baixe o livro de resumos noc

Transcription

Ӂ·∙Á
CONTENTS
Symposia e
3
Oral Presentations e
4
Posters e
This document will be updated ¡'!9'9<#1-;$388'$ࣅ329;3-9!&38!z-9!&38!$8'!ࣅ='U9'8=-$'9
,3;3#@,-¡-6;3<ø'8
97
SYMPOSIA
COMING SOON
,3;3#@29'¡13&wø329'$!
ORAL PRESENTATIONS
,3;3#@29'¡13&wø329'$!
ID t
ABSTRACT
t
ID t
Table of Contents
beryllina. Principales hospederos fueron Salix bonplandiana,
Celtis caudata y Acacia schaffneri. Los principales dispersores, los
mosqueros Tyrannus vociferans y Myiozetetes similis. Se encontró
divergencia de caracteres de P. calyculatus en simpatría en
HVWUXFWXUDVćRUDOHV\IUXWRVDV¯FRPRFDOLGDG\FDQWLGDGGH
recompensas. El desplazamiento ecológico fue evidenciado en
la diferenciación del ensamble de dispersores y hospederos.
Ambos procesos, aunados a barreras post-cigóticas,
permiten su coexistencia en simpatría con P. auriculatus.
Oral Presentations
3
ABSTRACT
t
Biología reproductiva y polinización de Psittacanthus
calyculatusen en alopatría y en simpatría con P. auriculatus
Sergio Diaz Infante1*, Carlos Lara1, Maria del Coro
Arizmendi1, Juan Francisco Ornelas2
ǢW2-='89-&!&!$-32!£<;Ö231!&'Ì?-$3TǣW29ধ;<;3&'$3£3+-!TWW
r£'1'?-$!-2ǣӑ|+1!-£W$31
ORAL PRESENTATION SESSION 15: BREEDING BIOLOGY II
Estudiamos biología reproductiva y polinización del muérdago
Psittacanthus calyculatus en población alopátrica y simpátrica
con P. auriculatus (en México) durante 2013-14. Aunque la
biología reproductiva de P. calyculatus ya ha sido estudiada,
no se había explorado si los caracteres ligados a polinización y
dispersión de semillas divergen cuando co-ocurre en simpatría
FRQFRQJ«QHUHV'HVFULELPRVIHQRORJ¯DćRUDOPRUIRORJ¯DGH
ćRUHVIUXWRVVLVWHPDUHSURGXFWLYRSDWURQHVGHSURGXFFLµQ
reposición de néctar, polinizadores, dispersores y hospederos.
/RVUHVXOWDGRVLQGLFDQTXHODćRUDFLµQVHH[WLHQGHSRU
meses durante el periodo de lluvias en ambas localidades.
/DORQJLWXGGHĆODPHQWRV\SLVWLORVHQćRUHV\ODUJR\DQFKR
de frutos, son mayores en la población simpátrica. El sistema
de apareamiento predominante fue polinización cruzada.
Promedios de cosecha en pie de néctar y concentración de
azúcar fueron 9.6, 10.6 y 4.2 µl y de 16, 21 y 16o Brix para
P. calyculatus en alopatría, en simpatría y para P. auriculatus,
UHVSHFWLYDPHQWH(OSULQFLSDOYLVLWDQWHćRUDOHQDORSDWU¯D
fue el colibrí Eugenes fulgens y en simpatría el colibrí Amazilia
!+'S8!¡8'9'2;!ࣅ329
7
Using market data to assess the impact of
the wild bird trade on bird populations
David Wilcove1*, J. Berton Harris1
ǢW8-2$';322-='89-;@
r&>-£$3='|68-2$';32W'&<
ORAL PRESENTATION SESSION 3: AVIAN CONSERVATION I
The bird trade is increasingly seen as a major threat to bird
populations. Within the Neotropics, where thriving domestic
and international markets for wild birds persist, many
restricted-range species are potentially at risk. However,
the impacts of the trade on bird species are poorly known
EHFDXVHĆHOGPRQLWRULQJRIZLOGSRSXODWLRQVLVH[SHQVLYH
localized, and requires specialized expertise. Moreover, the
PXOWLWXGHRIVSHFLHVWKDWDUHWUDGHGPDNHVLWGLIĆFXOWWR
determine which species are in greatest need of monitoring.
Here we present a new approach to assessing the impacts
of the trade on wild bird populations, based on our research
in Indonesia, which has a massive bird trade. We show that
market data (price and volume trends for traded species) can
{փdփTT
ID t
ABSTRACT
t
ID t
be used to identify those bird species whose populations are
likely declining due to the trade. Market data can identify
species at risk well before they become globally endangered.
