Química de Nucleotídeos e Ácidos Nucléicos - UFPE

Comments

Transcription

Química de Nucleotídeos e Ácidos Nucléicos - UFPE
UNIVERSIDADE FEDERAL DE PERNAMBUCO
CENTRO DE CIÊNCIAS BIOLÓGICAS
DEPARTAMENTO DE BIOQUÍMICA
Química de Nucleotídeos e
Ácidos Nucléicos
Disciplina: Bioquímica 7
Turma: Medicina ( 2o período)
Profa. Nereide Magalhães
Departamento de Bioquímica - UFPE
• “A analogia me levaria a um passo adiante, isto é, à
crença de que todos os animais e vegetais
descendem de um protótipo único [...]
Todos os seres vivos têm muito em comum, em sua
composição
química,
em
suas
vesículas
germinativas, em sua estrutura celular e em suas leis
de crescimento e reprodução [...]
Provavelmente todos os seres orgânicos que tenham
em qualquer ocasião vivido nessa Terra, descendem
de alguma forma primordial única, na qual a vida
primeiro respirou. ... De um começo tão simples,
formas infindáveis, as mais belas e as mais
maravilhosas, evoluíram e estão evoluindo.”
CHARLES DARWIN (1859)
On the Origin of Species
Escala Cronológica da Evolução da Vida
DNA – origem da vida: Uma cronologia (Battail, 2001)
O QUE É REALMENTE A VIDA?
Tendências estão derrubando as
barreiras entre o vivo e o não vivo.
• 1a mudança: Superação do vitalismo.
• 2a mudança: desaparecimento dos contornos
nítidos na distinção entre vivos e
não vivos
Seleção natural
• Darwinismo e Teoria da evolução
• O DNA/RNA
Propriedades características da vida natural
• Capacidade de reprodução
• Sensibilidade ao ambiente
• Metabolismo
• Singularidade química
• Alto grau de complexidade e organização
• Programação genética que dirige o
desenvolvimento
• Histórico modelado pela seleção natural
Dificuldades para definir a vida
SEMENTES, estão vivas, mas não metabolizam
VIRUS, não se auto-reproduzem
SALSICHAS não estão vivas, mas contém programa
genético, são feitas de proteínas e DNA
VIRUS DE COMPUTADOR, com propriedades da vida
biológica: reproduzem-se, são sensíveis ao ambiente,
metabolizam (consomem processamento, memória),
podem ser complexos, sobrevivem usando seleção
natural.
•INTELIGÊNCIA E VIDA ARTIFICIAL
Os maiores desenvolvimentos: trabalho brilhante do Inglês
Alan Turing (1912-1954).
O pensamento como processo que liga insumo
ao produto, independente do substrato que o
encerra (Princípio da inteligência artificial).
http://em.wikipedia.org/wiki/Alan_Turing
http://www.turing.org.uk/Turing/
Estudo do comportamento de máquinas:
• “Esconder" de um observador detalhes sobre
"quem é quem". O observador é apresentado
a diversas situações em que se defronta com
duas "pessoas", digamos João e José.
• Uma delas é uma pessoa e a outra é uma
máquina, porém o observador não sabe
"who is who".
• Se ele for capaz de discriminar claramente
quem é o computador, então fica claro que a
máquina não "é" um ser humano.
• Mas, quando o observador não for capaz de
discernir quem é a máquina e quem é o
computador? Não se tratam de "duas" pessoas?
Uma máquina não pode ser humana apenas no
sentido de não possuir vida Biológica!
O FUTURO
A vida artificial deve proporcionar avanços
extraordinários.
É
importante
refletir,
conhecer e tratar de maneira oportuna e
cautelosa.
Provavelmente haverá síntese de sistemas
adaptativos complexos, oferecendo uma
visão que coloca o homem dentro de um
mundo onde haverá muitas formas de vida e
entidades aparentemente vivas.
Importância Biológica dos Ácidos
Nucléicos
DNA = Ácido Desoxirribonucléico
RNA = Ácido Ribonucléico
Os
ácidos
transmissão do
protéica.
nucléicos
são
responsáveis
Código genético
e pela
pela
síntese
Relação do Dogma Central
DNA
tradução
vo
vi
RNA
X
DNA
In
o
ã
ç
e
ri
s
c
s
a
r
e
rt an
m
i
l
po
A
N
R
replicação
Síntese Protéica
Fluxo da Informação Genética
RNA
a
s
r
e
v
e
r
e
s
ta
p
i
r
c
s
n
a
r
T
DNA
RNA
Retrovírus
Síntese Protéica
Introdução
• O corpo humano é constituído por alguns
trilhões de células
• Estas células, na sua maioria, possuem uma
estrutura que comanda e coordena todas as
suas atividades: o núcleo
• No interior do núcleo, é encontrado o DNA
(cromatina), que contém a informação
genética a partir do qual são sintetizados os
RNA, responsáveis pela transmissão da
informação genética e pela síntese de
proteínas.
