD
FRPELQDWLRQRIZHLJKWWUDLQLQJDQGLQWHUYDOFDUGLRDOVRNQRZQDV
EXUVWWUDLQLQJ%XUVWWUDLQLQJLVVLPSO\H[HUFLVLQJOLNHDVSULQWHUUDWKHU
WKDQDPDUDWKRQUXQQHU
Burst Training:
Do 20-60 sec. bursts* at 80-100% of your max effort
Rest for 30 seconds
Repeat for 15 min.
1RWH7KHUHnVDWKRXVDQGGLIIHUHQWH[HUFLVHV\RXFDQGRZLWKWKLV
EXWWKHLQWHQVLW\DQGLQWHUYDOVDUHZKDW\RXVKRXOGIRFXVRQ
,GRWKLVZKLOHUXQQLQJRQDVSLQELNHRULQDSRRO
Super Detox
Water
Cultured Dairy
Flaxseeds
Algae
Cultured Whey
$FFRUGLQJ WR WKH ,QWHUQDWLRQDO $JHQF\ IRU 5HVHDUFK RQ &DQFHU RI
DOOFDQFHUVDUHDWWULEXWHGWRHQYLURQPHQWDOIDFWRUVUDWKHUWKDQJHQHWLFIDFWRUVDQG
FDUFLQRJHQLFFKHPLFDOVDQGWR[LQVFDQFDXVHVHULRXVLOOQHVVDQGGLVHDVH:LWKDOO
WKHWR[LQVLQRXUHQYLURQPHQWZHPXVWFRQVXPHIRRGVWKDWSURWHFWXVDQGKHOSXV
GHWR[ QDWXUDOO\ 7KH QH[W VXSHUIRRGV DQG EHYHUDJHV DUH JRLQJ WR FOHDQVH \RX
QDWXUDOO\
0DQ\RIRXUGULQNLQJERWWOHVWKHPVHOYHVFRQWDLQV%3$nV%LVSKHQRO$%3$nV
KDYHEHHQOLQNHGWRPLPLFHVWURJHQDQGLQWHUIHUHZLWKKRUPRQHOHYHOVZKLFKFDQ
LQFUHDVHWKHULVNRIEUHDVWSURVWDWHDQGRYDULDQFDQFHU,UHFRPPHQGVXEVWLWXWLQJ
DERWWOHZLWKVRPHWKLQJOLNHD.OHDQ.DQWHHQRUJODVV
, NQRZ D ORW RI SHRSOH ZDQWLQJ WR
GHWR[DOVRZDQWWRORVHZHLJKW:DWHUFDQ
KHOSZLWKZHLJKWORVV,I\RXKDYHWR[LQV
LQ\RXUZDWHUWKRVHWR[LQVJHWVWRUHGLQ
\RXU IDW FHOOV 7KH\ ZRQnW OHDYH \RXU
ERG\ XQWLO \RX UHGXFH \RXU WR[LF
H[SRVXUH
+DYH \RX HYHU H[HUFLVHG
DQGQRWIHOWOLNH\RXUERG\ZDVORVLQJ
ZHLJKWDVIDVWDVLWVKRXOG"7KDW
FDQ EH GXH WR WR[LFLW\
DQG D PDMRU VRXUFH
RIWR[LQVWRGD\LV
RXUZDWHU
H2O (WATER):KDWnVPRUHSUHFLRXVWKDQJROGVLOYHUDQGGLDPRQGV":DWHU
%XWGR\RXNQRZZKDWnVLQ\RXUZDWHU"0RVWSHRSOHGRQnWZDQWWRNQRZEXW,nOOWHOO\RX
DQ\ZD\7KH(QYLURQPHQWDO:RUNLQJ*URXS(:*IRXQGGLIIHUHQWFKHPLFDOV
LQWDSZDWHUWKURXJKRXWWKHFRXQWU\3DWULFLD+XQWSURIHVVRUDW:DVKLQJWRQ6WDWH
8QLYHUVLW\H[SODLQVo%LUWKFRQWUROSLOOVKRUPRQHWKHUDS\PHGLFDWLRQVDQGDKRVWRI
FRQWDPLQDQWVFDQDOOJHWLQWRRXUZDWHUVXSSO\DQGZHKDYHQnWILJXUHGRXWDZD\WR
DIIRUGDEO\ILOWHUWKHPRXWp
8QIRUWXQDWHO\ ERWWOHG ZDWHU LVQnW PXFK EHWWHU 7KH 1DWLRQDO 5HVRXUFHV
'HIHQVH&RXQFLOHVWLPDWHVWKDWDWOHDVWRIERWWOHGZDWHULVUHDOO\MXVWWDSZDWHU
7KH(:*IRXQGWKHWRSEUDQGVRIERWWOHGZDWHUFRQWDLQWR[LFSROOXWDQWV7KH
FRPPRQFKHPLFDOVIRXQGDUHDUVHQLFIHUWLOL]HUVKHDY\PHWDOVLQGXVWULDOVROYHQWV
DQGSKDUPDFHXWLFDOGUXJV
,WnVYLWDOWKDW\RXILQGFOHDQZDWHU'U6DXHULQKLVVWXG\o5HODWLRQVKLSRI
:DWHU WRWKH 5LVN RI '\LQJp PDGH D VXUSULVLQJ GLVFRYHU\ +H IRXQGWKDWDV WRWDO
GLVVROYHGVROLGV7'6LQFUHDVHLQDZDWHUVXSSO\VRGRHVWKHQXPEHURIFKURQLF
GLVHDVHV LQ WKH SRSXODWLRQ XVLQJ WKDW VXSSO\ 7KHUHIRUH WR EH D VXSHU EHYHUDJH
ZDWHUPXVWEHORZLQ7'6DQGKHUHnVZK\
Drink low-TDS bottled spring water,
taken straight from the ground to the bottle.
3XULILHGZDWHUKDVKDGDOOWKHVROLGVDQGLPSXULWLHVWDNHQRXWZKLOHVSULQJ
ZDWHU KDV D ZLGH UDQJH RI SXULW\ OHYHOV GHSHQGLQJ XSRQ WKH URFNV LW SDVVHV
RYHU:KHQWHVWHGIRU7'6WKHUHVXOWVVKRZWKHDPRXQWRILQRUJDQLFPLQHUDOV
WKDWWKHVSULQJZDWHUFRQWDLQV7'6ILJXUHVFDQUDQJHIURPJUHDWWR
QRWVRJRRG'LVVROYHGVROLGVFDQEHFKORULGHVVRGLXPDUVHQLF
FDGPLXPQLWUDWHVDQGPHWDOV
%H\RQG 2UJDQLF IRXQGHU -RUGDQ 5XELQ VDLG LWnV LPSRUWDQW IRU
ZDWHUWREHORZ7'6EHFDXVHLWVSXUSRVHLVWRFDUU\QXWULHQWVWRWKH
FHOOV+HWUDYHOHGWKHFRXQWU\DQGORRNHGDWGLIIHUHQWVSULQJVDQG
IRXQGWKHSXUHVWZDWHUWREHLQWKH%OXH5LGJH0RXQWDLQV:KHQ-RUGDQ
WHVWHGZDWHUIURPKLVVSULQJVLQ%OXH5LGJHLWKDGD7'6RIRQHRIWKH
EHVWWKDWKDVHYHUEHHQWHVWHG
Super Detox
CULTURED DAIRY (AMASAI AND KEFIR) 2IDOOWKHVXSHUIRRGVZHnYH
RUVZLPLQDFKORULQDWHGSRRO\RXnUHDOVRSUREDEO\SURELRWLFGHILFLHQW
$PDVDLLVDOVRWKHSHUIHFWSRVWZRUNRXWIRRG2QHR]VHUYLQJRIDPDVDL
FRQWDLQVJUDPVRIKLJKO\DEVRUEDEOHZKH\SURWHLQ&/$YLWDPLQ'FDOFLXP
YLWDPLQ.%YLWDPLQVDQGRPHJDIDWW\DFLGV
,Q 5LFKDUG 0RNXD D :LVFRQVLQ 0DVWHUnV VWXGHQW LQ )RRG DQG
1XWULWLRQ 6FLHQFHV VWXGLHG WKH EHQHILWV RI D
.HQ\DQ FXOWXUHG GDLU\ IRRG FDOOHG oDPDVLp +H
QRWLFHGWKDWFKLOGUHQZKRJUHZXSLQ.HQ\DKDG
DKHDOWKLHUGLJHVWLYHV\VWHPDQGZHUHOHVVSURQH
WRGLDUUKHDWKDQRWKHUFKLOGUHQ
0RNXDNQHZWKDWDPDVDLKDGKLJKOHYHOV
RI ODFWLF DFLG DQG SURELRWLFV DQG KH EHOLHYHG
WKHVH QXWULHQWV ZHUH SURWHFWLQJ WKH FKLOGUHQ
DJDLQVW EDG EDFWHULD +H WKHQ FRPSDUHG WKH
EDGEDFWHULDILJKWLQJDELOLWLHVRIUDZPLON\RJXUW
DQG DPDVL +H XVHG D GDQJHURXV EDFWHULD (
&ROLDQGLQMHFWHGLWLQWRWKHUDZPLON\RJXUWDQG
DPDVLDOORIZKLFKFDPHIURPWKHVDPHVRXUFHLQ
Richard Mokua
:LVFRQVRQ
:KHQEX\LQJDPDVDLRUNHILUWKHUHDUHVRPHWKLQJV\RXZDQWWRWDNHQRWH
RI 7KH KLJKHVW TXDOLW\ RI FXOWXUHG GDLU\ LV RUJDQLF IURP JUHHQIHG FRZV ORZ
WHPSHUDWXUHSURFHVVHGRUUDZDQGIUHHRIDKDUPIXOSURWHLQFDOOHGEHWDFDVHLQ$
WDONHG DERXW , EHOLHYH WKLV RQHnV WKH PRVW SRZHUIXO &XOWXUHG GDLU\ OLNH DPDVDL
DQGNHILUDUHWKH6XSHUPDQRIVXSHUIRRGV7KHVHIRRGVSURYLGHDKRVWRIHVVHQWLDO
QXWULHQWVWKDWDLGGLJHVWLRQDQGGHWR[WKHERG\RIWR[LQVDQGoEDGEDFWHULDp
:KHQ(&ROLZDVLQMHFWHGLQWRUDZPLONWKHUDZPLONGLGQnWNLOOLWDQGLQ
IDFWEDGEDFWHULDIORXULVKHG<RJXUWKDGDGHFHQWUHVSRQVHDQGNLOOHGRIIWKHEDG
EDFWHULDLQGD\V$PDVDLKDGDQLQFUHGLEOHUHVSRQVHNLOOLQJRIIWKH(&ROLLQMXVW
GD\V
the majority of Americans today are
probiotic deficient
7KHPDMRUGLIIHUHQFHEHWZHHQ\RJXUWDQGDPDVDLZDVWKHDPRXQWRIODFWLF
DFLGEDFWHULD7KLVW\SHRIJRRGEDFWHULDDOVRNQRZQDVSURELRWLFVDQGODFWREDFLOOXV
KDYHDPD]LQJHIIHFWVRQGLJHVWLYHKHDOWK
,I \RXnYH HYHU WDNHQ D SUHVFULSWLRQ DQWLELRWLF DQG KDYHQnW VSHQW WLPH
EXLOGLQJ EDFN XS WKH JRRG EDFWHULD LQ \RXU ERG\ WKHUHnV D JRRG FKDQFH \RXnUH
GHILFLHQW$OVRIOXRULGHDQGFKORULQHFDQNLOORIISURELRWLFVVRLI\RXGULQNWDSZDWHU
&XOWXUHGGDLU\LVUHDOO\DQDPD]LQJVXSHUIRRGWKDWKDVEHHQDURXQGVLQFH
ELEOLFDO WLPHV ,Q *HQHVLV $EUDKDP VHUYHG FXOWXUHG GDLU\ DQG SDVWXUHIHG
EHHIWRWZRDQJHOV,I\RXZDQWWRKDYHDORQJDQGEOHVVHGOLIH\RXPD\ZDQWWR
IROORZWKHOHDGRIIDWKHU$EUDKDPDQGVHUYHVRPHFXOWXUHGGDLU\DW\RXUQH[WGLQQHU
SDUW\
The probiotics found in cultured dairy don’t just detox.