0RUHRYHUPDUNHWPRQLWRULQJLVPXFKOHVVH[SHQVLYHWKDQĆHOG
monitoring. We explore how these techniques can be applied
to the Neotropics and conclude with a recommendation for
a two-step approach to assessing trade impacts: coordinated
PDUNHWPRQLWRULQJIROORZHGE\ĆHOGVWXGLHVRIWKRVHVSHFLHV
whose market signals indicate declining populations.
9
A multilocus analysis provides evidence for more than
one species within Eugenes fulgens (Aves: Trochilidae)
Luz E. Zamudio-Beltrán1*, Blanca E. Hernández-Baños1
ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3
rA#£<A'|,3;1!-£W$31
ORAL PRESENTATION SESSION 1: TAXONOMY & SYSTEMATICS
The status of subspecies in systematic zoology is a subject of
controversy. Recent studies use DNA sequences to evaluate the
status of subspecies within species complexes, and to recognize
and delimit species. The monotypic hummingbird genus
Eugenes, distributed along the highlands from southwest USA to
Central America, represents an interesting example of how the
original subspecies descriptions could be underestimating the
species taxonomy of a complex. We assessed the phylogenetic
relationships, the taxonomic status and the species limits of the
proposed subspecies of the taxon Eugenes fulgens (subspecies:
fulgens, viridiceps and spectabilis). We performed a phylogenetic
analysis using nuclear and mitochondrial markers (mtDNA:
ND2, ND4, Control Region; nDNA: BFib, ODC, MUSK), and
!+'¢S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
contrasted these data with the geographical distribution and
the original morphological descriptions for the subspecies.
Also, we assessed the species limits between the different
groups using a coalescent approach implemented in the
Bayesian Phylogenetics and Phylogeography software (BPP).
We found genetic differences between the three groups,
suggesting the existence of two cryptic species (E. fulgens and
E. viridiceps) and one phenotypically differentiated species
(E. spectabilis). Our analyses show that the E. viridiceps and
E. fulgens groups are the most closely related of the three.
11
Establishing migratory connections
using stable isotope atlassing
Keith A. Hobson
2=-8321'2;!2!&!
'-;,W3#932|'$W+$W$!
ORAL PRESENTATION SESSION 7: MIGRATION
AND SEASONAL VARIATION
There is an urgent need to establish migratory connections
between breeding, stopover and wintering grounds of
migrant birds using the Neotropics. Despite recent advances
in the use of transmitters and light-sensitive geolocators,
this conservation need is severely hampered by logistical
DQGĆQDQFLDOFRQVLGHUDWLRQV7KHGHYHORSPHQWRIPXOWL
isotope feather ‘isoscapes’ for the Americas provides a new
opportunity to provide coarse-scale assignment of birds to
moult origins. In particular, the use of both stable-hydrogen
and stable carbon isotope surfaces to delineate origins is
showing considerable potential, especially for South America.
7KHPRVWFXUUHQWGHYHORSPHQWVLQWKLVĆHOGZLOOEHGHVFULEHG
{փdփTT
ID t
ABSTRACT
t
ID t
and migratory connections depicted for several Neotropical
migrants wintering in Central America, the Caribbean and
South America. Special focus will be placed on Barn Swallow
(Hirundo rustica) for which results of stable isotope and light
sensitive geolocator returns will be shown. Precipitationbased isoscapes for South America are less structured than
North America and underline the more favorable use of
species that grow feathers in North America before migration.
However, we generally found good concordance between
geolocator and isotope assignments for Barn Swallow that
molts on the wintering ground. Preliminary analysis suggest
that sulfur isotopes can be used to determine coastal regions.
It is proposed that a coordinated isotopic atlassing project be
established for the Palearctic-Neotropical migratory system.