Ácidos Nucléicos
• Existem dois tipos de ácidos nucléicos: o ácido
desoxirribonucléico
(DNA)
e
o
ácido
ribonucléico (RNA)
• O DNA é o principal constituinte dos
cromossomos e é nele que estão todos os genes
• Os diferentes tipos de RNA (mensageiro,
ribossômico e transportador) são formados no
núcleo, mas passam para o citoplasma onde
promovem a síntese de proteínas.
Química de Nucleotídeos e Ácidos Nucléicos
•
•
•
Importância biológica
Histórico
Constituição
•
•
•
•
•
•
Nucleosídeos
Nucleotídeos
Estrutura química dos ácidos nucléicos
•
•
•
•
•
Bases nitrogenadas
Pentoses
Radical Fosfato
Estrutura do DNA
Estrutura do RNA
Diferenças químicas entre DNA e RNA
Funções do DNA e RNA
Referências Bibliográficas
Fundamentos da
Estrutura do DNA e RNA
Histórico
• 1868 – Meischer isolou nucleoproteínas:
protamina + substância ácida (ácido nucléico)
• 1885 – Kossel isolou as bases nitrogenadas do DNA e
RNA (Nobel de Medicina, 1910)
• 1909 – Levene extraiu a ribose dos ácidos nucléicos
(levedura)
• 1929 - Levene extraiu a desoxirribose dos ácidos
nucléicos
(glândula do timus)
• 1944 – Avery, McLoad e McCarty descobriram que o DNA
carrega a informação genética
- Beadle e Edward propuseram a hipótese: “1 gen –
1 enzima”
- Linus Pauling propôs a estrutura de α-hélice para a
queratina (Nobel de Medicina, 1959)
- McClintock propôs os transposons (genes
saltadores)
Histórico
• 1948 – Chargaff após separação das bases nitrogenas
por cromatografia propôs a regra [A=T] e [C=G]
• 1952 – Franklin e Wilkens análise de raios-X do DNA
• 1953 – Watson e Crick propuseram o modelo de dupla
hélice para o DNA (Nobel de Medicina, 1962)
• 1954 – Gamow concebeu um código genético
multinucleotídico
• 1956 – Palade descobriu os ribossomas (Nobel de Medicina,
1974)
• 1956 – Monod e Jacob descobriram o mRNA (Nobel de
Medicina , 1965)
• 1956 – Moaglang descobriu que o RNA está presente no
citoplasma
• 1961 Niremberg/Kohana propuseram o código genético
em trinca de bases (Nobel de Medicina, 1968)
• 1967 – Gurden produziu o 1o clone
Histórico
• 1970 – Gilbert, Maxam e Sanger propuseram um método de
sequenciamento de genes (Nobel de Medicina , 1965)
• 1973 – Coehen e Boyer iniciaram a engenharia genética
• 1976 – Khorona sintetizou o 10 Gene
• 1978 – Elucidação do genoma do vírus SV40
• 1980 – Síntese de pequenas partes do DNA
- Difração de raios-X : variação na geometria tridimensional dos
pares de bases dependendo da seqüência do DNA
• 1983 – Descoberta do gene da doença de Huntington
• 1988 – Projeto Genoma Humano
• 1990 – 1a. Terapia gênica (tratamento da ADA)
• 1991- Terapia gênica da hipercolesterolemia familiar
• 1994 – Estudos sobre RNA terapêutico (pares de bases >4)
Histórico
• 1994 – Radman produziu a Salmorichia
(genes da Samonella e da E. coli)
• 1994 – Mary-Clair King Descobriu o gene do câncer de
mama BRCA1 (Myriade Genetics)
• 1995 – Slonimisk genoma do Saccharomyces cerevisea
• 1995- Descoberta do gene do câncer de ovário
• 1996 - Descoberta do gene do câncer de mama BRCA2
• 1997 - Descoberta do gene da fibrose cística
• 1997 - Terapia gênica para fibrose cística, distrofia
muscular e hemofilia
• 1999 – Tragédia na terapia gênica no tratamento da
deficiência ornitina transcarbamoilase
(jovem de 18 anos: reação com falência múltipla dos órgãos)
Histórico
1999 Nature:
A primeira seqüência de um cromossomo humano
• 2000 Science (Celera):
Genoma completo da drosófila
• 2000 – Descoberta do gene do mal de Alzheimer,
enfisema, esquizofrenia deCODE Genetics
(Islândia)
esclerose múltipla, osteoartrite, psoríase
–
Descoberta de 39 genes responsáveis por
doenças
Criação do banco da população da Islândia
(genótipo de + 20.000 pessoas)
Constituição dos Ácidos Nucléicos
• Definição: Os ácidos nucléicos são
macromaléculas funidades monoméricas de
nucleotídeos.