Cultured dairy can also help:
Improve digestion
5HGXFHLQÁDPPDWLRQ
Promote weight loss
Boost immunity
(British Medical Journal 2001)
Super Detox
CHIA AND FLAXSEEDS0RVWKHDOWKIRRGGRFWRUVDJUHHWKDW&KLDLVRQHRI
QDWXUHnVWUXHVXSHUIRRGV,WGHOLYHUVPD[LPXPQXWULHQWVZLWKPLQLPXPFDORULHVDQG
SURPRWHVGLJHVWLRQDQGGHWR[RIWKHERG\2ULJLQDOO\JURZQLQ0H[LFRWKHVHHGV
ZHUHKLJKO\YDOXHGIRUWKHLUPHGLFLQDOSURSHUWLHVDQGQXWULWLRQDOYDOXH,QIDFWWKH\
ZHUHHYHQXVHGDVFXUUHQF\$]WHFZDUULRUVDWHFKLDVHHGVWRJLYHWKHPKLJKHQHUJ\
DQGHQGXUDQFH
&KLD LV VXSHU KLJK LQ ILEHU SURYLGLQJ QHDUO\ JUDPV SHU RXQFH 2QH
VHUYLQJFDQSURYLGHWKHUHFRPPHQGHGILEHULQWDNHIRUWKHGD\DFFRUGLQJWRWKH
$PHULFDQ'LHWHWLF$VVRFLDWLRQ)LEHULVHVVHQWLDOIRU\RXUERG\nVDELOLW\WRGHWR[LI\
$FFRUGLQJWRWKH1DWLRQDO,QVWLWXWHRI+HDOWKVHHGVOLNH)OD[DQG&KLDFDQEHD
QDWXUDOOD[DWLYHGXHWRLWnVKLJKILEHUFRQWHQWDQGKHDOWK\IDWV
&KLD VHHGV DUH KLJK LQ OLQROHLF DFLG D IDWW\ DFLG ZKLFK KHOSV WKH ERG\
DEVRUEIDWVROXEOHYLWDPLQV$'(DQG.,WFRQWDLQVFDOFLXPDQGERURQZKLFK
HQDEOHVWKHERG\WRDEVRUELWDQGKDVPRUH2PHJDIDWW\DFLGVWKDQVDOPRQ,W
FDQDEVRUEXSWRWZHOYHWLPHVLWVRZQZHLJKWLQZDWHU
)OD[VHHGLVDVLPLODUVXSHUIRRGULFKLQRPHJDDQGDQWLR[LGDQWV
$VWXG\GRQHDW'XNH8QLYHUVLW\VXJJHVWVWKDWIOD[VHHGVPD\VWXQWWXPRUJURZWK
DQGVXSSRUWWKHERG\LQGHWR[LILFDWLRQ,WnVKLJKLQILEHUDQGORZLQFDUEVPDNLQJ
LWJUHDWIRUGLHWHUVZKRZDQWWRIHHOIXOOIRUORQJHU+LJKLQ%YLWDPLQVPDJQHVLXP
DQGPDQJDQHVHWKHVHWLQ\VHHGVFRXQWHULQIODPPDWLRQDNH\FRQWULEXWRUWRDUWKULWLV
DQGRWKHUGHELOLWDWLQJGLVHDVHV6SULQNOHLWRQFXOWXUHGGDLU\ZLWKEHUULHVDQGHQMR\
»
»
»
High in fiber
Natural laxative
Vitamins A, D, K
»
»
»
Calcium and Boron
Omega-3’s
Antioxidants
ALGAE:KHUHGLG$TXDPDQJHWDOOKLVVXSHUVZLPPLQJSRZHUV",WnVWKHVDPH
SODFHVDOPRQGRHVDQGWKDWnV$OJDH$OJDHFRPHVLQWKHIRUPRIJUHHQEOXHJUHHQ
RUEURZQVHDZHHGDQGLVDFRPSOH[VXSHUIRRG
&OLQLFDO VWXGLHV SXEOLVKHG LQ Chemosphere Journal VXJJHVWV EOXHJUHHQ
DOJDH OLNH &KORUHOOD DLGV LQ GHWR[LIFDWLRQ RI SRO\FKORULQDWHG GLEHQ]RGLR[LQV LQ
KXPDQVDQGPD\KHOSKHDOUDGLDWLRQH[SRVXUH
$OJDHRIDOOW\SHVVWLPXODWHVWKHLPPXQHV\VWHPLQFUHDVHVZKLWHEORRGFHOOV
DQGSURPRWHVKHDOWK\IORUDLQWKHFRORQ,WLVDEHQHILFLDOWUHDWPHQWIRULQIHFWLRQ
DQHPLDREHVLW\LQIODPPDWLRQDQGWR[LFLW\DQGVKRXOGEHLQFOXGHGLQDQ\KHDOWK\
GLHWLQRQHRILWVIRUPV
$OJDH LV H[FHOOHQW IRU VXSSRUWLQJ D KHDOWK\ GLJHVWLYH V\VWHP DQG LWV KLJK
ILEHUFRQWHQWPDNHVLWDQHIIHFWLYHGHWR[*UHHQDOJDHUHGXFHVFKROHVWHUROSUHYHQWV
DOOHUJLFUHDFWLRQVDQGLVWKRXJKWWRFRXQWHUWKHGHYHORSPHQWRIDEQRUPDOJURZWKV
,WLVDOVRKLJKLQEHWDFDURWHQHYLWDPLQ'DQGJDPPDOLQROHLFDFLG*/$DVZHOODV
SURYLGLQJQLQHHVVHQWLDODPLQRDFLGV
Blue-green algaeLVDVRXUFHRIYLWDPLQ%DORQJZLWKDPLQRDFLGVPDNLQJ
LWH[FHOOHQWIRUDLGLQJGLJHVWLRQ6SLUXOLQDLVDQRWKHUW\SHRIEOXHJUHHQDOJDHWKDWLV
SURWHLQ1LFNQDPHGWKHoIRRGRIWKHIXWXUHpLWKDVHVVHQWLDODPLQRDFLGV
DQGLVDJRRGVRXUFHRIRPHJDIDWV
5HVHDUFK 3XEOLVKHG LQ 3XE0HG DOVR IRXQG EOXHJUHHQ DOJDH KDV DQWLWXPRU
SURSHUWLHVDQGHQKDQFHVYDVFXODUIXQFWLRQZRXQGKHDOLQJDQGLPPXQHIXQFWLRQ
Brown algaeLVNQRZQIRULWnVZHLJKWORVVEHQHILWVKDYLQJDVXSHUQXWULHQWFDOOHG
)XFR[DQWKLQ6WXGLHVGRQHDW+RNNDLGR8QLYHUVLW\LQGLFDWHIXFR[DQWKLQSURPRWHV
IDWEXUQLQJE\LQFUHDVLQJH[SUHVVLRQRIWKHUPRJHQLQ,QWKHVWXG\SDUWLFLSDQWVWRRN
DFRPELQDWLRQRIIXFR[DQWKLQZLWKSRPHJUDQDWHVHHGRLODQGORVWSRXQGVRYHU
ZHHNV$VZHOODVSXULI\LQJWKHEORRGEURZQDOJDHDFWVDVDQDWXUDOGHWR[LILHU
,JHWP\DOJDHLQSRZGHUIRUP,WDNHVFRRSGDLO\LQZDWHUDQGDOWHUQDWH
WDNLQJLWZLWKMXLFLQJYHJHWDEOHV/RRNIRUEUDQGVWKDWDUH5$:RUSURFHVVHGDWORZ
WHPSHUDWXUHVIRUPD[LPXPEHQHILWV
Meal Plan Super Detox
SUPER DETOX MEAL PLAN
CULTURED WHEY +RZGLGWKHIDPRXV*UHHN$FKLOOHVJHWDOOKLVVWDPLQDDQG
VWUHQJWK"/HJHQGVVD\KHZDVGLSSHGLQWKHULYHU6W\[EXW,WKLQNSDUWRIKLVVXSHU
SRZHUVFDPHIURPFXOWXUHGZKH\&XOWXUHGZKH\ZDVNQRZQE\WKH*UHHNVORQJ
DJRDVoKHDOLQJZDWHUp,WnVDE\SURGXFWDIWHUPLONKDVEHHQFRDJXODWHGZLWKUHQQHW
WR IRUP FKHHVH FXUGV ,WnV EHHQ QRWHG WKDW +LSSRFUDWHV WKH IDWKHU RI PHGLFLQH
UHFRPPHQGHG ZKH\ DV D WUHDWPHQW RYHU \HDUV DJR 6R \RX FRXOG VD\ LWV
EHHQZHOOWULHGDQGWHVWHG:KDWnVLQWHUHVWLQJLVWKDWDOOWKHKLVWRULFKHDOLQJXVHVDUH
EHLQJFRQILUPHGE\PRGHUQPHGLFDOUHVHDUFKPDNLQJLWDVXSHUIRRGORQJEHIRUH
WKHWHUPZDVHYHQLQYHQWHG
,QDSDWLHQWJLYHQOLWWOHWLPHWROLYHWUDYHOHGWRWKH6ZLVVPRXQWDLQ
YLOODJHRI*DLV+HEHJDQWRGULQNZKH\RQDGDLO\EDVLVDQGZDVKHDOHGRIKLV
GLVHDVH :RUG VSUHDG RI WKH oPLUDFXORXVp KHDOLQJ SURSHUWLHV RI FXOWXUHG ZKH\
DQGKHDOWKVSDVSRSSHGXSDOORYHUWKHUHJLRQDWWUDFWLQJHPSHURUVUR\DOW\DQG
DULVWRFUDWVWREHKHDOHG)RUWXQDWHO\FXOWXUHGZKH\LVQRZUHDGLO\DYDLODEOHDFURVV
WKHZRUOGDQGLVDFFHVVLEOHWRDQ\RQHORRNLQJIRUDQDOOURXQGVXSHUIRRG
Cultured whey has four main healing properties:
6WLPXODWHVLQWHVWLQDOSHULVWDOVLVDJHQWOHUHPHG\IRUFRQVWLSDWLRQ
*HQHUDWHVLQWHVWLQDOIORUDLPSURYLQJGLJHVWLRQ
(OLPLQDWHVH[FHVVZDWHUUHWHQWLRQ5HGXFLQJEORRGSUHVVXUHDQGVZHOOLQJ
6WLPXODWHVWR[LQHOLPLQDWLRQE\WKHNLGQH\V
,nYHKHDUGKXQGUHGVRIVXFFHVVVWRULHVIURPSHRSOHDOORYHUWKHFRXQWU\
ZKR VWDUWHG FRQVXPLQJ FXOWXUHG ZKH\ 7KH\nYH QRWLFHG LPSURYHPHQWV ZLWK WKHVH
KHDOWKFRQGLWLRQV
*RXW
&RQVWLSDWLRQ
.LGQH\6WRQHV )DWLJXH
$FLG5HIOX[
(F]HPD
0XVFOH&UDPSV
+LJK%ORRG3UHVVXUH
:HLJKW/RVV
&XOWXUHG ZKH\ FDQ DOVR ZRUN DV D QDWXUDO VSRUWV GULQN ,W FRQWDLQV KLJK
OHYHOVRIHOHFWURO\WHVOLNHSRWDVVLXPSURELRWLFVFDOFLXP%YLWDPLQVZKH\SURWHLQ
DQGQDWXUDOO\RFFXUULQJFDUERK\GUDWHVIRUHQHUJ\DQGUHFRYHU\7KHUHDUHPDQ\
SURIHVVLRQDODQGRO\PSLFOHYHODWKOHWHVZKRDUHEULQJLQJWKHLUK\GUDWLRQHQGXUDQFH
DQGSHUIRUPDQFHWRWKHQH[WOHYHOE\FRQVXPLQJFXOWXUHGZKH\
,SHUVRQDOO\WU\WRGULQNR]RIFXOWXUHGZKH\GDLO\
Morning
&KLD6KDNHR]SODLQ$PDVDL.HILUZ7EVSRI&KLD6HHGV
Mid-Morning&+226(
R]&XOWXUHG:KH\
R]6SULQJ:DWHUZLWK7EVS&RFRQXW9LQHJDURU$SSOH&LGHU9LQHJDU
Lunch&+226(
9HJHWDEOH-XLFHR]
6XSHUIRRG6DODG
Afternoon
&KLD6KDNHR]SODLQ$PDVDL.HILUZ7EVSRI&KLD6HHGV
Pre-Dinner&+226(
R]&XOWXUHG:KH\
R]6SULQJ:DWHUZLWK7EVS&RFRQXW9LQHJDURU$SSOH&LGHU9LQHJDU
Dinner&+226(
9HJHWDEOH-XLFHR]
6XSHUIRRG6DODG
*Drink 2/3 your body weight
in ounces of water daily.
9HJHWDEOH-XLFHDQG)HUPHQWHG:KH\FRQVXPSWLRQFRXQWWRZDUGV\RXUWRWDOLQWDNH
)RUH[DPSOHLIVRPHRQHZHLJKVSRXQGVWKH\ZLOODLPWRFRQVXPHRXQFHV
RIZDWHUDGD\VRVHYHQR]GULQNV
Spread the health!
