kashrus conscience

Comments

Transcription

kashrus conscience
Hotline: (818) 262-5351 Fax: (818) 766-8537
Website: www.kosherquest.org E-Mail: [email protected]
Mailing Address: P.O. Box #56851, Sherman Oaks, California 91413
KASHRUS CONSCIENCE
A Service of the KOSHER INFORMATION BUREAU by RABBI E. EIDLITZ
When can I start the second seder?
Is it OK to use my coffee machine on Passover?
What is the last time to eat chametz?
Passover
Pesach
March 2013
Nissan 5773
Can romaine be used for maror?
Where can I buy oat matzah?
Is quinoa kitniyos?
What is shmurah matzah?
Table of Contents
&KRPHW]2Q3HVDFK
3DJH
6WDQGDUGV2I.DVKUXV
3DJH
.LWQL\RV3DJH
%LWXO$QQXOPHQW2I&KRPHW] 3DJH
&RQVXPSWLRQ2I&KRPHW]
3DJH
+DQD¶DK%HQH¿W)URP&KRPHW]3DJH
0HFKLUDV6HOOLQJ2I&KRPHW] 3DJH
&KRPHW]6KH¶DYDU$ODY+DSHVDFK
%X\LQJ&KRPHW]$IWHU3HVDFK3DJH
.DVKHULQJ0DNLQJ8WHQVLOV.RVKHU3DJH
(UHY3HVDFK
3DJH
(DWLQJ2Q(UHY3HVDFK
3DJH
6HOHFWHG/DZV&XVWRPV
3DJH
7KH6HGHU3ODWH
3DJH
7KH$UED.RVRV)RXU&XSV2I:LQH3DJH
0DW]R
3DJH
0HGLFLQH 3DJH
7RLOHWULHV 3DJH
CHOMETZ ON PESACH
Chometz is any substance that contains leavening
IURPRQHRI¿YHFHUHDOJUDLQVZKHDWEDUOH\RDWV
VSHOWRUU\HFDXVHGE\LWVSURORQJHGFRQWDFWZLWK
ZDWHURURWKHUOLTXLGV7KHSURKLELWLRQRIchometz on
3HVDFKLQFOXGHV³Chometz Gomur´XQDGXOWHUDWHG
&KRPHW]DQG³Ta‘aruvas Chometz´DPL[WXUH
FRQWDLQLQJUHDO&KRPHW]7KHUHDUHWKUHHDUHDV
ZLWKZKLFKZHPXVWEHFRQFHUQHGZKHQHYDOXDWLQJ
FKRPHW])LUVWWKHUHLV³Isur Hana’ah´7KLVPHDQV
WKDWRQHPD\QRWGHULYHDQ\SOHDVXUHRUEHQH¿W
ZKDWVRHYHUIURPchometzHJIHHGLQJchometz
WRRQH¶VSHWVHWF6HFRQGO\D-HZPD\QRWRZQ
chometz7KLVSURKLELWLRQH[WHQGVWRSRVVHVVLRQ
of chometzDQ\ZKHUHLQWKHZRUOGVXFKDVLQD
ERDWRI¿FHPRXQWDLQUHWUHDWHWF7KLUGO\WKHUH
is a prohibition against having chometz in one’s
SRVVHVVLRQ2QHPXVWEHFDUHIXOWRUHPRYHDOO
chometz IURPWKHLUSUHPLVHV-HZVPD\QRWOHDYH
chometzLQWKHLUSRVVHVVLRQRQ3HVDFKHYHQLI
WKH\GRQRWLQWHQGWRXVHLWDQGWKH\GRQ¶WRZQLW
2QHVKRXOGEHFDUHIXOQRWWRVHQGDSDFNDJHZKLFK
contains chometzWRRFORVHWR3HVDFKDVLWPD\
DUULYHGXULQJ3HVDFK'XHWRWKHVHYHULW\RIchometz
PDQ\GRQRWVHOOWKHLUchometz for Pesach but prefer
WRGLVSRVHRILWLQVWHDG7KHIROORZLQJDUHactual
chometzEUHDGFDNHFHUHDOPDGHIURPZKHDW
RDWVRUEDUOH\FRRNLHVIDUIHOPL[VRPHOLFRULFH
SDVWDSUHW]HOVUROOHGRDWVZKHDWJOXWHQZKHDW
SURWHLQ6RPHKDYHWKHVDPHFXVWRPFRQFHUQLQJ
EHHUDQGZKLVNH\
STANDARDS OF KASHRUS
:LWKRYHU.RVKHUFHUWLI\LQJDJHQFLHVDQG
LQGLYLGXDOVFRPSHWLQJLQWKH.RVKHUFHUWLI\LQJ
EXVLQHVVLWLVH[SHFWHGWKDWVWDQGDUGVZLOOYDU\
:KLOHPRVWNHHSWRDEDVLFDFFHSWDEOHVWDQGDUG
VRPHGRQRW:HVWLOOVHHJHODWLQIURPQRQ.RVKHU
DQLPDOVEHLQJXVHGRIWHQOLVWHGDV³N*HODWLQ´
FRUQV\UXSDVDQLQJUHGLHQWLQ3DVVRYHUSURGXFWV
ZLWKDORQJUHIHUHQFHDWWHPSWLQJWROHJLWLPL]HLW
FDUPLQHIURPEXJVXVHGDVUHGFRORULQJDVZHOO
DVPDQ\RWKHUTXHVWLRQDEOHLQJUHGLHQWV:LWKWKH
3
)UR]HQ9HJHWDEOHV 3DJH
)UHVK9HJHWDEOHV
3DJH
)UHVK)UXLW
3DJH
6RGD
3DJH
(JJV
3DJH
0LON
3DJH
0LON6XEVWLWXWHV
3DJH
0DUVKPDOORZV*HODWLQV
3DJH
3HW)RRG 3DJH
,WHPV7KDW0D\%H8VHG:LWKRXW3DVVRYHU
&HUWL¿FDWLRQ)RU 3DJH
,WHPV7KDW$UH5HOLDEO\&HUWL¿HG
)RU3DVVRYHU)RU3DJH
,WHPV7R%H&DXWLRXV2I
)RU3DVVRYHU)RU3DJH
,WHPV7R%H&DXWLRXV2I)RU3DVVRYHU
)RU$OHUWV8SGDWHV3DJH
YDVWQXPEHURISURGXFWVEHLQJFHUWL¿HGE\UHOLDEOH
DJHQFLHVDQGLQGLYLGXDOVLWZRXOGVHHPWREHPXFK
OHVVWHPSWLQJWRDOORZIRUWKHVHOHQLHQWRSLQLRQVWR
OHVVHQRXUREVHUYDQFHRI3HVDFK$GGLWLRQDOO\VRPH
HVWDEOLVKPHQWVRQO\RIIHU³.RVKHUVW\OH´SURGXFWVIRU
3HVDFKZKLOHWKHOHQLHQWZRUG³VW\OH´LVPLVVHGE\
PDQ\6RPHIRRGHVWDEOLVKPHQWVRIIHUD3DVVRYHU
WDFREDUKDPRQPDW]DKVSHFLDODQG3DVVRYHU
FKDOODKDPRQJRWKHUWKLQJV7KHRQO\SURWHFWLRQ
DVIDUDVWKHJRYHUQPHQWLVFRQFHUQHGLVIURP
$VVHPEO\%LOOVHFWLRQSDVVHGLQ0DUFK
RI,WVWDWHV³1RSHUVRQVKDOOGRDQ\RIWKH
IROORZLQJ0DNHDQ\GLUHFWVWDWHPHQWHLWKHURUDOO\RU
LQZULWLQJGLVSOD\WKHZRUGV³.RVKHU´³.RVKHUVW\OH´
³.RVKHUW\SH´³.RVKHUIRU3DVVRYHU´³-HZLVK´RU
³+HEUHZ´LQDQ\ODQJXDJHRUGLVSOD\DQ\LQVLJQLDVL[
SRLQWHGVWDURURWKHUPDUNWKDWPLJKWUHDVRQDEO\EH
FDOFXODWHGWRGHFHLYHRUOHDGDUHDVRQDEOHSHUVRQ
WREHOLHYHDSURGXFWLV³.RVKHU´RUVDQFWLRQHGE\
2UWKRGR[+HEUHZUHOLJLRXVUHTXLUHPHQWVLILWLV
QRW´2EYLRXVO\RQHQHHGVWREHYLJLODQWLQFDUHIXOO\
ZDWFKLQJIRUSURSHUFHUWL¿FDWLRQ
KITNIYOS
'XHWRWKHVWULQJHQF\RIWKHSURKLELWLRQRIQRWHDWLQJ
chometzRQ3HVDFK$VKNHQD]LF-HZVDVZHOODV
PDQ\6HSKDUGLPKDYHGHYHORSHGDFXVWRPQRW
to eat kitniyosOHJXPHVRQ3HVDFKRWKHUWKDQ
IRULQIDQWVDQGXQGHURWKHUVSHFLDOFLUFXPVWDQFHV
SURYLGHGWKDWWKHIRRGVDUHSUHSDUHGLQVHSDUDWH
XWHQVLOVKitniyosLQFOXGHVEHDQVVR\ULFHSHDV
DQGFRUQDPRQJRWKHUVVHHEHORZ6HSKDUGLP
ZKRVHminhagSHUPLWVWKHPWRHDWULFHRQ3HVDFK
PXVWEHFDUHIXOWRGHWHUPLQHWKDWWKHULFHLVDGGLWLYH
IUHH0DQ\6HSKDUGLPKDYHWKHminhag WRFKHFNWKH
ULFHWKUHHWLPHVDVZHOODVWRFKHFNIRURWKHUJUDLQV
WKDWPD\EHPL[HGLQ,QDQ\FDVHRSHQELQVLQ
VWRUHVVKRXOGQRWEHXVHG
$VKNHQD]LPUHIUDLQIURPHDWLQJSHDQXWVDVZHOO
+RZHYHUWKLVUHVWULFWLRQUHJDUGLQJSHDQXWVPD\QRW
LQFOXGHSHDQXWRLODFFRUGLQJWRWKHRSLQLRQRI5DY
0RVKH)HLQVWHLQ=7´//HJXPHVDUHSHUPLWWHGIRU
VRPH6HSKDUGLF-HZVZKRIRUYDULRXVKLVWRULFDO
BITUL (ANNULMENT) OF CHOMETZ, CONSUMPTION OF
CHOMETZ , HANA’AH (BENEFIT) FROM CHOMETZ, MECHIRAS
(SELLING OF) CHOMETZ, CHOMETZ SHE’AVAR ALAV
HAPESACH (BUYING CHOMETZ AFTER PESACH)
UHDVRQVGLGQRWDGRSWWKLVFXVWRPRIUHIUDLQLQJIURP
kitniyosFRQVXPSWLRQRQ3HVDFK$UHOLDEOHVRXUFHRI
DFFHSWDEOHSURGXFWVIROORZLQJWKLV6HSKDUGLFFXVWRP
LVWKH6HSKDUGLGLYLVLRQRIWKH-625DW
RU:::-62525*EHDZDUHWKDWDQXPEHU
RIOLVWVH[LVWIRU6HSKDUGLPWKDWDUHH[WUHPHO\
PLVOHDGLQJDQGHUURQHRXV
)RUWKLVUHDVRQWKH.RVKHUFRQVXPHULVFRQIURQWHG
HYHU\\HDUDURXQG3HVDFKWLPHZLWKDFRQIXVLQJ
DUUD\RI.RVKHUFHUWL¿FDWLRQVIRXQGRQFDQG\MDP
PXVWDUGDQGRWKHUSURGXFWVFRQWDLQLQJOHJXPHV,Q
UHDOLW\WKHVHSURGXFWVDUHHGLEOHRQ3HVDFKE\RQO\
FHUWDLQJURXSVRI-HZV0DQ\EXWQRWDOOZLOOVWDWH
³Leochlei KitniyosRQO\IRUWKRVHZKRHDWkitniyos´
6RPHH[DPSOHVRIWKLVDUHVXQÀRZHUVHHGVFDQQHG
YHJHWDEOHVKDOYDHWF(YHU\-HZKRZHYHULV
SHUPLWWHGWRGHULYHEHQH¿WIURPkitniyosVXFKDVSHW
IRRGJOXHEDE\IRUPXODHWF
7KHIROORZLQJDUHFRQVLGHUHG.LWQL\RVRUWUHDWHGDV
.LWQL\RVDFFRUGLQJWRPDQ\RSLQLRQV
$QLVH$VFRUELF$FLG0D\EH&KRPHW]$VSDUDWDPH
1XWUDVZHHW%HDQV%ODFN(\HG3HDV%XFNZKHDW
&DOFLXP$VFRUEDWH&DQROD2LO&DUDZD\&LWULF
$FLG0D\EH&KRPHW]&KLFNSHDV&RQIHFWLRQHUV¶
VXJDUZLWKFRUQVWDUFK&RULDQGHU&RUQ&RUQ6\UXS
&XPLQ'H[WURVH)HQQHO)HQXJUHHN)OD[6HHGV
+HPS+\GURO\]HG9HJHWDEOH2LO.DVKD.LPPHO
/HFLWKLQ/HQWLOV/LFRULFH/XFHUQH/XSLQH0DOWR
'H[WULQV(chometzRUNitnios GHULYHG0LOOHW06*
0XVWDUG3HDQXWV3RO\VRUEDWHV0D\EHchometz)
3RSFRUQ3RSS\6HHGV5LFH9LWDPLQVDGGHGPD\
be chometz6HVDPH6HHGV6QRZ3HDV6RGLXP
&LWUDWH0D\EHchometz6RGLXP(U\WKRUEDWH0D\
be chometz6RUELWRO&RXOGEHchometzLIRXWVLGH
WKH866R\2LO&RUQ2LO6R\6WULQJ%HDQV
6XQÀRZHU6HHGV7RIXIURPVR\9LWDPLQ&PD\
be chometz:LOG5LFH;DQWKDQJXP0D\EH
chometz)127()OD[VHHGDQG+HPSVHHGDUHQRW
kitniyosDQGFDQEHXVHGDIWHUFKHFNLQJIRURWKHU
JUDLQV
BITUL (ANNULMENT) OF CHOMETZ
DXULQJWKH\HDUDQ\QRQ.RVKHULQJUHGLHQWVZKLFK
DUHLQDGYHUWHQWO\PL[HGZLWK.RVKHULQJUHGLHQWV
PD\EH+DODFKLFDOO\DFFRUGLQJWR-HZLVKODZ¿W
WRHDW7KHUHDVRQIRUWKLVOHQLHQF\LVWKDWWKH\DUH
GHFODUHG³%DWHO%HVKLVKLP´DQQXOOHGLQVL[W\LH
WKH.RVKHUIRRGLVDWOHDVWVL[W\WLPHVJUHDWHUWKDQ
WKHQRQ.RVKHUWKXVPDNLQJWKHQRQ.RVKHUIRRG
DQQXOOHG7KLVUXOHLVWUXHUHJDUGLQJchometz on
3HVDFKRQO\LIWKHPL[WXUHZDVPDGHEHIRUH3HVDFK
'XULQJ3HVDFKWKHODZVRI³bitul” are notDSSOLFDEOH
,QRWKHUZRUGVGXULQJWKHZHHNRI3HVDFKLIHYHQ
a tiny amount of chometz falls into a large amount
RI³.RVKHUIRU3HVDFK´IRRGLWUHQGHUVWKHIRRGDV
ZHOODVWKHSRWXQ¿WIRUXVHRQ3HVDFK$VLQDOO
VXFK+DODFKLFTXHVWLRQVDFRPSHWHQW5DYVKRXOG
EHFRQVXOWHG
1RWH/DFWDLGGURSVPD\FRQWDLQchometz
7KHUHIRUHWKH\VKRXOGEHDGGHGWRPLONEHIRUH
Pesach to have the chometzDQQXOOHGLQVL[W\WLPHV
5
WKHDPRXQWRIPLONDSSOHVDXFHHWF
CONSUMPTION OF CHOMETZ
6LQFHWKHSURKLELWLRQRIHDWLQJ&KRPHW]RQ
Pesach applies not only to chomet]LWVHOIEXWWR
DQ\GHULYDWLYHVRIchometzRUWRDQ\SURGXFWWKDW
may contain chometzRQHVKRXOGPDNHFHUWDLQ
WKDWDOOIRRGSURGXFWVWKDWDUHERXJKWIRU3HVDFK
VKRXOGKDYHDFHUWL¿FDWLRQE\DUHOLDEOH.DVKUXV
RUJDQL]DWLRQRU2UWKRGR[5DEEL
HANA’AH (BENEFIT) FROM CHOMETZ
DXULQJ3HVDFKZHPD\QRWGHULYHDQ\VRUWRI
EHQH¿WIURP&KRPHW]7KHUHIRUH&KRPHW]PD\
QRWEHVROGRUXVHGHYHQLQEXVLQHVVWUDQVDFWLRQV
RUDVSHWIRRG(YHQVRPHFRVPHWLFVPXVWEH
&KRPHW]IUHH*HQHUDOO\WKHUHLVQRSUREOHPZLWK
WKHIROORZLQJSURGXFWVLIWKH\DUHQRWRUJDQLFLQ
QDWXUHDQGGRQRWFRQWDLQDQ\JUDLQE\SURGXFWV
$FQH$LG0LQHUDO2LO%DE\&UHDP%DE\2LO(\H
/LQHU0DVFDUD5RXJH3RZGHU1DLO3ROLVK7DOFXP
3RZGHU6WLFN3RZGHU'HRGRUDQWDQG9DVHOLQH
MECHIRAS (SELLING OF) CHOMETZ
Mechiras chometzLVWKHVDOHRI-HZLVKRZQHG
FKRPHW]WRDQRQ-HZEHIRUH3HVDFK2QHPXVW
sell chometzZKLFKLVLQWKHLUUHJXODUKRPHYDFDWLRQ
KRPHRI¿FHHWF7KLVWUDQVIHURIchometz to a
QRQ-HZLVDOHJDODQGELQGLQJVDOHFRPSOHWHZLWK
FRQWUDFW7KLVVDOHLVWUDQVDFWHGWKURXJKD5DEEL
ZKRDFWVDVDOHJDODJHQWWRVHOOWKH-HZ¶Vchometz
WRDQRQ-HZ7KH5DEELHQWHUVLQWRDQDJUHHPHQW
ZLWKWKHQRQ-HZIRUWKHVDOHRIWKLVchometz7KH
chometzWKDWKDVEHHQVROGPXVWEHSODFHGLQ
DQDUHDZKLFKLVFRPSOHWHO\VHDOHGRIIDQGPXVW
UHPDLQWKHUHWKURXJKRXWWKHKROLGD\RI3HVDFK2QH
PXVWEHFDUHIXOWRLQIRUPWKH5DEELLIWKH\LQWHQG
WREHLQDGLIIHUHQWWLPH]RQHIRU3HVDFK7KH\GR
QRWZDQWWRKDYHWKHLU chometzERXJKWEDFNLILWLV
VWLOO3HVDFKZKHUHWKH\DUHLHRYHUVHDVHWF,I
RQHOHDYHVKRPHZLWKLQGD\VRI3HVDFKDQGZLOO
QRWUHWXUQEHIRUH3HVDFKWKH\VKRXOGHLWKHUFKHFN
for chometz the night before they leave or appoint
VRPHRQHWRFKHFNIRUWKHPRQWKHUHJXODUQLJKWRI
B’dikas Chometz,IWKHFKHFNLQJLVGRQHEHIRUHWKH
bdikahQLJKWRQHGRHVQRWVD\Dbracha$SHUVRQ
can sell all the chometz in their home before leaving
DQGFKHFNRQO\RQHURRPIRUchometz5HJDUGOHVV
DSHUVRQQHHGVWRVD\WKHBittulDQQXOPHQWRI
chometzDWLWVUHJXODUWLPHRI(UHY3HVDFK
CHOMETZ SHE’AVAR ALAV HAPESACH
(BUYING CHOMETZ AFTER PESACH)
DXHWRWKHVHYHULW\RIWKH³Issur´SURKLELWLRQRI
chometz&KD]DOUHLQIRUFHGWKHVDOHRIchometzZLWK
D¿QH7KLV¿QHZDVOHYLHGRQDQ\-HZVZKRNHSW
chometzLQWKHLUSRVVHVVLRQRURZQHUVKLSGXULQJ
3HVDFK7KLVLVFDOOHG³Chometz She’avar Alav
HaPesach´-HZLVKODZUHTXLUHVWKDWLID-HZRZQV
chometzRQ3HVDFKQR-HZLVDOORZHGWRHDWWKDW
IRRGHYHQDIWHU3HVDFK7KHUHIRUHZHDUHDOVR
SURKLELWHGIURPEX\LQJIURPVWRUHVZKLFKDUH-HZLVK
RZQHGLIWKH\KDYHQRWVROGWKHLU&KRPHW]
5DY0RVKH)HLQVWHLQ=7´/LQKLVsefer ,JURV
6
Kosher Food Internet
Sites
Kosher Newsletters &
Kashrus Information
Hotlines
.RVKHU)RRG
,QWHUQHW6LWHV
ZZZNRVKHUTXHVWRUJHPDLOHHLGOLW]#
NRVKHUTXHVWRUJ
0($/6)2575$9(/,1*KRWHOV
FUXLVHOLQHVGHOLYHU\
ZZZ.RVKHUÀ\DZD\FRP
ZZZ.RVKHUFRUQXFRSLDFRP
ZZZNRVKHUFRP
ZZZNRVKHUJRXUPHWPDUWFRP
ZZZNRVKHUPDQLDFRP
ZZZ\LGZRUOGFRP
ZZZODEULXWPHDOVFRP
.RVKHURQ:KHHOV
5&&.HKLOOD
&KR6HQ,VODQG
9DDGRI)LYH7RZQV&KDSD1RVK
9DDGRI)LYH7RZQV7KH-HZLVK'LDEH
WHV$VVQ
7HO,VUDHO
ZZZMHZLVKGLDEHWHVRUJ
ZZZNRVKHUFOXEFRP
ZZZNRVKHUPDUWFRP
ZZZNRVKHUGHSRWEL]
ZZZNRVKHUVWDUEXFNVFRP
Sweet Events
by Candie
:HGGLQJ3DUW\3ODQQLQJ
)XOOVXSSRUWWKHGD\RIHYHQW
EHIRUH
Candie Schwartz
3KRQH
&HOO
)D[
Kosher Newsletters &
Kashrus Information Hotlines
.DVKUXV&RQVFLHQFH.RVKHU,QIRUPDWLRQ%XUHDX
5DEEL((LGOLW]5DEELQLF$GPLQLVWUDWRU
32%R[6KHUPDQ2DNV&DOLIRUQLD
+RWOLQH)D[
(PDLOHHLGOLW]#NRVKHUTXHVWRUJ
:HEVLWHKWWSZZZNRVKHUTXHVWRUJ
3XEOLFDWLRQV.DVKUXV&RQVFLHQFH0DJD]LQH
(PDLOXSGDWHVDQGDOHUWV
ZZZNDVKUXWFRP$UOHQH-0DWKHV6FKDUI
3KRQH)D[
(PDLODMPV#NDVKUXWFRP85/³KWWSZZZNDVKUXWFRP´
)RRG6FLHQWLVW.RVKHU)RRG6SHFLDOLVW6FKDUI$VVRFLDWHV
32%R[6KDURQ0$
9D¶DG+D5DEDQLPRI*UHDWHU6HDWWOH
6RXWK'DZVRQ6W6HDWWOH:$
3KRQH)D[
(PDLO5DEELDEN#VHDWWOHYDDGRUJZZZVHDWWOHYDDGRUJ
3XEOLFDWLRQV4XDUWHUO\3URGXFW*XLGH$QQXDO3HVDFK*XLGH
9DDG+D.DVKUXVRI%DOWLPRUH6WDU.