• Constituintes
– Bases Nitrogenadas
Púricas ou purínicas
Adenina Guanina
Pirmídicas ou pirimidínicas
Timina Uracila Citosina
– Pentoses Ribose e Desoxirribose
(furanoses)
– Radical fosfato
Bases Nitrogenadas
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
DNA – Estrutura e Função
Bases nitrogenadas
Purinas
Pirimidinas
Bases Nitrogenadas dos Ácidos Nucléicos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Bases Nitrogenadas Púricas e Derivados
Devlin, 1998
Bases Nitrogenadas
Conformações tautoméricas das Bases Pirimídicas (Uracila)
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
DNA – Estrutura e Função
Pentoses
Desoxirribose
Fosfato
Ribose
Fosfato
Pentoses
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleosídeos
• Base Nitrogenada + Pentose
Ligação β-N-Glicosídica N9 Base púrica
N1 Base pirimídica
•Nomemclatura
-Nucleosídeos da pirimidina = raíz do nome da base + idina
Citidina, Uridina, Timidina
-Nucleosídeos da purina
= raíz do nome da base + osina
Adenosina, Guanosina
Conformações dos Nucleosídeos
Conformações Sin e Anti dos Nucleosídeos
(ligação β-N-Glicosídica)
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Conformações dos Nucleosídeos
Conformações Exo e Endo de C2´e C3´com relação a C5´
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Reações de Nucleosídeos
•Metilação
•Hidroximetilação
•Radical S (tioderivados)
•Aminação
•Desaminação
Nucleosídeos Derivados
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleosídeos Derivados
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Reações de Metilação de Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Reação de Metilação da Guanina
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Reações de Desaminação de
Bases Nitrogenadas
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleosídeos
Adenosina: Nucleosídeo com atividade fisiológica
• Hormônio local = autoctone
• dilatação de vasos
• contração muscular
• descarga neuronal
• liberação de neurotransmissores
• metabolismo de lipídeos
Nucleotídeos
• Nucleotídeos são nucleosídeos
fosforilados
– Base nitrogenada
– Açúcar
– Radical fosfato
Ligação éster-fosfato – OH C5’ do nucleosídeo
Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Ribonucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Desoxirribonucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleotídeos Derivados
Conformações 5´, 2´, 3´e 2´,3´-ciclo monofosfatos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleotídeos di e tri-fosofatos
•ATP fonte de energia química para o metabolismo
•GTP fonte de energia na síntese protéica
metabólito essencial na síntese de fosfolipídeos
•UTP substrato na biossíntese de carboidratos complexos e
polissacarídeos
Nucleotídeos di e tri-fosofatos
Nomenclatura dos Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Desoxirribonucleotídeos tri-fosfato
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Estrutura da Adenosina Tri-Fosfato (ATP)
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nomenclatura de Nucleosídeos e Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Nucleotídeos Cíclicos (20 mensageiros)
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Reação de Depurinação de Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Funções dos nucleotídeos
• Unidades monoméricas dos ácidos nucléicos
• Metabolismo energético: ATP e UTP fornecem
energia nos processos metabólicos
• Efeitos alostéricos: níveis de ATP, ADP e AMP
controlam os processos metabólicos
• Nucleotídeos da adenina participam da estrutura
de coenzimas (NAD, NADP, FAD, FMN, CoA)
• Precursor de metabólitos importantes
Funções dos nucleotídeos
6. Mediadores fisiológicos
• Adenosina – controle do fluxo sanguíneo coronário
• ADP – agregação plaquetária
• cAMP e cGMP agem como segundos mensageiros
• GTP transdução do sinal de proteínas ligantes de GTP
formação de microtúbulos
7. Intermediários ativados
• Síntese de polissacarídeos (UDP-Glicose)
• Síntese de glicoproteínas (GDP-manose;
GDP-fucose; UDP-galactose; CMP-ácido sialíco)
• Síntese de polissacarídeos (UDP-Glicose)
• Metabolismo de fosfoflipídeos (CTP)
Funções dos nucleotídeos
8. Síntese de metabólitos
SAM = S-adenosil metionina: doador de CH3
PAPS = 3´-fosfoadenosina 5´-fosfosulfato:
doador de SO4
Síntese de proteoglicanos sulfatados
Polimerização de Nucleotídeos
• Cadeia Polinucleotídica
DNA = Desoxirribonucleotídica
RNA = Ribonucleotídica
Ligações 3’,5’ - Fosfodiéster
• Esqueleto molecular DNA
RNA
• Cadeia Lateral
Desoxirribose + P
Ribose + P
Bases nitrogenadas
DNA
RNA
Adenosina, Timidina
Guanosina, Citosina
Adenosina, Uridina
Guanosina, Citosina
Polimerização de Nucleotídeos
Ligação 3´, 5´-Fosfodiéster
5´-Fosfodiéster
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
Representação Esquemática de uma Seqüência de
Nucleotídeos
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
pApCpGpTpA ou
pACGTA
5´-PO4
ApCpGpTpAp ou ACGTAp
3´-PO4
5´-ACGTA-3´ ou 3´-ACGTA-5´
Fundamentos da
Estrutura do DNA
Leningher Principles of Biochemistry, 2000
(Nelson, D.L. e Cox, M.M.)