6KDUHWKLVHERRNRQIDFHERRN
Anti-Aging
Berries
Avacado
Garlic
Wild Salmon
Cocoa
+DYH\RXHYHUORRNHGDWVRPHRQHDQGWKRXJKWWKH\ZHUH\HDUVROG
RQO\WRILQGRXWWKH\ZHUHRUWKRXJKWVRPHRQHZDVDQGIRXQGRXWWKH\ZHUH
"7KLVUHPLQGVPHRIRQHRIP\KHDOWKVXSHUKHURHV-DFN/D/DQQH
-DFNZDVDFKLURSUDFWRUQXWULWLRQH[SHUWDQGILWQHVVWUDLQHU$WDJHKH
WLHGERDWVDURXQGKLVZDLVWFDUU\LQJSHRSOHDQGVZDPWKHERDWPLOHLQOHVV
WKDQKRXUDQGSHUIRUPHGDVLPLODUIHDWDWDJH+RZnG-DFNGRLW"
,WKLQNKLVQXPEHURQHUXOHIRUQXWULWLRQVXPVLWXS
“If man made it, don’t eat it”
:KDWGRHVPRYLHVWDU+DOOH%HUU\HDWWRKDYHVXFKDPD]LQJVNLQLQDOO
KHUVXSHUKHURPRYLHV":HOO,WKLQNKHUQDPHVD\VLWDOO%HUU\%HUULHVFRQWDLQ
SRZHUIXOFRPSRXQGVFDOOHGDQWLR[LGDQWV$QWLR[LGDQWVSURWHFW\RXUFHOOVDJDLQVWIUHH
UDGLFDOGDPDJHFDXVHGE\R[LGDWLRQ
,I\RXELWHLQWRDQDSSOHDQGOHDYHLWRXWSUHWW\VRRQ\RXnOOQRWLFHWKHDSSOH
WXUQLQJEURZQWKDWnVR[LGDWLRQ7KHVDPHKDSSHQVZKHQDQDLOJHWVUXVW%\WKH
ZD\ZKLFKSDUWRIDQDSSOHKDVWKHPRVWDQWLR[LGDQWV"7KHVNLQ$QWLR[LGDQWVJLYH
WKHVNLQLWVEULJKWFRORUVDQGEHUULHVDUHWKHEULJKWHVWRIWKHPDOO
25*$1,&$//< *52:1 EOXHEHUULHV KDYH VLJQLILFDQWO\ KLJKHU FRQFHQWUDWLRQV RI
SKHQRODQWLR[LGDQWVDQGDQWKRF\DQLQDQWLR[LGDQWVWKDQFRPPHUFLDOO\JURZQIUXLWV
DQGDUHEHVWHDWHQUDZ
Blueberries FRQWDLQ SRZHUIXO DQWLR[LGDQWV DQWKRF\DQLQV IODYRQROV WDQQLQV
DQGUHVYHUDWUROWKHVDPHSRWHQWDQWLR[LGDQWIRXQGLQUHGZLQH
)LJKWFDQFHUFHOOJURZWK-RXUQDORI0ROHFXODU1XWULWLRQ)RRG5HVHDUFK
5HGXFHLQIODPPDWLRQ
,PSURYHPHPRU\
3DFNHGZLWKYLWDPLQ&DQG&ROODJHQ
6XSSRUWVKHDOWK\VNLQDQGJXPV
)LJKWVULVNRI$O]KHLPHUV
-DFN DJHG LQFUHGLEO\ VORZHU WKDQ PRVW
SHRSOH EHFDXVH KH DWH KHDOWK\ DQG H[HUFLVHG
GDLO\
7KHUHnVDZKROHUHJLRQRISHRSOHWR
PRGHORXUKHDOWKDIWHUDQGLWnV
2NLQDZD-DSDQ
$FFRUGLQJWR
WKHPittsburgh
Tribune-DSDQ
KDGDUHFRUG
EUHDNLQJ
FHQWXULRQVLQ
ZKHUH
$PHULFDKDGRQO\
2QHUHDVRQ
SHRSOHLQ2NLQRZD
PD\OLYHVRORQJLVWKH
IDFWWKDWWKH\FRQVXPH[
WKHOHYHOVRI$QWLR[LGDQWV
IODYRQRLGVFRPSDUHG1RUWK
$PHULFDQV
BERRIES
Raspberries DUH VLPLODUO\ KLJK LQ DQWLR[LGDQWV 7KH XQLTXH DFLG LQ UDVSEHUULHV
SURWHFWVKXPDQFHOOVZKLFKOHDGVWRDPD]LQJORRNLQJVNLQ+LJKLQYLWDPLQ&ULFK
LQ%YLWDPLQDQGKHOSPHWDEROL]HFDUEVSURWHLQDQGIDW
Indian gooseberries, DOVR FDOOHG DPOD DUH DQRWKHU JRRG VRXUFH RI GLHWDU\
ILEHU YLWDPLQ & DQG PLQHUDOV ZLWK JUHDW DQWLR[LGDQW SURSHUWLHV ZKLFK KHOS VORZ
WKHDJLQJSURFHVV7KH\nUHSDUWLFXODUO\JRRGIRUWKHVNLQKDLUDQGH\HVDQGKHOS
EDODQFHVWRPDFKDFLGV
7KH DPOD EHUULHV LQFUHDVH UHG EORRG FHOO SURGXFWLRQ IOXVK RXW WR[LQV VWUHQJWKHQ
KHDUWPXVFOHVDQGDUHEHQHILFLDOWRGLDEHWLFVDVWKH\UHGXFHEORRGVXJDU,QGLDQ
JRRVHEHUULHVDOVRFRQWDLQDQH[WUDRUGLQDU\HQ]\PHWKDWUHGXFHVLQIODPPDWLRQDQG
SURWHFWVDJDLQVWR[LGDWLYHVWUHVV(Journal of Leukocyte Biology 2004).
Jack LaLanne
(DWFXSWRFXSRIEHUULHVRQHRUWZRWLPHVGDLO\ZLWKDEUHDNIDVWVPRRWKLHDQG
IRUDQDIWHUQRRQVQDFNZLWKFXOWXUHGGDLU\
Anti-Aging
AVOCADO
GARLIC
&DUGLRYDVFXODU GLVHDVH LV WKH FDXVH RI GHDWK LQ $PHULFD WRGD\ \HW
HDWLQJVXSHUIRRGVVXFKDVDYRFDGRVLVDSDLQOHVVZD\WRUHGXFHWKHULVNRIKHDUW
GLVHDVH DQG VORZ DJLQJ GUDPDWLFDOO\ 1RW RQO\ GR DYRFDGRV KDYH HVVHQWLDO
QXWULHQWVEXWWKH\nUHNQRZQDVoQXWULHQWERRVWHUVpDVWKH\KHOSWKHERG\DEVRUE
RWKHUIDWVROXEOHQXWULHQWVDVZHOO%\DGGLQJDVOLFHRIDYRFDGRWRDPHDO\RXU
ERG\LVDEOHWRGLJHVWPRUHQXWULHQWVIURPRWKHUIRRGV
)RUPHQJDUOLFKDVEHHQVKRZQWRKHOSSUHYHQWDQHQODUJHGSURVWDWHDQG
IRUERWKPHQDQGZRPHQLWnVJUHDWIRUNLOOLQJRII\HDVWLQIHFWLRQVVXFKDVFDQGLGD
*DUOLFLVDQWLEDFWHULDODQWLPLFURELDODQWLLQIODPPDWRU\DQWLFRDJXODQWDQWLVHSWLF
DQGDQWLIXQJDODQGWKRVHDUHDOOJRRGWKLQJVWREH
,UHFHQWO\VWDUWHGDFOXEFDOOHGWKH$7HDP7RMRLQDOO\RXKDYHWR
GRLVHDWDQ$YRFDGRDGD\7KH$YRFDGR7HDPLVVWULFWO\IRUWKRVHZKRZDQWWR
DVSLUHWRHDUQWKHWLWOHRI&HQWXULRQ
.H\QXWULHQWVLQ$YRFDGRVKHOSK\GUDWH\RXUFHOOVNHHSLQJ\RXUVNLQVRIW
DQG\RXQJ$YRFDGRVDUHULFKLQ%YLWDPLQVYLWDPLQ.YLWDPLQ(ZKLFKJLYHV\RXU
VNLQPRLVWXUHDQGKDVPRUHSRWDVVLXPWKDQDEDQDQDZKLFKKHOSVK\GUDWH
\RXU VNLQ $OVR ZLWK KLJK OHYHOV RI RPHJD IDWV $YRFDGRV FDQ KHOS QDWXUDOO\
EDODQFHKRUPRQHV
Eating healthy fat can actually help
you burn fat and lose weight.
0DQ\SHRSOHDYRLGDYRFDGRVVHHLQJWKHPDVDKLJKFDORULHKLJKIDWIRRG7KDWnV
D ELJ PLVWDNH EHFDXVH KHDOWK\ IDW LV HVVHQWLDO IRU DQWLDJLQJ $FFRUGLQJ WR WKH
Archives of Medical ResearchWKHIDWW\DFLGVIURPDYRFDGR
DFWXDOO\ LQFUHDVH JRRG +'/ FKROHVWHURO OHYHOV DQG KHOS
SURWHFWFHOOVIURPGDPDJLQJIUHHUDGLFDOV
$YRFDGRVDOVRFRQWDLQFDURWHQRLGVZKLFKSURYLGH
YLWDPLQ$IRUH\HKHDOWKERRVWWKH
LPPXQH V\VWHP DQG VXSSRUW
D KHDOWK\ UHSURGXFWLYH
V\VWHP 7KH XQLTXH PDNH
XS RI WKHVH VXSHUIRRGV
KHOSV WKH ERG\ ILJKW
LQIODPPDWLRQ DQG UHGXFHV
WKH ULVN RI DUWKULWLV WKHUHnV
QREHWWHUZD\WRVORZWKHDJLQJ
SURFHVV $V ZH RQ WKH $7HDP
VD\DQ$YRFDGRDGD\ZLOONHHS
DJHDZD\
*DUOLF IRU FHQWXULHV KDV EHHQ XVHG WR ILJKW RII WKH WRS WZR NLOOHUV LQ
$PHULFDWRGD\FDQFHUDQGKHDUWGLVHDVH/LNHDFDSWDLQRIDQDUP\JDUOLFKDVWKH
SRZHUWRNLOOGDQJHURXVYLUXVHVEDFWHULDSDUDVLWHVDQGFDQFHUFHOOVDFFRUGLQJWR
WKH8QLYHUVLW\RI0DU\ODQG0HGLFDO&HQWHU
8VHWKUHHFORYHVRIJDUOLFZKHQSUHSDULQJDIDPLO\VL]HGGLVKZKLFKLVD
VQHDN\ZD\WRJHWHYHU\RQHWKHLUYLWDPLQ&%DQGPDQJDQHVH,I\RXGRQnWZDQW
WRPHVVDERXWSHHOLQJDQGFUXVKLQJWKHVHSXQJHQWFORYHVDGGLWWR\RXUFRRNLQJ
DVDUXESRZGHURUH[WUDFW5DZJDUOLFLVHYHQPRUHEHQHILFLDOVREHDGYHQWXURXV
$GGJDUOLFWRKXPPXVVDOVDJXDFDPROHRU\RJXUWWREULQJRQDGGLWLRQDOKHDOWK
EHQHILWV
*DUOLFDFWVDVDIXHOIRUSURELRWLFVDVZHOODVVXSSRUWLQJDVWURQJLPPXQH
V\VWHPWRZDUGRIIFROGVIOXDQGRWKHUPRUHVHULRXVLQIHFWLRQV7RNLOORIIDFROGIDVW
,UHFRPPHQGGRLQJFORYHVRIUDZJDUOLF[DGD\ELWWHQRQFHDQGVZDOORZHGZKROH
RUPL[HGLQIRRG,I\RXGRQnWZDQWWRVKDUHJDUOLFN\EUHDWK
FKHZSDUVOH\FKHZLQJJXP
SHSSHUPLQWRUDSLHFHRI
GDUN FKRFRODWH WR QHJDWH
WKHSRZHUIXOVFHQW
*DUOLFLVDYDOXDEOHVRXUFH
RI DQWLR[LGDQWV ZKLFK
SURWHFW FHOOV SDUWLFXODUO\
VNLQ FHOOV IURP IUHH
UDGLFDO
GDPDJH
PDNLQJ LW LPSRUWDQW LQ
VORZLQJGRZQWKHDJLQJ
SURFHVV
$QWLR[LGDQWV
SURWHFWDJDLQVWSROOXWDQWV
DQG ILJKW RII WR[LQV WKDW
FDQ KDUP RXU LPPXQH
V\VWHP
Anti-Aging
WILD SALMON )ROORZHUVRI'U3HUULFRQH0'ZLOODSSUHFLDWHKLVKLJKUHJDUG
IRU ILVK SDUWLFXODUO\ RLO\ ILVK DV D VXSHUIRRG +H VD\V o2QO\ RQH IRRG KDV WKH
UHSXWDWLRQRIEHLQJDoEUDLQIRRGp7KDWIRRGLVILVKe\RXVKRXOGSODQWRHDWD
VHDIRRGPHDOIRXUGD\VDZHHNsDQGVDOPRQDWOHDVWWZRWLPHVDZHHNp6DOPRQ
LV DQ H[FHOOHQW VRXUFH RI DVWD[DQWKLQ DQG RPHJD HVVHQWLDO RLOV ZKLFK VORZ WKH
HIIHFWVRIDJLQJERWKLQVLGHDQGRXWVLGHWKHVNLQ
:KHQ EX\LQJ VDOPRQ VWLFN ZLWK ZLOG VDOPRQ DQG VWHHU FOHDU IURP IDUP
UDLVHGVDOPRQ)DUPUDLVHGVDOPRQLVWR[LFIURPFKHPLFDOVDQGSHVWLFLGHVDQGLV
YRLGRIPRVWRIWKHQXWULHQWVWKDWZLOGFDXJKWVDOPRQKDV)DUPUDLVHGVDOPRQLV