12
Thomas A. W. Enright1*, T. Wayne Schwertner1, Heather
A. Mathewson1, Jeffrey B. Breeden1, James P. Muir5
ǢW!8£';32;!;'2-='89-;@TǦW'?!9+8--(''9'!8$,!2&?;'29-32'2;'8
ORAL PRESENTATION SESSION 26: WETLAND CONSERVATION
The white-tipped dove (WTDO; Leptotila verreauxi) is an elusive,
resident Columbid that reaches its northernmost distribution
in south Texas. Since its designation as a game species in 1984,
there has been little effort directed toward monitoring or
PDQDJLQJWKHVSHFLHV5HVHDUFKGHĆQLQJ:7'2RFFXSDQF\DQG
distribution, critical to effective monitoring program design,
has not been undertaken. The objectives of this study were to
model WTDO detection probability and multi-scale habitat-
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
occupancy, and predict species distribution. A time-of-detection
protocol, incorporating playback methods, was used to quantify
detection probability and occupancy of WTDO at 490 survey
locations. Detection probability and habitat-occupancy models,
integrating patch and landscape metrics, were developed
through UNMARKED. The best generalized multi-mixture
model resulted in an estimated detection probability of 0.82
that declined with ambient noise (8804; P=0.0001). Playback
FDOOVVLJQLĆFDQWO\LQFUHDVHGGHWHFWLRQSUREDELOLW\W 3.20, P = 0.001). Through model averaging, riparian forest
and citrus had the greatest occupancy probability, >0.80,
while urban and wetland had the lowest, <0.40. Occupancy
declined with distance to the nearest suitable patch, increased
with the proportion of riparian forest and had a quadratic
relationship with patch area, indicative that species occupancy
was contingent upon the proximity of riparian habitat and
citrus while negatively impacted by fragmentation. The model
and distribution provide a foundation for species abundance
assessment, guidance for future land management, and the
development of a targeted monitoring program for WTDO.
Detection probability, multi-scale occupancy, and
distribution of the white-tipped dove in South Texas
r;,31!9W'28-+,;|+3W;!8£';32W'&<
ABSTRACT
t
13
Where to Live in the Matrix: Avian Diversity
in a Tropical Landscape Mosaic
Diego Santiago-Alarcon1*, Ian MacGregorFors1, Fernando González-García1
ǢW29ধ;<;3&'$3£3+Ð!
r&-'+3W9!2ধ!+3|-2'$3£W1?
ORAL PRESENTATION SESSION 10: LANDSCAPE ECOLOGY
Due to the current complexity of landscapes, considering
their anthropogenic components in ecological studies can
{փdփTT
ID t
ABSTRACT
t
provide a more solid groundwork to better understand their
patterns and processes. We assessed bird species richness
DQGFRPSRVLWLRQDWĆYHGLIIHUHQWHQYLURQPHQWDOFRQGLWLRQV
(well-preserved cloud forest, peri-urban forest, urban forest,
shade coffee plantation, cattle ranch) embedded in a landscape
whose original vegetation was tropical montane cloud forest.
We used 10 point-counts of 25 m radius at each location to
census bird communities. Birds respond differently to the
VWXGLHGHQYLURQPHQWDOFRQGLWLRQV:HUHFRUGHGVLJQLĆFDQW
differences in species richness during the breeding season,
but no differences during the wintering season. This results
support the idea that during the wintering season, when
habitat requirements for birds are less strict, species distribute
homogeneously across the landscape, while species tend
to be more selective and concentrate in original forests
during the breeding season. Our community composition
results show that vegetation structural traits play a more
important role in determining bird communities than spatial
aggregation does. Considering the limitations of our study,
our results provide information suggesting that in order to
make effective avian conservation in the region, it is crucial
to adopt a dynamic scheme, taking into account temporal
changes in both human-managed and non-managed systems.
!+'£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
14
Spatial and seasonal variation of avian malaria
infections in sites with different land uses within
a neotropical montane forest matrix
Table of Contents
Carolina Hernández-Lara1*, Diego SantiagoAlarcon1, Fernando González-García1
ǢW29ধ;<;3&'$3£3+Ð!TWW
r$!83£-2!,£ӑǦ|+1!-£W$31
ORAL PRESENTATION SESSION 18: AVIAN DISEASES
Habitat destruction and seasonality can alter host-parasite
interactions. The montane cloud forest of Veracruz State in
Mexico has been transformed into agroecosystems and cities.
Our aim was to determine how ecological parameters of avian
malaria parasites responded to four different land use types
(i.e., preserved cloud forest, periurban forest, urban forest, and
coffee plantation) and to seasonality. We used microscopy and
PCR to determine prevalence, parasitaemia, and aggregation
of haemosporidians infecting the widespread chestnut-capped
EUXVKĆQFK$UUHPRQEUXQQHLQXFKD:HSHUIRUPHG3&$
and cluster analyses to determine vegetation structure and
similarity, and to investigate how vegetation variables are
associated with parasitological parameters. Prevalence and
parasitaemia of avian malaria were higher during the rainy
season, while aggregation presented the opposite pattern.