DNA – Estrutura e Função
Estrutura - Watson & Crick (1953) - Dupla Hé
Hélice
Polí
Polímero - conjunto de monô
monômeros (nucleotí
(nucleotídeos)
Composiçã
Composição
o de cada nucleotí
nucleotídeo:
• Molé
Molécula de açú
açúcar
car - Pentose =
desoxirribose
• Ácido Fosfó
Fosfórico
• Bases Nitrogenadas:
Purinas= Adenina e Guanina
Pirimidinas= Timina e Citosina
Estruturas Biológicas Tridimensionais
Propriedades: Flexibilidade e Estabilidade
§ Estruturas macromoleculares tridimensionais
• DNA
• Proteí
Proteínas
§ Complexos supramoleculares
Natureza transitó
transitóriaInteraçõ
Interações
es nã
não-covalentes
Individualmente fracas
Coletivamente fortes
Flexibilidade
Estabilidade
Essencial para a funçã
função
o da macromolé
macromolécula
DNA – Estrutura e Função
Dupla Hélice
DNA – Estrutura e Função
Bases Complementares
DNA – Estrutura e Função
Linus Pauling - 1951
α-Hélice (Proteínas)
DNA – Estrutura e Função
Rosalin Franklin e Maurice Wilkins,
Wilkins, 1951
Hélice com periodicidade regular de 3,4 Å e 34 Å
Difração de Raios-X
34 Å
Estrutura Molecular
DNA – Estrutura e Função
1953: descoberta da estrutura do DNA
Watson & Crick: estrutura dupla
hélice do DNA
DNA – Estrutura e Função
Estrutura - Watson & Crick (1953) - Dupla Hé
Hélice
“ We have descovery the secret of life!
life!”
“Descobrimos o segredo da vida!”
vida!”
“A elucidaçã
elucidação
o da estrutura em dupla hé
hélice do
DNA representou um dos mais significantes
eventos da histó
história da ciê
ciência. Esta descoberta
mais do que qualquer outra marcou o iní
início da
Biologia Molecular”
Molecular”
DNA – Estrutura e Função
Estrutura - Watson & Crick (1953) - Dupla Hé
Hélice
“ The structure of DNA: ´A
A melody for the eye of
the intellect,
intellect, with not a note wasted”
wasted”
Horace Freeland Judson
The Eight Day of Creation
“A estrutura do DNA: ´É
É uma melodia para
os olhos do intelecto, sem nenhuma nota fora
do tom””
tom””
The Music of Genes
Susumo Ohno, Beckman University, California
The Music of Genes
Susumo Ohno, Beckman University, California
http://www.toshima.ne.jp/~edogiku/
http://www.membres.iycos.jr/mihalic
http:/whozoo.org/mac/Music/Sources.htm
http://www.algoart.com/music.htm
http://www.molecularmusic.com
http://www. Artic.edu/~pgena/ionstrmus.htm
DNA – Estrutura e Função: Duplicação
Ocorre na presença da DNA polimerase,
polimerase, que
rompe as pontes de hidrogênio entre as bases
nitrogenadas e as duas fitas do DNA se
afastam:
•Nucleotídeos
Nucleotídeos livres existentes na célula
encaixam-se nas fitas, sempre em suas bases
complementares
•São
São formadas duas moléculas de DNA
idênticas.
•A
A duplicação do DNA é chamada
semiconservativa porque a molécula nova do
DNA tem uma fita nova e uma fita velha,
originária da molécula mãe.