DFWXDOO\JUD\LQFRORUZKLFKLVLQMHFWHGZLWKUHGIRRGG\H:LOGVDOPRQLVIDUDQG
DZD\DEHWWHUVRXUFH
:LOG6DOPRQSURYLGHV(3$DQG'+$IDWW\DFLGVWKDWDUHYLWDOIRUJURZWK
DQGIRUPDLQWDLQLQJDKHDOWK\KHDUWDQGEUDLQ:KDWRWKHUVXSHUIRRGLVSDFNHG
ZLWKKLJKTXDOLW\SURWHLQHVVHQWLDODPLQRDFLGVRPHJDYLWDPLQV$'%DQG
(FDOFLXPLURQDQGRWKHUHVVHQWLDOPLQHUDOV"7KHKLJKHVWTXDOLW\VDOPRQ\RXFDQ
EX\LVZLOGVRFNH\HVDOPRQDQGRQHR]VHUYLQJRIVDOPRQFRQWDLQVPJRI
2PHJDIDWW\DFLGV
:LOGVDOPRQJHWVLWnVUHGRUDQJHFRORUIURPDVWD[DQWKLQDSRZHUIXOIDW
VROXEOHDQWLR[LGDQWLQWKHFDURWHQRLGIDPLO\5HVHDUFKSXEOLVKHGLQ7KH-RXUQDO
RI 1XWULWLRQ DQG 0HWDEROLVP VXJJHVWV DVWD[DQWKLQ FDQ UHGXFH R[LGDWLYH VWUHVV
LQIODPPDWLRQDQGHQKDQFHWKHLPPXQHV\VWHP
,Q UHWXUQ IRU HQMR\LQJ WKLV WDVW\ VXSHUIRRG ZLOG
VDOPRQFDQUHOLHYHDUWKULWLVSURWHFW\RXUKHDUWIURP
GLVHDVHUHGXFHWKHULVNRIDGHELOLWDWLQJVWURNH
LPSURYH EORRG OLSLGV SURPRWH KHDOWK\
EORRG YHVVHOV DQG UHGXFH PHQWDO
GLVRUGHUV LQFOXGLQJ $O]KHLPHUnV
7KH $PHULFDQ -RXUQDO RI
&DUGLRORJ\ 6DOPRQ LV DOVR
JUHDW IRU WKH VNLQ QDWXUDOO\
OXEULFDWLQJLWIURPZLWKLQ&RXSOHG
ZLWKDKHDOWK\KHDUWZLOGVDOPRQ
LVWKHSHUIHFWDQWLGRWHWRDJLQJ
COCOA 0RVWSHRSOHDUHDPD]HGDQGGHOLJKWHGWRILQGWKDWFRFRDWKHPDLQ
LQJUHGLHQWRIGDUNFKRFRODWHLVDVXSHUIRRG+LJKLQDQWLR[LGDQWVWKRVHWKLQJVWKDW
FRXQWHU KDUPIXO IUHH UDGLFDOV LQ WKH ERG\ FKRFRODWH ZLWK D KLJK FRFRD FRQWHQW
HQKDQFHVWKHPRRGSURWHFWVWKHVNLQIURP89VXQGDPDJHERRVWVFDUGLRYDVFXODU
KHDOWK DQG LV EHQHILFLDO IRU WKH QHUYRXV V\VWHP :KLOH LW LV LQFUHGLEO\ EHQHILFLDO
PRGHUDWLRQ LV WKH NH\ -XVW RXQFHV RI FRFRD SHU GD\ FDQ KHOS ORZHU EORRG
SUHVVXUHUHGXFHEORRGFORWVLPSURYHWKHVNLQVKDUSHQWKHPLQGDQGVORZGRZQ
WKHVLJQVRIDJLQJ
Choose a dark chocolate with
at least 60% cocoa content
0LONFKRFRODWHDQGZKLWHFKRFRODWHGRQRWKDYHWKHVDPHEHQHILWVDQG\RX
PXVWHDWQRQDONDOL]HGSURGXFWVDVWKHDONDOL]DWLRQSURFHVVGHVWUR\VWKHSRO\SKHQROLF
FRPSRXQGV&KRRVHGDUNFKRFRODWHZLWKDFRFRDFRQWHQWRIDWOHDVWZKLFKZLOO
KDYHDPD[LPXPDPRXQWRIIODYRQRLGVOHVVVXJDUDQGDQDFFHSWDEOHDPRXQWRI
FDORULHVDQGIDW
5HVHDUFKHUVIRXQGWKDWGDUNFKRFRODWHKDGPRUH
DQWLR[LGDQWDFWLYLW\WKDQRWKHUKLJKO\UHJDUGHG
KHDOWKMXLFHVVXFKDVDFDLEOXHEHUU\DQG
FUDQEHUU\MXLFHDFFRUGLQJWRVWXG\
SXEOLVKHGLQWKH&KHPLVWU\&HQWUDO
-RXUQDO&RFRDVKRZHGKLJKHU
DQWLR[LGDQWDFWLYLW\DQGKLJKHUIODYRQRLG
FRQWHQWWKDQWKHVRFDOOHGVXSHUIUXLWV
ZLWKRYHUPJSHUVHUYLQJFRPSDUHG
WRPJ
1HZ <RUN &DUGLRORJLVW 6X]DQQH 6WHLQEDXP
0'UHFRPPHQGVo:KHQORRNLQJIRUDVZHHW
VQDFN D VTXDUH RI GDUN FKRFRODWH PLJKW
LQ IDFW EH \RXU KHDOWKLHVW FKRLFHp $V ZHOO
DV GHOLYHULQJ D GRVH RI DQWLR[LGDQWV FRFRD
KHOSVNHHSDUWHULHVKHDOWK\DQGSURWHFWVIURP
FDUGLRYDVFXODUGLVHDVH
Meal Plan
Spread the health!
6KDUHWKLVHERRNRQIDFHERRN
MORNING
$PDVDL%HUU\6PRRWKLH
2PHOHWZLWK$YRFDGRDQG6SLQDFK
.DOH6KDNH
*):UDSZLWK(JJVRQLRQVDQGUDZFKHHVH
*UDLQOHVV*UDQRODWRSSHGZLWKR]$PDVDL
MID-MORNING
FXSRI*UHHQ7HDRU:KLWH7HDRU$POD%HUU\
LUNCH
6DODGZLWK6DOPRQRU&KLFNHQDQG$YRFDGR
6XSHUIRRG6DODG
6DOPRQRU*UHHQIHG%HHI6WLU)U\
*):UDSZLWK7XUNH\*UHHQVDQG*RDW&KHHVH
9HJHWDEOH6RXS
AFTERNOON
*UDLQOHVV*UDQROD
FXS+XPPXVRU*XDFDPROHZLWK9HJHWDEOHV
5DZ&KHHVHRQ)OD[VHHGFUDFNHUV
$SSOHZLWK5DZ$OPRQG%XWWHU
&RFRQXW%HUU\6PRRWKLH
DINNER
6DOPRQ3DWWLHVZLWK6DXWHHG*UHHQV
*UHHQIHG%XUJHUZLWK5DZ&KHGGDUDQGPDVKHGIDX[WDWRHV
&KLFNHQZLWK0L[HG9HJHWDEOHV
9HQLVRQZLWK%ODFNEHDQVDQG9HJHWDEOHV
*UHHQIHG&KLOL
DESSERT
R]RI'DUN&KRFRODWH
&RFRQXW0LONRU$PDVDL,FH&UHDP
5DVSEHUULHVDQG6WUDZEHUULHVFRYHUHGLQ0HOWHG'DUN&KRFRODWH
$SSOHZLWK5DZ+RQH\DQG$OPRQG%XWWHU
1RWH$OOPHDWDQGGDLU\SURGXFWVPXVWEHRUJDQLF$OVRWKLVLVDJXLGHQRWDQ
DEVROXWHOLVWVRKDYHVRPHIXQLQWKHNLWFKHQDQGPDNH\RXURZQFUHDWLRQV$OZD\V
PDNHVXUHHYHU\WKLQJ\RXnUHXVLQJLVUHDOIRRG
Build Muscle
,I\RXZDQWWREHFRPHDPDQRIVWHHORUEDEHRIEURQ]H\RXnYHJRWWRHDW
DORWRIVXSHUIRRGVDQGOLIWZHLJKWV6XUHVRPHSHRSOHPD\EHDEOHWRHDVLO\SXW
RQPXVFOHE\HDWLQJORWVRIXQKHDOWK\FDORULHVDQGGHQDWXUHGSURWHLQVEXWLI\RX
ZDQWWREHVWURQJDVVWHHOLQVLGHDQGRXW\RXnYHJRWWRHDWUHDOIRRG
GREEN-FED BEEF AND DAIRY ,WnVWLPHWRJRJUHHQDQG,nPQRWMXVWWDONLQJ
7KHVH IRRGV DUH ERWK JUHDW IRU PHQ ZKR ZDQW
WRSDFNRQPXVFOHDQGZRPHQZKRZDQWWRJHW
WRQHG6RZKHWKHU\RXnUHJRLQJIRUWKHSK\VLTXH
RIZRQGHUZRPDQRUWKHERG\RIVXSHUPDQWKHVH
IRRGVDUHIRU\RX
&DWWOHUDLVHGQDWXUDOO\RQJUHHQJUDVVUDWKHUWKDQJUDLQrIHGFDWWOHSURGXFH
EHHI ZLWKRXW WKH SUREOHPV DVVRFLDWHG ZLWK DQWLELRWLFV SHVWLFLGHV DQG KRUPRQH
UHVLGXHV&RZVDUHQDWXUDOKHUELYRUHVGHVLJQHGWROLYHRQJUDVVQRWWREHIRUFH
IHGJUDLQVDQGDQLPDOSURGXFWVDVHQFRXUDJHGE\WKH'HSDUWPHQWRI$JULFXOWXUH
$QRWHWRZRPHQ<RXPD\WKLQN\RX
GRQnWZDQWWRSXWRQPXVFOHEXW\RXGR
0XVFOHEXUQVIDWDQGERRVWV\RXU
PHWDEROLVP%HFDXVHZRPHQ
ODFNWKHVDPHWHVWRVWHURQH
DVPHQHDWLQJWKHVHIRRGV
ZLOORQO\FDXVH\RXWR
DGGPXVFOHGHILQLWLRQ
DQGORVHZHLJKW
\RXZRQnWJHW
EXON\,QIDFW
PRYLHVWDUV
OLNH+DOOH
%HUU\DQG
-HQQLIHU
*DUQHU
HDWWKHVH
IRRGV
DQGOLIW
ZHLJKWV
WRKHOS
VFXOSW
WKHLU
ERGLHV
DERXWHDWLQJPRUHJUHHQOHDYHV,nPWDONLQJDERXWJUHHQIHGEHHI,I\RXZDQWWR
EXLOGPXVFOHJUHHQIHGEHHIUDLVHGRQSDVWXUHVIUHHRISHVWLFLGHVDQGIHUWLOL]HUVDUH
DQHVVHQWLDOVXSHUIRRGIRUERG\EXLOGLQJQHHGV
$IRXURXQFHWHQGHUORLQRIEHHIIURPQDWXUDOO\UDLVHGJUHHQIHGFDWWOHZLOO
KDYHRIWKHGDLO\UHTXLUHPHQWVRIWU\SWRSKDQRI\RXUGDLO\SURWHLQQHHGV
DQGVKRXOGEHFRQVLGHUHGFDORULHVZHOOVSHQW*UHHQIHGEHHIKDVPRUH]LQF
DQG%WKDQJUDLQIHGFDWWOHKDVOHVVWRWDOIDWZKHUHWR[LQVDUHVWRUHGDQGPRUH
RPHJDIDWW\DFLGV,WDOVRKDVKLJKHUOHYHOVRIYLWDPLQV$DQG(PRUHDQWLR[LGDQWV
DQGKLJKHUOHYHOVRIFRQMXJDWHGOLQROHLFDFLG&/$ZKLFKVXSSRUWVKHDOWK\PXVFOH
WLVVXH
»
»
»
High in protein
Loaded with Vitamin B12
Zinc, selenium, iron and phosphorous
,DOVRKLJKO\VXJJHVW\RXGULQNJUHHQIHGGDLU\OLNHDPDVDLNHILURUUDZ
PLON*UHHQIHGGDLU\FRQWDLQVKLJKDPRXQWVRIZKH\ZKLFKLVDSURWHLQ\RXUERG\
FDQ TXLFNO\ XWLOL]H DQG WXUQ LQWR PXVFOH 5HVHDUFK SXEOLVKHG LQ WKH International
Journal of Sport Nutrition and Exercise Metabolism IRXQG WKDW PHQ ZKR
VXSSOHPHQWHGZLWKZKH\SURWHLQLQFUHDVHGOHDQPXVFOHPDVVDQGVWUHQJWKGXULQJ
UHVLVWDQFHWUDLQLQJ
, ZDUQ \RX KRZHYHU 127 WR FRQVXPH PRVW ZKH\ SURWHLQ SRZGHUV ,nG
JXHVVWKDWRISURWHLQSRZGHUVRQWKHPDUNHWFRPHIURPGHQDWXUHGSURWHLQV
FDOOHGK\GURO\]HGSURWHLQRQWKHODEHOZKLFKFDQGDPDJH\RXUGLJHVWLYHV\VWHP,
UHFRPPHQG\RXVWLFNZLWKZKH\LQLWVIRRGIRUP
:KHQ\RXnUHEX\LQJEHHIDQGGDLU\WKLQNJUHHQHYHU\WLPH/RRNIRUODEHOV
WKDWVD\JUDVVIHGRUHYHQEHWWHUJUHHQIHGWRJHWWKHPRVWPXVFOHEXLOGLQJ
DQGIDWEXUQLQJHIIHFWV
Build Muscle
ALMONDS$VZHOODVEHLQJWDVW\DQGQXWULWLRXVDKDQGIXORIDOPRQGVFDQJLYH
KXJHPXVFOHEXLOGLQJEHQHILWV7KH\DUHWKRXJKWWRGHFUHDVHWKHULVNRIGLDEHWHV
KHDUW GLVHDVH $O]KHLPHUnV DQG FDQFHU DQG ZKR GRHVQnW ZDQW WR UHGXFH WKRVH"