5DEEL0RVKH+HLQHPDQQ5DEELQLF$GYLVRU
:DUUHQ5RDG3LNHVYLOOH0DU\ODQG
3XEOLFDWLRQ.DVKUXV.XUUHQWV3HVDFK*XLGH
.DVKUXV0DJD]LQH5DEEL<RVHI:LNOHU5DEELQLF$GPLQLVWUDWRU
3%R[%URRNO\Q1HZ<RUN
NDVKUXV#DROFRP
5DEELQLFDO&RXQFLORI&DOLIRUQLD7KH5&&
:LOVKLUH%OYG/RV$QJHOHV&$
)D[
LQIR#UFFYDDGRUJZZZUFFYDDGRUJ
7KH2./DE7UR\$YHQXH%URRNO\Q1HZ<RUN
5DEEL'RQ<RHO/HY\
7KH-HZLVK'LDEHWHV$VVRFLDWLRQ
1HZ<RUN2I¿FH(DVWWK6W%URRNO\Q1
7HO,VUDHO
(PDLO-HZLVKGLDEHWHV#DROFRP
/RQGRQ%HLV'LQ+RWOLQH
ZZZNRVKHURUJXN*HQHUDO(QTXLULHV
7KH.RVKHU*UDP9DDG+DUDERQLPRI*UHDWHU'HWURLW0HUND]
:HVW7HQ0LOH5RDG6RXWK¿HOG0LFKLJDQ
2UWKRGR[8QLRQ28.RVKHU+RWOLQH3DVVRYHU'LUHFWRU\
WK$YHQXH1HZ<RUN1HZ<RUN
5DEEL0HQDFKHP*HQDFN
ZZZRXNRVKHURUJ
-6256HSKDUGLF/LVW-HUVH\6KRUH2UWKRGR[5DEELQDWH
32%R[(OEHURQ1-
5DEEL,VDDF'ZHN'HDO5DEEL,VDDF)DUKL'HDOZZZMVRURUJ
0HGLFLQHV&RVPHWLFVRI3HVDFKE\5DEEL*HUVKRQ%HVV
.ROOHO/RV$QJHOHV6RXWK)RUPRVD%OYG/RV$QJHOHV
&DOLIRUQLDOHDYHQDPHDQGDGGUHVVRQ
&KRGRVK+RW/LQH±5DEEL+HUPDQ
7KLVLVVXHLVGHGLFDWHGLQWKHQDPHRI
+D5DY$YUDKDP'DQLHO0RUGHFKDL
EHQ0LULDP6DUD)HJD%DW<HWD5LINDK
0D\+DVKHPJUDQWWKHPDUHIXDKVKOHPDKLQWKH
]FKXVRIWKHLUEHLQJDFRQVWDQWRVHNE¶W]RUFKDLW]LEXU
CHOMETZ SHE’AVAR ALAV HAPESACH
(BUYING CHOMETZ AFTER PESACH),
KASHERING (MAKING UTENSILS KOSHER)
0RVKHVWDWHVWKDWLID-HZVROGKLVchometz for
3HVDFKDQGWKHQNHSWKLVVWRUHRSHQGXULQJ3HVDFK
DQGFRQWLQXHGWRVHOOLWHPVRIchometz, one is
QHYHUWKHOHVVDOORZHGWREX\IURPWKDWVWRUHDIWHU
3HVDFK
(OHYHQ$OEHUWVRQV&DPEULGJH)DUPV&RIIHH
%HDQ&RVWFR&96*HOVRQ¶V-RQ¶V.0DUW/RQJV
3HWFR3HWVPDUW5DOSKV.URJHU5LWH$LG&96
6DIHZD\6DP¶V&OXE6PLWK¶V7DUJHW7UDGHU-RH¶V
9RQV3DYLOLRQV:DOJUHHQV:DOPDUWDQG:KROH
)RRGVDUH¿QHWRXVHDIWHU3HVDFK5HOLDEO\FHUWL¿HG
Kosher stores all sell their chometzEHIRUH3HVDFK
1RWH5DEEL(OPDOLDFKWKH5DEELLQFKDUJHRI
.DVKUXVDW%HQ*XULRQDLUSRUWUHSRUWVWKDWWKH
VWRUHVDWDUHD'LQWKHDLUSRUWDUHFOHDURI chometz
6KH¶DYDU2ODY+DSHVDFK7KHRWKHUVWRUHVLQRWKHU
DUHDVRIWKHDLUSRUWKDGWKHLU&KRPHW]VROGEXW
ZHUHRSHQRQ3HVDFKDQGFRQWLQXHGWRVHOO chometz
GXULQJ3HVDFK6RPHSRVNLPDOORZSXUFKDVHVIURP
VXFKHVWDEOLVKPHQWVZKLOHVRPHGRQRW
99centVWRUHVDUH-HZLVKRZQHGDQGSUREOHPDWLF
DIWHU3HVDFKXQOHVVVROG6HH$.2ZKLVNH\DOHUW`
KASHERING (MAKING UTENSILS KOSHER)
8WHQVLOVWKDWDUHXVHGGXULQJWKH\HDUIRUchometz
PD\QRWEHXVHGWRSUHSDUHIRRGIRU3HVDFKXQOHVV
WKH\DUHSURSHUO\.DVKHUHG
Cloth tableclothsQRWSODVWLFDQGWRZHOVXVHG\HDU
URXQGVKRXOGEHZDVKHGWKRURXJKO\DQGPD\WKHQ
EHXVHGIRU3HVDFK
6XUIDFHVXSRQZKLFKRQO\FROGchometz has been
SODFHGGXULQJWKH\HDUVXFKDVrefrigeratorsDQG
SDQWU\VKHOYHVVKRXOGEHWKRURXJKO\ZDVKHGDQG
ULQVHGWRSUHSDUHWKHPIRU3HVDFKXVH6XUIDFHV
ZKLFKDUHXVHGIRUKRWchometz GXULQJWKH\HDULQ
DGGLWLRQZKHQHYHUSRVVLEOHPXVWEH.DVKHUHGE\
SRXULQJKRWZDWHURQWKHP6XUIDFHVWKDWFDQQRWEH
.DVKHUHGVXFKDV)RUPLFDDQG&HUDPLF7LOHVHWF
VKRXOG¿UVWEHFOHDQHGWKRURXJKO\DQGWKHQFRYHUHG
ZLWKQRQDEVRUEHQWPDWHULDOLHFRQWDFWSDSHU
FDUGERDUGRUPXOWLSOHOD\HUVRIDOXPLQXPIRLO
7KHGLIIHUHQWOHYHOVRI.DVKHULQJDUHLibbun
Gomur±WRUFKLQJRUPDNLQJWKHPHWDOJORZLibun
Kal±KHDWLQJWKHPHWDOWLOOLWFDQEXUQSDSHURQWKH
RWKHUVLGHHagolo ±GLSSLQJLQERLOLQJZDWHUEruy
Roschim±SRXULQJERLOLQJZDWHU7KHJHQHUDOUXOH
LVWKDWZHXQGRDVZHGLG,IVRPHWKLQJXVHVVWUDLJKW
GU\KHDWLHEETZHQHHGWRWRUFKLWRUXVHVHOI
FOHDQLQDQRYHQZKLFKLVWKHVDPH6RXSSRWVDUH
XVHGZLWKOLTXLGVRWKH\DUHNDVKHUHGZLWKOLTXLGLQ
ERLOLQJZDWHUHWF
7R.DVKHUDQelectric range¿UVWVFRXULW
WKRURXJKO\7KHQWXUQLWRQWRWKHKLJKHVW
WHPSHUDWXUHVHWWLQJIRUPLQXWHVRUXQWLOLWJHWV
UHGKRW(QDPHOJOD]HGVWRYHWRSVVKRXOGEH
FRYHUHGGXULQJ3HVDFKGas gratesVKRXOGEHSXW
LQWKHRYHQIRU.DVKHULQJRUWRUFKHGGlass-top
stovesFDQEH.DVKHUHGLQWKHDUHDRIWKHEXUQHUV
7KH\VKRXOGEHWXUQHGWRKLJKIRUPLQXWHV7KH
DUHDVLQEHWZHHQFDQQRWEH.DVKHUHG6RPH¿QGLW
SUDFWLFDOWRFKDQJHWKHHQWLUHJODVVWRSIRU3HVDFK
7
$non self-cleaning ovenVKRXOGEHFOHDQHGZLWK
DVSHFLDOVROXWLRQVXFKDV³(DV\2II´DQGQRWXVHG
IRUKRXUV$IWHUWKLVWLPHLWVKRXOGEHWXUQHG
RQWRWKHPD[LPXPVHWWLQJIRURQHKRXU7KLVZLOO
.DVKHUWKHRYHQEXWQRWWKHEURLOHU7KHEURLOHU
SDQFDQQRWEH.DVKHUHGWKHUHIRUHLWLVXVXDOO\
QRWXVHGIRU3HVDFK,IWKHEURLOHUSDQLVUHSODFHG
WKHEURLOHUFDQEH.DVKHUHGLQDVLPLODUIDVKLRQ
DVWKHRYHQ,IRQHGHVLUHVWR.DVKHULW³Libbun”
JORZLQJKRWLVUHTXLUHGLHE\XVLQJDWRUFK$
self cleaning ovenQHHGVRQO\WRJRWKUXRQHVHOI
FOHDQF\FOH0DQ\microwave ovensWKRVHZKRVH
ZDOOVGRQRWH[FHHGGHJUHHVGXULQJFRRNLQJ
ZLWKRXWEURZQLQJHOHPHQWVRUFRQYHFWLRQFDQEH
.DVKHUHGE\¿UVWFOHDQLQJWKHPDQGQRWXVLQJWKHP
IRUKRXUVDQGWKHQSXWWLQJDQHZJODVVWUD\RU
FDUGERDUGRQWKHERWWRP$IWHUZDUGVDFXSRUERZO
RIZDWHUVKRXOGEHERLOHGLQVLGH$barbecue must
EH.DVKHUHGZLWK³Libun Gamur´ZKLFKLQFOXGHV
WRUFKLQJDQ\VXUIDFHWKDWIRRGFRPHVLQFRQWDFWZLWK
LQDGGLWLRQWRFOHDQLQJDQGEXUQLQJRXWWKHUHVWRIWKH
EDUEHFXH,QDGGLWLRQWKHFRDOVRUODYDURFNVKRXOG
EHUHSODFHG2IWHQLWLVPRUHSUDFWLFDOWRSXUFKDVHD
QHZRQHIRU3HVDFK
$stainless steel sinkLV.DVKHUHGDIWHULWKDV¿UVW
EHHQFOHDQHGDQGWKHQNHSWIUHHIURPKRWZDWHU
XVDJHIRUKRXUV7KHQERLOLQJZDWHUPXVWEH
SRXUHGRYHULWVHQWLUHVXUIDFH3RUFHODLQVLQNV
KRZHYHUPD\QRWEH.DVKHUHG7KH\VKRXOGEHIXOO\
OLQHGZLWKDWLQLQVHUWFRQWDFWSDSHUDOXPLQXPIRLO
RUD3HVDFKEDVLQLQVHUW
DishwashersPD\EH.DVKHUHGRQO\LIWKH\KDYHD
VWDLQOHVVVWHHOLQWHULRU$OOUDFNVPXVWEHFKDQJHG
$IWHUZDLWLQJKRXUVUXQDFRPSOHWHF\FOHZLWK
VRDS$OOUXEEHURUSODVWLFSDUWVPXVWEHUHSODFHG
DVZHOO
Metal utensilsWKDWDUHXVHGZLWKOLTXLGVRXSSRWV
HWFPD\EH.DVKHUHGE\¿UVWFOHDQLQJWKHPQRW
XVLQJWKHPIRUKRXUVDQG¿QDOO\FRPSOHWHO\
LPPHUVLQJWKHPLQD.DVKHUHGSRWIXOORIERLOLQJ
ZDWHUIRUVHFRQGVIROORZHGE\ULQVLQJWKHPLQ
FROGZDWHULPPHGLDWHO\XSRQUHPRYDO7KH\VKRXOG
EH.DVKHUHGRQHDWDWLPH$QDOWHUQDWHPHWKRG
SDUWLFXODUO\XVHIXOIRUODUJHUSRWVLVWRVHWDVLGHWKH
SRWIRUKRXUVDIWHUZKLFKWLPHLWVKRXOGEH¿OOHG
ZLWKZDWHUDQGWKHQEHEURXJKWWRDERLO$JORZLQJ
KRWLWHPVXFKDVDURFNVKRXOGWKHQEHSODFHG
LQVLGHDOORZLQJWKHKRWZDWHUWRVSLOORYHUWKHVLGHV
BracesELWHSODWHVDQGUHWDLQHUVVKRXOGEHEUXVKHG
WKRURXJKO\EHIRUH3HVDFK
Counter tops)RUPLFDFRXQWHUWRSVPD\QRWEH
.DVKHUHGIRU3HVDFKDQGWKHUHIRUHWKH\VKRXOGEH
FRYHUHG
*UDQLWH0DUEOHRU6WDLQOHVV6WHHOFRXQWHUWRSV
PD\EH.DVKHUHGE\SRXULQJERLOLQJKRWZDWHUQRW
VWHDPRQWKHP(LUXL
&DHVDUVWRQHFRXQWHUWRSVPD\QRWEH.DVKHUHGIRU
3HVDFKDFFRUGLQJWRPDQ\RSLQLRQVDVWKH\DUH
FRPSRVHGRIRQO\SHUFHQWVWRQH,QDGGLWLRQ
6LOHVWRQHDQG&RULDQDOVRPD\QRWEH.DVKHUHG
8
KASHERING (MAKING UTENSILS KOSHER), EREV PESACH,
EATING ON EREV PESACH, SELECTED LAWS & CUSTOMS, THE
SEDER PLATE, THE ARBA KOSOS (FOUR CUPS OF WINE), MATZO
1RWHSteam cleanersRIWHQPD\QRWEHXVHGIRU
.DVKHULQJSXUSRVHVDV.DVKHULQJPXVWEHGRQH
ZLWKERLOLQJZDWHU
:DWHU¿OWHU±FKDQJHWKH¿OWHU
.LWFKHQ,WHPV7KDWPD\QRW%H.DVKHUHG0L[HUV
&RUHOOH$UFRODF%UHDG0DFKLQH&ROODQGHUSODVWLF
&URFNSRW&KLQD&RUQLQJ:DUH*UDWHUDQ\
.QLYHVZLWK3ODVWLF+DQGOHV0HOPDF3DVWD0DNHU
3ODVWLF3RUFHODLQ3RUFHODLQ(QDPHOHG3RWV3\UH[
6DQGZLFK0DNHU6LOYHUVWRQH6WRQHZDUH6\QWKHWLF
5XEEHU7HÀRQ7RDVWHU7RDVWHU2YHQ:DIÀH,URQ
7KHVHLWHPVVKRXOGEHZDVKHGWKRURXJKO\DQGEH
SXWDZD\LQDFRPSOHWHO\VHDOHGRIIDUHDXQWLODIWHU
3HVDFK
EREV PESACH
Bedikas Chometz7KHVHDUFKEHJLQV6XQGD\
QLJKW0DQ\KDYHWKH0LQKDJWRSODFHWHQ
SLHFHVRIEUHDGRXWEHIRUHWKHVHDUFKLVVWDUWHG
Fast of the First Born: 7KLV\HDUWKLVIDVWIDOOVRQ
0RQGD\
Siyum:0DOHVZKRDUH¿UVWERUQDQGGRQRWZLVK
WRIDVWRQ0RQGD\VKRXOGDWWHQGD6L\XPLQWKH
PRUQLQJDQGHDWDWWKHPHDOIROORZLQJLW7KLVPHDOLV
FDOOHGDSeudas Mitzvah
Biur Chometz:7KHEXUQLQJRIWKHchometz left in
RQH¶VSRVVHVVLRQLQFOXGLQJWKHchometzIRXQGWKH
SUHYLRXVQLJKWPXVWEHEXUQHGE\WKHHQGRIWKH¿IWK
KRXURQ0RQGD\PRUQLQJ3OHDVHVHHWLPH
FKDUWIRUWKHH[DFWODWHVWWLPH
Selling of the Chometz: 7KLVPXVWEHGRQHE\
0RQGD\PRUQLQJQRODWHUWKDQWKHWLPHRIBiur
Chometz
EATING ON EREV PESACH
CRQVXPSWLRQRI&KRPHW]LVSURKLELWHGRQ(UHY
3HVDFKIURPDWKLUGRIWKHGD\DQGDIWHUWKLV
LVXVXDOO\FRXQWHGIRXUSURSRUWLRQDOKRXUVIURP
GD\EUHDNVHHWLPHVWRUHPHPEHU,WLVDOVR
IRUELGGHQWRHDW0DW]RRUDQ\WKLQJEDNHGZLWK
0DW]RRQ(UHY3HVDFK7KLVSURKLELWLRQLQFOXGHV
HJJ0DW]RK7KLVLVLQRUGHUWRHQVXUHWKDWRQHZLOO
HDWWKH0DW]RDWWKH6HGHUZLWKD³KHDUW\DSSHWLWH´
7KLVSURKLELWLRQLQFOXGHVFDNHVDQGFRRNLHVPDGH
IURPPDW]RPHDO+RZHYHUFRRNHG0DW]RSURGXFWV
VXFKDVNQDLGODFK0DW]REDOOVDUHSHUPLWWHG1RQ
*HEURFKWVSURGXFWVDUHVXLWDEOHIRUWKLVWLPHSHULRG
$OOIRRGVVKRXOGRQO\EHHDWHQLQPRGHUDWLRQIURP
WKHQLQWKKRXULQWKHGD\DQGRQLQRUGHUWRKDYH
DQDSSHWLWHIRUWKH6HGHU,PLWDWLRQ0DW]RPDGH
IURP7DSLRFDDQG3RWDWRLQJUHGLHQWVLV¿QHIRU(UHY
3HVDFK
SELECTED LAWS & CUSTOMS
OQHVKRXOGSUHSDUHHYHU\WKLQJIRUWKH¿UVW6HGHU
RQ(UHY3HVDFKLQRUGHUWKDWWKH6HGHUVKRXOGEHJLQ
LPPHGLDWHO\XSRQDUULYLQJIURP6KXO7KLVLQFOXGHV
VHWWLQJWKHWDEOHHWF,WLVDFXVWRPWKDWSLOORZV
VKRXOGEHSUHSDUHGIRUOHDQLQJRQGXULQJWKH6HGHU
:RPHQDUHQRWUHTXLUHGWROHDQKRZHYHUPDOH
FKLOGUHQDUH,WLVDOVRDFXVWRPDPRQJVRPHWKDW
WKHKHDGRIWKHKRXVHKROGZHDUVD.LWWHOGXULQJWKH
6HGHU,QPRVWSODFHVWKHFXVWRPLVWKDWRQO\WKH
KHDGRIWKHKRXVHKROGKDVD6HGHUSODWHDQGWKH
WKUHH0DW]RV6RPHKRZHYHUKDYHD6HGHUSODWH
DQG0DW]RVIRUHDFKPDQSUHVHQWDWWKH6HGHU
:KHQRQO\WKHKHDGRIWKHKRXVHKROGKDVD6HGHU
SODWHKHPXVWSURYLGHIRUHYHU\RQHDWWKH6HGHU
IURPKLVSODWH6LQFHWKHUHLVXVXDOO\QRWDVXI¿FLHQW
amount of Matzo, MarrorDQGZLQHWRHQVXUHWKDW
HYHU\RQHSUHVHQWPDOHDQGIHPDOHDOLNHKDV
WKHUHTXLUHGDPRXQWVGXULQJWKH6HGHUDGGLWLRQDO
Matzo, MarrorDQGZLQHVKRXOGEHSODFHGRQWKH
WDEOHIRUVXSSOHPHQWDU\XVH
THE SEDER PLATE
2QHPD\QRWXVHMARRORWRIXO¿OOWKH0LW]YDK
RI0DUURUWKDWZDVVRDNHGIRUKRXUVRU
ORQJHU6RDNLQJWKLVORQJLVFDOOHGSLFNOLQJDQGLV
+DODFKLFDOO\FRQVLGHUHGFRRNLQJ2QHPD\RQO\XVH
XQFRRNHGYHJHWDEOHVIRU0DUURU'RQRWOHDQZKHQ
HDWLQJPDUURU
CHAROSESFDQEHPDGHRIJURXQGDSSOHVSHDUV
SRPHJUDQDWHVGDWHV¿JVZDOQXWVDOPRQGVJLQJHU
DQGFLQQDPRQWRZKLFKZLQHLVDGGHG5HFLSHVPD\
YDU\DFFRUGLQJWRWUDGLWLRQ
KARPASLVDQ\YHJHWDEOHXSRQZKLFKDBrocho
RI³HaAdama”LVPDGHWKDWPD\EHGLSSHGLQVDOW
ZDWHURUYLQHJDUDQGWKDWPD\EHXVHGRQ3HVDFK
3DUVOH\FHOHU\DQGSRWDWRHVDUHRIWHQXVHGDV
.DUSDV
ZROA LVDSLHFHRIPHDWZKLFKLVURDVWHGRYHUWKH
¿UH0RVWSHRSOHXVHDFKLFNHQQHFNRUZLQJIRUWKLV
SXUSRVH
BAITZA iVDQRUGLQDU\KDUGERLOHGRUURDVWHGHJJ
,IRQHIRUJRWWRURDVWWKHZroa or Baitza on Erev
3HVDFKDQGKDGWRGRLWDWQLJKWKHPXVWHDWWKH
HJJEHIRUHVXQVHWRIWKHQH[WGD\
THE ARBA KOSOS (FOUR CUPS OF WINE)
IWLVSUHIHUDEOHWKDWWKHZLQHXVHGDWWKH6HGHU
EHUHGLQFRORU)RUWKRVHZKRFDQQRWGULQNZLQH
JUDSHMXLFHPD\EHXVHGFRQVXOW\RXU5DEEL
1HYHUWKHOHVVRQHVKRXOGPDNHHYHU\HIIRUWWR
GULQNZLQHDWWKH6HGHU,WLVSUHIHUDEOHWRDGGDW
OHDVWVRPHZLQHWRWKHJUDSHMXLFH(DFKFXSRI
ZLQHVKRXOGFRQWDLQDWOHDVWÀXLGRXQFHV,WLV
SUHIHUDEOHWRGULQNWKHHQWLUHFXSRUDWOHDVWKDOIRI
LWIRUHDFKRIWKHIRXUFXSV0HQPXVWFRQVXPHDOO
FXSVRIZLQHZKLOHUHFOLQLQJRQWKHLUOHIWVLGH,IRQH
GUDQNHLWKHURIWKH¿UVWWZRFXSVZLWKRXWUHFOLQLQJ
KHPXVWGULQNDJDLQZLWKRXWDBrocho1RWH0DQ\
.RVKHUZLQHVDQGVRPHEUDQGVRIJUDSHMXLFH
LQWKHR]ERWWOHVDUHQRWFRRNHG0HYXVKDO
7KHUHIRUHFDUHPXVWEHWDNHQDVWRZKRKDQGOHV
WKHP0RVWERWWOHVWKDWDUHFRRNHGVD\³Mevushal”
LQ(QJOLVKRU+HEUHZRQWKHODEHO1RWH0DQ\ORZ
DOFRKROZLQHVDUHQRZDYDLODEOH6RPHDUHSXUH
ZLQHZKLOHRWKHUVDUHDPL[WXUHRIZLQHDQGJUDSH
MXLFHDVLQGLFDWHG
MATZO
Only Shmurah MatzoJXDUGHG0DW]RZKLFK
LVPDGHRIJUDLQWKDWKDVEHHQJXDUGHGDJDLQVW
IHUPHQWDWLRQIURPWKHWLPHRIKDUYHVWVKRXOGEH
XVHGIRUWKHMitzvaRIHDWLQJ0DW]RDWWKH6HGHU
MATZO, MEDICINE, TOILETRIES, FROZEN
VEGETABLES, FRESH VEGETABLES
%RWKKDQGDQGPDFKLQHShmurah Matzo are
DFFHSWDEOH2YHUWKHSDVWPDQ\GHFDGHVWKHUH
have been many opinions given as to the merits of
KDQGYHUVXVPDFKLQH0DW]RK0RVWXVHHLWKHURQH
ZLWKSURSHUHashgocho. Shmurah Matzo has been
ZDWFKHGLQPRVWFDVHVIURPWKHWLPHRIFXWWLQJRI
WKHZKHDWWRSURWHFWIURPXQZDQWHGPRLVWXUHZKLFK
PD\PDNHLWULVH(LJKWHHQPLQXWH0DW]RLVUXQ
RQPDFKLQHVWKDWDUHFOHDQHGHYHU\PLQXWHVWR
SUHYHQWDQ\SRVVLELOLW\RIWKHGRXJKULVLQJ5HJXODU
3HVDFK0DW]RKDVEHHQEDNHGRQDPDFKLQHLQ
XQGHUPLQXWHVEXWWKHPDFKLQHZLOOUXQDOOGD\
ZLWKRXWFOHDQLQJLQEHWZHHQUXQV. Matzo Ashira is
DQ\0DW]RWKDWFRQWDLQVSURGXFWVRWKHUWKDQÀRXU
DQGZDWHUVXFKDVJUDSHMXLFHRUDSSOHMXLFH7KH
consumption of Matzo AshiraLVSURKLELWHGIRUPRVW
SHRSOHWKURXJKRXW3HVDFK,QFOXGHGLQWKLVFDWHJRU\
DUH0DW]RZKLFKZDVNQHDGHGZLWKIUXLWMXLFHHJJ
PDW]RWHDPDW]RKRQH\DQGVSLFH0DW]RDQGVRPH
FKRFRODWHFRYHUHG0DW]R+RZHYHUWKLVSURKLELWLRQ
GRHVQRWDSSO\WRLQIDQWVRUSHRSOHZKRDUHLOO:KHQ