Ação da DNA polimerase
Fundamentos da
Estrutura do RNA
Ácidos Ribonucléicos - Tipos
Síntese do RNA - Transcrição
•
É realizada a partir de um
molde de DNA
•
A enzima que cataliza a reação é
a RNA-polimerase
RNA-polimerase
• Três etapas principais:
o Iniciação
o Alongamento
o Término
Síntese de Proteínas - Tradução
•A
A tradução ocorre nos ribossomas
•Trinca
Trinca de bases do mRNA
àcódon
•Trinca
Trinca de bases do tRNA
à anti-códon
O Código Genético
2a Letra
U
C
A
G
U
FENILALANINA
FENILALANINA
LEUCINA
LEUCINA
SERINA
SERINA
SERINA
SERINA
TIROSINA
TIROSINA
PARADA
PARADA
CISTEÍ
CISTEÍNA
CISTEÍ
CISTEÍNA
PARADA
TRIPTOFANO
U
C
A
G
C
LEUCINA
LEUCINA
LEUCINA
LEUCINA
PROLINA
PROLINA
PROLINA
PROLINA
HISTIDINA
HISTIDINA
GLUTAMINA
GLUTAMINA
ARGININA
ARGININA
ARGININA
ARGININA
U
C
A
G
A
ISOLEUCINA
ISOLEUCINA
ISOLEUCINA
METIONINA
(INÍ
(INÍCIO.)
TREONINA
TREONINA
TREONINA
TREONINA
ASPARAGINA
ASPARAGINA
LISINA
LISINA
SERINA
SERINA
ARGININA
ARGININA
U
C
A
G
G
VALINA
VALINA
VALINA
VALINA
ALANINA
ALANINA
ALANINA
ALANINA
AC. ASPÁ
ASPÁRTICO
AC. ASPÁ
ASPÁRTICO
AC. GLUTÂ
GLUTÂMICO
AC. GLUTÂ
GLUTÂMICO
GLICINA
GLICINA
GLICINA
GLICINA
U
C
A
G
1a Letra
3a Letra
1953: primeira seqüência de aminoácidos
Sanger: seqüência de aminoácidos
da insulina bovina
MALWTRLRPLLALLALWPPPPARAFVNQHLCGSHLVEALYLVCGERGFFYTP
KARREVEGPQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN
Representação inner-outer
Pro Leu
Pro
Gln
His
UC
C
G
GA
G
A
Asn
CU
A
GA
U
C
GA
UCA
G GA CU
CU
Thr
Thr
Met
Val Val
Glu
Ala
Ala
Ile
Asp
AG
GA
Lys
Gly
UC
U
CU
Gly
CU
C
U
Trp
GA
G
G
Stop
G
A
AG
Cys
UC
A
G
A
UC
Tyr
GA
A
CU
Stop
U
C
C
Ser
Ser
CU
AG
U
CU
Arg
AG GA
UC
UC
Arg
Leu
Phe Ser
CU
GA
AG
Arg
Leu
Trecho de DNA da β-hemoglobina humana
(reading frames)
• ...ACA GAC ACC ATG GTC CAC CTT GAC...
• . .. CAG ACA CCA TGG TGC ACC TGG...
•
... AGA CAC CAT GGT GCA CCT TGA ...
Genes da sub-unidade β da hemoglobina
(2 genes)
B
A
90 bp
131 bp
222 bp
851 bp
126 bp
DNA do bacteriófago φX174
• 5.386 bp - 10 genes (A até K)
Gene
n. de aminoácidos
quadro
A
B
C
D
E
F
G
H
J
K
455
120
86
152
91
427
175
328
38
56
(1539 bp)
(360 bp)
(258 bp)
(456 bp)
(273 bp)
(1281 bp)
(525 bp)
(984 bp)
(114 bp)
(168 bp)
5.958 bp
2
1
1
3
1
2
1
3
2
3
ORDEM DE MAGNITUDE DE GENOMAS
(pares de bases = bp)
Vírus
bactéria
yeasts
nematóide
insetos
mosca da fruta
mamíferos
lung fish
mostarda weed
Pinheiro
amoebia dubia
10 kbp (SV40 5k, T2 48.6 k...)