7KHVH OLWWOH QXWV FDQ ORZHU EDG /'/ FKROHVWHURO DQG UDLVH JRRG +'/ FKROHVWHURO
OHYHOV $OPRQGV DUH KLJK LQ ILEHU DQG PLQHUDOV DQG DUH D JUHDW VQDFN IRU WKRVH
ORRNLQJWRLQFUHDVHPXVFOHDQGEXUQIDW
$OPRQGVFRQWDLQDPLQRDFLGVWKDWDLGLQPXVFOHEXLOGLQJDQGFRQWDLQ
KLJKOHYHOVRIWKHDPLQRDFLG$UJLQLQH$UJLQLQHLVWKHLPPHGLDWHSUHFXUVRURI1LWULF
2[LGHDQGLVQHFHVVDU\IRU&UHDWLQHSURGXFWLRQ%RWK1LWULF2[LGHDQG&UHDWLQH
KDYHEHHQXVHGLQWKHERG\EXLOGLQJZRUOGIRU\HDUVWRJDLQVWUHQJWKDQGPXVFOH
$VDSUHFXUVRUWR1LWULF2[LGH$UJLQLQHPD\LQFUHDVHEORRGIORZWKDWFDQDLGLQ
HQGXUDQFHDQGPXVFOHEXLOGLQJ
5HVHDUFKSXEOLVKHGLQWKH-RXUQDORI&OLQLFDO(QGRFULQRORJ\DQG0HWDEROLVP
IRXQGWKDW$UJLQLQHVWLPXODWHVWKHVHFUHWLRQRIJURZWKKRUPRQH*URZWKKRUPRQHLV
NQRZQWREHDQDEROLFZKLFKPHDQVoWREXLOGXSp*URZWKKRUPRQHKHOSVPLQHUDOL]H
ERQH EXLOG PXVFOH VWLPXODWH LPPXQH V\VWHP DQG LQFUHDVH SURWHLQ V\QWKHVLV
*URZWKKRUPRQHLVQRWKHDOWK\ZKHQWDNHQDVDGUXJVKRWRULIUHFHLYHGLQQRQ
IRRGVRXUFHV+RZHYHUQDWXUDOIRRGVWKDWFDQLQFUHDVH*+FDQEHEHQHILFLDO
$OPRQGV DUH QXWULWLRQDOO\ GHQVH DQG DUH DQ DEXQGDQW VRXUFH RI
PRQRXQVDWXUDWHGIDWVWKDWWKHERG\QHHGV7KH\DUHKLJKLQFDORULHVDQGJRRGIRU
ERG\EXLOGLQJ3XUGXH8QLYHUVLW\UHVHDUFKHUVIRXQGWKDWFDORULHVIURPDOPRQGVGR
QRWDSSHDUWRFRQWULEXWHWRZHLJKWJDLQDVWKH\DUHQRWDEVRUEHG
OLNH RWKHU IDWW\ IRRGV 5HVHDUFK SXEOLVKHG E\ ([SHULPHQWDO
%LRORJ\ DOVR IRXQG WKDW HDWLQJ DOPRQGV
ZLWK D PHDO KLJK LQ FDUEV DFWXDOO\
EORFNHG WKH GLJHVWLRQ RI WKH FDUEV
DQG KHOSHG FRQWURO EORRG VXJDU
OHYHOV
,UHFRPPHQGFRQVXPLQJ
FXS RI DOPRQGV
GDLO\ RU 7EVS RI
DOPRQG EXWWHU GDLO\ IRU
PXVFOHEXLOGLQJEHQHILWV
PASTURED EGGS
,IEHHILVZKDWnVIRUGLQQHUWKHQHJJVDUHZKDWnVIRUEUHDNIDVW
,I\RXZDQWWREHFRPHDQo,URQ0DQpLQWKHZHLJKWURRPRUDVILWDV-HQQLIHU*DUQHU
LQWKHPRYLH(OHFWUDWKHUHLVQREHWWHUIRRGWKDQHJJV(JJVDUHRQHRIWKHWRSWZR
ELRDYDLODEOHVRXUFHVRISURWHLQZKLFKPHDQVWKH\FDQEHHDVLO\GLJHVWHGDQGWXUQHG
LQWRPXVFOH
3DVWXUHGRUIUHHUDQJHHJJVDUHSURGXFHGE\FKLFNHQVWKDWDUHJUDVVIHGRU
UDLVHGLQSDVWXUHVUDWKHUWKDQEHLQJFRQILQHGWRFDJHVDQGIHGRQJUDLQV:K\SD\
WKHH[WUDIRUSDVWXUHGHJJV"7KHUHDVRQLVWKDWHJJVIURPSDVWXUHGKHQVKDYHXSWR
WLPHVPRUHRPHJDIDWVWKDQHJJVIURPIDFWRU\KHQV7KDWPDNHVWKHPVXSHUE
YDOXH
(JJVDUHDJUHDWVRXUFHRISURWHLQDQGRPHJDIDWVDQGWKH\DUHHVVHQWLDO
IRU EXLOGLQJ DQG PDLQWDLQLQJ PXVFOH *UDVV IHG KHQV DUH UDLVHG LQ SDVWXUHV DQG
WKHLU GLHW LV FRPSOHPHQWHG E\ ZRUPV DQG VPDOO EXJV WKDW JLYH WKH HJJV H[WUD
QXWULWLRQDOYDOXHWKDQWKRVHIHGSULPDULO\RQJUDLQV$VZHOODVEHLQJUHVWULFWHGRQ
VSDFHIDFWRU\KHQVDUHIHGRQDQWLELRWLFVZKLFKLQWXUQSDVVWKURXJKWRWKHHJJV
WKH\SURGXFH
Eggs are one of the few food sources of vitamin D
7HVWV E\ 0RWKHU (DUWK 1HZV FRPSDULQJ SDVWXUHG HJJV ZLWK IDFWRU\
SURGXFHG HJJV VKRZHG WKDW SDVWXUHG HJJV KDG OHVV VDWXUDWHG IDW OHVV
FKROHVWHURODQGPRUHYLWDPLQ$7KH\DOVRFRQWDLQHGWKUHHWLPHVPRUHYLWDPLQ
(DQGDPDVVLYHWLPHVPRUHEHWDFDURWHQH2XUERGLHVSURGXFHLWQDWXUDOO\LQ
VXQOLJKWEXWRIFRXUVHIDFWRU\FKLFNHQVDUHXQGHUDUWLILFLDOOLJKWDQGKDYHWR
WLPHVOHVVYLWDPLQ'WKDQWKHLUIUHHUDQJHFRXVLQV(JJVFDQQRWUHDOO\EHFRQVLGHUHG
DVXSHUIRRGXQOHVVWKH\DUHIURPSDVWXUHUDLVHGKHQV
(JJV DUH JUHDW HDWHQ UDZ RU
FRRNHG ,nOO HDW WKHP UDZ LQ D
EUHDNIDVW VPRRWKLH RU FRRNHG
ZLWK VRPH FRFRQXW RLO , PL[
XS P\ VRXUFHV RI SURWHLQ VR ,
GRQnW HDW HJJV HYHU\GD\ EXW
, GR HDW WKHP RIWHQ <RX FDQ
HDWDQ\ZKHUHIURPRQHWRWZHOYH
HJJV GDLO\ IRU JUHDW ERG\ EXLOGLQJ
DQGIDWEXUQLQJEHQHILWV
Build Muscle
BROCCOLI
/LNH WKH ,QFUHGLEOH +XON %URFFROL FDQ KHOS \RX EHFRPH D OHDQ
JUHHQPXVFOHEXLOGLQJPDFKLQH
TURMERIC
0XVFOHEXLOGLQJLVQRWRQO\DERXWJHWWLQJHQRXJKSURWHLQDQGFDORULHVLQ
\RXUGLHWEXWLWnVDOVRLPSRUWDQWWRORDGXSRQYLWDPLQVDQGQXWULHQWV,I\RXZDQWWR
EXLOGPXVFOHDQGORZHU\RXUFKROHVWHURODWWKHVDPHWLPHEURFFROLLVWKHVXSHUIRRG
IRU\RX,WDOVRWDFNOHVWKHWKUHHSUREOHPVRIFKURQLFLQIODPPDWLRQR[LGDWLYHVWUHVV
DQGGHWR[LILFDWLRQZKLFKUHVHDUFKVKRZVDOOUDLVHWKHULVNRIFDQFHU
7KLVVXSHUKHUEWKRXJKXVHGLQVPDOODPRXQWVFDQSDFNDSXQFK
ZKHQ LW FRPHV WR PXVFOH UHFRYHU\ 7XUPHULF LV D WUXH VXSHUIRRG DV LW KDV EHHQ
VKRZQWRKDYHUHPDUNDEOHDQWLLQIODPPDWRU\DQGKHDOLQJSURSHUWLHV,QIODPPDWLRQ
VRXQGVWULYLDOEXWLWLVDFRPPRQFDXVH
RI DUWKULWLV DQG RWKHU GHJHQHUDWLYH Turmeric can help
GLVHDVHV7XUPHULFFRPHVRXWRQWRSIRU » Build muscle
UHGXFLQJ LQIODPPDWLRQ R[LGDWLYH VWUHVV » Accelerate healing
DQGDLGLQJLQPXVFOHDQGMRLQWUHFRYHU\
%URFFROLLVRQHPHPEHURIWKHFUXFLIHURXVJURXSRIYHJHWDEOHVWKDWLQFOXGHV
FDEEDJHERNFKR\NDOHFROODUGJUHHQV%UXVVHOVVSURXWVFDXOLIORZHUDQGRWKHU
JUHHQ OHDI\ YHJHWDEOHV 7KH\ DOO FRQWDLQ SK\WRFKHPLFDOV DQWLR[LGDQWV PLQHUDOV
YLWDPLQV DQG ILEHU DQG ZH VKRXOG EH FRQVXPLQJ WKHP GDLO\ %URFFROL FRQWDLQV
WKH PRVW YLWDPLQ & RI \RXU GDLO\ YDOXH DQG PRUH ILEHU WKDQ PRVW RWKHU
FUXFLIHURXVYHJJLHV,WDOVRSXWVDJRRGVHUYLQJRIYLWDPLQ$%%.IROLFDFLG
PDJQHVLXPSRWDVVLXPDQGRPHJDRQ\RXUSODWHZLWKIHZFDORULHV
7XUPHULF FRQWDLQV FXUFXPLQ
ZKLFKKDVEHHQIRXQGWRKHOSGLDEHWHV
FDQFHU SUHYHQWLRQ UHGXFH $O]KHLPHUnV
ULVN VORZ DJLQJ ERRVW LPPXQH V\VWHP
ILJKWLQIHFWLRQDQGUHGXFHLQIODPPDWLRQ
DFFRUGLQJ3XE0HG7KLVEULJKWRUDQJH\HOORZVSLFHFRQWLQXHVWRVXUSULVHVFLHQWLVWV
SURYHQE\RYHUVWXGLHVUHSRUWLQJRQLWVH[FHSWLRQDOKHDOWKSURSHUWLHV
7KHQXWULHQWVLQ%URFFROLFDQDOVRKHOS\RXUERG\UHFRYHUPRUH
TXLFNO\DIWHUDQLQWHQVHZRUNRXW
%URFFROLKDVEHHQIRXQGWRFRXQWHUR[LGDWLYH
VWUHVV D FRQGLWLRQ ZKHQ WKH ERG\ LV RYHUORDGHG
ZLWK IUHHUDGLFDOV WKDW DUH NQRZQ WR FDXVH
GDPDJHWRFHOOVDQG'1$7KH1DWLRQDO&DQFHU
,QVWLWXWHUDQDVWXG\RQSDUWLFLSDQWVZKRKDG
WRHDWFXSVRIFUXFLIHURXVYHJHWDEOHVDGD\
$IWHUWKUHHZHHNVWKHLUERGLHVZHUHIRXQGWR
KDYH OHVV R[LGDWLYH VWUHVV SURYLQJ WKDW
EURFFROLDQGRWKHUOHDI\JUHHQVYHJHWDEOHVDUH
D ZLVH DQG KHDOWK\ FKRLFH (DW LW UDZ DGG LW
WRVDODGVDQGVRXSVRUJHQWO\VWHDPLWDQGWKLQN
DERXWKRZPXFKJRRGLWLVGRLQJ\RXUERG\
»
»
»
»
»
Improve blood flow
Decrease stress
Improve focus
Boost immunity
Reduce inflammation
$PD]LQJO\WXUPHULFLVWKHWKKLJKHVWDQWLR[LGDQWULFKKHUEZLWKDQ25$&
VFRUHRI7KH2[\JHQ5DGLFDO$EVRUEDQFH&DSDFLW\25$&VFRUH
PHDVXUHV WKH DQWLR[LGDQW DQG FKHPLFDO OHYHOV RI IRRG 7KRVH LQJUHGLHQWV
IRXQG WR KDYH KLJK VFRUHV DUH EHVW DEOH WR HOLPLQDWH WKH IUHH UDGLFDO
ZKLFKWKHERG\QDWXUDOO\SURGXFHVGDLO\MXVWE\EUHDWKLQJDQGOLYLQJ
7XUPHULF LV D NH\ VXSHUIRRG IRU PXVFOH EXLOGLQJ DQG DFFHOHUDWHV WKH
KHDOLQJ SURFHVV ,W KDV DOVR EHHQ IRXQG WR LPSURYH EORRG IORZ ORZHU
VWUHVV OHYHOV DQG PDNH WKH EUDLQ VKDUSHU LPSURYLQJ IRFXV 6SULQNOH
7XUPHULFRQVDODGVEXUJHUVKXPPXVRUDQ\WKLQJHOVH\RXPD\FKRRVH7R
ILJKWLQIODPPDWLRQDQGLPSURYHPXVFOHDQGMRLQWUHFRYHU\WDNHDGRVHRIWXUPHULF
GDLO\
Spread the health!