LQGRXEWFRQVXOW\RXU5DEEL
(YHQRQHZKRLVDOORZHGWRHDWMatzo AshiraFDQQRW
IXO¿OOWKHLU0LW]YDKRIAchilas MatzoHDWLQJ0DW]R
ZLWKLW)RUSHRSOHDOOHUJLFWRZKHDW2DW6KPXUD
0DW]RLVDYDLODEOHE\FDOOLQJ
RU7R
RUGHU6SHOW0DW]RFDOO2UJDQLF
+DQG6KPXUDK±/DNHZRRG0DW]RKFRP*OXWHQ
)UHH2DW0DW]RVIURP(QJODQGPD\EHRUGHUHG
E\FDOOLQJ,QDGGLWLRQIRUPRUH
LQIRUPDWLRQDERXW2DW0DW]RVRQHPD\ORRNRQWKH
ZHEVLWHZZZ*OXWHQIUHHRDWPDW]RVFRP
MEDICINE
MRVWSUHVFULSWLRQVFDQEH¿OOHGZLWK.RVKHUIRU
3HVDFKPHGLFLQH)RULQIRUPDWLRQRQWKH.RVKHU
VWDWXVRI\RXUPHGLFLQHVFRQWDFWWKH.RVKHU
,QIRUPDWLRQ%XUHDXDW(PDLOWR
HHLGOLW]#NRVKHUTXHVWRUJRU\RXUORFDOUHOLDEOH
5DEEL,Q,VUDHO
5DEEL%HVVRI/RV$QJHOHVKDVFRPSLOHGWKH
PRVWGHWDLOHGUHOLDEOHOLVWLQWKH86+HFDQEH
UHDFKHGDW5DEEL%HVVWRJHWKHU
ZLWKWKH6WDU.SXEOLVKHVWKH3DVVRYHU'LUHFWRU\
ZLWKWKLVLQIRUPDWLRQ6LQFHVRPHSUHVFULSWLRQV
XQIRUWXQDWHO\DUHQRWDYDLODEOHZLWK.RVKHU
FHUWL¿FDWLRQZHZLOOPHQWLRQVRPHJXLGHOLQHVIRU
WKRVHZKRPXVWWDNHPHGLFLQHRQ3HVDFK
,IRQHVXIIHUVIURPDQLOOQHVVWKURXJKZKLFKRQH¶V
OLIHPD\EHFRPHHQGDQJHUHGRQHPD\HDWchometz
RQ3HVDFKDQGPD\XVHDQ\PHGLFDWLRQQHHGHG
WRDYRLGDOLIHWKUHDWHQLQJVLWXDWLRQ7KLVchometz
VKRXOGEHRZQHGE\DQRQ-HZ
,IVRPHRQHLVLOOEXWKLVOLIHLVQRWHQGDQJHUHGKH
may not eat chometz RQ3HVDFK+RZHYHUKHPD\
WDNHchometzPHGLFLQHXQGHUFHUWDLQFLUFXPVWDQFHV
DVORQJDVKHGRHVQRWWDNHLWLQWKHQRUPDOZD\
LHDSLOOZLWKRXWDFXSRIZDWHU$5DEELVKRXOG
EHFRQVXOWHGLIWKHQHHGIRUVXFKPHGLFDWLRQVKRXOG
RFFXU
9
*HQHUDOO\VSHDNLQJFRXJKV\UXSVDQGRWKHUOLTXLG
PHGLFLQHVPD\FRQWDLQJUDLQDOFRKRODQGPD\QRW
EHXVHGRQ3HVDFK:KHQRQHPXVWWDNHPHGLFLQH
GXULQJ3HVDFKKLVKHUGRFWRUVKRXOGEHDVNHGWR
SUHVFULEHPHGLFLQHZLWKRXWDOFRKRORUFDSVXOHV
0DQ\RYHUWKHFRXQWHUPHGLFLQHVUHTXLUHQRVSHFLDO
FHUWL¿FDWLRQWREHXVHGRQ3HVDFK&RQVXOW\RXU
5DEELIRUVSHFL¿FTXHVWLRQV)RUDFRPSOHWHOLVWLQJ
RIWKLV\HDU¶V.RVKHUIRU3HVDFKYLWDPLQVDVZHOODV
\HDUURXQGYLWDPLQVJRRQOLQHWR
ZZZNRVKHUYLWDPLQVFRP
TOILETRIES
5DEEL%HVVOLVWVWKHIROORZLQJSRVVLEOHLVVXHV
$PLQR3HSWLGH&RPSOH[$PS,VRVWHDUR\O+\GUROL]HG
:KHDW3URWHLQ$YHQD6DWLYD)ORXU$YHQD6DWLYD
.HUQHO3URWHLQ%DUOH\([WUDFW%HWD*OXFDQ
'LVRGLXP:KHDWJHUPLGR3HJ6XOIRVXFFLQDWH
+RUGHXP9XOJDUH([WUDFW+\GURO\]HG:KHDW
*OXWHQ+\GURO\]HG:KHDW3URWHLQ+\GURO\]HG
:KHDW3URWHLQ3J3URS\O6LODQHWULRO+\GURO\]HG
:KHDW6WDUFK+\GUR[\SURS\OWULPRQLXP
+\GUROL]HG:KHDW3URWHLQ2DW%HWD*OXFDQ2DW
([WUDFW2DW)ORXU3K\WRVSKLQJRVLQH([WUDFW
3URODPLQH6RGLXP/DXUR\O2DW$PLQR$FLGV
6WHDU\OGLPRQLXPK\GURV\SURS\O+\GURO\]HG:KHDW
3URWHLQ7ULWLFXP9XOJDUH7ULWLFXP9XOJDUH)ORXU
/LSLGV7ULWLFXP9XOJDUH*HUP([WUDFW7ULWLFXP
9XOJDUH*HUP2LO:KHDW$PLQR$FLGV:KHDW
%UDQ([WUDFW:KHDW*HUP([WUDFW:KHDW*HUP
*O\FHULGHV:KHDW*HUPDQLGRSURS\OGLPRQLXP
+\GUR[\SURS\O+\GURO\]HG:KHDW3URWHLQ:KHDW
*HUP2LO:KHDW3URWHLQ:KHDW6SKLQJROLSLGV
FROZEN VEGETABLES
There are many issues concerning the use of frozen
YHJHWDEOHVIRU3HVDFK0RVWODUJHFRPSDQLHVVXFK
DV6:*UHHQ*LDQWDQG%LUG¶V(\HSXUFKDVHWKHLU
YHJHWDEOHVIURPPDQ\GLIIHUHQWSURFHVVRUV'XHWR
LQFUHDVHGFRPSHWLWLRQLQWKLVLQGXVWU\IURP0H[LFR
DQG*XDWHPDODPDQ\SDFNHUVDUHSURFHVVLQJSDVWD
DQGYHJHWDEOHVLQWKHVDPHEODQFKLQJHTXLSPHQW
ZKHQLWLVQRWEHLQJXVHGIRUSXUHYHJHWDEOHV
7KLVLVGRQHDWWHPSHUDWXUHVEHWZHHQWR
GHJUHHVWKXVPDNLQJWKHPDFKLQHU\+DODFKLFDOO\
XQDFFHSWDEOHIRU3HVDFKXVH+RZHYHUVRPH
FRPSDQLHVXVHVWHDPEODQFKHUVZKLFKDUHQRW
XVDEOHIRUSDVWD%RGHN*DUGHQ3XUHDVZHOODV
RWKHUVFDUU\PDQ\IUR]HQYHJHWDEOHVZKLFKDUH
FHUWL¿HGIRU3HVDFK
FRESH VEGETABLES
IQJHQHUDOIUHVKYHJHWDEOHVGRQRWSRVHDVSHFLDO
FRQFHUQIRU3HVDFK+RZHYHUIUXLWVDQGYHJHWDEOHV
IURP,VUDHOUHTXLUHWKDWTerumosDQGMaasros be
WDNHQ/HDI\YHJHWDEOHVUHTXLUHWKHVDPHOHYHO
RILQVSHFWLRQIRULQVHFWVDVGXULQJWKHUHVWRIWKH
\HDU7KLVLVDSDUWLFXODUFRQFHUQIRUPDQ\ZKRXVH
romaine lettuce for the Mitzvah of Marror7RDYRLG
WKLVSUREOHPVRPHFKRRVHWRXVHURPDLQHVWDONV
RQO\ZKLFKDUHHDVLHUWRULQVHDQGFKHFNIRULQVHFWV
7KHUHDUHURPDLQHOHWWXFH VWDONVDQGRWKHUSURGXFH
FHUWL¿HGIRU3HVDFKWKDWDUHQRWFKHFNHGIRULQVHFWV
10
FRESH FRUIT, SODA, EGGS, MILK,
MILK SUBSTITUTES,
MARSHMALLOWS & GELATINS
2QHQHHGVWRPDNHVXUHWKDWWKH+HFKVFKHUFRYHUV
ERWKWKH3HVDFKDQGLQVHFWLVVXHV
FRESH FRUIT
FUHVKIUXLWIURP,VUDHOLVIRXQGLQPDQ\VXSHUPDUNHWV
DWWKLVWLPHRI\HDUSUHVHQWLQJDQLVVXHRI Terumos
DQGMaasros7KHLVVXHIUHTXHQWO\H[LVWVFRQFHUQLQJ
PDQJRHVWRPDWRHVSHSSHUVDQGRUDQJHV6RPH
MDPVDVZHOODVOHPRQMXLFHKDYHWKHVDPHLVVXH
7KHVHSURGXFWVVWDWH³SURGXFWRI,VUDHO´
SODA
WKHQGHWHUPLQLQJZKHWKHUDW\SHRIVRGD
LV.RVKHUIRU3HVDFKWKHUHDUHWKUHHPDMRU
LQJUHGLHQWVZLWKZKLFKZHDUHFRQFHUQHG7KH\
DUHEURPLQDWHGYHJHWDEOHRLOÀDYRULQJVDQGVXJDU
&RUQV\UXSZKLFKLVPDGHIURP.LWQL\RVLVD
FRPPRQVZHHWHQHULQVRGD7KHRWKHULQJUHGLHQW
³ÀDYRULQJ´LVDOVRDVRXUFHRIFRQFHUQVLQFHWKHUH
DUHWKRXVDQGVRIÀDYRUVPDQ\RIZKLFKDUHQRW
.RVKHUDQGRWKHUVWKDWDUHGHULYHGIURPchometz
7KHUHIRUHHYHQ6HSKDUGLPZKRQRUPDOO\FRQVXPH
KitniyosRQ3HVDFKVKRXOGVHHNRQO\WKRVHSURGXFWV
UHOLDEO\FHUWL¿HGWREHchometzIUHH*HQHUDOO\
VSHDNLQJÀDYRULQJLVWKHNH\WRDSURGXFW¶VVXFFHVV
LQWKHIRRGPDUNHW7KHUHIRUHLWVIRUPXODLVDOZD\V
DKLJKO\JXDUGHGVHFUHWRIWKHFRPSDQ\(YHQD
PLQXVFXOHFKDQJHLQWKHIRUPXODRIDSURGXFWZKHUH
ÀDYRULQJLVFRQFHUQHGFDQSURYHWREHGLVDVWURXV
7KHUHIRUHLWLVQRWVXUSULVLQJWKDWWKHVHFRPSDQLHV
JXDUGWKHLUÀDYRULQJVYHU\FDUHIXOO\PDNLQJLW
QHFHVVDU\WRKDYHD0DVKJLDFKVXSHUYLVLQJ5DEEL
JRWRWKHSODQWWRSHUVRQDOO\FKHFNWKHÀDYRULQJV
EHLQJXVHG,QUHJDUGWR3HVDFKLWLVDOVRLPSRUWDQW
WRQRWHWKDWHYHQZLWKLQWKHVDPHFRPSDQ\&RNH
3HSVLHWFDQ\LQGLYLGXDOERWWOLQJSODQWWKURXJKRXW
the country may choose to use corn syrup as a
VZHHWHQHU)RUWKLVUHDVRQDVZHOOLWLVHVVHQWLDO
WKDWDUHOLDEOH0DVKJLDFKEHRQWKHSUHPLVHVGXULQJ
SURGXFWLRQ7KHUHDUHWKRXVDQGVRIÀDYRULQJVXVHG
E\WKHIRRGLQGXVWU\QRWDOORIZKLFKDUH.RVKHU
OHWDORQHIRU3HVDFK6RPHVXFKDVDPEHUJULV
IURPZKDOHLQWHVWLQHVDQGFLYLWDEVROXWHIURPFDWV
DUHRIFRXUVHQHYHU.RVKHU(YHQLIDQLQGLYLGXDO
NQRZVWKDWDVRGDLVUHOLDEO\FHUWL¿HG.RVKHUIRU
3HVDFKLQRQHSDUWLFXODUFLW\WKLVGRHVQRWPHDQ
WKDWWKHVDPHEUDQGRIVRGDLV.RVKHUHOVHZKHUH
1RWH&RPPRQO\&RNHDQGRWKHUVZLOOEHUHOLDEO\
FHUWL¿HGIRU3HVDFK7KHERWWOHKRZHYHUPD\OLVW
³FRUQV\UXSVXJDU´DVDQLQJUHGLHQW$VORQJDVWKH
SURGXFWEHDUVDUHOLDEOH3HVDFKFHUWL¿FDWLRQWKH
VRGDKDVEHHQUHIRUPXODWHGWRPHHWDOO3HVDFK
FRQFHUQV1RWHCoke is notEHLQJSURGXFHGIRU
3HVDFKLQ&DOLIRUQLDWKLV\HDU
EGGS
IWLVEHVWWREX\HJJVWKDWZHUHODLGEHIRUH3HVDFK
7KLVLVGXHWRWKHIDFWWKDWFKLFNHQVDUHXVXDOO\
JLYHQIHHGZKLFKLVchometz7KHUHIRUHWKHUHLVD
minhag FXVWRPQRWWRHDWHJJVZKLFKZHUHODLGRQ
3HVDFK1RWHHJJVGRQRWUHTXLUHD+HFKVFKHU
MILK
DXHWRWKHPRGHUQSDVWHXUL]LQJSURFHVVHVXVHGLQ
WKHPLONLQGXVWU\PDQ\QXWULHQWVDUHLQDGYHUWHQWO\
UHPRYHG
*RYHUQPHQWDOUHJXODWLRQVGLFWDWHWKDW9LWDPLQ'
DQGLQVRPHFDVHV9LWDPLQ$EHDGGHGWRPLON
EHIRUHLWVVDOH7KHDPRXQWVDGGHGDUHYHU\PLQXWH
,QDVPXFKDV9LWDPLQV$DQG'DUHRIWHQGHULYHG
from chometz or kitniyosDQGVLQFHPL[WXUHVRIHYHQ
small amounts of chometz on Pesach are not “batel”
DQQXOOHGZHPXVWEHFDXWLRXVFRQFHUQLQJPLON
ZKLFKFRQWDLQVWKHVHDGGLWLYHV
$QRWKHUPDWWHURIFRQFHUQLVWKHSURFHVVLQJ
HTXLSPHQW0LONFRPSDQLHVRIWHQSURGXFHFKRFRODWH
PLONRQWKHVDPHHTXLSPHQWWKDWWKH\XVHIRUWKHLU
SODLQ³ZKLWH´PLON7KHFKRFRODWHPLONPD\FRQWDLQ
PDOWZKLFKLVPDGHIURPJUDLQ,QRUGHUWRDYRLG
WKHVHSUREOHPVWZRVWHSVDUHQHFHVVDU\)LUVWLW
LVQHFHVVDU\WRPDNHVXUHWKDWWKHGDLU\FRPSDQ\
ZKRVHPLONZHSXUFKDVHIRU3HVDFKSURFHVVHVRQO\
SODLQ³ZKLWH´PLONDQGQRWFKRFRODWHPLON6HFRQGO\
WKHPLONWKDWZHQHHGIRUDOORI3HVDFKPXVWEH
ERXJKWEHIRUH3HVDFK%\GRLQJVRWKHYLWDPLQVLQ
WKHPLONDUHGHHPHG³batel´DQQXOHGIURPEHIRUH
3HVDFKVLQFHBitul ZRUNVLIWKHPL[WXUHRFFXUV
EHIRUH3HVDFKDQGWKHUHIRUHPD\EHXVHGRQ
3HVDFK:KHQHYHUSRVVLEOHFHUWL¿HG.RVKHUIRU
3DVVRYHUPLONLVSUHIHUDEOH
Milk Substitutes
MDQ\SHRSOHLHLQIDQWVHOGHUO\WKRVHZKRDUH
LOOHWFRIWHQZDUUDQWFRQVXPLQJkitniyos but not
chometz.7KHIROORZLQJSURGXFWVSDUWLDOOLVWDUHIUHH
of actual chometz:
,QIDQW)RUPXOD±$OVR\&96(QID&DUH(QIDPLO
(QIDSUR+HLQ]1XUWXUH,VRPLO0RWKHU¶V&KRLFH
1HVWOH*RRG6WDUW3UR6REHH5LWH$LG6LPLODF
7DUJHW:DOJUHHQV
6R\0LON±(YHU\GD\9DOXHRULJLQDO/LJKWDQG
8QVZHHWHQHG)LW$FWLYH+\9HH0HLMHU1DWXUH¶V
3ODFH1DWXUH¶V3URPLVH2UJDQLF
$OPRQG0LON±(YHU\GD\9DOXH.URJHU0HLMHU
1DWXUH¶V3ODFH5DOSKV7UDGHU-RH¶V
5LFH0LON±2ULJLQDO&OHDUO\2UJDQLF+DUULV7HHWHU
.UDVGDOH2UJDQLF0HLMHU1DWXUH¶V3URPLVH5LFH
'UHDPXQVZHHWHQHG
1RWHDOORIWKHDERYHDUHEHVWLQOLTXLGIRUPDQG
ERXJKWEHIRUH3HVDFK
MARSHMALLOWS & GELATINS
AOWKRXJKPDQ\³.RVKHUIRU3DVVRYHU³PDUVKPDOORZV
DUHSUHVXPDEO\PDGHZLWKRXWchometzLQJUHGLHQWV
QHYHUWKHOHVVWKH\PD\FRQWDLQDQLQJUHGLHQWZKLFK
LVKLJKO\FRQWURYHUVLDOIRU\HDUURXQGXVHQDPHO\
JHODWLQ7KHPDLQVRXUFHVRIJHODWLQDUHFDWWOHDQG
KRJV7KHSURFHVVRIPDNLQJJHODWLQLVDVIROORZV
WKHFROODJHQLQWKHERQHVDQGVNLQVRIWKHDQLPDOV
LVFRQYHUWHGE\VRDNLQJ´[´VWULSVRIKLGHLQ
K\GURFKORULFDFLGXQWLOLWWXUQVLQWRRVVHLQ7KLVLV
WKHQVRDNHGLQOLPHIRUDERXWDPRQWK,WLVWKHQ
ZDVKHGLQVXOIXULFDFLGWRREWDLQWKHJHODWLQ
,Q5DY&KDLP2]HU*URG]HQVNL=7´/VHQWD
UHVSRQVHWRWKH5R\DO*HODWLQ&RPSDQ\FRQFHUQLQJ
WKHPHWKRGVRIREWDLQLQJ.RVKHUJHODWLQIURPQRQ
MARSHMALLOWS &
GELATINS, PET FOOD
.RVKHUKLGHV$GGLWLRQDOO\LQ5DY/D]HU6LOYHU
YHKHPHQWO\RSSRVHGWKHKHFKVKHURQDZHOONQRZQ
JHODWLQSURGXFW,Q5DY0RVKH)HLQVWHLQ=7´/
DQG5DY$DURQ.RWOHU=7´/ERWKRSSRVHGDOOJHODWLQV
WKDWZHUHQRWREWDLQHGIURPD.RVKHUVRXUFH
.RVKHUJHODWLQIURP.RVKHUVODXJKWHUHGDQLPDOV
WHQGVWREHWRRH[SHQVLYHIRUODUJHFRPSDQLHVWR
SURGXFH7KLVLVWKHUHDVRQWKDWWKH282.6WDU
.DQGRWKHUUHOLDEOHFHUWLI\LQJDJHQFLHVLQVLVWXSRQD
JHODWLQVXEVWLWXWHLQSURGXFWVZKLFKZRXOGRWKHUZLVH
QHHGJHODWLQ0DUVKPDOORZVDUHDSULPHH[DPSOH
RIVXFKDSURGXFW6RPHDFFHSWDEOHVXEVWLWXWHVIRU
JHODWLQDUH-DSDQHVHJHODWLQ-DSDQHVHLQVLQJODVV
DJDUDJDU&KLQHVHPRVV,ULVKPRVVFDUUDJHHQDQ
6XUSULVLQJO\WKHUHLVHYHQRQHPDUVKPDOORZSURGXFW
EHLQJVROGZKLFKVWDWHV³.RVKHU%HHI*HODWLQ´
ZKLFKLVSURGXFHGIURPGULHGEHHIERQHVIURP
,QGLDZKLFKZHUHQRW.RVKHUVODXJKWHUHG7KHUH
LVDQHZW\SHRI¿VKJHOWKDWLVSUHVHQWO\EHLQJ
XVHGLQSKDUPDFHXWLFDOVDQGVRPHIRRGSURGXFWV
FHUWL¿HG.RVKHU)RUWXQDWHO\DWUXO\UHOLDEOHFHUWL¿HG
.RVKHUJHODWLQREWDLQHGIURP*ODWW.RVKHUKLGHV
LVEHLQJSURGXFHGXQGHUWKHVXSHUYLVLRQRIWKH
287KLVJHODWLQLVXVHGE\7]DOL¶V*ROGHQ)OXII
0DQLVFKHZLW]DQG*UDQQ\¶VPDUVKPDOORZEUDQGV
PET FOOD
OQHRIWKHPDQ\FKDOOHQJHVRI3HVDFKLV¿QGLQJ
+DODFKLFDOO\SHUPLVVLEOHSHWIRRG7KHUHDUHWZR
VHSDUDWH.DVKUXVLVVXHVDERXWZKLFKRQHVKRXOG
EHDZDUH2QHLVUHODWHGVSHFL¿FDOO\WR3HVDFK
DQGWKHRWKHUUHODWHGWRWKHUHVWRIWKH\HDUDVZHOO
7KH\HDUURXQGSUREOHPFRQFHUQVWKHPL[LQJRI
PLONDQGPHDW,WVD\VWKUHHWLPHVLQWKH7RUDK³Lo
Sevashel Gedee Bachalev Imo´/LWHUDOO\WKLVLVD
SURKLELWLRQDJDLQVWFRRNLQJPLONDQGPHDWWRJHWKHU
+RZHYHUIURPWKHIDFWWKDWWKH7RUDKVWDWHVWKLV
WKUHHWLPHVDQGXVHVWKHWHUPGedee NLGWKH
GemorahTalmudLQChulin $%H[SODLQV
WKLVWRPHDQWKDWPLONIURPDQ\.RVKHUVSHFLHVDQG
PHDWIURPDQ\.RVKHUVSHFLHVLHEHHIPL[HGZLWK
FRZ¶VPLONRUJRDW¶VPLONHWFDUHIRUELGGHQWRD
EHFRRNHGWRJHWKHUEEHHDWHQWRJHWKHUFGHULYH
EHQH¿WRUSOHDVXUHIURPWKHP7KHVHSURKLELWLRQV
IURPWKH7RUDKGRQRWDSSO\WRSRXOWU\RUYHQLVRQ
,QRUGHUWRDYRLGFRQIXVLRQWKHRabanan 5DEELV
H[WHQGHGWKHSURKLELWLRQRIHDWLQJPLONDQGPHDW
WRJHWKHUWRLQFOXGHSRXOWU\DQGYHQLVRQ+RZHYHU
GHULYLQJEHQH¿WIURPSRXOWU\PL[HGZLWKPLONZDV
QRWLQFOXGHGLQWKLVGHFUHH7KHUHIRUHFKLFNHQZLWK
ZKH\PLONRUFKHHVHLVSHUPLVVLEOHLQSHWIRRG
&RPPRQO\GRJDQGFDWIRRGVFRQWDLQPLONDQG
PHDWPL[WXUHVDQGWKHUHIRUHDUHIRUELGGHQWR
-HZLVKSHWRZQHUVDOO\HDUURXQG7KHUHLVDQ
DGGLWLRQDOSUREOHPIRUD-HZZKRLVDSHWRZQHU
GXULQJ3HVDFK7KHEDVLVIRUWKLVSUREOHPLVWKDW
&KRPHW]FDUULHVZLWKLWWKUHH³Isurim´DHanaah
EHQH¿WE2ZQHUVKLSFBaal YimatzeLWPXVW
EHFRPSOHWHO\UHPRYHGIURPDSHUVRQ¶VSUHPLVHV
'XHWRWKHSURKLELWLRQRIGHULYLQJDQ\SOHDVXUHRU
EHQH¿WIURPchometzZHDUHQRWSHUPLWWHGWRXVH
11
RURZQSHWIRRGFRQWDLQLQJDQ\W\SHRIchometz on
3HVDFK7KHUHIRUHLWLVLPSRUWDQWWREHDZDUHRIWKH
SUHYDOHQWXVHRIWKH¿YHJUDLQVwheat, rye, barley,
oats, speltLQGRJDQGFDWIRRGVWRGD\2WKHU
&KRPHW]LQJUHGLHQWVDUHMalt, Brewers Yeast,
Zanthan Gum, Gluten, Starch$OPRVWDOOGU\SHW
IRRGVOLVWZKHDWRURDWVDVWKHLU¿UVWLQJUHGLHQW7KLV
LVWUXHIRU¿VKIRRGDQGELUGIRRGVDVZHOO
127(2QO\FOD\RUZRRGEDVHG.LWW\/LWWHUPD\EH
XVHGRQ3HVDFK
The following is a list of pet foods that do not
contain
forbidden milk and meat mixtures, nor do they
contain Chometz.