4 Mbp (E. coli 4.7 Mb)
9 Mbp
90 Mbp
0.2 - 7.5 Gbp
180 Gbp
1.4 - 5.7 Gbp (man 3.2 Gbp)
140 Gbp
200 Mbp
68 Gbp
670 Gbp
Genes no DNA do bacteriófago φX174
GAGTTTTATCGCTTCCATGACGCAGAAGTTAACACTTTCGGATATTTCTGATGAGTCGAAAAATTATCTTGATAAAGCAGGAATTACTACTGCTTGTTTACGAATTAAATCGAAG
TGGACTGCTGGCGGAAAATGAGAAAATTCGACCTATCCTTGCGCAGCTCGAGAAGCTCTTACTTTGCGACCTTTCGCCATCAACTAACGATTCTGTCAAAAACTGACGCGTTG
GATGAGGAGAAGTGGCTTAATATGCTTGGCACGTTCGTCAAGGACTGGTTTAGATATGAGTCACATTTTGTTCATGGTAGAGATTCTCTTGTTGACATTTTAAAAGAGCGTGGA
TTACTATCTGAGTCCGATGCTGTTCAACCACTAATAGGTAAGAAATCATGAGTCAAGTTACTGAACAATCCGTACGTTTCCAGACCGCTTTGGCCTCTATTAAGCTCATTCAGG
CTTCTGCCGTTTTGGATTTAACCGAAGATGATTTCGATTTTCTGACGAGTAACAAAGTTTGGATTGCTACTGACCGCTCTCGTGCTCGTCGCTGCGTTGAGGCTTGCGTTTATG
GTACGCTGGACTTTGTGGGATACCCTCGCTTTCCTGCTCCTGTTGAGTTTATTGCTGCCGTCATTGCTTATTATGTTCATCCCGTCAACATTCAAACGGCCTGTCTCATCATGG
AAGGCGCTGAATTTACGGAAAACATTATTAATGGCGTCGAGCGTCCGGTTAAAGCCGCTGAATTGTTCGCGTTTACCTTGCGTGTACGCGCAGGAAACACTGACGTTCTTACT
GACGCAGAAGAAAACGTGCGTCAAAAATTACGTGCGGAAGGAGTGATGTAATGTCTAAAGGTAAAAAACGTTCTGGCGCTCGCCCTGGTCGTCCGCAGCCGTTGCGAGGTA
CTAAAGGCAAGCGTAAAGGCGCTCGTCTTTGGTATGTAGGTGGTCAACAATTTTAATTGCAGGGGCTTCGGCCCCTTACTTGAGGATAAATTATGTCTAATATTCAAACTGGC
GCCGAGCGTATGCCGCATGACCTTTCCCATCTTGGCTTCCTTGCTGGTCAGATTGGTCGTCTTATTACCATTTCAACTACTCCGGTTATCGCTGGCGACTCCTTCGAGATGGA
CGCCGTTGGCGCTCTCCGTCTTTCTCCATTGCGTCGTGGCCTTGCTATTGACTCTACTGTAGACATTTTTACTTTTTATGTCCCTCATCGTCACGTTTATGGTGAACAGTGGAT
TAAGTTCATGAAGGATGGTGTTAATGCCACTCCTCTCCCGACTGTTAACACTACTGGTTATATTGACCATGCCGCTTTTCTTGGCACGATTAACCCTGATACCAATAAAATCCC
TAAGCATTTGTTTCAGGGTTATTTGAATATCTATAACAACTATTTTAAAGCGCCGTGGATGCCTGACCGTACCGAGGCTAACCCTAATGAGCTTAATCAAGATGATGCTCGTTAT
GGTTTCCGTTGCTGCCATCTCAAAAACATTTGGACTGCTCCGCTTCCTCCTGAGACTGAGCTTTCTCGCCAAATGACGACTTCTACCACATCTATTGACATTATGGGTCTGCAA
GCTGCTTATGCTAATTTGCATACTGACCAAGAACGTGATTACTTCATGCAGCGTTACCATGATGTTATTTCTTCATTTGGAGGTAAAACCTCTTATGACGCTGACAACCGTCCTT
TACTTGTCATGCGCTCTAATCTCTGGGCATCTGGCTATGATGTTGATGGAACTGACCAAACGTCGTTAGGCCAGTTTTCTGGTCGTGTTCAACAGACCTATAAACATTCTGTGC
CGCGTTTCTTTGTTCCTGAGCATGGCACTATGTTTACTCTTGCGCTTGTTCGTTTTCCGCCTACTGCGACTAAAGAGATTCAGTACCTTAACGCTAAAGGTGCTTTGACTTATA
CCGATATTGCTGGCGACCCTGTTTTGTATGGCAACTTGCCGCCGCGTGAAATTTCTATGAAGGATGTTTTCCGTTCTGGTGATTCGTCTAAGAAGTTTAAGATTGCTGAGGGT
CAGTGGTATCGTTATGCGCCTTCGTATGTTTCTCCTGCTTATCACCTTCTTGAAGGCTTCCCATTCATTCAGGAACCGCCTTCTGGTGATTTGCAAGAACGCGTACTTATTCGC
CACCATGATTATGACCAGTGTTTCCAGTCCGTTCAGTTGTTGCAGTGGAATAGTCAGGTTAAATTTAATGTGACCGTTTATCGCAATCTGCCGACCACTCGCGATTCAATCATG