6KDUHWKLVHERRNRQIDFHERRN
Meal Plan
MORNING
(JJVR]5DZ&KHGGDUZLWKFXSRI4XLQRD
R]%HUU\%DQDQD6PRRWKLHZLWK&RFRQXW0LONDQG3URWHLQ3RZGHU
*)3DQFDNHVPDGHZLWKHJJV*))ORXU3XPSNLQ%OXHEHUULHVDQGWRSSHG
ZLWK3XUH0DSOH6\UXSDQG$OPRQG%XWWHU
&UHDPRI%URZQ5LFHR]$PDVDLFXS$OPRQG%XWWHUDQG3URWHLQ3RZGHU
*)%UHDNIDVWEXUULWRV
MID-MORNING
6XSHU0XVFOH6KDNH
LUNCH
R]*UHHQ)HGVWLUIU\WVS7XUPHULFFXS4XLQRD
&KLFNHQ%UHDVWV6ZHHW3RWDWRDQG6DODG
R]9HQLVRQZLWKFXS.LGQH\%HDQVDQGFXS%URZQ5LFH
*UHHQIHG+RW'RJVZLWKR]5DZ&KHHVH%URZQULFHDQGYHJHWDEOHV
R]2UJDQLFVOLFHGWXUNH\RQH]HNLHOEUHDGZLWKVXSHUIRRGVDODG
AFTERNOON
R]5DZ&KHHVHRQ)OD[&UDFNHUV
FXS$OPRQG%XWWHUZLWK$SSOH
6XSHU0XVFOH6KDNH
*UHHQIHGEHHIMHUN\
POST-WORKOUT
6XSHU0XVFOH6KDNH
DINNER
*UHHQIHG%XUJHUWVS7XUPHULFLQPL[5DZFKHGGDU4XLQRDDQG%URFFROL
*)&KLFNHQ7HQGHUVZLWKFXS%HDQVDQG0L[HG9HJHWDEOHV
*UHHQIHG+RWGRJVZLWK6ZHHW3RWDWRDQG6SLQDFK
6DOPRQ3DWWLHVZLWK%LJ6DODGZLWKWVS7XUPHULF
7XUNH\%XUJHURQ(]HNLHO%UHDGZLWKPDVKHGIDX[WDWRHV
1RWH $ORQJ ZLWK IROORZLQJ WKH HDWLQJ SODQ :HLJKW 7UDLQ [ D ZHHN DQG GR
PLQLPDOFDUGLR
WEIGHT TRAINING
6HVVLRQVVKRXOGODVWPLQXWHV
GLIIHUHQWH[HUFLVHVDQGUHSVIRUXSSHUERG\OHJVVKRXOGEH
UHSV
$OVR,VXSHUVHWPRVWGD\VGRLQJWZRH[HUFLVHVLQDURZOLNHSXOOXSVDQGSXVKXSV
WRVDYHWLPH
&DUGRGRPLQXWHVRIEXUVWWUDLQLQJDWWKHHQGRIZHLJKWWUDLQLQJZRUNRXWV
RURQRIIGD\V
Your Enemies
,QDOOVXSHUKHURPRYLHVWKHUHDUHVXSHUYLOODLQV7KHUHnVDOZD\VDEDGJX\ZKR
FRPHVDORQJDQGWKUHDWHQVWKHHQWLUHKXPDQUDFH6XSHUPDQKDG/H[/XWKHUDQG
%DWPDQKDG7KH-RNHU+HUHDUHWKHIRRGYLOODLQV\RXnOOZDQWWRVWD\DZD\IURP
ZKLOHOLYLQJWKH6XSHU)RRGOLIH
HYDROGENATED OILS
,WFDQPHDQGRRPVGD\LI\RXnUHHDWLQJK\GURJHQDWHG
RLOVRQDUHJXODUEDVLV$FFRUGLQJWRWKH+DUYDUG6FKRRORI3XEOLF+HDOWKoWKHULVN
RIFDUGLRYDVFXODUGLVHDVHULVHVIRUHYHU\LQFUHDVHLQFDORULHVIURPWUDQVIDWV
FRQVXPHGHYHU\GD\p
7UDQVIDWVDUHSDUWLDOO\K\GURJHQDWHGRLOVWKDWKDYHEHHQOLQNHGWRKHDUW
SUREOHPVVXFKDVKHDUWGLVHDVHDQGREHVLW\+\GURJHQDWHGRLOVDUHNQRZQWRUDLVH
/'/ FKROHVWHURO OHYHOV WKDW DOORZV FKROHVWHURO WR EXLOG XS DV SODTXH QDUURZLQJ
DUWHULHVDQGHYHQWXDOO\FDXVLQJKHDUWGLVHDVHDQGVWURNHV%XWWKDWnVQRWDOO7KHVH
K\GURJHQDWHG RLOV DOVR ORZHU JRRG FKROHVWHURO ZKLFK VXSSRUWV \RXU EUDLQ DQG
DELOLW\WRKHDO
7KHPDLQYLOODLQVRIK\GURJHQDWHGRLOVWKDW\RXZDQWWRVWD\DZD\IURPDUH
FRUQRLOVR\EHDQRLOFRWWRQVHHGRLODQGFDQRODRLO
CONVENTIONAL MEAT AND PASTEURIZED DAIRY&RQYHQWLRQDO
PHDW DQG GDLU\ SURGXFWV FDQ EH PRUH WR[LF WKDQ 9HQRP 7KH VD\LQJ o\RX DUH
ZKDW\RXHDWpLVQHYHUPRUHWUXHWKDQZLWKPHDWDQGGDLU\SURGXFWV<RXUERG\ZLOO
DEVRUEDOOWKHWR[LQVDQGFRQWDPLQDQWVRIZKDW\RXHDWDORQJZLWKWKHQXWULHQWVVR
LWnVYLWDOWKDW\RXNQRZH[DFWO\ZKDW\RXnUHSXWWLQJRQ\RXUSODWH
$UHFHQWVWXG\SXEOLVKHGLQWKH-RXUQDORI$JULFXOWXUDODQG)RRG&KHPLVWU\
FRQILUPHGWKDWRQHJODVVRIFRQYHQWLRQDOSDVWHXUL]HGPLONERXJKWIURPWKHJURFHU\
VWRUHFRQWDLQVFKHPLFDOVLQFOXGLQJDQWLELRWLFVVWHURLGVDQWLLQIODPPDWRU\GUXJV
VWDWLQ GUXJV DQG SDLQ NLOOHUV DOO RI ZKLFK DUH URXWLQHO\ XVHG WR WUHDW GLVHDVHG
DQLPDOV
7KHDYHUDJH$PHULFDQHDWVSRXQGVRIEHHISHU\HDU\HWWKHPDMRULW\RI
FDWWOHDUHUDLVHGFRPPHUFLDOO\LQXQQDWXUDOFRQGLWLRQV&DOYHVEDOORRQIURPWR
SRXQGVLQPRQWKVE\IHHGLQJWKHPRQJUDLQVSURWHLQVXSSOHPHQWVGUXJV
DQWLELRWLFVDQGKRUPRQHV%HHILVDOVRWUHDWHGZLWKJDPPDUD\VWRNLOOEDFWHULDEXW
WKHUDGLDWLRQRIPHDWDQGIRRGVKDVSURGXFHGUDGLRO\WLFE\SURGXFWVUDLVLQJVHULRXV
KHDOWKFRQFHUQV+RZHYHULIUDZPLONLVVRXUFHGIURPKHDOWK\JUDVVIHGFRZVLW
FDQEHDKHDOWK\VXSHUIRRGWKDWnVFRQWDPLQDQWDQGLQIHFWLRQIUHH
ARTIFICIAL SWEETENERS AND MSG
$UWLILFLDOVZHHWHQHUVDUHWKH-RNHU
RIWKHIRRGLQGXVWU\DQGDUHQnWDVVZHHWDV\RXPLJKWWKLQN6XFUDORVHEHWWHUNQRZQ
DV 6SOHQGD LV FUHDWHG E\ FKORULQDWLQJ VXFURVH UHSODFLQJ K\GUR[\O ZLWK FKORULQH
ZKLFKLVDNQRZQFDUFLQRJHQ$VZHOODVEHLQJDKHDOWKULVNVXFUDORVHDSSHDUVWR
DFWXDOO\FDXVHZHLJKWJDLQSRVVLEO\EHFDXVHLWVWLOOWULJJHUVWKHUHOHDVHRILQVXOLQ
ZKLFKLVWKRXJKWWRLQGXFHSHRSOHWRDFWXDOO\HDWPRUH
,Q D UHSRUW IURP DQ RIILFLDO 8QLWHG 6WDWHV $LU )RUFH SXEOLFDWLRQ SLORWV
ZHUHZDUQHGQRWWRFRQVXPHDVSDUWDPH7KHUHSRUWVWDWHGo$VSDUWDPHKDVEHHQ
LQYHVWLJDWHGDVDSRVVLEOHFDXVHRIEUDLQWXPRUVPHQWDOUHWDUGDWLRQELUWKGHIHFWV
HSLOHSV\3DUNLQVRQnV'LVHDVH)LEURP\DOJLDDQG'LDEHWHVp7RGDWHWKH)'$KDV
PDGHQRPRYHWRUHJXODWHDVSDUWDPHZKLFKLVVROGDV1XWUD6ZHHWRU(TXDO
0RQRVRGLXPJOXWDPDWH06*LVXVHGDVDIODYRUHQKDQFHU\HWLWFDQFDXVH
VLGHHIIHFWVVXFKDVVZHDWLQJIOXVKLQJQDXVHDKHDGDFKHVDQGHYHQQXPEQHVVLQ
WKHIDFHDQGQHFN,WKDVDOVREHHQOLQNHGWRZHLJKWJDLQDFFRUGLQJWRVWXGLHVE\
WKH8QLYHUVLW\RI1RUWK&DUROLQDZKRIRXQGWKDWWKRVHZKRFRQVXPHG06*RQD
UHJXODUEDVLVZHUHPRUHOLNHO\WREHRYHUZHLJKWRUREHVH
PROCESSED GRAINS AND SUGAR3URFHVVHGJUDLQVDQGVXJDUVDUHOLNH
.U\SWRQLWHWRWKHKXPDQERG\:KLWHEUHDGSDVWDULFHVXJDU\FHUHDOVSDVWULHV
FUDFNHUVDQGFDQG\DUHQnWRQO\XQQXWULWLRXVWKH\DUHDFWXDOO\DQWLQXWULHQWV7KHVH
IRRGVWKDWDUHVXJDUEDVHGRULPPHGLDWHO\WXUQLQWRVXJDURQFHLQJHVWHGLQWR\RXU
V\VWHPDFWXDOO\OHDFKYLWDPLQVRXWRI\RXUFHOOV(YHUKLWWKHSPFDUEFRPDDW\RXU
ZRUNSODFHIURPHDWLQJDELJFDUERK\GUDWHORDGHGOXQFK"7KDWLVLQSDUWEHFDXVH
SURFHVVHGJUDLQVDQGVXJDUVDUHDFWXDOO\VXFNLQJWKHOLIHRXWRI\RX
2XU ERGLHV DUH GHVLJQHG DV KXQWHUJDWKHUHUV \HW RXU PRGHUQGD\ GLHWV
DUH KLJK LQ FDUERK\GUDWHV SURFHVVHG JUDLQV DQG VXJDU :H FRQVXPH IDU WRR
PXFKEUHDGFHUHDOSDVWDULFHDQGWZLQNLHVWKDQZHVKRXOGDQGRXUERGLHVDUH
SURWHVWLQJ
7KRVH ZKR DUH VXIIHULQJ IURP RYHUZHLJKW IDWLJXH LQVRPQLD GHSUHVVLRQ
IRJJ\EUDLQEORDWLQJORZEORRGVXJDUKLJKEORRGSUHVVXUHRUKLJKWULJO\FHULGHV
QHHGWRFKDQJHWKHLUGLHWrSURQWRrEHIRUHLWOLWHUDOO\EHFRPHVWKHGHDWKRI\RX
5HILQHGFDUERK\GUDWHVDUHGHULYHGIURPSURFHVVHGJUDLQVZKLFKKDYHKDGPRVWRI
WKHQXWULHQWVUHPRYHG5HILQHGJUDLQVDUHWKHPDLQLQJUHGLHQWVLQEUHDGEDJHOV
FHUHDODQGSDVWD7KH\mUHNQRZQDVoHPSW\FDORULHVpDVWKH\nUHVWULSSHGRIQXWULHQWV
ILEHUDQG%YLWDPLQV
Eating Beyond Organic
2UJDQLFKDVEHHQWKHKHDOWKEX]]ZRUGRYHUWKHSDVWVHYHUDO\HDUVWKDWKDV
FRPHWRPHDQoKHDOWK\p2UJDQLFIRRGLVGHILQLWHO\VXSHULRUWRFRQYHQWLRQDOIRRG
EHFDXVHLWnVIUHHRIPRVWFKHPLFDOVDQGUDLVHGRUJURZQLQDKHDOWKLHUHQYLURQPHQW