%HQH¿WIURP³.LWQL\RV´OHJXPHVLVSHUPLWWHG
on Pesach, even for an Ashkenazi Jew.
Therefore, rice, for instance, does NOT pose a
problem in pet foods.
Evangers (crc) *UDLQ)UHH6ZHHW3RWDWRIRU
'RJV&DWV*UDLQ)UHH6ZHHW3RWDWRIRU
'RJV&DWV2UJDQLF&RRNHG&KLFNHQ %HHI
'LQQHU%HHI7LSVZLWK*UDY\%HHIZLWK&KLFNHQ
%HHIZLWK&KLFNHQ/LYHU&DWFKRIWKH'D\Catch
RIWKH'D\R]&KLFNHQ5LFH'LQQHU&KLFNHQ
'LQQHU&RRNHG&KLFNHQ'XFN6ZHHW3RWDWR
'LQQHU*UDLQ)UHH%HHIIRU'RJV&DWV*UDLQ
)UHH%XIIDORIRU'RJV&DWV*UDLQ)UHH&KLFNHQ
IRU'RJV&DWV*UDLQ)UHH&KLFNHQIRU'RJV
&DWVR]*UDLQ)UHH&KLFNHQIRU'RJV&DWV
R]-80%2*UDLQ)UHH'XFNIRU'RJV&DWV
*UDLQ)UHH3KHDVDQWIRU'RJV&DWV*UDLQ)UHH
3KHDVDQWIRU'RJV&DWV*UDLQ)UHH5DEELWIRU
'RJV&DWVR]*UDLQ)UHH:LOG6DOPRQIRU
'RJVDQG&DWV+XQNRI%HHISDFNHGE\KDQG
/DPE5LFH'LQQHU/DPE5LFH'LQQHU /LYHU
6QDFNV2UJDQLF7XUNH\ZLWK3RWDWR&DUURWV
'LQQHU5DZ)UHH]H'ULHG%HHI+HDUWV5DZ)UHH]H
'ULHG%HHI7ULSH5DZ)UHH]H'ULHG:LOG6DOPRQ
6HQLRU:HLJKW0DQDJHPHQW)RRG6ORZ&RRNHG
%HHI6WHZ6ORZ&RRNHG%HHI6WHZ 6ORZ&RRNHG
&KLFNHQ6WHZ6ORZ&RRNHG&KLFNHQ6WHZ 6ORZ
&RRNHG/DPE6WHZ6ORZ&RRNHG7XUNH\6WHZ
:KROH&KLFNHQ7KLJKVSDFNHGE\KDQG:LOG
6DOPRQIRU'RJV&DWV
Bird Food -3XUHVXQÀRZHUVHHGVVRUJKXPDOIDOID
SHDQXWVRUPLOOHWDUH¿QH0RVWRWKHUSURGXFWV
FRQWDLQZKHDWRURDWV
Cat Food)5,6.,(6/LYHU&KLFNHQ'LQQHUZLWK
6DOPRQ&ODVVLFV6HDIRRG(QWUHH2FHDQ:KLWH¿VK
7XQD'LQQHU6SHFLDOGLHWWXUNH\DQGJLEOHWV
:+,6.(560HDOWLPH6HDVLGH6XSHU%LWV2¶%HHI
ZLWK6DOPRQZLWK/DPE5LFH&$/,)251,$
1$785$/6HD&DSWDLQV&KRLFH6DOPRQ'LQQHU
%5$1'21)$5062UJDQLF&KLFNHQ0DFNHUHO
7XUNH\/LYHU&KLFNHQ&KLFNHQ/LYHU6&,(1&(
',(7±GU\$GXOWRSWLPDOFDUHRFHDQ¿VKULFH
$GXOWLQGRRU$GXOWOLJKW.LWWHQKHDOWK\UHFKHFN
LQJUHGLHQWVEHIRUHEX\LQJ
Dog Food$06%HHI5LFH$/32+HDUW\:D\
ZLWKRXW*UDY\3(735,'(%HHI&KXQNV'LQQHU
12
PET FOOD, ITEMS THAT MAY BE USED WITHOUT
PASSOVER CERTIFICATION (FOR 5773-2013)
ZLWK
7XUNH\%DFRQ&KXQN\&KLFNHQ&KRSSHG%HHI
3(',*5((ZLWK&KRSSHG/LYHU%HHI&KLFNHQ
%HHI&KRSSHG&RPERZLWK&KLFNHQ%HHIDQG/LYHU
&$/,)251,$1$785$/0,*+7<'2*&ODVVLF
FKLFNHQHJJEDFRQ&ODVVLFJRXUPHWGLQQHU
&ODVVLFWXUNH\EDFRQ6&,(1&(',(7±GU\$GXOW
OLJKW3XSS\VPDOOELWHV0DWXUHDGXOWODUJHEUHHG
$GXOWDFWLYHUHFKHFNLQJUHGLHQWVEHIRUHEX\LQJ
Fish Food (fresh water) -IUHH]HGULHGZRUPVNULOO
IUR]HQZLWKRXWDGGLWLYHV
Fish Food (salt water) -IUR]HQEULQHVKULPSNULOO
IUR]HQZLWKRXWDGGLWLYHV7(75$'8(&$EORRG
ZRUPV
Fish Food vacation feeder±GD\E\$TXDULXP
3KDUPDFHXWLFDOV
Rabbit & Hamster FoodDOIDOIDFRUQVXQÀRZHU
VHHGV
NOTE2QHPD\VKRSDW3HWFRDQG3HWVPDUWVWRUHV
DIWHU3HVDFK
ITEMS THAT MAY BE USED WITHOUT
PASSOVER CERTIFICATION (FOR 5773-2013)
Abdominal Discomfort*HOXVLOWDEOHWV0HWDPXFLO
RULJLQDOWH[WXUHUHJXODUÀDYRUSRZGHURQO\not
ZDIHUV3KLOOLSV0LONRI0DJQHVLDXQÀDYRUHG
'L*HO.LWLQL\RV3HSFLG3HSWR%LVPRO5RODLGV
0\ODQWDWDEOHWVRUOLTXLG%LFDUERQDWHRI6RGD
=DQWDFQRWOLTXLG,PPRGLXP
Air FreshenerDQ\
AlcoholDQ\,VRSURS\O
Aluminum Foil and PansDQ\
Ant & Roach6ZHOO
AmmoniaDQ\
Aluminum Disposable ContainersDQ\
Baby Carrots±DQ\
Baby Formula&DUQDWLRQ$OVR\(QIDPLO
3URVREHH,VRPLO6LPLODFLQVHSDUDWHXWHQVLOVDV
WKH\FRQWDLQ.LWQL\RV
Baby OilDQ\SXUH
Baby Ointment -$'UHJXODURQO\'HVLWLQ
Baby Medicine3HGLDO\WH3HGLD6XUH7HPSUD
'URSV7DEOHWV
Baby Powder-RKQVRQ¶VRUDQ\SXUH7DOFXP
3RZGHU
Baby Wipes-RKQVRQ¶V%DE\:DVKFORWKRUDQ\
RWKHUZLWKRXWDOFRKRO
BagsSDSHUDQGSODVWLF
Baking SodaQRWEDNLQJSRZGHUDQ\SXUH
ELFDUERQDWHHJ$UP+DPPHUDQG9,3EUDQG
Band AidsDQ\LQFOXGLQJPHGLFDWHG
Bleach - any
Bird Food -VHHDERYH³3HW)RRG´VHFWLRQ
Blush PDNHXSDOOSRZGHUHG
Body Wash - any
Boric AcidDQ\
Buckwheat±.LWQL\RVQRW&KRPHW]
Candles - DQ\SXUHXQVFHQWHG
Cat FoodVHH3HW)RRGDUWLFOH
Cardboard$Q\
Charcoal Briquets -IRUDEDUEHTXHDQ\NLQG
Chia Seeds±DQ\UDZZLWKRXWDGGLWLYHV
Cleansers:LWK28RURWKHUUHOLDEOH+HFKVKHU
RQO\)RUH[DPSOH%DE2&OHDQVHU$MD[3RZGHU
$MD[$OO3XUSRVH&OHDQHU/HPRQ6FHQW$MD[*ODVV
0XOWL6XUIDFH&OHDQHU$MD[7XE7LOH&OHDQHU
&RPHW6SLF6SDQ6RIW6FUXE)RUPXOD
/\VRO&ORUR[3LQH/HVWRLO3LQH6RO7RS-RE
.DIWDQ&RIIHH3RW&OHDQHU0U&OHDQ*UHDVH
5HOLHI6KDNOHH%DVLF*%DVLF+%DVLF,*HW
&OHDQ%DVLF+2UJDQLF6XSHU&OHDQLQJ:LSHV
*HW&OHDQ%DVLF+2UJDQLF6XSHU&OHDQLQJ
&RQFHQWUDWH0HODOHXFD8OWUD'LDPRQG%ULWH
'LVKZDVKLQJ&RQFHQWUDWH0HOD0DJLF3UH6SRW
6WDLQ5HPRYHU7XE7LOH&OHDQHU6WDWHU6XQOLJKW
%RQ$PL'XERLV%ULOOR&OHDQVHU(OFR/DE&RRN
7RS&OHDQVHU'RZ2YHQ&OHDQHU)DQWDVWLN*ODVV
3OXV7DUQLVKLHOG&RSSHU%UDVV&OHDQHU$PZD\
0XOWL6XUIDFH&OHDQHUDQG+HDY\'XW\'HJUHDVHU
$PZD\,QGXVWURFOHDQ+HDY\'XW\&OHDQHU$PZD\
/2&0XOWL3XUSRVH&OHDQHU$PZD\/2&3OXV
.LWFKHQ&OHDQHU$PZD\/2&3OXV*ODVV&OHDQHU
$PZD\/2&3OXV0HWDO&OHDQHU$PZD\
3XUVXH'LVLQIHFWDQW&OHDQHU$PZD\6$6ROXWLRQV
6PDVKLQJ:KLWH:DWHU6RIWHQHU'HWHUJHQW%RRVWHU
3RZGHU&DYDOLHU&KHPLFDO.LWFKHQ.OHQ]HU
0DQKDWWDQ3URGXFWV0XUSK\2LO&OHDQVHU-RKQVRQ
&OHDQHU'HJUHDVHU0XUSK\¶V2LO6RDS6SUD\
)RUPXOD:ULJKWV&RRNWRS&OHDQHU
Cocoa - DQ\SXUHXQVZHHWHQHGFRFRDVXFKDV
'H]DDQ1HVWOH6DYLRQ&DUJLO+DVKDFKDU+DROH
:LQGKDP+HUVKH\¶VSXUHEDNLQJFRFRDSRZGHU
H[FHSWIRUWKRVHZLWK62/RQWKHFRQWDLQHU1RWH
cocoa beans are not Kitniyos due to their not being
beans but rather seeds from the cocoa fruit.
Coffee (Ground or beansDOOXQÀDYRUHGSXUH
FRIIHHH[FHSWGHFDIIHLQDWHG7KHIROORZLQJDUH
VRPHH[DPSOHV$OEHUWVRQ¶V%OHQGHUV3ULGH0-%
2OG-HUXVDOHP1HVFDIHQRW0W%OHQGFRQWDLQV
FKLFRU\&DLQ¶V&KDVH6DQERUQ+LOOV%URV
7DVWHU¶V&KRLFH%ULP&KRFN)XOO¶1XWVH[FHSW
GHFDIRU&ROXPELDQ5RPERXWV*R\D%RNDU
(LJKW2¶&ORFN(LJKW2¶&ORFN+RWHO5HVWDXUDQW
(LJKW2¶&ORFN5R\DOH)ROJHUV:KLWH+RXVH%HVW
&KRLFH)UHQFK5RDVW%HQH.HLWK8QÀDYRUHG
%DUULH+RXVH(OOLV3HUXJLQD(VSUHVVRRU5HJXODU
6XSHULRU0HOLWD5HG&LUFOH5DOSK¶V2QH)UHVK
&XS%HVW&KRLFH%URWKHU¶V&DIH6DUNV0DVWHU
&KHI3URFWRU*DPEOH6WDUEXFNV6DIHZD\
7UDGHU-RHµV3HUXYLDQ%OHQG9RQ¶V6DUD/HH
*UDQG8QLRQ0DVWHU&KHI1DWLRQDO%UDQGV6WDU
.6HDWWOH¶V%HVW28:DO0DUW287XOO\¶V
281HZPDQ¶V2ZQ28.URJHU283HHWV
.6$
&RIIHH*URXQG'HFDI8QÀDYRUHG(OOLV3DUNHU
+RXVH3LQQDFOH3HUXJLQD&DIIH:KLWH+RXVH
3LQQDFOH6XSHULRU1DWLRQDO%UDQGV6WDU.+HQD
.LQJ'DYLG.6$3HHW¶V.6$/DYD]]D
Coffee K-cups±notGHFDIDQGRQO\ZKHQEHDULQJ
RX6WDUEXFNVUHJXODULHEUHDNIDVWEOHQG7XOO\¶V
,WDOLDQ5RDVW*UHHQ0RXQWDLQFRPSDQ\
ITEMS THAT MAY BE USED WITHOUT
PASSOVER CERTIFICATION (FOR 5773-2013)
Coffee (instant5HJXODUXQÀDYRUHGnot'HFDI
RU&KLFRU\LQWKHIROORZLQJEUDQGVRQO\)ROJHUV
7DVWHUV&KRLFH1DWLRQDO%UDQGV6WDU.
(OLWH28S*HIHQ28S
Coffee FilterDQ\XQÀDYRUHG
Cold Medication&KLOGUHQ¶V&ROG7\OHQRO([FHGULQ
6LQXV9LFNV1\TXLO'D\TXLO&ROG)OX9LFNV
LQFOXGLQJ'(0&KDSVWLFN&ROG6RUH
7KHUDS\7ULDPLQLF+&7=%OLVWH[1HRVSRULQ
&ODULWLQ$IULQ1DVDO6SUD\
Contact Lens Fluid DQ\EUDQG
Copper Cleaner+DJHUW\28
Cough Medicine&RUULFLGLQ0\WXVVLQ6FRW7XVVLQ
Cream of Tartar*HO6SLFH286SLFHFR28
6DUDWRJD283DFL¿F1DWXUDO6SLFHV28
Crockpot LinerDQ\
Cups - any plastic or styrofoam
Deli(PSLUH6RORPRQ¶V&RPSDQ\%XIIDOR28S
Dental FlossDQ\XQÀDYRUHGEUDQG
Denture Cleansers3ROLGHQW3ROL*ULS
Deodorant±$ULG([WUDGU\6HFUHW6XUH-HDQ
1DWH7RP¶V5LJKWJXDUG$HURVROQRWVSRUW
RULJLQDO2OG6SLFHERG\VSUD\DOOGU\SRZGHUW\SHV
Detergent (Clothes)6XQOLJKW5RNHDFK3DFH
6WDWHU%URWKHUV7LGH$OO)DE'DVK2[\GRO%L]
&KHHUOLTXLGSRZGHU%ROG%UHH]H'UHIWOLTXLG
SRZGHU%OXH0DJLF$PZD\'HWHUJHQW$PZD\
%OHDFK$PZD\3UHZDVK/X[/LTXLG:LVN/LTXLG
6SLF6SDQ7RS-RE6KDNOHH%DVLF/3DWKPDUN
/DXQGU\'HWHUJHQW,YRU\6QRZ'LVK'HWHUJHQW
7UHQGSRZGHURQO\$PZD\'RYH$MD['DZQ
&U\VWDO&OHDU/X[6XQOLJKW&DUHVV-R\,YRU\
/LTXLG/LTXLG$OO/X[/LTXLG3DFH&ORXG1LQH'LVK
:DVK'D]]OH$MD[/HPRQ'LVK'HWHUJHQW$MD[
$QWL%DFWHULDO$MD[$QWL%DFWHULDOZLWK%DNLQJ6RGD
DQG5XE\5HG*UDSHIUXLW3DOPROLYH$QWL%DFWHULDO
3DOPROLYH2[\3OXV:LSHV
Dish Detergent±DQ\SRZGHUHG
Dishwasher Detergent - 3DFH&DOJRQLWH
&ORXG1LQH3LQN/DG\'LVKZDVKHU$OO3URFWRU
*DPEOH&DVFDGH$PZD\6XQOLJKW$PZD\
$XWRPDWLF'LVKZDVKLQJ)RUPXOD6RIW:DWHU
$PZD\$XWRPDWLF'LVKZDVKLQJ3RZGHU$PZD\
&RQFHQWUDWHG'LVKZDVKLQJ/LTXLG
Diapers 'LVSRVDEOHDQ\
Dog Food6HH³3HW)RRG´DUWLFOH
Dried Fruits±$OEHUWVRQ¶VUDLVLQV'ROHUDLVLQV
.URJHUUDLVLQV5DOSK¶VUDLVLQV7UDGHU-RH¶VUDLVLQV
%LQJ&KHUULHV)DQF\'ULHG1HFWDULQHV)DQF\'ULHG
pears
Eggs±DQ\
EthenolJDVXVXDOO\IURPFRUQDQGDOZD\VLQHGLEOH
Eye DropsDQ\
Eye Shadow / Eye LinerDQ\EUDQGZLWKRXWJUDLQ
LQJUHGLHQWV
Fabric SoftenerDQ\
Face powder - any
Fireplace LogDQ\XQVFHQWHGEUDQG
Fish (Raw8QJDUV.RVKHUL¿F5DOSK¶V5&&
.RVKHUFHUWL¿HG.LQHUHW)UHVKZDWHUEUDQG
13
Fishcanned5XEHQVWHLQVDOPRQ3LOODU5RFN
VDOPRQERWKLQZDWHUDQGVDOW
Fishfrozen.LUNODQGIUR]HQVDOPRQRXrinse
EHIRUHXVHDQ\.RI.FHUWL¿HGUDZ¿VK
Flax Seed±&KHFNVHHGVWKRURXJKO\EHIRUH
3HVDFKIRUDQ\SRVVLEOHPL[HGLQJUDLQV
Fruits (Canned&DOLIRUQLD'HOLJKW
Fruit (Frozen)DQ\ZLWKRXWDGGLWLYHVLHFLWULFDFLG
RUDVFRUELFDFLG
Fruit (Packaged - Dried)$PHULFDQ5DLVLQ
3DFNHUV&DODYR3LWWHGDQG:KROH'DWHV3ULGH
5DLVLQV6DIDUL5DLVLQV6DIDUL'ULHG)UXLW6XQ:RUOG
3LWWHGRU:KROH'DWHV6XQJORZ3LWWHGRU:KROH
'DWHV$PHULFDQ(DJOH$SULFRWV6XQ6DWLRQDO
6QDFNVDSULFRWV$PHULFDQ5DLVLQ3DFNHUV
&DOLIRUQLD5DLVLQV'HO0RQWH5DLVLQV1DWXUDO
*ROGHQ'HOX[H5DLVLQV'ROH5DLVLQV5HJHQW
5DLVLQV3ULGH7KRPSVRQ5DLVLQV=RULD'ULHG
$SSOHVDQG0L[HG)UXLW7UDGHU-RH¶VUDLVLQVELQJ
FKHUULHVIDQF\GULHGQHFWDULQHVIDQF\GULHGSHDUV
Furniture PolishDQ\
Garbage BagsDQ\SODVWLF
Glass Cleaner%RQ$PL*ODVV3OXV
Glue – (OPHU¶V:KLWHJOXHQRWSDVWH
Grape Seed oil±3RPSHLDQ6WDU.