ACTTCGTGATAAAAGATTGAGTGTGAGGTTATAACGCCGAAGCGGTAAAAATTTTAATTTTTGCCGCTGAGGGGTTGACCAAGCGAAGCGCGGTAGGTTTTCTGCTTAGGAGT
TTAATCATGTTTCAGACTTTTATTTCTCGCCATAATTCAAACTTTTTTTCTGATAAGCTGGTTCTCACTTCTGTTACTCCAGCTTCTTCGGCACCTGTTTTACAGACACCTAAAGC
TACATCGTCAACGTTATATTTTGATAGTTTGACGGTTAATGCTGGTAATGGTGGTTTTCTTCATTGCATTCAGATGGATACATCTGTCAACGCCGCTAATCAGGTTGTTTCTGTT
GGTGCTGATATTGCTTTTGATGCCGACCCTAAATTTTTTGCCTGTTTGGTTCGCTTTGAGTCTTCTTCGGTTCCGACTACCCTCCCGACTGCCTATGATGTTTATCCTTTGAATG
GTCGCCATGATGGTGGTTATTATACCGTCAAGGACTGTGTGACTATTGACGTCCTTCCCCGTACGCCGGGCAATAACGTTTATGTTGGTTTCATGGTTTGGTCTAACTTTACC
GCTACTAAATGCCGCGGATTGGTTTCGCTGAATCAGGTTATTAAAGAGATTATTTGTCTCCAGCCACTTAAGTGAGGTGATTTATGTTTGGTGCTATTGCTGGCGGTATTGCTT
CTGCTCTTGCTGGTGGCGCCATGTCTAAATTGTTTGGAGGCGGTCAAAAAGCCGCCTCCGGTGGCATTCAAGGTGATGTGCTTGCTACCGATAACAATACTGTAGGCATGGG
TGATGCTGGTATTAAATCTGCCATTCAAGGCTCTAATGTTCCTAACCCTGATGAGGCCGCCCCTAGTTTTGTTTCTGGTGCTATGGCTAAAGCTGGTAAAGGACTTCTTGAAGG
TACGTTGCAGGCTGGCACTTCTGCCGTTTCTGATAAGTTGCTTGATTTGGTTGGACTTGGTGGCAAGTCTGCCGCTGATAAAGGAAAGGATACTCGTGATTATCTTGCTGCTG
CATTTCCTGAGCTTAATGCTTGGGAGCGTGCTGGTGCTGATGCTTCCTCTGCTGGTATGGTTGACGCCGGATTTGAGAATCAAAAAGAGCTTACTAAAATGCAACTGGACAAT
CAGAAAGAGATTGCCGAGATGCAAAATGAGACTCAAAAAGAGATTGCTGGCATTCAGTCGGCGACTTCACGCCAGAATACGAAAGACCAGGTATATGCACAAAATGAGATGC
TTGCTTATCAACAGAAGGAGTCTACTGCTCGCGTTGCGTCTATTATGGAAAACACCAATCTTTCCAAGCAACAGCAGGTTTCCGAGATTATGCGCCAAATGCTTACTCAAGCTC
AAACGGCTGGTCAGTATTTTACCAATGACCAAATCAAAGAAATGACTCGCAAGGTTAGTGCTGAGGTTGACTTAGTTCATCAGCAAACGCAGAATCAGCGGTATGGCTCTTCT
CATATTGGCGCTACTGCAAAGGATATTTCTAATGTCGTCACTGATGCTGCTTCTGGTGTGGTTGATATTTTTCATGGTATTGATAAAGCTGTTGCCGATACTTGGAACAATTTCT
GGAAAGACGGTAAAGCTGATGGTATTGGCTCTAATTTGTCTAGGAAATAACCGTCAGGATTGACACCCTCCCAATTGTATGTTTTCATGCCTCCAAATCTTGGAGGCTTTTTTA
TGGTTCGTTCTTATTACCCTTCTGAATGTCACGCTGATTATTTTGACTTTGAGCGTATCGAGGCTCTTAAACCTGCTATTGAGGCTTGTGGCATTTCTACTCTTTCTCAATCCCC
AATGCTTGGCTTCCATAAGCAGATGGATAACCGCATCAAGCTCTTGGAAGAGATTCTGTCTTTTCGTATGCAGGGCGTTGAGTTCGATAATGGTGATATGTATGTTGACGGCC
ATAAGGCTGCTTCTGACGTTCGTGATGAGTTTGTATCTGTTACTGAGAAGTTAATGGATGAATTGGCACAATGCTACAATGTGCTCCCCCAACTTGATATTAATAACACTATAGA
CCACCGCCCCGAAGGGGACGAAAAATGGTTTTTAGAGAACGAGAAGACGGTTACGCAGTTTTGCCGCAAGCTGGCTGCTGAACGCCCTCTTAAGGATATTCGCGATGAGTAT
AATTACCCCAAAAAGAAAGGTATTAAGGATGAGTGTTCAAGATTGCTGGAGGCCTCCACTATGAAATCGCGTAGAGGCTTTGCTATTCAGCGTTTGATGAATGCAATGCGACA
GGCTCATGCTGATGGTTGGTTTATCGTTTTTGACACTCTCACGTTGGCTGACGACCGATTAGAGGCGTTTTATGATAATCCCAATGCTTTGCGTGACTATTTTCGTGATATTGG
TCGTATGGTTCTTGCTGCCGAGGGTCGCAAGGCTAATGATTCACACGCCGACTGCTATCAGTATTTTTGTGTGCCTGAGTATGGTACAGCTAATGGCCGTCTTCATTTCCATG