0RVW SHRSOH UHDOL]H WKDW FRQYHQWLRQDO LV EDG DQG RUJDQLF LV JRRG EXW , ZDQW
JUHDW,GRQnWZDQWWRMXVWHDW2UJDQLF,ZDQWWRHDW%H\RQG2UJDQLF
,DVNHG-RUGDQZKDWKHFRQVLGHUHGWREHPRVWLPSRUWDQWZKHQLWFRPHVWR
HDWLQJ%H\RQG2UJDQLF+HUHDUHVRPHRIKLVJXLGLQJSULQFLSOHVLQFUHDWLQJERWK
SODQWDQGDQLPDO6XSHU)RRGV
$JRRGIULHQGRIPLQH-RUGDQ5XELQUHFHQWO\VWDUWHGDFRPSDQ\ZKRnV
PLVVLRQLVWRFUHDWHWKHKHDOWKLHVW6XSHU)RRGVLQWKHZRUOG7KHFRPSDQ\nVQDPH
LV%H\RQG2UJDQLF-RUGDQKDGVXIIHUHGIURP&URKQnVGLVHDVH8OFHUDWLYH&ROLWLV
5KHXPDWRLG $UWKULWLV DQG &KURQLF IDWLJXH EXW KLV RZQ OLIH ZDV VDYHG ZKHQ KH
VZLWFKHGWRDGLHWKLJKLQ6XSHU)RRGV
No Chemicals (pesticides, fungicides, and herbicides)
Non GMO
No Anti-­biotics, Growth Hormones, or Vaccines
Green-­fed animals
Biblical based processing
Kind animal treatment
Raw or Low temperature production
-RUGDQWUDYHOHGWKHJOREHORRNLQJIRUDQVZHUVDQGWDONHGWRRYHUGRFWRUV
DOORYHUWKHZRUOGDQGMXVWNHSWJHWWLQJZRUVH-RUGDQKDGORVWRYHUSRXQGVDQG
ZDVRQWKHYHUJHRIGHDWKZKHQKHPHWDPDQWKDWWROGKLPLIKHIROORZHGDGLHW
EDVHGRIIRIWKH%LEOHKHFRXOGEHKHDOHG
)RUVRPHWKLQJWREHD6XSHU)RRGLWPXVWQRWRQO\EHORDGHGZLWKYLWDPLQV
DQGSK\WRQXWULHQWVLWDOVRPXVWEHIUHHRIWR[LFFKHPLFDOV&KHPLFDOVFDQQHJDWH
DOOKHDOWKEHQHILWVWKDWD6XSHU)RRGFDQJLYH\RXLQWKHILUVWSODFH%HVXUHWKDWWKH
IRRGV\RXnUHHDWLQJDUHRUJDQLFRUHYHQEHWWHU%H\RQG2UJDQLF
-RUGDQ FKDQJHG KLV GLHW DQG EHJDQ HDWLQJ 6XSHU)RRGV OLNH FXOWXUHG
GDLU\ ZLOG EHUULHV JUHHQ OHDI\
YHJHWDEOHVDQGSDVWXUHIHGEHHI
$IWHU IROORZLQJ WKLV SODQ IRU PRQWKVKLVKHDWKZDVFRPSOHWHO\
UHVWRUHG
7KLV LQVSLUHG -RUGDQ WR
ZULWH WKH 1< 7LPHV EHVWVHOOLQJ
ERRN7KH0DNHUV'LHWDQGWRJRRQDQGVWDUWRQHRIWKHODUJHVWYLWDPLQFRPSDQLHV
LQWKHZRUOGFDOOHG*DUGHQRI/LIH$OWKRXJK-RUGDQKDGPXFKVXFFHVVZLWK*DUGHQ
RI/LIHDQGKHOSHGPLOOLRQVZLWKWKHLUKHDOWKKHDOZD\VNQHZKHZDQWHGWRVWDUWD
IRRGPRYHPHQW<HVVXSSOHPHQWVDUHLPSRUWDQWEXWLWLVLPSRUWDQWWRUHPHPEHU
WKDWVXSSOHPHQWVDUHIRUVXSSOHPHQWLQJDQDOUHDG\KHDOWK\GLHW
, KDYH ZLWQHVVHG WKRXVDQGV RI SHRSOH RYHU WKH \HDUV ZKR KDYH WKRXJKW
WKH\FRXOGFRQWLQXHWRHDWMXQNEXWPDNHXSIRULWE\WDNLQJFHUWDLQYLWDPLQV6XUH
YLWDPLQVFDQKHOSEXW*RGSXW$//RIWKHQXWULHQWVZHQHHGLQWKHIRRGZHHDWLI
WKH\DUHJURZQDQGUDLVHGSURSHUO\
Jordan Rubin, at the Beyond Organic Ranch in Missouri
Be A Hero
+RZPDQ\SHRSOHGR\RXNQRZZKRQHHGWRFKDQJHWKHLU
GLHWORVHVRPHZHLJKWDQGVWDUWHDWLQJVXSHUIRRGV",I\RXnUHOLNH
PHLWnVDOPRVWHYHU\RQH\RXNQRZ
:HKDYHDQRSSRUWXQLW\WRVDYHOLYHVWRJHWKHUE\VSUHDGLQJ
WKLVPHVVDJHDQGVKDULQJWKLV)5((H%RRN
,UHFHQWO\KDGDSDWLHQWFRPHWRPHDQGVD\o'U$[H
\RXnUHQRWJRLQJWREHOLHYHWKLV,HPDLOHGRQHRI\RXUDUWLFOHVWR
P\PRPDQGDIWHUIROORZLQJ\RXUDGYLFHIRUPRQWKVKHUGRFWRU
KDVWDNHQKHURIIRIPHGLFDWLRQVDQGVKHKDVORVWSRXQGV
7KDQN\RX6KHVD\V\RXnUHKHUKHURp
, ZDV EH\RQG WRXFKHG E\ KHU NLQG ZRUGV DQG , JLYH *RG
WKH JORU\ IRU JLYLQJ PH WKH SODWIRUP WR VSHDN DERXW KHDOWK , ZDQW
WR HQFRXUDJH \RX WR XVH \RXU SODWIRUP WR KHOS VSUHDG WKLV PHVVDJH
RI KHDOWK DV ZHOO :KHWKHU VHQGLQJ DQ HPDLO SRVWLQJ RQ IDFHERRN RU
YHUEDOL]LQJVRPHWKLQJ\RXnYHOHDUQHGWKHUHDUHVRPDQ\JUHDWZD\V<28FDQ
KHOSSHRSOH
7KDQNVVRPXFKIRUUHDGLQJWKLVERRNDQGWKDQNVIRUEHLQJDKHUR
%\RXUSRZHUVFRPELQHGZHFDQKHOSVDYHWKHSODQHW
Spread the health!
6KDUHWKLVHERRNRQIDFHERRN
Breakfast
Berry Smoothie
R]$PDVDL2U&RFRQXW0LON
FXSUDVSEHUULHV
5DZHJJV2UVFRRSSURWHLQ
6WHYLDWRWDVWH
Peach Probiotic Smoothie
R]$PDVDL
FXSIUR]HQ3HDFKHV
7EVS$OPRQGRU&DVKHZEXWWHU
5DZ(JJV
WVS&LQQDPRQ
WVS9DQLOOD
7EVS+RQH\
SuperFood Smoothie
R]$PDVDL2U&RFRQXW0LON
FXS%OXHEHUULHVRU5DVSEHUULHV
FXS.DOHRU6SLQDFK
WVS)OD[RU&KLDVHHGV
+DOIWVS&LQQDPRQ
6WHYLDWRWDVWH
Breakfast
Gluten free pancakes
FJOXWHQIUHHSDQFDNHPL[%REnV5HG0LOO
HJJV
FFRFRQXWPLON
FFDQQHGSXPSNLQ
FIUHVKRUIUR]HQEOXHEHUULHV
WVSYDQLOOD
WVSFLQQDPRQ
WEVSFRFRQXWRLO
&RPELQHZHWLQJUHGLHQWVLQDERZOH[FHSWEOXHEHUULHV
:KLVNLQGU\LQJUHGLHQWVFDUHIXOO\WRDYRLGFOXPSLQJ
6WLULQEOXHEHUULHV
+HDWFRFRQXWRLOLQSDQRYHUPHGLXPKHDW
6HUYHZDUPZLWKEOXHEHUU\DQGPDSOHV\UXS
Grainless Granola
FVOLFHGUDZDOPRQGV
FFKRSSHGZDOQXWV
FFKRSSHGGULHGDSSOHV
FEOXHEHUULHV
FFRFRQXWIODNHV
SLQFKRIFLQQDPRQ
7RVVDOOLQJUHGLHQWVWRJHWKHULQDODUJHERZO
6HUYHZLWKEHUULHV
Snacks
Superhuman Shake
5DZ(JJV
R]$PDVDLRU*RDWV0LON<RJXUW
7EVS$OPRQG%XWWHU
7EVS)OD[6HHGVRU)OD[0HDO
WVS&LQQDPRQ
%DQDQD
Hummus
FDQVJDUEDQ]REHDQV
FUDZVHVDPHVHHGV
7EVSROLYHRLO
FOHPRQMXLFH
JDUOLFFORYHSHHOHG
WVSFXPLQ
6HD6DOWWRWDVWH
'UDLQDQGULQVHJDUEDQ]REHDQVUHVHUYLQJFOLTXLG
3ODFHDOOLQJUHGLHQWVLQDEOHQGHUDQGEOHQG
$GGPRUHZDWHURUROLYHRLOXQWLOGHVLUHGFRQVLVWHQF\
LVUHDFKHG
Snacks
Guacamole
DYRFDGRV
OLPH
FORYHVRIJDUOLFPLQFHG
VPDOOWRPDWRRUVDOVD
WVSVHDVDOW
WVSGLOO
6SRRQRXWDYRFDGRVLQWRODUJHERZO
$GGOLPHMXLFHPLQFHGJDUOLFDQGFKRSSHGWRPDWR
:LWKDVSRRQPDVKWRJHWKHUXQWLOPL[WXUHEHFRPHVFUHDP\
$GGVHDVDOWDQGGLOO
5HIULJHUDWHDQGVHUYHZLWKEHOOSHSSHUVOLFHVRUFHOHU\
Anti-Oxidant Trail Mix
FSHFDQV
FDOPRQGV
FUDLVLQV
FGDUNFKRFRODWHFKLSVXQVZHHWHQHG
FGULHGDSSOHVOLFHV
VHDVDOWVSULQNOHG
FLQQDPRQVSULQNOHG
&RPELQHDOOLQJUHGLHQWVLQDERZO
Lunch
Superfood Salad
FXS6SLQDFK
—FXSEOXHEHUULHVDQGVWUDZEHUULHV
R]6DOPRQRU&KLFNHQ
–VOLFHGFXFXPEHU
–FXSVOLFHGDOPRQGV
–FXSVOLFHGRUDQJH\HOORZUHGSHSSHUV
Lemon Tahini Dressing
—FXSOHPRQMXLFH
FXSH[WUDYLUJLQROLYHRLO
FXSWDKLQL
WEVSKRQH\
FORYHVPLQFHGJDUOLF
WVSVHDVDOW
WVSEODFNSHSSHU
Lunch
Vegetable Soup
7EVSUDZRURUJDQLFEXWWHU
PHGJDUOLFFORYHVVPDVKHG
FFKRSSHGUHGRQLRQ
FFHOHU\FKRSSHG
]XFKLQQLnVFKRSSHG
ODUJHFDUURWGLFHG
FWRPDWRGLFHG
OEPXVKURRPVFKRSSHG
WVSGULHGWK\PHOHDYHV
FYHJHWDEOHRUFKLFNHQVWRFN
7EVS%UDJJnVOLTXLGDPLQRV
R]JUHHQEHDQV
FFKRSSHGSDUVOH\
VHDVDOWSHSSHUWRWDVWH
,QDODUJHSRWRYHUPHGLXPKHDWPHOWEXWWHU$GG
JDUOLFDQGRQLRQVDQGVDXWÃVWLUULQJRFFDVLRQDOO\
IRUPLQXWHV
$GGFHOHU\]XFKLQQLWRPDWRVFDUURWV
PXVKURRPVKHUEVVDOWSHSSHU&RYHUDQG
FRRNVWLUULQJRFFDVLRQDOO\IRUPLQXWHV
$GGVWRFNFRYHUDQGOHWVLPPHUIRUDQDGGLWLRQDO
PLQXWHVRUORQJHU6WLULQ%UDJJnVJUHHQ
EHDQVDQGSDUVOH\DQGVLPPHUIRUDIHZPRUH
PLQXWHV
Lunch
Green-Fed Stir-Fry
7EVSFRFRQXW9LQHJDU