Hairspray±DQ\
HempFKHFNWKRURXJKO\IRUDQ\SRVVLEOHPL[HGLQ
grains
Household Cleanser/\VRO6XQOLJKW)DQWDVWLF
*ODVV3OXV
Hydrogen PeroxideDQ\
Ice IURPSODLQXQÀDYRUHGZDWHUDQ\
Insecticide - any
Juice (frozen)DQ\EUDQGQDPHIUR]HQRUDQJHMXLFH
FRQFHQWUDWHZKLFKLVXQVZHHWHQHGJUDGH$DQGLV
QRWHQULFKHG0LQXWH0DLGRUDQJHMXLFHIUR]HQ
FRQFHQWUDWH$PHULFD¶V&KRLFH)UR]HQ&RQFHQWUDWH
*UDSHIUXLW-XLFH)ORULGD*ROG*UDSHIUXLW)UR]HQ
&RQFHQWUDWH2UDQJH*ROGHQ)ORZ2UDQJH-XLFH
*UHDW9DOXH2UDQJH*UDSHIUXLW-XLFH3DWKPDUN
*UDSHIUXLW2UDQJH-XLFH5LYHU9DOOH\*UDSHIUXLW
2UDQJH-XLFH6KRSULWH2UDQJH-XLFH6XQNLVW
*UDSHIUXLW-XLFH)UR]HQ&RQFHQWUDWH9LWDOLW\6HOHFW
*UDSHIUXLW2UDQJH)UR]HQ&RQFHQWUDWH5DOSKV
RUDQJH6XQNLVWRUDQJH
Lactaid DropsNOT7DEOHWV,IQHHGHGLWPXVW
EHDGGHGWRPLONRURWKHUGDLU\SURGXFWVbefore
3HVDFK
Lactaid Milk 0XVW EH SXUFKDVHG EHIRUH 3HVDFK
PD\FRQWDLQVPDOODPRXQWRIDFWXDOchometz
Lemon Juice5HDO/HPRQ
Lime Juice5HDO/LPH
Lotion1R[]HPD3RQGV&ROG&UHDP6HD%UHH]H
6HD6NL2[\3HWUROHXP-HOO\6KDNOHH+DQG
DQG%RG\
Mascara - DQ\ZLWKRXWJUDLQLQJUHGLHQWV
Meat - PRVWUDZPHDWVQRWFRDWHGSURFHVVHG
HWFZLWKUHOLDEOH\HDUURXQG+HFKVKHUDUHDOVR
.RVKHUIRU3HVDFKVXFKDV0HDO0DUW$PDUD6WDU
NS,QWHUQDWLRQDO*ODWWHWF&KHFNZLWK\RXUORFDO
14
7,0(6725(0(0%(5)253(6$&+
,17+(/$$5($
%HGLNDV&KRPHW],QWKH(YHQLQJ
)DVWRI)LUVWERUQ
)LUVWERUQDWWHQGDVL\XPWRDYRLGIDVWLQJ
/DVW7LPHWR(DW&KRPHW]
DP0$DP*5$
%LXU&KRPHW]
DP0$DP*5$
&DQGOH/LJKWLQJVWQLJKWSP
0LGQLJKW&KDW]RVDP
&DQGOH/LJKWLQJQGQLJKW
$IWHUSPPLQSPPLQ
0RW]HL<RP7RYSPPLQSPPLQ
6KDEERV&DQGOHOLJKWLQJSP
0RW]HL6KDEERVSPPLQSPPLQ
&DQGOH/LJKWLQJWKQLJKW
&DQGOH/LJKWLQJWKQLJKW
$IWHUSPPLQSPPLQ
0RW]HL<RP7RYSPPLQSPPLQ
15
16
17
Cholov Yisroel: Milk that was supervised during
production by a Mashgiach
Bishul Yisroel: Jewish cooked food
Pas Yisroel: baked goods made by a Jew
Mashgiach: Kosher food supervisor
Kosher: fit to eat according to Jewish Law
Mevushal: Cooked wine
Treife: not kosher
Glatt/Mehadrin: meat that has met the highest
level of kosher standards
Chometz: grains that have been rendered unfit
for Pesach
Pesach: Passover
Halacha: Jewish Law
Hechscher: Kosher supervision
18
ITEMS THAT MAY BE USED WITHOUT
PASSOVER CERTIFICATION (FOR 5773-2013)
5DEELQLFDXWKRULW\IRUDOOLQTXLULHV7KLVLQFOXGHV
9HQLVRQIURP0XVLFRQ)DUPV28DW
$OOH283KLOO\)RRGV9DFXXP3DFNHG5DZ
%HHI9HDO/DPEZKHQEHDULQJ6WDU.6RORPRQ¶V
&RPSDQ\%XIIDORDWFHUWL¿HGE\
28SSee chart below
MedicinePLVF3UR]DF1R'R]H&DSOHWV
CC'UDPDPLQWDEOHWVDOVRVHH$EGRPLQDO'LVFRPIRUW
$VSLULQDQG&ROG0HGLFDWLRQ
Milk,WLVSUHIHUDEOHWREX\.RVKHUIRU3DVVRYHU
PLONRWKHUZLVHDQ\EUDQGSXUFKDVHG%()25(
3HVDFKIURPDFRPSDQ\WKDWGRHVQRWSURFHVV
FKRFRODWHPLONRQWKHVDPHPDFKLQHU\PD\EH
XVHGRQ3HVDFKDVORQJDVLWGRHVQ¶WFRQWDLQ
PRQRGLJO\FHULGHVRUGH[WURVH7KRVHFRPSDQLHV
IURPZKLFKZHFDQEX\PLONLQWKH/RV$QJHOHV
DUHDEHIRUH3HVDFKDUH-HUVH\PDLG5DOSK¶V$OWD
'HQD6WDWHU%URWKHUV)RUPRVW9RQV3DYLOLRQVDQG
.QXGVRQNote0LONFHUWL¿HG.RVKHUIRUDOO\HDULV
FHUWL¿HGIRU3DVVRYHURQO\ZKHQLQGLFDWHG
Milk Dry±QRQIDWZLWKRXWDGGLWLYHVEHIRUH3HVDFK
Mineral OilDQ\
Mouthwash6FRSH/LVWHULQHSODLQDQG
/LVWHUPLQW7RP¶VRI0DLQ$PZD\QRWWKH$PZD\
*OLVWHU$QWL3ODTXH)ORXULGH
Nail Polish/RemoverDQ\
NapkinsDQ\
NutsDQ\UDZDOPRQGVZDOQXWVHYHQLIEOHDFKHG
0XVWEHZLWKRXW%+$%+7RURWKHUDGGLWLYHV
$]DU2.%OXH'LDPRQG.RI.1XWV*DORUH
QRWH3HFDQpieces must have Kosher for Pesach
FHUWL¿FDWLRQ
Olive Oil2OLR'L2OLYD%HUWROOL([WUD9LUJLQ2OLYH
2LO28&DOOLVWR)UDQFHVFRQL([WUD9LUJLQ2OLYH2LO
&RODYLWD([WUD9LUJLQ)HUUDUD([WUD9LUJLQ/XSL([WUD
9LUJLQ5RODQG([WUD9LUJLQ.ULQRV3RPSHLDQ([WUD
9LUJLQ*UDGHFROG3UHVVHG
Onions frozen choppedDQ\SXUHRUIUHVK
FKRSSHGUHIULJHUDWHG5HDG\3DF%UDQG
Oven CleanerDQ\HJ'RZ0U0XVFOH)RDP
(DV\2II(DV\3DVW$PZD\-LIIRDP)DQWDVWLF
6KDNOHH
Oven Cooking Bag5H\QROGVPLFURZDYHEDJV
Pain Medication%XIIHULQ([FHGULQSODLQ
PLJUDLQHVLQXV0RWULQ6W-RVHSKDGXOW
FKHZDEOH$VW7DEV7\OHQRO7\OHQROSOXV
Paper CupsDQ\VW\URIRDPSODVWLFRUFDUGERDUG
$PHULFD¶V&KRLFH+RW&XSV%L5LWH+RW&ROG
&XSV&ODVVLF+RW&ROG*UHDW%X\&ROG&XSV
ZD[RQO\-DPHV5LYHU$Q\WLPH&XSV%DWKURRP
&XSV*HQHUDO2FFDVLRQ&XSV.LWFKHQ&XSV
%L5LWH'L[LH
Paper NapkinsDQ\
Paper (Plate)$PHULFD¶V&KRLFH%L5LWH&ODVVLF
'L[LH3DSHU3ODWHV)LQHVW)09)UHG0H\HU
GHFRUDWHGSDSHUSODWHVERZOVDQGZKLWHSDSHU
SODWHV-DPHV5LYHU.URJHUGHFRUDWHGDQG
ZKLWHSDSHUSODWHVDQGGHFRUDWHGERZOV5DOSK¶V
ZKLWHSDSHUSODWHVGHFRUDWHGSDSHUSODWHVDQG
GHFRUDWHGERZOV6ROR6ZHHWKHDUWSDSHUERZOV
19
SODWWHUVSODWHVDQGIRRGWUD\V%LJ<%L5LWH'L[LH
6WRQHZDUH*HRUJLD3DFL¿F'L[LH5DOSKV:KLWH
'HFRUDWHG3DSHU3ODWHV*LDQW/RZHV3ULGH0DGH
6KRSSHU¶V9DOXH6WRS6KRS7RSFR5LWH$LG
Paper (Parchment)8QLRQ3DSHU%DN20DWLF
&DVWDZD\5H\QROGV&\VFR3ULPH6RXUFH3XUH
$OOLDQW:LOWRQ&253$Q\6WDUNFHUWL¿HG
Paper TowelDQ\EUDQG¿UVWVKHHWVPD\FRQWDLQ
NLWKL\RVJOXHDQGVKRXOGQRWEHXVHGZLWKKRW
IRRGV
Pepper - 0RUWRQ¶V%ODFN3HSSHU'XUNHH6SLFH
,VODQG,W¶V'HOLVK
Personal Care Product7KHIROORZLQJ6KDNOHH
SURGXFWV$YRFDGR&UHDP0RLVWXUL]HU'HRGRUDQW
&UHDP6NLQ3ROLVKHU3RZGHU%OXVK6XQVFUHHQ
0RLVWXUL]HU/LS&RQGLWLRQHU0HQ¶V6NLQ&RQGLWLRQHU
Plastic Bag & Wrap, Plate, CupHWFDQ\EUDQG
LH6DUDQ:UDS5H\QROGV*ODG%DJV&KHI¶V
5HYLHZ+DJHUW\=LSSHU%DJV+DQGL:UDS
3RFDKRQWDV3ULFH6DYHU6DIHZD\3ODVWLF:UDS
6ODWHU%URV6KDPURFN6WDWHU%URWKHUV6\VFR
9RQV:DOJUHHQV:HJPDQ¶V=LSORF5LWH$LG6DP¶V
&OXE5DOSK¶V6XQQ\6HOHFW7DUJHW.URJHU
Polish$Q\
Poultry - AQ\UHOLDEOH.RVKHUEUDQGWKDWLVQRW
SURFHVVHGRUFRDWHGLHRQO\UDZ6RPHSRSXODU
EUDQGVDUH(PSLUH)DOOV9LQHODQG'DYLG(OOLRWHWF
See Chart Below
Powdered Milk$OED&DUQDWLRQ'DLU\PDQ
Raisins - $PHULFDQ5DLVLQ3DFNHUV'HO0RQWH
'ROH3ULGH6DIDUL)LVKHU1XW7UDGHU-RHV6XQ
0DLG
Rice - IRUWKRVH6HSKDUGLPZKRXVHULFHRQ3HVDFK
LWLVDFFHSWDEOHRQO\ZLWKRXWDGGLWLYHVWKLVLQFOXGHV
YLWDPLQVLH3DUL1DVLP5R\DO6KDKU]DG$IWDE
.XVKD6XFFHVV5LYLDQD0DKDWPDDQG(PSHURU
Rice Milk±Kitniyos- not Chometz&OHDUO\2UJDQLF
+\9HH0DUNHW%DVNHW0HLMHU1DWXUH¶V3URPLVH
5LFH3XUH
Rubber GlovesDQ\XQFRDWHGLH3OD\WH[5XEEHU
0DLG
Salt - (Coarse Kosher Salt)DQ\
Salt - (Table0RUWRQ¶VSODLQFRDUVHSRSFRUQVDOW
VSHFLDOFRRNLQJVDOWFDQQLQJDQGSLFNOLQJVDOWH[WUD
¿QHÀRXUVDOW5HG&URVV6WHUOLQJ'RPLQLRQ6HD
6DOW
NOTERQ6DOW$OZD\VFKHFNWRPDNHVXUHWKDWWKHUH
LVQRGH[WURVHLRGLQHRUSRO\VRUEDWHOLVWHGLQWKH
LQJUHGLHQWV
Sandwich BagDQ\SDSHURUSODVWLF
Sanitizer DQ\
Scouring Pad'RELH%ULOOR1\ORQ6FUXEEHU
6FRWFK%ULWH6XSUHPH&KRUH%R\$LUZLFN1\ORQ
*ROGHQ)OHHFH6FUXQJH2&HO2DQ\VWHHOZRRO
ZLWKRXWVRDS
6HOW]HU8QÀDYRUHGDQ\
Shampoo3UHOO%UHFNUHJXODU+HDG
6KRXOGHUV-RKQVRQ¶V6HOVXQ%OXH3HUW
Shelf PaperDQ\XQFRDWHG
Shoe PolishDQ\LH:ULJKWV
20
ITEMS THAT MAY BE USED WITHOUT
PASSOVER CERTIFICATION (FOR 5773-2013)
Silver Polish$PZD\:HLPDQ+DJHUW\28
6WDUFR28(QYLURFKHP7DUQLVKLHOG6WDUFR
5RNHDFK*RGGDUGV
Skin Care/XEULGHUP8QÀDYRUHG%OLVWLN.HUL
2UDMHO
Soap (Hand)DQ\
Soy Milk.LWQL\RVEXWQRW&KRPHW]9LWDVR\6DQ
6XL2ULJLQDO6R\'UHDP2ULJLQDO1DWXUDO
Spices - 3DFL¿F1DWXUDO6SLFHV28DQ\ZKROH
spices
SpongeDQ\ZLWKRXWVRDSLH6266FUXEEHU
HWF
Steel WoolDQ\ZLWKRXWVRDS
Sterno - any
StrawsDQ\SODVWLF
Styrofoam ProductsDQ\
Sugar - (Brown)&+*ROG%URZQ6WDU.&
+'DUN%URZQ6WDU.'L[LH&U\VWDOV/LWH%URZQ
:KROHVRPH)RRGV2UJDQLF&DQH6XJDU
Sugar - (White)DQ\JUDQXODWHGSXUHFDQHVXJDU
ZLWKRXWGH[WURVHVXFKDV&+9RQV3DYLOLRQV
$OEHUWVRQV6PDUW)LQDO6SUHFNOHV6\VFRLWPXVW
EHOLVWHGDVSXUHFDQHVXJDURQWKHODEHO
Sugar - (Raw)&++DZDLLDQUDZFDQHVXJDU
Palm Sugar±6ZHHW7UHH&RFRQXW3DOPVXJDU
Suntan Lotion & Medication&RSSHUWRQHNLGV
RLOIUHH6KDGH6SRUW3UH6XQ6SUD\V1HXWURJHQD
6XQOHVV7DQQLQJ/RWLRQ6RODUFDLQJHOVSUD\DQG
PHGLFDO¿UVWDLGVSUD\
Supplement - (QVXUH:LWKRXW)LEHU1RWHLW
FRQWDLQV.LWQL\RVFKHFNZLWK\RXU5DYZKHQ
QHHGHG
Sweetener - 6\QFDO6DFFKDULQ
Tea (Instant)1HVWHD8QÀDYRUHG3XUH7HD
5HJXODURU'HFDI
7HDEDJV5HJXODU8QÀDYRUHG7HWOH\/LSWRQ
6ZHH7RXFK1HH6DODGD5HGFR&KRFN)XOO2¶
1XWV$PHULFD¶V&KRLFH%URPOH\(VWDWH$OEHUWVRQ¶V
.URJHU1HVWHD3RFDKRQWDV6XSHULRU6DIHZD\
6HOHFW7KH5HSXEOLFRI7HD5LWH$LG
127(RQ7HDEDJV5HJXODUWHDEDJVWKDWDUH
XQÀDYRUHGDQGQRWGHFDIIHLQDWHGDQGKDYHQR¿OOHUV
VXFKDVFKLFRU\PD\EHXVHGIRU3HVDFKZLWKRXW
VSHFLDOFHUWL¿FDWLRQ
Tea Bags (Decaf)/LSWRQ8QÀDYRUHG
6ZHH7RXFK1HH'HFDI
Tissue (Bathroom & Facial)DQ\
ToothbrushDQ\
Tooth Pain2UDMHO$QEHVRO
Toothpaste&ROJDWH7RP¶VRI0DLQH&UHVW&RRO
0LQW([WUD:KLWHQLQJ0XOWLFDUH.LGV6SDUNOH
$TXDIUHVK$LP*HO0HQWDGHQW&ORVH8S*HO
6HQVRG\QH
ToothpicksDQ\XQÀDYRUHG
Vegetable (Fresh)DOIDOIDVSURXWVDUWLFKRNH
DVSDUDJXVDYRFDGREHHWVEHOOSHSSHUEURFFROL
EUXVVHOVSURXWVFDEEDJHUHGRUJUHHQFDUURW
FDXOLÀRZHUFHOHULDFFHOHU\URRWFHOHU\FKLFRU\
FKLYHVFROODUGFXFXPEHUGDQGHOLRQJUHHQVGLOO
HJJSODQWHQGLYHHVFDUROHJDUOLFWKHUHDUHYDU\LQJ
FXVWRPVUHJDUGLQJWKHXVHRIJDUOLFRQ3HVDFK
JUHHQRQLRQKRUVHUDGLVKUDZNRKOUDELOHHN
OHWWXFHDOOW\SHVPLQWOHDYHVPXVKURRPRNUD
RQLRQSRWDWRSDUVOH\SDUVOH\URRWSXPSNLQ
UDGLVKHVDOOW\SHVUKXEDUEUXWDEDJDVFDOOLRQV
VSLQDFKWRPDWLOORWRPDWRHVWXUQLSZDWHUFUHVV
ZKROHSHSSHU\DPVDQG]XFFKLQL
Vegetable Wash 6HUHOL
:DWHU8QÀDYRUHGDQ\
Water FiltersDQ\
Wax Paper&XW5LWH$PHULFD¶V&KRLFH,JD0DUFDO
.LWFKHQ&KDUP5HPDUNDEOH5H\QROGV
Raw Meat and Poultry including ground 7KH
IROORZLQJDUH¿QHDOO\HDUURXQG for Pesach use:
$+$'5RVHQEODWW'DYLG(OOLRWW:LVH.RVKHU
1DWXUDOSURGXFHGDIWHU(PSLUH0DOFKXV
.RVKHU9DOOH\)DLUZD\¶VSURGXFHGDIWHU
,QWHUQDWLRQDO*ODWW6DUDK¶V6SULQJFKLFNHQ
SURGXFHGDIWHU.-3RXOWU\.HGDV.RVKHUV
%HVW4XDOLW\.RVKHU.RVKHU0HKDGULQ1RDK¶V
$UN)LVKHO¶V*ODWW/¶0HKDGULQ/DNHZRRG¶V%HVW
6RORPRQ¶V5HDO.RVKHU*RRG1¶*ODWW*ODWW%R[
+DU1RI6DJHEUXVK1DWXUDO*URZDQG%HKROG
.HGDV.LU\DV-RHO.RO)RRGV.RVKHU9DOOH\
.RVKHUV%HVW0DOFKXV3HOOHK4XDOLW\.RVKHU5HDO
.RVKHU7LIHUHWK.RVKHU
7KHIROORZLQJDUH¿QHDOO\HDUURXQG for Pesach
excluding ground meat/poultry:
$JUL$DURQ¶V%HVW6KRU+DERU$OOH3URFHVVLQJ'
*UHXQVSHFW0HDO0DUW*URZDQG%HKROGJURXQG
EHHILV¿QH*URXQGSRXOWU\LVQRW/RFDOSUHSDUDWLRQ
LH5DOSKVNRVKHUVWRUHVDVNHDFKORFDO5DEEL
0DVKJLDFK
NUTRITIONAL PRODUCT INFORMATION
'LHW2UJDQLF1LWULWH)UHH/DFWRVH5HGXFHG/RZ
6RGLXP*OXWHQ)UHHHWF)RRGV
ZZZ28RUJ&KDJLP3HVDFK3HVDFKJXLGH
GLHWVKWP
7KH-HZLVK'LDEHWHV$VVRFLDWLRQ
7HO
1HFKDPD#-HZLVKGLDEHWHVRUJ
,VUDHO
ITEMS THAT ARE RELIABLY CERTIFIED FOR
PASSOVER (5773 -2013)
Agave Nectar±*R\D2.S+HDOWK*DUGHQ
2.S0DUHWDL2.S7UDGHU-RH¶V2.S
Airline Meals:LOWRQ28S0HDO0DUW28S
/RX*6LHJHO28SZLWK.RVKHUIRU3DVVRYHUVHDO
RQO\>$/(57$LUOLQHVRIWHQPLVWDNHQO\VHUYHPHDOV
RQ3HVDFKZKLFKDUHQRW.RVKHUIRU3HVDFK$OZD\V
EHFDUHIXOWRFKHFN\[email protected]
Allergy Medication$GZH28S
Antacid - $GZH+HDUWEXUQ5HOLHISODLQDQGZLWK
FDOFLXP.$-$GZH.R/DQWD$QWDFLG$GZH$QWL
*DV
Appetizers7XY7DDP2.S
Apple Butter6HDVRQ28S(GHQRUJDQLF2.S
Apple Juice+DGGDU.$-6HDVRQ2.S
(PSLUH2.S.HGHP2.S0DQLVFKHZLW]
28S8QJDU¶V(GHQRUJDQLF2.S6WUHLWV
ITEMS THAT ARE RELIABLY CERTIFIED
FOR PASSOVER (FOR 5773-2013)
.RI.S
Applesauce.HGHP28S6HDVRQ28S
)HVWLYH28S5RNHDFK28S*HIHQ28S
(GHQRUJDQLF2.S6WUHLWV.RI.S0DQLVFKHZLW]
28S*OLFN¶V.$-5XH/DID\HWWH
Aspirin$GZHQRQ$VSLULQSDLQUHOLHIUHJXODUDQG
H[WUDVWUHQJWK28
Baby Food)HVWLYH28S+DGGDU.$-*HIHQ
28S3UHVLGHQW¶V&KRLFH/REODZ¶V%UDQG
28SRQO\+HDOWK\7LPHV28SRQO\*OLFNV
.$-)LUVW&KRLFH28S±$SSOH6DXFH&DUURWV
6ZHHWSRWDWRHV
Bags - %RGHN*DUQHW+HUE%DJV28S
Bakery Goods*UXHQHEDXP.$-2EHUODQGHU
5DEEL%DEDG6FKLFN¶V.$--HQQLH¶V0DFDURRQV
.RI.S+LUVFK%URV2.+RURZLW]0DUJDUHWHQ
28S0DQLVFKHZLW]28S*RRGPDQ¶V28S
6SLONH¶V.RI.S
Baking Powder+DGGDU.$-*HIHQ28S
Baking Soda*HIHQ28S
Bamboo Shoots&DOLIRUQLD'HOLJKW6WDU.