CGGTGCACTTTATGCGGACACTTCCTACAGGTAGCGTTGACCCTAATTTTGGTCGTCGGGTACGCAATCGCCGCCAGTTAAATAGCTTGCAAAATACGTGGCCTTATGGTTAC
AGTATGCCCATCGCAGTTCGCTACACGCAGGACGCTTTTTCACGTTCTGGTTGGTTGTGGCCTGTTGATGCTAAAGGTGAGCCGCTTAAAGCTACCAGTTATATGGCTGTTGG
TTTCTATGTGGCTAAATACGTTAACAAAAAGTCAGATATGGACCTTGCTGCTAAAGGTCTAGGAGCTAAAGAATGGAACAACTCACTAAAAACCAAGCTGTCGCTACTTCCCAA
GAAGCTGTTCAGAATCAGAATGAGCCGCAACTTCGGGATGAAAATGCTCACAATGACAAATCTGTCCACGGAGTGCTTAATCCAACTTACCAAGCTGGGTTACGACGCGACG
CCGTTCAACCAGATATTGAAGCAGAACGCAAAAAGAGAGATGAGATTGAGGCTGGGAAAAGTTACTGTAGCCGACGTTTTGGCGGCGCAACCTGTGACGACAAATCTGCTCA
AATTTATGCGCGCTTCGATAAAAATGATTGGCGTATCCAACCTGCA
Tamanho de Genomas
• Menor número de genes
Mycoplasma genitalium 470 genes
• Genoma humano
Homem ~120.000 genes
PARADOXO DO ‘valor C’
• Valor C =
Quantidade de DNA no Seu genoma haploide
• Muitos organismos menos complexos possuem valores
C surpreendentemente elevados.
• O DNA “extra” tem função?
Senão, por que é preservado de geração para geração?
Gene
•
β-globina humana
doença
anemia falciforme
• Fator VIII humano
hemofilia
• Proteína kinase
distrofia muscular
comprimento
2.000 bp
200.000 bp
3.407 bp
A identidade das coisas vivas fornecida pelo
substrato genético, parece válida a hipótese
“species are sparse” (Battail, 2001).
• N. de espécies vivas na Terra ~ 107
Admita que estas sejam uma fração de 1/100 das
que existiram (extinção)
Tem-se ~109 espécies (aparentemente grande...)
Isso é ridiculamente pequeno com respeito ao n. total
de possíveis genomas na ausência de redundância
GENOMAS ~ 4^109 ~10100000000
(para um genoma típico de 109 nucleotídeos)
O homem é mais próximo do gorila ou do orangotango?
Comparação do DNA mitocondrial
• homem
• ATA ACC ATG CAC ACT ACT ATA ACC ACC CTA ACC CTG ACT
TCC CTA ATT CCC CCC ATC CTT ACC CTC GTT ACC ...
• gorila
• ATA ACT ATG TAC GAT ACC ATA ACC ACC TTA GCC CTA ACT
TCC TTA ATT CCC CCT ATC CTT ACC TTC ATC ACT ...
• orangotango
• ACA GCC ATG TTT ACT ACC ATA ACT GCC CTC ACC TTA ACT
TCC CTA ATC CCC CCC ATT ACC GCT CTC ATT AAC ...
Pequena Cronologia de Genomas
• 1977 Seqüenciamento completo
genoma do fago φX174 (5.386 bp)
• 1995 Primeiro organismo vivo
Genoma do Haemophilus influenzae (1,8 Mbp)
• 1996 Saccharomyces cerevisiae (12,1 Mbp)
• 1997 Escherichia coli
• 1998 Primeiro animal –nematóide
Genoma do caenorhabditis elegans (97,1 Mbp)
• 1999 Primeiro cromossomo humano
Cromossomo 22 (33,4 Mbp)
• 2000 Drosophila melanogaster (120 Mbp)
• 2000 Cromossomos 5, 16, 19, 21
• 1988-2000 Human Genome Project
• June 2000 – milestone draft sequence