7EVSKRQH\
7EVSFRFRQXWRLO
7EVSPLQFHGIUHVKJLQJHUURRW
7EVSPLQFHGJDUOLF
OEJUDVVIHGEHHIURXQGVWHDNFXWLQWRWKLQVWULSV
R]FKRSSHGEURFFROL
UHGEHOOSHSSHUVOLFHG
R]PXVKURRPV
)LUVWDGGFRFRQXWRLOWRSDQOHWKHDWIRUPLQXWH
7KHQDGGLQDOOLQJUHGLHQWV
+HDWIRUPLQXWHV
6HUYHRYHUEURZQULFH
Chicken Salad Lettuce Wrap
FOHIWRYHUFRRNHGFKLFNHQ
FGLFHGFHOHU\
FVOLFHGUHGJUDSHV
WVSOHPRQMXLFH
FPD\RQQDLVHDOWHUQDWLYH9HJDQDLVH
FFKRSSHGZDOQXWV
VHDVDOWSHSSHUWRWDVWH
3ODFHDOOLQJUHGLHQWVLQDERZODQGPL[WRJHWKHU
6FRRSLQWROHWWXFHZUDSVRUOHWWXFHERZOV
Sides
Garlicky Greens
F.DOH
FORYHV*DUOLF
—2QLRQ
WEVS&RFRQXW2LO
6HDVDOWDQGEODFNSHSSHUWRWDVWH
$GGFRFRQXWRLOWRSUHKHDWHGSDQ
WKHQVDXWHHJDUOLFDQGRQLRQVIRUPLQXWHV
$GG.DOH
6HDVDOWDQGEODFNSHSSHUWRWDVWH
Mashed Faux-Tatoes
PHGKHDGFDXOLIORZHUDERXWOEV
FUDZRURUJDQLFEXWWHU
WVSVHDVDOW
JULQGVEODFNSHSSHU
PLQFHGFKLYHVRSWLRQDO
6WHDPFDXOLIORZHUXQWLOWHQGHU
,QDIRRGSURFHVVRUEOHQGDOOLQJUHGLHQWV
XQWLOVPRRWK
Dinner
Green-fed Meatballs
SRXQGVJUHHQIHGEHHI
RUJDQLFHJJV
FXSDOPRQGPHDORU*OXWHQ)UHHEUHDGFUXPEV
WHDVSRRQ,WDOLDQVHDVRQLQJ
ODUJHRQLRQJUDWHG
WVSVHDVDOW
WVSEODFNSHSSHU
WVSIUHVKJURXQGQXWPHJRUFLQQDPRQ
—FXSRUJDQLF%%4VDXFHRU.HWFKXS
0L[DOOLQJUHGLHQWVZHOOWKHQVKDSHLQWRpEDOOV
%DNHDWIRUPLQXWHVWKHQVHUYH
Powerburgers
SRXQGJUHHQIHGEHHI
–FXSWKLQO\VOLFHGRQLRQV
—WVSWXUPHULF
–WVSJDUOLFSRZGHU
–WVSEODFNSHSSHU
WEVSFRFRQXWDPLQRVRUEUDJJnVOLTXLGDPLQRV
0L[ LQJUHGLHQWV LQ ERZO WKHQ PDNH LQWR LQFK
SDWWLHV&RRNRQJULOORUVNLOOHWIRUPLQXWHVWKHQIOLS
FRRNIRUPRUHPLQXWHVWKHQDGGRQUDZFKHGGDU
FKHHVHFRRNIRUPRUHPLQXWHVWKHQVHUYH
Dinner
Salmon Patties
FDQVZLOGFDXJKW$ODVNDQVDOPRQ
HJJV
7EVSROLYHRLO
RQLRQFKRSSHG
ER[0DU\nV*RQH&UDFNHUVFUXPEOHG
&RPELQHDOOLQJUHGLHQWVLQDODUJHERZODQG
IRUPLQWRSDWWLHV
+HDW7EVSFRFRQXWRLORUJUDSHVHHGRLOLQDODUJH
VNLOOHWRYHUPHGLXPKHDW&RRNSDWWLHVPLQXWHV
RQHDFKVLGH
Gluten Free Chicken Tenders
&KLFNHQ6WULSV
FXS*OXWHQ)UHH)ORXU%REnV5HG0LOO
WVS3DSULND
WVS&D\HQQH
WVS6HD6DOW
WVS%ODFN3HSSHU
WVS*DUOLF3RZGHU
7EVS&RFRQXW2LO
0L[GU\LQJUHGLHQWVLQERZOWKHQFRDWFKLFNHQ
&RRNLQDSDQZLWKFRFRQXWRLO
Dessert
Dark Chocolate Covered Berries
&KRFRODWH%DUV
7EVSWRDVWHGIOD[VHHGV
FIUHVKEOXHEHUULHV
0HOWFKRFRODWHLQDERZORYHUDSDQRIVLPPHULQJZDWHU
6WLUIUHTXHQWO\XQWLOPHOWHGDQGVPRRWK6WLULQ)OD[
5HPRYHIURPWKHKHDWPL[LQEOXHEHUULHV
6SRRQVPDOOFOXPSVRIEOXHEHUULHV RQWRZD[HGSDSHU
RQEDNLQJVKHHW5HIULJHUDWHXQWLOILUPPLQ
Avacado Mousse
FPHGMRROGDWHVVRDNLQFROGZDWHUKRXUV
FPDSOHV\UXS
WVSYDQLOODH[WUDFW
FPDVKHGDYDFDGRDERXWDYDFDGRV
FRUJDQLFFRFRDRUFDURESRZGHU
FZDWHU
%OHQG RU SURFHVV GDWHV PDSOH V\UXS DQG YDQLOOD XQWLO
VPRRWK$GGPDVKHGDYDFDGRDQGFRFRDSRZGHU$GG
ZDWHUDQGSURFHVVXQWLOVPRRWK6HUYHFKLOOHG
Dessert
Coconut Macaroons
HJJZKLWHV
WVSFHOWLFVHDVDOW
FXSUDZKRQH\
WEVSYDQLOODH[WUDFW
FXSVXQVZHHWHQHGFRFRQXW
,QPL[LQJERZOZKLVNHJJVVHDVDOWUDZKRQH\
YDQLOODDQGFRFRQXW
6SRRQEDWWHURQWRSDUFKPHQWSDSHURQFRRNLHVKHHW
%DNH DQG GHJUHHV IRU WR PLQV XQWLO OLJKWO\
EURZQHG
Want more Real, Healthy Recipes
just like these? *HWWKHFRRNERRN
o'HOLFLRXV DQG VLPSOH WR SUHSDUH UHFLSHV FRQWDLQLQJ
PDQ\RI\RXUIDYRULWHLQJUHGLHQWVWKHo5HDO)RRG'LHWp
FDQSURYLGHRSWLPDOQXWULWLRQIRUWKHHQWLUHIDPLO\
,I\RXZDQWWRUHGXFHDOOHUJLHVERRVWHQHUJ\LPSURYH
\RXUPRRGDQGVKULQN\RXUZDLVWOLQHWKHQLWnVWLPH\RX
EHJDQD5HDO)RRG'LHWp
Jordan Rubin
Founder of Beyond Organic
NY TImes bestselling author,
The Maker’s Diet
Limited Offer: $5 off
Enter: SUPERFOOD at checkout
Workout Plans
Spread the health!
6KDUHWKLVHERRNRQIDFHERRN
3-DAY HOME (30 minute workouts)
ADVANCED WORKOUT PLAN
Monday
6KRXOGHUV
/HJV %XUVW
'XPEEHOO3UHVV VHWV 6XSHUVHW6KRXOGHUV/HJV
'XPEEHOOODWHUDOUDLVH VHWV
/XQJHV VHWV 6XPR6TXDWV VHWV
6SULQWLQ3ODFH VHFRQGV
0RXQWDLQ&OLPEHUV
VHFRQGV
3ODQNV VHFRQGV
5HSHDW%XUVW[7KHQUHVWPLQXWH
Monday
6KRXOGHUV
/HJV 6HDWHG'XPEEHOO3UHVV
'XPEEHOOODWHUDOUDLVH
0DFKLQH3UHVV 5HDU'HOWUDLVH /HJ3UHVV
/HJ&XUOV
/HJ([WHQVLRQ /XQJHV Tuesday
5(67
Tuesday
PLQXWHV%XUVW7UDLQLQJ
Wednesday
%DFN
&KHVW
3XOOXSV 6HDWHG&DEOH5RZV
/DW3XOOGRZQ 5RZ0DFKLQH ,QFOLQH'XPEEHOO3UHVV
,QFOLQHEHQFK3UHVV
'LSVRU0DFKLQH
3XVKXSV
Thursday
PLQXWHV%XUVW7UDLQLQJ
Friday
7ULFHSV
%LFHSV
$EV &DEOH3UHVVGRZQ
.LFNEDFNV
6NXOOFUXVKHUV 'XPEEHOO&XUO (=EDU&XUO
&DEOH&XUO
&UXQFKHV
2EOLTXHGXPEEHOOWZLVW
Saturday
PLQXWHV%XUVW7UDLQLQJ
Sunday
5(67
Wednesday
%DFN
&KHVW
%XUVW
Thursday
5HYHUVH)O\VRU3XOOXSV VHWV 2QHDUP5RZV VHWV
,QFOLQH'XPEEHOO3UHVV VHWV
3XVKXSV
VHWV
%XUSHHV
VHFRQGV
$UP&LUFOHV
VHFRQGV
3XOVLQJ6TXDWV VHFRQGV
5HSHDW%XUVW[7KHQUHVWPLQXWH
6XSHUVHW%DFN&KHVW
5(67
Friday
7ULFHSV
%LFHSV
$EV 'XPEHOO7ULFHS([WHQVQ
.LFNEDFNV
'XPEEHOO&XUO &RQFHQWUDWLRQ&XUO
&UXQFKHV
2EOLTXHGXPEEHOOWZLVW
Saturday
PLQXWH:DON-RJRU%LNH5LGHRXWVLGH
Sunday
5(67
VHWV VHWV
VHWV
VHWV
VHWV
VHWV
6XSHUVHW%LnV7ULnV
VHWV 6XSHUVHW6KRXOGHUV/HJV
VHWV
VHWV
VHWV
VHWV VHWV VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
VHWV
6XSHUVHW%DFN&KHVW
6XSHUVHW%LnV7ULnV
WANT MORE?
The Real Food Diet Cookbook
By Dr. Josh Axe
$24.95
Get it here.
Beyond Organic
High-Quality Superfoods
Get it here.
Educational DVD’s
Taught by Dr. Josh Axe
Weight Loss
Advanced Nutrition
Real Body Revolution
Get it here.
Free Health Articles
DrAxe.com
Sign up for my email newsletter, here.
C O M I N G
S O O N
BurstFit DVD Series
Lead by Dr. Josh Axe
Intense, interval style burst exercises.
6x20 min. Sessions
Sign up for a free email offer, here.

Similar documents

P acific O cean N

P acific O cean N RIIHUDQFRPELQDWLRQRIDUWSDLQWLQJVJLIWVDQGÀQHUHOLJLRXV DQGVSLULWXDOERRNV2SHQGD\VDZHHNDQGIHDWXUHDUWFUHDWHG E\PHPEHUVRIRXUFRPPXQLW\DQGORFDODUWLVWV-HZHOU\FDUGV FD...

More information

September 9, 2014 Issue 36, Vol. 18

September 9, 2014 Issue 36, Vol. 18 HQWHUWDLQPHQW ZDV MXVW DERXW WR EHJLQ 1RERG\LVVD\LQJZKDWWULJJHUHGWKHQH[W HYHQW ± PD\EH WKH\ KDG WKHLU VLJKWV VHW RQWKHVDPHFXWHÀLJKWDWWHQGDQWRURQH RIWKHPIRUJRWWREUL...

More information