Blintzes.LQHUHW28S
Borscht - *ROG¶V28S*HIHQ28S5RNHDFK
28S0RWKHU¶V28S0DQLVFKHZLW]28S
Butter±%UHDNVWRQH¶V28S
Cake&DURXVHO&KHHVHFDNH2EHUODQGHUV.RI
.S6PLORZLW]*,1HZ<RUN6W\OH&KHHVHFDNH
28S&KRORY<LVURHO*HIHQ28S*RRGPDQ¶V
28S5RNHDFK28S0DQLVFKHZLW]28S
6KDEWDL*RXUPHW2.S0HVVLQJ.RI.S.LQHUHW
28S6FKLFN¶V.$-.LQQHUHW282VHP28
Cake Mix6WUHLW¶V.RI.S0DQLVFKHZLW]28S
*RRGPDQ¶V28S6DYLRQ28S
Candy - 0DQLVFKHZLW]28S3DVNHV](OLWHRQO\
ZLWK28SRU%DGDW].UXPV28S.RSSHUV
2.S2SHQKHLPHU-HUXVDOHP6ZHHWV2.S
'UHDP&RQIHFWLRQV.RI.6KXIUD2.S+ROLGD\
.RI.6HDVRQ28S6WUHLWV.RI.,W¶V'HOLVK
+HDUW.3URJUHVV28S*ROGHQ)OXII
28S(PSUHVV&KRFRODWH28S5RNHDFK
28S%DUULFLQL.RI.S%DUWRQV.RI.VRPH
DUHGDLU\%ORRP\¶V28S%OXP¶V28S7]DOL¶V
28S+ROLGD\&DQG\.RI.S2QHJ.$-
6DYLRQ28$OSURVH&KRFRODWHV280DQKDWWDQ
&KRFRODWHV2.5DEEL:HLVVPDQGO3L]]D])UXLW
6OLFHV28S.OHLQV2.S
Cereal - 0DQLVFKHZLW]28S0RWKHUV28S
5RNHDFK28S7$EUDKDPV28S.RMHO28S
6WUHLW¶V.RI.2EHUODQGHU¶V.RI.S6DYLRQ28
Charoset - 6WUHLW¶V.RI.
Cheese7XY7DDP2.S0LOOHUV28S
+DRODP.$-*RODQ6WDU.S.R6XUH6WDU.S
0HKDGULQ--.$-7DDP7RY28S*LGHRQ
6OLP89RWYDWD0RUQLQJ6HOHFW$KDYD3DVWXUHVRI
(GHQ-HUXVDOHP&KHHVH±2.S&KRVRP6RIHU
(QWUHPRQW(PHQWDOH6SUHDGDEOH&KHHVHIURP
)UDQFH5DEEL$OORXP0RQVH\'DLU\6WULQJOHV
2.1DWXUDO.RVKHU&KRORY<LVURHO2.IRU
3DVVRYHU/HV3HWLWHV)HUPLHUHV&KRORY6WDP
2.IRU3DVVRYHU/D&KHYUH&KRORY<LVURHO2.
21
IRU3DVVRYHU0LJGDO.$-&DERW280HKDGULQ
&KHHVH6QDFN9ROYH5DY3KLODGHOSKLDFUHDP
FKHHVH2.S7XY7DDP+XQJDULDQFKHHVH2.S
Chicken Coating6WUHLWV%DJ1%DNH.RI.S
Children’s Chewable Fever & Pain Reliever
$GZH28S
Chocolate Chips%ORRPV/LHEHU¶V:HLVVPDQGHO
Chocolate%DNLQJ%DUV+DGGDU.$-
0DQLVFKHZLW]28S3DVNHV]2.S5DEEL
:HVWKHLP
Chocolate Syrup0DQLVFKHZLW]28S
Cigars±6HQRU6RORPRQ±.6$
Cleansers - )HVWLYH28S$PHULFD¶V&KRLFH
28S%ULWH:DWHU28S*HIHQ28S3URFWHU
*DPEOH28S5RNHDFK28S+DGGDU.$-
:HLPDQ:D[$ZD\28S
Cocoa - /LHEHU¶V2.S6DYLRQ28S9LFWRU¶V
28S9,328S+DGDU.$-*HIHQ28S
Coffee(OLWH28S0D[ZHOO+RXVHZLWK2.S
RQO\0HULGLDQ28S6WDUEXFNV)ODYRUORFN%DJV
28S)HVWLYH7KH*RXUPHW%HDQ2.S+DGGDU
.$-*HIHQ28S6DYDULQ28S6XSHULRU
&RIIHHUHJXODUDQGGHFDIIHLQDWHGDUH&5&
FHUWL¿HGIRU3HVDFKQRWÀDYRUHG/D-RORD*RXUPHW
/LTXLG&RIIHH6WDU.S.LQJ'DYLG&RIIHH5RDVWHUV
.6$S*HYDOLD2.S9DVFDIH([SUHVVR5DEEL
)UDQNHOS:KLWH+HQ2.S.DUDW2.S+DJ
2.S&DQDGLDQ(LJKW2¶&ORFN,QVWDQW&RIIHH
2.S<XEDQ2.S6HDWWOH¶V%HVW28S
Coffee (Decaf) - 6DQNDZLWK2.SRQO\)HVWLYH
(OLWH2.S+DGGDU<XEDQ2.S0D[ZHOO+RXVH
2.S7KH*RXUPHW%HDQ2.S*HYDOLD2.S
*HIHQ28S:KLWH+HQ2.S.DUDW2.S
+DJ2.S3HHW¶V.6$1HVFDIH7DVWHU¶V&KRLFH
'HFDIILQVWDQW&KDVDP6RIHU
Coffee K-cups±notGHFDIDQGRQO\ZKHQEHDULQJ
RX6WDUEXFNVUHJXODULHEUHDNIDVWEOHQG7XOO\¶V
,WDOLDQ5RDVW*UHHQ0RXQWDLQFRPSDQ\
Coffee (Liquid Concentrate)0D[ZHOO+RXVH
2.S
Coffee Creamer*HIHQ28S.LQHUHW28S
0LVKSDFKD28S
Cold Cuts0HDO0DUW28S(PSLUH28S
Cookies%3*RXUPHW.RI.S*RRGPDQV
28S0DQLVFKHZLW]28S6DYLRQ/RZIDW
&RRNLHV28S-HQQLHV%DNHU\WUHDWV.RI.S
6HDVRQ28S0RWKHUV28S2EHUODQGHU¶V
*UXHQEDXP¶V.$-%ORRP\¶V28S)HVWLYH
28S5RNHDFK28S)URRNLHV.UXP¶V28S
6KDEWDL*RXUPHW2.S0HVVLQJ.RI.S0\
%XEE\¶V.RI.S2EHUODQGHU¶V.RI.S%DUWHQXUD
28.LQHUHW281HVV28
Cooking Bags&RRNLW&RRNLQJ%DJV28S
Cooking Spray6HDVRQ28S0DQLVFKHZLW]
28S0RWKHUV28S
Cosmetics6KDLQ'HH&RVPHWLFV6WDU.S$GZH
&RVPHWLFV28S
Cough Syrup$GZH7XVVLQ&RXJK6\UXSDQG'0
28
Cream - /DQG2/DNHV28S6HDOWHVW28S
22
ITEMS THAT ARE RELIABLY CERTIFIED
FOR PASSOVER (FOR 5773-2013)
Cream Cheese)ULHQGVKLS%UHDNVWRQH)OHXU'H
/DLW5DOSK¶V9RQV$OOZLWK28S2QO\3KLODGHOSKLD
&UHDP&KHHVHZLWK2.SRQO\--$UXJDV
+DERVHP
Cups - 'L[LH28S-DPHV5LYHU28S
Dairy/XFHUQH&RWWDJH&KHHVH6RXU&UHDP
.RI.S
Deodorant'U)LVFKHU'HRGRUDQW6SUD\*HO
5DEEL6KORPR.RUDFK
Dish Detergents)HVWLYH5RNHDFK28S
6HDVRQ28S*HIHQ28S$GZH.$-+DGGDU
.$-
Dishwasher Detergent6HDVRQ28S5RNHDFK
28S+DGGDU.$-
Dressing0DQLVFKHZLW]28S6DYLRQ%ODQFKDUG
%ODQFKDUG28S0RWKHUV28S6WUHLWV
.RI.S
Egg Substitute.LQHUHW28S+HDOWK\0RUQ
28S
Egg Whites3DSHWWL)RRG28S
Fish (3UHSDUHGDQG5DZ6HDVRQ28S5RNHDFK
ZLWK28S0HDO0DUW28S&DOLIRUQLD'HOLJKW
6DUGLQHV6WDU.ZLWK.RVKHUIRU3DVVRYHUVHDO
RQO\7XQD'HOLJKWZLWK6WDU.SFHUWL¿FDWLRQPXVW
VD\PD\EHXVHGIRU3DVVRYHU.LQJRIWKH6HD
&5&+DGGDU¶V7XQD.$-8QJDU¶V
28S%HQ]¶V6WDU.S3KLOO\)RRGV6WDU.S
0UV$GOHUV28S0RWKHUV28S.HGHP
28S0DQLVFKHZLW]28S'DJLP28S9LWD
28S8QJDU¶V*H¿OWH)LVK28S7XY7DDP
2.S*HIHQ7XQD28S5R\DOH28S2FHDQ
*RXUPHW28S$%*H¿OWH)LVKUHJXODUDQG
VXJDUIUHH28S%DQQHU28S*HIHQ28S
1DWKDQ¶V28S6DOPROX[*RXUPHW.RI.S7XY
7DDP2.S(OI+HUULQJ28S/DVFR28S
6HOHFWHG5DOSK¶V0DUNHWVFDUU\IUHVK¿VKZLWK5&&
ODEHODQGEOXHSDFNDJLQJ.LQHUHW28S'DJJLP
28S(PSLUH28S)UHVKZDWHU
UDZXQFRDWHG¿VKRQO\7KLVGRHVQRWLQFOXGH
DQ\FRDWHGRU¿VKEOHQGV+HUULQJ%URRN6WDU.
/LHEHU¶V:HLVVPDQGHO
Fish (Lox)9LWD28S7KUHH6WDU28S
6SULQJ¿HOG28S'LDPRQG28S5LWH)RRGV
28S6DOPRQ6DODPLSDUHYH&ROG&XWV28S
Fish (Smoked)$FPH.RI.S$PHULFDQ6PRNHG
)LVK.RI.S6DOPROX[&KXEV5DLQERZ7URXW
6DOPRQ6DOPRQ1RYD:KLWH)LVK.RI.S*HIHQ
6PRNHG6DOPRQ28S
Food Coloring+DGGDU.$-
French Fries.LQHUHW28S
Frozen Meals & Side Dishes.LQHUHW0HDOV
0DFDURQL&KHHVH28&KRORY<LVURHO.LQHUHW
9HJHWDEOH3L]]D3RSSHUV28&KXJ&KDVDP
6RIHU.LQHUHW)UHQFK)ULHV
Fruits And Vegetables (Canned and Packaged)
&DOLIRUQLD'HOLJKW6WDU.PXVWVD\.RVKHUIRU
3DVVRYHUWURSLFDOIUXLWFRFNWDLOPDQGDULQRUDQJHV
6HDVRQ28S*HIHQ28S0DQLVFKHZLW]
28S8QJDU¶V6RXU3LWWHG&KHUULHV28S
6LPFKD&UDQEHUU\6DXFH&&5S
Fruits (Canned)+DGGDU.$-S/LHEHU¶V
:HLVVPDQGHOS0LVKSDFKD28S6HDVRQ
&DOLIRUQLD'HOLJKW
Fruits (Dried)7UDGHU-RH¶V6WDU.S6XQ:RUOG
28S'HO0RQWH6OLFH+RPD6WDU.S&DOLIRUQLD
+L/LWHV28S&DOLIRUQLD3UXQH&R2.S&DODYR
3LWWHG'DWHV:KROH'DWHV&LQGHUHOOD5DLVLQV'ROH
3LWWHG'DWHV3UXQHV1DWXUDO5DLVLQV6XQJORZ
3LWWHG'DWHV:KROH'DWHV&KRSSHG'DWHV6XQ
:RUOG3LWWHG'DWHVZKROHRQO\0DUULDQLZLWK
28S6HDVRQZLWK28S)HVWLYHZLWK28S
%RQQHU2UJDQLF5DLVLQV28S,W¶V'HOLVK
+HDUW.&DOLIRUQLD3UXQH3DFNLQJ&RPSDQ\
28S*UHDW/DNHV7XUNLVK$SULFRWV)LJV6WDU.
*OLFNV5DLVLQV.-S+DGOH\¶V2.SRQO\6HWWRQ
,QWHUQDWLRQDO)RRGV2.SRQO\*HIHQ)UXLW/HDWKHU
28S.OHLQV2.S
Fruits (Frozen)%RGHN28S*UDQDGDLVD28S
5DLQERZ)DUPV2.S
*H¿OWH)LVK*OLFN¶V.$-+DGGDU.$-
Gelatin6ZHHW&LW\1HZ<RUN%DGDW]0DFKD]HNDL
+DGDDV
Gift Packs&DOLIRUQLD+L/LWHV28S
&RUQXFRSLD6.26+(5+RZ6ZHHW,W
,V.RI.S%DOWLPRUH0DU\ODQG.RVKHU&RQQHFWLRQ
.RI.S
Grape Juice5:.QXGVRQ28S+HLQHNH¶V
6SDUNOLQJ*UDSH-XLFH28S:HOFK¶V*UDSH-XLFH
28S.HGHP2UJDQLF*UDSH-XLFH28S6HDVRQ
*UDSH-XLFH28S&DUPHO*UDSH-XLFH28S
6DYLRQ28S7DPSUL*UDSH-XLFH28S7L5RVK
28S$IWHU7KH)DOO28S.HVVHU2.S*HIHQ
28S5RNHDFK28S/DQGRI9LQHV2UJDQLF
*UDSH-XLFH2.S
Gum(OLWH28S3DVNHV]28S%ORRP28S
0XVW6XJDU)UHH*XP28S
Honey - 5RNHDFK28S)HVWLYH28S6HDVRQ
28S+DGGDU.$-:HVWHUQ&RPPHUFH2.S
*HIHQ28S0DQLVFKHZLW]28S*HIHQ28S
/LHEHU¶V:HLVVPDQGHO(LQ+DURG0HXFKDG1DWXUDO
+RQH\&KRVRP6RIHUS'XWFK*ROG28S
0FOXUH¶V28S/LQ¶V)DUP+RUVHUDGLVK%HQ]¶V
6WDU.8QJHU¶V6WDU.%D7DPSWH28S*ROG¶V
28S0DQLVFKHZLW]28S0HDO0DUW28S
6HDVRQ28S5RNHDFK28S6LOYHU6SULQJ
28S+DGGDU.$-
Horseradish±6LOYHU6SULQJ2.S3RODQGV%HVW
2.S*ROGHQ7DVWH2.S
Hot Chocolate Mix+DGGDU.$-&KRORY<LVURHO
.R6XUH&KRORY<LVURHO6WDU.S.RMHO28S
+RW6DXFH±%ODQFKDUG2.S
Ice Cream.OHLQV'HEHULW]HQ5DY3ULGHRIWKH
)DUP&KRORY<LVURHOWKH\DOVRPDNHSDUHYHLFHV
6WDU.S.LQQHUHW28S3DVVRYHU'HOLJKW28S
*OLGD&KRORY<LVURHO0DQLVFKHZLW]28S
Ices3ULGHRIWKH)DUP6WDU.S.OHLQ'HEHUFLQHU
5DY.LQHUHW28S3DVFDOV.6$SDQG%ORRP
XQGHUWKHVXSHUYLVLRQRI5DY/DQGDX&\UN
*RXUPHW28S%URWKHU¶V,QWHUQDWLRQDO'HVVHUWV
.RI.S
ITEMS THAT ARE RELIABLY CERTIFIED
FOR PASSOVER (FOR 5773-2013)
Jams & Jellies Preserves$WODV3UHVHUYHV&R
2..HGHP28S0DQLVFKHZLW]28S3RODQHU
28S6HDVRQ28S+DGGDU.$-28S
*HIHQ28S6WUHLWV.RI.S2VHP28-HOV
'HVVHUW.RMHO28S&DUPHO28S)HVWLYH
28S2VHP28S.R6XUH9LFWRU¶V28S
(O\RQ.&/+DGGDU.$-
Juices (Fresh)1HZ6TXDUH2UDQJH.HGHP
&UDQEHUU\*UDSH2UJDQLF*UDSH-XLFH28S
6HDVRQ¶V*UDSHIUXLW$SSOH3LQHDSSOH3UXQH
2UDQJH28S6WUHLW¶V$SSOH*UDSH-XLFH
7RUSHGR-XLFHXQGHUWKHVXSHUYLVLRQRI5DY
/DQGDX+HLQHNH¶V6SDUNOLQJ*UDSH-XLFH
28S)HVWLYH28S)LQDVW28S7URSLFDQD
2.S0RUQLQJ6HOHFW6WDU.$SSOH(YH
2.S+DGGDU.$-*HIHQ28S&HUHV
6WDU.S(GHQ6WDU.S0DQLVFKHZLW]28S
+.63RPHJUDQDWH-XLFH28
Juices (Frozen)DQ\EUDQGQDPHXQVZHHWHQHG
JUDGH$IUR]HQRUDQJHMXLFHFRQFHQWUDWHLH
0LQXWH0DLGSHUFHQWWDQJHULQHRUJUDSHIUXLW
FRQFHQWUDWH-XVW3LN¶W28S7UDGLWLRQ
Ketchup2VHP28S)HVWLYH28S5RNHDFK
28S6HDVRQ28S8QJDU¶V28S6WUHLW¶V
.RI.S+DGGDU.$-*HIHQ28S*ROG¶V
28S*OLFN¶V.$-6DYLRQ)LUHPDQ¶V)UHQ]\
6SLF\.HWFKXS28
Latkes.LQHUHW28S
Lemon Juice6HDVRQ&R28S
Lime Juice6HDVRQ&R28S
Lip Balm'U)LVFKHU8OWUDVRO5DEEL.RUDFK
.RVKHUIRU3HVDFK6XSHU/DQ1DWXUH¶V1DWXUDO
0RLVWXUL]HUIRU&KDSSHG/LSV5DEEL<*UXEHU
Liquid Sugar)ORVZHHW28S9O30DVWHUV
28S
Liquor*LYRQ&KRFRODWH%UDQG\DQG9RGND
28S.HGHP9RGND28S.HGHP9HUPRXWK
28S.HGHP%HQWHQXUD&RUGLDOV28S&DUPHO
ZLWK28S9LQSURP7UR\DQ%UDQG\6WDU.S
-HOLQHNVOLYRYLW]SHDUEUDQG\28S'LVWLOOHULHJLQ
28S1R9RGND*LQ28S$VNDORQ$UDN
2.S
Lotion - 6XSHU/DQ0RLVWXUL]HU/RWLRQ$GZH6NLQ
&UHDP'U)LVFKHU+DQG&UHDP
Macaroons+DGGDU.$-0DQLVFKHZLW]28S
*OLFN¶V.$-0HVVLQJ.RI.
Mail Order Meals:
$YL*ODWW
$YLJODWWFRP
Kosher Cornucopia
Kosher Connection
Mandarin Oranges+DGGDU.$-&DOLIRUQLD
'HOLJKW6WDU.S
Maple Syrup-DQHULF0DSOH6\UXS0.S
5DQFKR&XFDPXQJD2.S$GLURQGDFN.RI.S
MargarinH5DOSKV28S0RWKHUV28S
23
Marinades6DYLRQ28
Marshmallows6KXIUD*ROGHQ)OXII28S.RMHO
¿VKJHODWLQ6WDU.S7]DOL¶V28S0DQLVFKHZLW]
28S+DGGDU.$-6DYLRQ28
Matzoh - 5DNXVHQ*RRGPDQ¶V28S+RURZLW]
0DUJDUHWHQ28S<HKXGDK28S0DQLVFKHZLW]
28S%HO]7]HOHP3RSHK+RO\ODQG28S
+DGGDU6KPXUDK.$-<DQRYVN\+126%XHQRV
$LUHV$UJHQWLQD&DUPHO283URPLVHG/DQG
2UJDQLF0DW]R28<DUGHQ280DW]R%DOO0L[
+RURZLW]0DUJDUHWHQ28S0DQLVFKHZLW]28S
6WUHLWV.RI.S5RNHDFK28S&UR\GHQ+RXVH
28S/DNHZRRGZKROHZKHDWVSHOWRDW.RI.S
ZZZODNHZRRGPDW]RKFRP
Matzo0HDO*RRGPDQ¶V28SRQO\+RURZLW]
0DUJDUHWHQ28S<DQRYVN\+126%XHQRV$LUHV
$UJHQWLQD(P+DFKLWD2.S
Matza - (Chocolate Covered)FKHFNZLWKORFDO
5DEELDVWRSHUPLVVLELOLW\RQ3HVDFK+ROLGD\&DQG\
+DGGDU.$-0DQLVFKHZLW]28S*HIHQ6KPXUD
28S
Matza (Oat)WKHIROORZLQJDUHORFDWLRQVDURXQG
WKHFRXQWU\WRRUGHURDW0DW]RV/DNHZRRG
/RV$QJHOHV%URRNO\Q
RU%DOWLPRUH
/DNHZRRG0DW]RKZZZODNHZRRGPDW]RKFRP
*OXWHQ)UHH2DWPDW]RVIURP*ROGHUV*UHHQ
+DVKJDFKD'D\DQ:HVWKHLPRI0DQFKHVWHU%HLV
'LQVXOD#ZDLWURVHFRPZZZJOXWHQIUHHRDWPDW]RV
FRP
Matza (Spelt)RU
+DGGDU.$-6KPXUD0LQ/DNHZRRGZZZ
ODNHZRRGPDW]RKFRP
Mayonnaise%HQ]¶V6WDU.+DGGDU.$-
)HVWLYH28S6HDVRQ28S0RWKHUV28S
5RNHDFK28S8QJDU¶V0DQLVFKHZLW]28S
*HIHQ28S6WUHLWV.RI.S*OLFN¶V.$-
Meals (Prepackaged)*RXUPHW.RVKHU.RI.S
0HDO0DUW28
Meat Deli28S0HDO0DUW28S
Medicines/Vitamins$GZHZLWK3HVDFK
&HUWL¿FDWLRQ6HHZHEVLWHZZZNRVKHUYLWDPLQVFRP
/DQGDX9LWDPLQ&
Milk (Dry).R6XUH3RZGHU6WDU.S&KRORY
<LVURHO'DLU\PHQ28S3DUPDODW.RI.S
Milk (Chocolate / White)3ULGHRIWKH)DUP
6WDU.S.R6XUH6WDU.S
Mixes0RWKHU¶V6WXI¿QJ&RDWLQJ28S+DGGDU
.$-.DVKHU9¶6DPHDFK
Mouthwash and Mint Spray$GZH.$-
0XI¿QV2EHUODQGHU¶V.RI.S
Mushrooms (Dried).LUVFK.RI.S
Mustard,PLWDWLRQ6DYLRQ)LUHPDQ¶V)UHQ]\
285RNHDFK'LMRQ0XVWDUG28S
Non Dairy Creamer.LQHUHW28S8QJHU¶V
6WDU.S(GHQ6WDU.S
Noodles - 6HDVRQ¶V%UDQG28S0DQLVFKHZLW]
28S+RURZLW]0DUJDUHWHQ28S
Nuts - *HIHQ28S6DYLRQ28S,W¶V'HOLVK
+HDUW.S0HVKXJD1XWV28S6HWWRQ)DUPV
24
ITEMS THAT ARE RELIABLY CERTIFIED
FOR PASSOVER (FOR 5773-2013)
2.S+DGGDU.$-2QHJ.$-*ROGHQ)OXII
28S.OHLQV2.S
Oil - %HQ]L¶V6WDU.S1XWROD28S+XQW:HVVRQ
2.S)HVWLYH28S0RWKHUV&KRLFH28S
/LEHUW\28S+DGGDU.$-*HIHQ28S)HVWLYH
&RWWRQVHHG28S6WUHLWV.RI.S0DQLVFKHZLW]
28S+DLQ2LOV.RI.SRQO\-RVHSK$GDPV
+HUEDO)ODYRUHG2LOV&RUS2.SRQO\%DUWHQXUD
*UDSHVHHG2LO28
Oil Sprays0RWKHU¶V2OLYH2LO6SUD\28S
5RNHDFK28S6HDVRQ¶V28S+DGGDU.$-
Olives - +DGGDU.$-*ROGHQ)OXII.&/*HIHQ
2VHP28S+LGRULP2OLYHV28S.YX]DW<DYQH
2OLYHV28S
Olive Oil0RWKHU¶VFRRNLQJVSUD\28S6HDVRQ
28S*OLFN¶V.$-S)LWXFFL2OLYH2LO6WDU.
6XOWDQ¶V
Oven Bags5H\QROGV
3DQFDNHDQG0XI¿Q0L[7UDGLWLRQ0DQLVFKHZLW]
28S0RWKHU¶V
Parchment Paper&KHI¶V6HOHFW6WDU.S
%DNHPDUN6WDU.
Peppers8QJDU¶V6WDU.S2VHP28S
Personal Care Products$GZH28S
Pickles+DGGDU.$-%D7DPSWH28S)HVWLYH
28S*HIHQ28S6HDVRQ28S2VHP
28S8QJDU¶V6WDU.S
Pie Crust - 5RNHDFK28S0DQLVFKHZLW]28S
Pizza'D\HLQX3DVVRYHU3L]]D28S
Potato Chips6HDVRQ¶V28S3DVNHV]
28S%ORRPV28S&DSH&RG28S5XIÀH¶V
28S+DGGDU.$-0DQLVFKHZLW]28S7HUUD
9HJHWDEOH&KLSV.RI.
Potato Pancake Mix+RURZLW]0DUJDUHWHQ28S
0DQLVFKHZLW]28S6WUHLWV.RI.S
Potato Starch+LVDFKGXV&5&+DGGDU.$-
*HIHQ28S*RRGPDQ¶V28S0DQLVFKHZLW]
28S
Potato Sticks and Chips3DVNHV]28S
%ORRP¶V28S*ROGHQ)OXII.&/7HUUD<XNRQ
*ROG3RWDWR&KLSV.RI.SRQO\
Poultry - DQ\UHOLDEOH.RVKHUEUDQGWKDWLVQRW
SURFHVVHGRUFRDWHGLHUDZ6RPHSRSXODU
EUDQGVDUH(PSLUH)DOOV9LQHODQG*DOLO6WDU.
5R\DO6WDU.(PSLUH5DZ*URXQG7XUNH\LVRQO\
DFFHSWDEOHZLWKWKH28S%HO]'DYLG(OOLRW0HDO
0DUW28SDQG1DRPL28S
NOTE:(PSLUHSURGXFHVPDQ\RILWVSURGXFWV
\HDUURXQG.RVKHUIRU3HVDFK,QIDFWPRVWRIWKHLU
SURGXFWVIDOOXQGHUWKLVFDWHJRU\6RPHH[DPSOHV
DUH%DUEHTXH&KLFNHQ5RWLVVHULH&KLFNHQ
%DUEHTXH7XUNH\&KLFNHQ)DW&RRNHG7XUNH\
%UHDVW:KLWH7XUNH\5ROO7XUNH\%RORJQD5ROO
7XUNH\6DODPL5ROO&KLFNHQ)UDQNV7XUNH\)UDQNV
6PRNHG7XUNH\%UHDVW6OLFHV&KLFNHQ%RORJQD
6OLFHV7XUNH\%RORJQD6OLFHV2UJDQLF:LVH
&KLFNHQV28
Preserves+DGGDU-XVW)UXLWQRVXJDU.$-
.HGHP28S2VHP28S6HDVRQ28S0RRQ
6KLQH7UDGLQJ&R5DEEL7HLFKPDQ28S
0DQLVKFKHZLW]28S
Puddings - +DGGDU28S2VHP28S
0DQLVFKHZLW]28S.R-HO28S
Quinoa±$QFLHQW+DUYHVW6WDU.SR]
ZZZTXLQRDQHW
6HWWRQ)DUPV6WDU.S2]
ZZZVHWWRQIDUPVFRP
$QGHDQZKROHVDOH6XJDWIURP2VHP
1DWXUDO(DUWK±6WDU.S6HWWRQ)DUPV±6WDU.S
6WUHLW¶V±.RI.S
ZZZTXLQRDQHW
Rice - IRUWKRVH6HSKDUGLPZKRXVHULFHRQ3HVDFK
Carolina rice from4XDOLW\)UR]HQGLVWULEXWRUVLV
DFFHSWDEOH±
Salad (Bagged)6WDU.EDJJHGSURGXFHLVNRVKHU
IRU3HVDFKHYHQZLWKRXWWKH3HVDFKGHVLJQDWLRQRQ
WKHEDJ7KHIROORZLQJEDJJHGVDODGVDUH.RVKHU
IRU3HVDFKRQO\ZKHQEHDULQJ6WDU.V\PERO
'ROH$PHULFDQ6DODG%OHQG$QJHO+DLU&ROHVODZ
%XWWHU/HWWXFH0L[6DODG%OHQG&KRSSHG5RPDLQH
&ODVVLF&ROHVODZ&ODVVLF,FHEHUJ6DODGV&ODVVLF
5RPDLQH&ODVVLF5RPDLQH%OHQG(XURSHDQ6DODG
%OHQG)LHOG*UHHQV6DODG%OHQG)UHQFK6DODG
%OHQG*UHHQHU6HOHFWLRQ+HDUWVRI5RPDLQH0L[
6DODG%OHQG,WDOLDQ6DODG%OHQG-XVW/HWWXFH
/HDI\5RPDLQH6DODG%OHQG0HGLWHUUDQHDQ6DODG
%OHQG3UHFXW&DEEDJH3UHFXW/HWWXFH6KUHGGHG
&DUURWV6KUHGGHG*UHHQ&DEEDJH6KUHGGHG
/HWWXFH6KUHGGHG5HG&DEEDJH
Salad Dressing%ODQFKDUG%ODQFKDUG28S
0RWKHUV28S6DYLRQ0DQLVFKHZLW]28S
)HVWLYH28S6HDVRQ¶V28S+DGGDU.$-
*HIHQ28S6DEUD2.S
Salsa - *ROG¶V28S6HDVRQ¶V28S
0DQLVFKHZLW]28S(P]HH6DOVD28S
Salt7DEOH+DGGDU.$-)HVWLYH28S*HIHQ
28S*R\D28S.URJHU28S6HDVRQ
28S6\VFR28S/DLVK6HD6DOW%DGDW]S
*OLFN¶V.$-
Salt (Substitute))UHHGD)UHH6DOWQRVDOW
XQVHDVRQHG6SLFHRI/LIHQRVDOWQRVXJDU
Sauce - 6HDVRQ0DULQDUD'XFN6DXFHV28S
*ROG¶V28S0DQLVFKHZLW]28S)HVWLYH
28S.HGHP6WHDN6DXFH28S+DGGDU.$-
0UV$GOHUV28SDQG6DYLRQ28S*HIHQ
28S7UDGLWLRQ5RNHDFK0DULQDUD6DXFH28S
*OLFN¶V.$-S0LVKSDFKD%DUE4XH6DXFH
28S*HIHQ%DUE4XH6DXFH28S/DLVK
+RW5HG3HSSHU6DXFH28S6LPFKD0DULQDGH
&5&S2VHP28
Scouring Pads*HIHQ6FRWFK%ULWH28S
5RNHDFK28S6HDVRQ¶V28S*OLFN¶V.$-
0LVKSDFKD28
Seltzer6DUDWRJD&DUERQDWHG6SULQJ:DWHU28S
Silver Polish - 5RNHDFK28S+DGGDU.$-
$GZH.$-
Soda - &RNHZLWK28SRQO\'U%URZQZLWK.S
RQO\XQGHUVXSHUYLVLRQRI5DEEL%XNVSDQ5&
&ROD28S,W¶V'HOLVK+HDUW.+DQVHQ¶V28S
0D\LP&KD\LP3HSVL.RI.SRQO\6FKZHSSHV
6HOW]HU.RI.S*OLFN¶V.$-
ITEMS THAT ARE RELIABLY CERTIFIED
FOR PASSOVER (FOR 5773-2013)
Soap±*HIHQ28S
Soups & Soup Mixes&UR\GHQ+RXVH28S
7HOPD28S0DQLVFKHZLW]6RXSLQD&XS&DQQHG
DQG%URWK28S5RNHDFK28S9,328S
&DUPHO28S+DGGDU.$-*ROG¶V28S
+RURZLW]0DUJDUHWHQ28S7UDGLWLRQ.RI.
7DEDWFKQLFN¶V.RI.S2VHP28
Soup Nuts)HVWLYH28S*RRGPDQ¶V
28S6HDVRQ¶V28S+DGGDU.$-+RURZLW]
0DUJDUHWHQ28S0DQLVFKHZLW]28S
Spices5RNHDFK28S,W¶V'HOLVK+HDUW.
6SLFH7LPH28S+DGGDU.$-*HIHQ28S
)HVWLYH28S*LOUR\)DUPV28S/LHEHU¶V
:HLVVPDQGHO
Spreads0RVKH$OL¶V7RPDWR%DVLO
0HGLWHUUDQHDQ28S
Stool Softener$GZH28S
Sugar (Brown)'RPLQRZLWK2.S'RPLQR
'HPHUDUD2.S6SUHFNOHV28S+DGGDU.$-
Sugar (White)'RPLQR2.S/XFN\%UDQG
28S6SUHFNOHV28S*HIHQ2.S+DGGDU
&5&.$-'RPLQR'HPHUDUH6XJDU2.S
/LHEHU¶V:HLVVPDQGHO
Sugar Substitutes*HIHQ28S.RMHO28S
9,30DVWHU28S6ZHHWµ1/RZ28S+HDOWK
*DUGHQ[\OLWRO28S'66XFUDORVH6SOHQGDW\SH
6WDU.6XFUD]LW%DGDW]$LGD&KDUDLGLV
Syrup$GLURQGDFN0DSOH6\UXS.RI.S.HGHP
28S%RVFR28S6DYLRQ28S6HDVRQ
28S+DGGDU.$-0DQLVFKHZLW]&KRFRODWH
DQG3DQFDNH28S.HGHP9DQLOOD6\UXS28S
6LODQ'DWH6\UXS5DEEL'LGL)R[¶V8%HW5DEEL
6FKDSLUR2VHP28
Tea Bags/LSWRQ28S)HVWLYH28S6ZHHW
7RXFK7HDLQFOXGLQJFDIIHLQHIUHH28S
*HIHQ28S:LVVRW]N\28S+DGGDU.$-
/LSWRQ'HFDIIHLQDWHG8QÀDYRUHG7HD%DJV
28ZLWKRUZLWKRXW3HVDFKGHVLJQDWLRQ
Tea (Herbal)*RRG(DUWK28S*¶'D\
+HUEDO7HDV6WDU.:LVVRW]N\28S7DDQXJ
&KDPRPLOOH6HQQDDQG0LQW7HD%LJHORZ*UHHQ
7HD&LQQDPRQ6WLFN7HD(QJOLVK%UHDNIDVW7HD
3HSSHUPLQW7HDHWF
Tea (Instant)1HVWHD8QÀDYRUHGUHJXODUDQG
GHFDI
Toothpaste - $GZH.RI.&UHVWIURP(QJODQG
ZLWK0.S
Vanilla Sugar+DGGDU.$-
Vegetables (Canned & Jarred6HDVRQ
28S&DOLIRUQLD'HOLJKW6WDU.S)HVWLYH28S
+DGGDU.$-*HIHQ28S5RNHDFK
28S0DQLVFKHZLW]28S%ORRP\¶V3LFNOHG
%HHWV28S/LHEHU¶V:LHVVPDQGHO*OLFN¶V<DPV
LQ6\UXSDQG0XVKURRPV.$-S0LVKSDFKD28S
Vegetables (Frozen)%RGHN28S*DUGHQ3XUH
28S0HLWDY28%7DP6WDU.S(GHQ
6WDU.
Vegetables (Fresh)%RGHN
Vegetable Soup Medley28S0.S5DEEL
*LVVLQJHU&5&S'ROH.$-S&KDVVD/HWWXFH
25
2.
Vegetables 6XQGULHG7RPDWRHV/¶HVSULW'H
&DPSDJQH&DUE&KLFNHQ7XUNH\6DXVDJHV
Vinegar - %DUWHQXUD28S&DUPHO28S+HLQ]
28S.HGHP28S0DQLVFKHZLW]%DOVDPLFDQG
:KLWH28S6HDVRQ28S+DGGDU.$-0D]]HWWL
%DOVDPLF9LQHJDU5DEEL*HUHOLFNS*OLFN¶V.$-
2VHP28
Vinegar - Balsamic.HGHP28=HKOHPHU5DY
%DUWHQXUD285DEEL*DUHOLFN
Vitamins and Supplements/DQGDX9LWDPLQ&
/LTXLG5DEEL7HLWHOEDXPWKH9ROYHU5DYZZZ
NRVKHUYLWDPLQVFRP
Walnut Oil.HGHP28S6KXIUD+DGGDU.$-
*HIHQ28S1XW2OD28S
Water(YLDQ28S9ROXLF28S9DOOH\6SULQJ
:DWHU28S63HOHJULQR6SULQJ:DWHU28S
Whip Topping.LQHUHW.RI.SRQO\
Wines & Liquors&DUPHODOODUH28SDQG
0HYXVKDO$UDN&LWURQ/LTXRU+DJDIHQ28S
0HYXVKDO$PLDG2.S7HDO/DNH2.S.HGHP
9HUPRXWK6DYLRQ28S&KXJ&KDVDP6RIHU
28S.HVVHU5DVKL2.S*DQ(GHQ28S
%DURQ+HU]RJ&DOLIRUQLD:LQH%DUWHQXUD28S
0HYXVKDO&ORYLV/HVLHXWUH28S&XYHH/HRQ
28S+HU]RJ)UHQFK28S-)XUVW28S
6WDU:KLWH28S7DP3UL:HLQVWRFN&DOLIRUQLD
Wine
28S0DQLVFKHZLW]28SRQO\.RUEHO
28SRQO\*DPOD28SQRWDOODUH0HYXVKDO
$EDUEDQHO.HGHPQRWH/LWUHDUHQRW
0HYXVKDO(PEDVV\:LQH6WDU.S5HFDQWL:LQHV
28S
Wine (Cooking).HGHP28=HKOHPHU5DY
6DYLRQ28S:LQH9LQHJDU.HGHP%DOVDPLF
:KLWH:LQH9LQHJDU28S+HLQ]28S
:LQHV:LWK3HVDFK&HUWL¿FDWLRQIURPWKH)ROORZLQJ
5DEELV.DVKUXV$JHQFLHV$UH5HFRPPHQGHG
5DY%DEDG7DUWLNRYHU5DY%HGDW]<HUXVKDOD\LP
5DY%HOLQRZ5DY&KD]DQ&KXJ&KDVDP6RIHU
3HWDFK7LNYDK5DEEL)UDQNIXUWHU5DY*RUHOLFN
5DEEL+RIIPDQ+XQJDU\/XEDYLWFK%HLV'LQ1HZ
6TXDUH5DEEL2\HUEDFK5DY7HLWHOEDXP1LUEDWXU
5DY7]HOHPHU5DY5DEEL+LOOHO:HLQEHUJHU5DEEL
:HLVVPDQGHO5DEEL=HOEDFK5DEEL=XVKH%OHFK
Xylitol±+HDOWK*DUGHQ28S
Yogurt - %UH\HUV28S6OLP828S'DQQRQ
28S
ITEMS TO BE CAUTIOUS OF FOR PASSOVER
(5773-2013)
Airline Meals - Chometz meals are sometimes
VHUYHGE\PLVWDNH
Apple Juice - 1XWULHQWVVRPHWLPHVSURFHVVHGRQ
YLQHJDUHTXLSPHQWHQ]\PHVFODULI\LQJDJHQWV
Applesauce - CRUQV\UXSVXJDUGH[WURVHÀDYRULQJ
Baby Cereals & Baby Food - 0D\FRQWDLQZKHDW
VXJDUDQGFDQEHPDGHRQChometzHTXLSPHQW
Baby Powder0D\FRQWDLQChometz
Bird Food0DQ\FRQWDLQJUDLQ
Brown Sugar&XOWXUH\HDVWFRUQVWDUFKPD\
26
ITEMS TO BE CAUTIOUS OF FOR
PASSOVER (FOR 5773-2013)
FRQWDLQZKHDWVWDUFK
Butter6DOWFRORULQJSUHVHUYDWLYHVQXWULHQWV
FXOWXUHODFWLFDFLGIURPFRUQ
Candied FruitGH[WURVHPD\FRQWDLQSRZGHUHG
VXJDUÀRXU
Canned & Frozen Fruit, Vegetables with Syrup
PD\EHLRGL]HGZLWKÀRXUGH[WURVHGLHWHWLFPD\
FRQWDLQJUDSHMXLFHFRUQV\UXS
Cat FoodZKHDWFKHHVHRUZKH\ZLWKPHDWRDWV
DQGEDUOH\VHHOLVWLQJ
Cheese & Cottage CheeseVWDELOL]HUVFRUQ
VXJDUFRDJXODWLQJDJHQWPLFURELDOUHQQHWIURPUHDO
ChometzGH[WURVHFXOWXUHV
Chewing GumFRUQV\UXSÀDYRULQJ
Cigars)ODYRUHGChometz alcohol
Chocolate & Chocolate MilkPDOWUHDOChometz
glucose
Chocolate SpreadIURP,VUDHOPD\FRQWDLQ
Kitniyos. Note: even though some chocolate
VSUHDGVZLWKKitniyosPD\VWDWHRQWKHODEHO.)3LW
LVDFFHSWDEOHRQO\IRU6HSKDUGLPZKRHDW.LWQL\RV
Cider VinegarPD\FRQWDLQ\HDVWWKDWLVUHDO
Chometz
Coffee*HQHUDO)RRGV,QWHUQDWLRQDOFXUUHQWO\
LVSURFHVVHGRQChometzPDFKLQHU\&RIIHH
VXEVWLWXWHVLH3HURDQGRWKHUVFRQWDLQJUDLQ
Coffee (DecaffeinatedPD\KDYHEHHQSURFHVVHG
ZLWKHWK\ODFHWDWHGHULYHGRIJUDLQDOFRKROFRIIHH
ÀDYRULQJPD\FRQWDLQChometzDOFRKRODVZHOODV
QRQ.RVKHUÀDYRULQJ
Condensed MilkVXJDUSUHVHUYDWLYHVDQGRLOWR
reconstitute
Confectionery SugarFRUQVWDUFKIRULQVWDQFH
WKUHHSHUFHQWLQ&+PD\FRQWDLQZKHDWVWDUFK
Creamer (Non-dairy)ZKH\HPXOVL¿HUVZKLFKDUH
GDLU\DQG.LWQL\RVVRPHFRQWDLQFRUQV\UXS
Dextrose - FRUQGHULYDWLYH
Dishwashing DetergentFHW\ODOFRKROQRW
.RVKHUJUDLQDOFRKRO
Dog FoodEDUOH\RDWVZKHDWFKHHVHRUZKH\DQG
PHDWVHHOLVWLQJ
Dried Fruits and RaisinsGULHGLQChometzRYHQV
PD\FRQWDLQ.LWQL\RVRLOÀRXU
(PXOVL¿HUVFDQFRQWDLQJOXFRVH
Fish FoodZKHDWVHHOLVWLQJ
Fish Frozen±ZLOGVDOPRQPD\KDYHEHHQIUR]HQLQ
corn syrup brine
Flour - KDVEHHQEOHDFKHGDQGZDVKHGWKHUHIRUH
Chometz
Frozen Fruit DrinkXVXDOO\FRQWDLQFRUQV\UXS
ÀDYRULQJ
Gelatin (Beef)IURPDOORYHUWKHZRUOGLQFOXGLQJ
,VUDHOQRWDFFHSWDEOHXQOHVVLWKDVUHOLDEOH
FHUWL¿FDWLRQDVLWXVXDOO\LVSURFHVVHGIURP
QRQ.RVKHUVODXJKWHUHGDQLPDOV
Glucose - FRUQRUZKHDWGHULYDWLYH
HoneyFRUQV\UXSFRORULQJHYHQLIQRWOLVWHG
([WUDFDXWLRQQHHGHGLILWLVIURP7XUNH\RU&KLQD
HorseradishYLQHJDUVZHHWHQHUVK\GURO\]HG
YHJHWDEOHSURWHLQZKHDWJOXWHQ
Hydrolized Vegetable Protein+93RIWHQLV
Chometz
Ice CreamVXJDUÀDYRULQJVVWDELOL]HUV
Ingredients$VFRUELF$FLG&DUDPHO&LWULF$FLG
RIWHQGHULYHGIURPJOXFRVH*OXFRVHFDQEH
GHULYHGIURPZKHDWIHUPHQWDWLRQ+93K\GUROL]HG
YHJHWDEOHSURWHLQ9LWDPLQ&
Israeli Products7HUXPD0DDVHU6KHPLWDPXVW
KDYHUHOLDEOHFHUWL¿FDWLRQ
Ketchup - VWDELOL]HUVRLOGH[WURVHYLQHJDUUHDO
chometzÀDYRULQJV
Kitniyos - LQFOXGHVEHDQVULFHFLWULFDFLGFRUQ
GH[WURVHVRPHW\SHVRIÀDYRULQJK\GUROL]HG
YHJHWDEOHSURWHLQVR\SHDQXWVVHVDPHVHHGV
VRUELWROVWDUFK
LactaidWDEOHWVPD\FRQWDLQ&KRPHW]
LecithinKitniyos
LiquorPD\KDYHJUDLQDOFRKROEDVHZLQHRUJUDLQ
DOFRKRORUZLQHDOFRKRO
MSG - ZKHDW
Maple Syrup±GHIRDPLQJDJHQWV
MargarineHPXOVL¿HUVDUWL¿FLDOÀDYRUVDOWVXJDU
oil
Maraschino CherriesJOXFRVHGH[WURVHFXW
FKHUULHVXVXDOO\DUHFRORUHGUHGZLWKFDUPLQHDQ
LQVHFWGHULYDWLYH
Mayonnaise06*IURPK\GURO\]HGSURWHLQRLO
ÀDYRULQJVVZHHWHQHUVYLQHJDU
Milk - PXVWEHERXJKWEHIRUH3HVDFKDQGSURFHVVHG
E\DGDLU\WKDWGRHVQRWPDNHFKRFRODWHPLONVHH
VHFWLRQRQPLON
Mustard - Kitniyos.6RPHPD\HYHQFRQWDLQDFWXDO
ChometzQRWWREHFRQIXVHGZLWK.RVKHUIRU
3DVVRYHULPLWDWLRQPXVWDUG
Nuts - %+$%+7VSUD\HGZLWK.LWQL\RVFRUQRLO
Oil - Kitniyos
Paper PlatesLQH[SHQVLYHFRDWHGZLWKVWDUFK
PeanutsFRQVLGHUHGKitniyosE\PRVWWUDGLWLRQV
Pecan Pieces or Midget - Chometz processing
Peeled VegetablesLHFDUURWVSRWDWRHVPD\EH
ZDVKHGDQGSUHVHUYHGZLWKFLWULFDFLGRUGH[WURVH
DQWLR[LGHQW
Pet FoodZKHDWPLONFKHHVHRUZKH\PL[HGZLWK
PHDWZKLFKLVQRWDFFHSWDEOH\HDUURXQGVHH
OLVWLQJ
PicklesYLQHJDUChometzÀDYRULQJV
Play DoughHGLEOHÀRXUPXVWEHGLVFDUGHGEHIRUH
3HVDFK
Powdered Cocoa (Sweetened)SRZGHUHGPLON
FRUQVZHHWHQHU
Products from Rabbanut of IsraelPD\FRQWDLQ
Kitniyos
Quinoa – UHTXLUHVYHUL¿FDWLRQWKDWLWLVQRWPL[HG
ZLWK&hometz6WDU.SDYDLODEOH
Rice$VKNHQD]LPGRQRWXVHULFHRQ3HVDFK
EHFDXVHLWLVFRQVLGHUHG.LWQL\RV6HSKDUDGLP
ZKRHDWULFHRQ3HVDFKPXVWXVHZLWK3HVDFK
FHUWL¿FDWLRQ
Roach Poison&RPEDWEUDQGHGLEOHChometz
EDLW
ITEMS TO BE CAUTIOUS OF FOR
PASSOVER (FOR 5773-2013)
Rubber Gloves3RZGHUHGChometzSRZGHU
Salads3UHSDUHGLQ%DJVPD\FRQWDLQFLWULFDFLG
Salt - WDEOHVDOWRIWHQFRQWDLQVGH[WURVHDQG
SRO\VRUEDWHHVSHFLDOO\ZKHQLRGL]HG
Snacks%RPED6QDFNVIURP2VHP,VUDHO
LVPDGHZLWKFRUQDQGSHDQXWV7KLVSURGXFWLV
FRQVLGHUHGWREHKitniyos even though some of the
SDFNDJHVPLVWDNHQO\EHDUDQ28S
Soda - ÀDYRULQJVGH[WURVHFRUQVXJDU
Soup cubes±7HOPDDQGRWKHUVUHJXODUO\FRQWDLQ
Chometz <HDVW
Soy Oil, Corn OilFRUQV\UXSVR\OHFLWKLQDOODUH
Kitniyos
Spices3URFHVVHGRU)ODYRUHGGH[WURVH
ÀDYRULQJPDFKLQHU\
SplendaFRQWDLQVKitniyos
SugarPDQ\VXJDUVDUHSURGXFHGIURPFRUQDQG
are Kitniyos
6XQÀRZHU6HHGVKitniyos
Tea (Instant)PD\FRQWDLQKitniyosVZHHWHQHU
Tea Bags$OOGHFDIIHLQDWHGWHDEDJVZLWKRXW
3HVDFKFHUWL¿FDWLRQDUHFRQVLGHUHGQRWSURSHUIRU
XVHRQ3HVDFK
Tea (HerbalChometz RUQRQ.RVKHUÀDYRULQJ
Tofu2IWHQSURFHVVHGXVLQJJUDLQ$OFRKRO
Chometz
Tomato ProductsYLQHJDUChometz)QXWULHQWV
VDOWVXJDUchometz machinery
Tonic WaterFRUQV\UXS
Tuna - K\GURO\]HGSURWHLQRLO
Vanilla ExtractFRUQV\UXSDOFRKRO
Vegetable wash±Kitniyos/Chometz
Vegetables (Frozen)FDQEHSURFHVVHGRQ
Chometz machinery
Vegetables from IsraelRIWHQ3HSSHUVTerumah,
Maaser, Shemita
Vitamins\HDVWVWDUFKFRUQGH[WURVHZKHDW
QRWH)UHHGDYLWDPLQVDUH&KRPHW]IUHH
Wine - FRUQVXJDUChometz alcohol. Note: not all
.RVKHUZLQHVDUH.RVKHUIRU3HVDFKDOVRPDQ\DUH
QRW0HYXVKDOFRRNHG&KHFNWKHODEHO
Yogurt - PLONSRZGHUHQ]\PHVÀDYRULQJVXJDU
UPDATES (5773/2013)
7KH6WDU.Hadar Machine Matzohs ZLOOEH
DYDLODEOHRQO\DVPLQXWHchabura Matzohs
7KHVHDUHWKHRQO\6WDU.PDFKLQH0DW]RKV
available this year
$OOStreit’s SURGXFWVSURGXFHGLQWKH8QLWHG6WDWHV
DUHXQGHUWKHGXHO+HFKVKHURI5DEEL0RVKH
6RORYHLWFKLNDQGWKH.RI.
From the COR:
3HJ9LWDQG3UHJ9LWIROLFYLWDPLQVDUH&25FHUWL¿HG
DQGDUHDFFHSWDEOHIRU3HVDFK
.FXSVIRU.HXULJPDFKLQHVDUHUHFRPPHQGHG
ZKHQEHDULQJWKH28LQWKHIROORZLQJUHJXODUQRW
GHFDI*UHHQPRXQWDLQFR±)DLU7UDGH+ROLGD\
)DLU7UDGHRUJDQLF)UHQFK5RDVW+RXVH%OHQG
/DNH/RGJH6XPDWUDQ'DUN0DJLF&RIIHH'RQXW
+RXVH([WUD%ROG6WDUEXFNV7XOO\¶V,WDOLDQ%DULVWD
3ULPD,WDOLDQ
27
NEW PRODUCTS (5773/2013)
Alle KHDWDQGVHUYHFKLFNHQVRXSFDEEDJHPHDW
Andean Quinoa6WDU.S
Manischewitz RUJDQLF0DW]DK±28S
Barkanit *RDWDQG6KHHW&KHHVH
28S±&KRORY<LVURHO
Eden RUJDQLF6SDJKHWWLVDXFH±2.S
Bartenura*UDSHVHHG2LO28S
Benz’s Ketchup
Blanchard & Blanchard6DODG'UHVVLQJVQHZ
ÀDYRUV
Blanchard & Blanchard :KROH:KHDW0DW]DVWLFNV
Cabot&KHGGDU&KHHVH28G±&KRORY6WDP
California DelightVXFUDOLV6SOHQGD6WDU.S
Dannon yogurtSODLQYDQLOOD&RIIHH28S
Dayenu 3L]]D5ROOVDQG3LHURJLHV
28S±ZLWK0DW]R0HDO
Dr. Fischer'HRGRUDQW6SUD\5DEEL6KORPR
.RUDFK
Gefen $OO1DWXUDO$SSOH6DXFH28S
Gefen $OPRQG%XWWHU28S
Gefen &DNHV&RRNLHVDQG)URVWLQJV28S
Gefen &XUO\1RVK6QDFNV28S
Gefen *OXWHQ)UHH&HUHDOV28S
Gefen ,FH3RSV28S
Geula 0DW]DKVDQG0DW]DK3URGXFWV28S
Gefen 6ZHHW5HOLVK28S
Glick’s $UWLFKRNH%RWWRPV28S
Glick’s ,PLWDWLRQ6R\DQG7HUL\DNL6DXFHV28S
Guiltless Gourmet vegetable chips
Guss 3LFNOHV28S
Haddar 3HVDFK3URGXFWVDOO28S
Haddar 0LON3RZGHU28S±&KRORY<LVURHO
Haddar $OPRQGDQG&DVKHZ%XWWHU28S
Haddar 0DW]DKVDQG0DW]DK3URGXFWV28S
Health Garden ;\OLWRO28S
Jane’s &UD]\0L[HG8S6DOW28S
Kedem 3RPHJUDQDWHDQG6SDUNOLQJ3RPHJUDQDWH
-XLFHV28S
Kedem-HOLQHN3HDU%UDQG\28S
Kedem'LVWLOOHULH*LQ28S
Kfar Chabad+DQG6KPXUDK0DW]RV28S
King David&RIIHH5RDVWHUV.6$
Kirkland $SSOH-XLFH28S
Klein’s 2UDQJH&UHDP%DU28GDLU\
Klein’s :KHHORI3DVVRYHU3L]]D28GDLU\
Kojel 6RXSLQD%RZO28S
Lay’s 3RWDWR&KLSV28S
Le Tova .LFKHODQG³%UHDG´6WLFNV28S
Lipton.RVKHU6RXS6HFUHWV28S
Lipton0DW]R%DOO6RXS0L[28S
Manischewitz JOXWHQIUHHFDNHPL[28S
Manischewitz ELVFRWWL28S
Manischewitz JOXWHQIUHH0DW]D&UDFNHUV28S
Manischewitz )UR]HQ0DFDURRQGRXJK28S
Manischewitz $OPRQGEXWWHU28S
Manischewitz&KRFRODWH&RYHUHG&KHUULHV28S
Manischewitz0DUVKPDOORZV28S
Manischewitz %LVFRWWL28S
Manischewitz 5HG9HOYHW&DNH0L[28S
28
ITEMS TO BE CAUTIOUS OF FOR PASSOVER
(FOR 5773-2013), ALERTS & UPDATES
Mishpacha1RQ'DLU\WRSSLQJ28S
MothersPDUJDULQHEORFNV28S
Neshama/RZ)DW/RZ&DUE&KLFNHQ7XUNH\
6DXVDJHV
Norman’s 0DFKPLULP*UHHN<RJXUW28SCholov
Yisroel
Osem%LWWHUVZHHW&KRFRODWH&RDWHG&RIIHH%HDQV
28S
Osem %LWWHUVZHHW&KRFRODWH&RDWHG&LWUXV3HHOV
28S
Osem 6XJDW4XLQRD
Price Chopper )ODYRUHG6HOW]HU28S
Quinoa±6WDU.S
Ratner’s 3DQFDNHVDQG%OLQW]HV28S
Rokeach +DQG6KPXUDK0DW]RV28S
Savion )LUHPHQ¶V)UHQ]\6DXFHV28S
Savion )OXII\6WUDZEHUU\0DUVKPDOORZ&UqPH
28S
Season0RURFFDQ6DUGLQHV0DVKJLDFK7HPLGL
%LVKXO<LVURHO28S
Shop - Rite7XQD28S
Shop – Rite )ODYRUHG6HOW]HU28S
Sonny & Joe’s 6DODGV'LSVDQG3LFNOHV28S
Streit’sFKRFRODWHFRYHUHGUDLVLQVQXWV
Tasters Choice 'HFDI&RIIHH±&KXJ&KDVDP6RIHU
Tishbi preserves
VIP %DNHU\*RRGV28S
VIP 6RXSLQD%RZO28S
Yehuda *OXWHQ)UHH0DW]R6W\OH6TXDUHV
Yehuda %DEDJDQXVKDQG0DWEXFKDGLSV28S
Yanovsky 0DW]DKIURP$UJHQWLQD28S
Yorvata 0R]]DUHOOD3URYRORQH3HFRULQR&KHHVH
28S
Zeta 2OLYH2LO
ALERTS:
%HFDUHIXOWRFKHFNSDFNDJHVRI.RVKHUIRU3HVDFK
LWHPVIRUWKH3HVDFKFHUWL¿FDWLRQ6RPHQRQ
3HVDFK.RVKHUSURGXFWVKDYHVLPLODUSDFNDJLQJWR
WKRVHSURGXFWVWKDWDUH.RVKHUIRU3HVDFKDQGFDQ
EHHDVLO\FRQIXVHG
1RWDOOEliteSURGXFWVEHDUUHFRPPHQGHG
+DVKJDFKRV&KHFNWKHODEHO
'DQQRQGLGSURGXFH28S\RJXUWWKLV\HDU
&DXWLRQVKRXOGEHXVHGZKHQEX\LQJ0DW]RVWREH
VXUHWKDWWKH\DUHQRWLQWKHFDWHJRU\RI³Matzah
Ashira´6RPHH[DPSOHVRIWKLVDUH0DQLVFKHZLW]
:KLWH*UDSH0DW]R*UDSH%LW&UDFNHUV(JJ
0DW]R(JJ0DW]R&UDFNHUV(JJ0DW]R6QDFN
%LWV&KRFRODWH&RYHUHG(JJ0DW]RDQG7DP7DP
FUDFNHUV7KHVHLWHPVDUHRQO\SHUPLVVLEOHIRUWKH
HOGHUO\LOORU\RXQJFKLOGUHQZKRDUHQRWDEOHWR
SURSHUO\GLJHVWUHJXODU0DW]DK
0DQ\VXSHUPDUNHWVFDUU\DWWKLVWLPHRI\HDUYDULRXV
SURGXFHIURP,VUDHO7KHVHLQFOXGHSHSSHUVPDQJR
WRPDWRHVDQGVSLFHV,IRQHSXUFKDVHVVXFKLWHPV
FDUHPXVWEHWDNHQWRWDNHDOODSSURSULDWHTerumos
DQGMaasros.
0DQ\.LWQL\RVSURGXFWVLQWKHPDUNHWDUHFHUWL¿HGDV
.RVKHUHVSHFLDOO\IURP)UDQFHDQGRWKHU(XURSHDQ
FRXQWULHV6RPHODUJH$PHULFDQ.DVKUXVDJHQFLHV
QRZFHUWLI\VXFKSURGXFWVDVZHOO7KRVHSURGXFWV
WKDWDUHRQO\¿WIRUWKRVHZKRVH0LQKDJDOORZ
WKHPWRHDW.LWQL\RVDUHFOHDUO\PDUNHGDVVXFK
7KHVH.LWQL\RVSURGXFWVDUHRIWHQLQWKHIRUPRI
FDQG\0DQ\EXWQRWDOORIWKHVHSURGXFWVZLOOVD\
³LeOchlay Kitniyos´)RULQVWDQFH$IIXOD6XQÀRZHU
6HHGVMXVWVD\³.RVKHUIRU3HVDFK´7KHVHDUH
PHDQWRQO\IRUWKRVH6HSKDUGLPZKRKDYHWKH
0LQKDJWRHDW.LWQL\RV
³3XUH+RQH\´IURP&KLQDKDVUHFHQWO\EHHQIRXQG
WREHDGXOWHUDWHGZLWKFRUQDQGULFHV\UXS2QHZDV
IRXQGWRQRWFRQWDLQKRQH\
From the Star-K:TXLQRDLV.RVKHU/¶3HVDFKDQGLV
QRWUHODWHGWRWKH¿YHW\SHVRIchometzJUDLQVPLOOHW
RUULFH+RZHYHUEHFDXVHWKHUHLVDSRVVLELOLW\WKDW
TXLQRDJURZVLQSUR[LPLW\RIchometz JUDLQVDQG
SURFHVVHGLQIDFLOLWLHVWKDWFRPSURPLVHLWV.RVKHU
IRU3DVVRYHUVWDWXVTXLQRDVKRXOGRQO\EHDFFHSWHG
ZLWKDUHOLDEOH.RVKHUIRU3DVVRYHUVXSHUYLVLRQ
:HKDYHFHUWL¿HGDUXQRITXLQRDZKLFKEHDUVWKH
6WDU±.S
,WLVLPSRUWDQWWRFRQ¿UPWKDWWKLV+HFKVFKHUDSSHDUV
RQWKHSDFNDJH)XUWKHUPRUHLWLVDGYLVDEOHWKDW
EHIRUH3DVVRYHURQHFKHFNWKURXJKWKHJUDLQVIRU
H[WUDQHRXVPDWWHUHJEDUOH\E\SODFLQJWKHTXLQRD
RQDSODWHDQGORRNLQJWKURXJKWKHJUDLQV
&KHFNZZZVWDUNRUJTXLQRDIRUXSGDWHVRI
ZKROHVDOHDQGUHWDLOVXSSOLHUV
1ote6XJDWIURP,VUDHODYDLODEOHLQPDQ\NRVKHU
PDUNHWVKDVFHUWL¿FDWLRQIRU3HVDFK
From the Kof K:
7KH.RI.SURYLGHVLWV.RVKHUFHUWL¿FDWLRQWRDOO
SURGXFWVPDQXIDFWXUHGE\-R\YDIRU\HDUURXQG
XVH(;&(37IRU3DVVRYHU7KH.RI.GRHVQRW
FHUWLI\RUVXSHUYLVHDQ\WKLQJPDQXIDFWXUHGE\-R\YD
as Kosher for Passover because of their use of
FRUQVWDUFKDQGFRUQV\UXSLQWKHLUSURGXFWV7KH.S
RQWKH3DVVRYHUUXQLVXQGHUWKHFHUWL¿FDWLRQDQG
VXSHUYLVLRQRI5DEEL6KHLQNRS
From the OU:
7KH28JUDQWVVXSHUYLVLRQIRUWKRVHZKRHDW
.LWQL\RV&DUHQHHGVWREHWDNHQDVWRZKDWWKH
+HFKVFKHUVD\VRQWKHSDFNDJH7KH+HFKVFKHULV
28ZLWKWKHZRUG.LWQL\RWRQWRSDQGWKHGLVFODLPHU
³DFFHSWDEOHIRUWKRVHZKRFRQVXPH.LWQL\RWRQ
3DVVRYHU´
Whiskey Alert
FRQFHUQLQJ&KRPHW]6KH¶2YDU$ODY+D3HVDFK
AKO: ASSOCIATION OF KASHRUS
ORGANIZATIONS
:HUHFRPPHQGWKDWKashrus $JHQFLHVDQG
FRQVXPHUVFKDQJHWKHLUSROLFLHVDQGRQO\FRQVXPH
WKRVHDOFRKROLFEHYHUDJHVZKLFK>DUHIUHHRI
[email protected]
SURGXFHGE\DQRQ-HZLVKFRPSDQ\RUD-HZLVK
RZQHGFRPSDQ\ZKLFKDUUDQJHGIRUWKHVDOHRIWKHLU
ChometzEQRWFRQWDLQDQ\Chometz
LQFOXGLQJQRWKDYLQJChometz VHFRQGDU\JUDLQVRU
PDOWHGEDUOH\ERXUERQDQGFRUGLDOVDUHH[DPSOHVRI
LWHPVWKDWPD\KDYHWKHVHIRUELGGHQLWHPVDQGRU
ALERTS & UPDATES
FZHUHQRWDJHGRYHUPesach HJYRGND
7KHIROORZLQJDUHVRPHEUDQGVZKLFKZHEHOLHYHWR
EHVXEMHFWWRWKHDERYHFRQFHUQ
From the cRc:
Some bourbon companies are owned by Jews who
do not sell their chametz; those brands are not
recommended and are listed below. See http://bit.ly/
r1ImVc for details.
5HFRPPHQGHGRQO\LISXUFKDVHGEHIRUH3HVDFK
5LGJHPRQW8QÀDYRUHG
&RORQHO/HH8QÀDYRUHG
)OHLVFKPDQQ¶V8QÀDYRUHG
,PSHULDO8QÀDYRUHG
.HQWXFN\*HQWOHPDQ8QÀDYRUHG
.HQWXFN\7DYHUQ8QÀDYRUHG
2OG7KRPSVRQ8QÀDYRUHG
7HQ+LJK8QÀDYRUHG
7RP0RRUH8QÀDYRUHG
9HU\2OG%DUWRQ8QÀDYRUHG
0DU5HFRPPHQGHGRQO\ZKHQEHDULQJWKH
NRVKHUORJR3DJH
Bourbon
5HFRPPHQGHGRQO\LISXUFKDVHGEHIRUH3HVDFK
2OG5LS9DQ:LQNOH8QÀDYRUHG
3DSS\9DQ:LQNOH8QÀDYRUHG
9DQ:LQNOH8QÀDYRUHG
5HFRPPHQGHGRQO\LISXUFKDVHGEHIRUH3HVDFK
$6PLWK%RZPDQ8QÀDYRUHG
$QFLHQW$JH8QÀDYRUHG
$QWLTXH&ROOHFWLRQ8QÀDYRUHG
%ODQWRQV8QÀDYRUHG
%RZPDQ8QÀDYRUHG
%XIIDOR7UDFH8QÀDYRUHG
(DJOH5DUH8QÀDYRUHG
(OPHU7/HH8QÀDYRUHG
([SHULPHQWDO&ROOHFWLRQ8QÀDYRUHG
*HRUJH76WDJJ8QÀDYRUHG
+DQFRFN¶V3UHVLGHQWV5HVHUYH
8QÀDYRUHG
0F$IIHH¶V%HQFKPDUN8QÀDYRUHG
2OG&KDUWHU8QÀDYRUHG
2OG:HOOHU8QÀDYRUHG
5RFN+LOO)DUPV8QÀDYRUHG
9LUJLQLD*HQWOHPDQ8QÀDYRUHG
:/:HOOHU8QÀDYRUHG
5HFRPPHQGHG
$++LUVFK8QÀDYRUHG
%DNHUV8QÀDYRUHG
%DVLO+D\GHQ8QÀDYRUHG
%HUQKHLP8QÀDYRUHG
%ODFN0DSOH+LOO8QÀDYRUHG
%RRNHUV8QÀDYRUHG
(OLMDK&UDLJ8QÀDYRUHG
(YDQ:LOOLDPV8QÀDYRUHG
)RXU5RVHV8QÀDYRUHG
+HDYHQ+LOO8QÀDYRUHG
-DFN'DQLHOV8QÀDYRUHG
-LP%HDP8QÀDYRUHG
.QRE&UHHN8QÀDYRUHG
0DNHU¶V0DUN8QÀDYRUHG
0LFKWHUV±8QÀDYRUHG
Canadian Whiskey:
5HFRPPHQGHGRQO\LISXUFKDVHGEHIRUH3HVDFK
%DUWRQ8QÀDYRUHG
&DQDGLDQ+RVW8QÀDYRUHG
&DQDGLDQ/7'8QÀDYRUHG
&DQDGLDQ6XSUHPH8QÀDYRUHG
0U%RVWRQ8QÀDYRUHG
1RUWKHUQ/LJKW8QÀDYRUHG
5HFRPPHQGHGRQO\LISXUFKDVHGEHIRUH3HVDFK
&DQDGLDQ+XQWHU8QÀDYRUHG
-DPHV)R[H8QÀDYRUHG
5LFK5DUH8QÀDYRUHG
5R\DO&DQDGLDQ8QÀDYRUHG
To See Additional
Updates & Alerts
Please Check Our Website:
www.kosherquest.org
We Wish All Our Readers
A Happy, Heathly &
Kosher Passover
29
30
Catering By BRENDA
Distinctive Cuisine for Special Occasions Weddings,
Bar Mitzvahs, Simchas, Special Events
Please Call: Brenda Walt
Phone: 310-203-8365 Fax: 310-788-0706
E-Mail: [email protected] website: cateringbybrenda.com
1467 South Durango Avenue, L.A., CA 90035
This magazine was made Possible by the Generous donation of:
Mr. & Mrs. Jim Kapenstein
Mr. & Mrs. Steve Darrison
Mr. & Mrs. Zev Stoll
Mr. & Mrs. Lenard Liberman
Mr. & Mrs. David Rubin
Mr. & Mrs. Paul Cohen
Mr. & Mrs. Asher Levine
Mr. Rick Brown & Family
$PZD\3URGXFWVIRUDOO\RXU$PZD\QHHGV
3OHDVH&DOO5XE\:HLVVPDQ
)UHHGHOLYHU\WR\RXUKRPH
RURI¿FHDQ\ZKHUHLQWKH/RV$QJHOHVDUHD
To See Additional Updates & Alerts
Please Check Our
Website: www.kosherquest.org
We Wish All Our Readers
A Happy, Heathly & Kosher Passover
31
Look to Ralphs
For All Your Kosher Needs
First In California
We Wish All Our
Valued Customers
A Happy, Healthy &
Kosher Passover

Similar documents