There was higher prevalence during the rainy season at sites
with the least disturbance and land management (preserved
cloud forest and periurban forest), while sites with urban
effects and frequent land management (urban forest and coffee
plantation) maintained similar prevalence values throughout
the year. Infection by avian malaria was negatively associated
with bush cover during the dry season. There was a higher
{փdփTT
ID t
ABSTRACT
t
ID t
likelihood of acquiring an infection and developing higher
parasite loads during the rainy season in birds inhabiting
the periurban and urban forests. Our results suggest that
an increase in land use management reduces seasonal
ćXFWXDWLRQVLQSDUDVLWHWUDQVPLVVLRQDQGWKDWLQIHFWLRQVFDQ
be more severe for birds inhabiting urban environments.
21
Daniela Gomez1*, Luis Rivera1, Roman Ruggera1, Natalia Politi1
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!&'
</<@TT<T</<@T8+'2ধ2!
ORAL PRESENTATION SESSION 21: AVIAN COMMUNITIES
Los bosques de ribera son ambientes que proveen sitios de
alimentación, reproducción, y rutas de paso para distintas
especies. En general albergan una rica y abundante fauna en
comparación con los ambientes no ribereños circundantes,
en donde las aves son uno de los grupos más conspicuos. A la
vez, las áreas circundantes son frecuentemente alteradas por
actividades productivas. Dadas su importancia y proclividad
a ser disturbados, y considerando que los estudios llevados a
cabo en bosques de ribera de las Yungas Australes (YA) son
escasos, nos proponemos: 1) describir el ensamble de aves
de los bosques de ribera en cuanto a diversidad, riqueza y
abundancia; y 2) analizar patrones de dichos ensambles en
UHODFLµQDDVSHFWRVPLJUDWRULRV\JUHPLRVWUµĆFRVSUHVHQWHV
Muestreamos seis bosques de ribera del sector norte de las
Yungas del noroeste de Argentina mediante transectas de
observación de 150m de largo (N=263) y redes de niebla
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
(2673.3 h-red) durante la estación seca y húmeda. Detectamos
un total de 207 especies de aves. Los ensambles de aves
variaron estacionalmente por la presencia de especies
migrantes latitudinales y altitudinales (similitud= 0,70%). El
gremio de las aves insectívoras fue el más numeroso (49%).
Tuvieron dominancia aquellas especies de aves características
de bosques maduros de Yungas (50%). Registramos una especie
categorizada como Vulnerable y una Casi Amenazada a nivel
global y cuatro Amenazadas en Argentina. Nuestros resultados
comprueban la importancia que tienen los bosques de ribera
para las aves como refugio de invernada y veraneo, todo lo cual
evidencia la prioridad de conservación de estos ambientes.
Ensambles de aves de los bosques de ribera pedemontanos
de las Yungas del noroeste de Argentina
r1!&!2-'£!+31'A|+1!-£W$31
ABSTRACT
t
28
Depauperate avian assemblages in
Amazonian oil palm plantations
Alexander C. Lees1*, Nárgila G. Moura1, Arlete
S. Almeida1, Ima C. G. Vieira1
ǢW<9'<!8!'29'1Ð£-33'£&r!£'?!2&'8£''9|#;36'2>38£&W$31
Amazonia, host to both the world’s largest remaining expanse
of tropical forest and its richest avifauna is also subject to
some of the planet’s highest absolute rates of forest loss and
degradation. Expansion of oil palm plantations elsewhere in the
humid tropics has precipitated massive loss of forest habitats
and their associated speciose biotas and their expansion into
north-east Brazil represents an emergent threat to Amazonian
biodiversity. Understanding the direct and indirect impacts
and concurrent conservation trade-offs of the expanding
Amazonian oil palm plantation acreage, alongside other
{փdփTT
ID t
ABSTRACT
t
dominant regional land-uses is thus critical for systematic
conservation planning. We carried out bird surveys in oil palm
plantations of varying ages and in both primary and secondary
forests and cattle pastures in the Brazilian state of Pará. We
found that oil palm plantations retained impoverished avian
communities with a similar species composition to pastures
and other non-forest land-uses and did not offer habitat for
most forest-associated species, including those of national
and international conservation concern. On the other hand,
the forest remnants which the oil palm companies are legally
obliged to protect, hosted a relatively species-rich community
including several globally-threatened bird species, although
these forest remnants already represent a shifted baseline.
We consider oil palm to be no less detrimental to regional
biodiversity than other agricultural land-uses and that
political pressure exerted by large landowners to permit its
legal substitution for native forest in private landholdings
would have dire consequences for regional biodiversity.
31
Relationship between beak morphology and diet of
three sympatric species of genus Sporophila “seedeaters”
in coastal agroecosystems of Central Peru
O.F. Cerron Sosa1*, L. Salinas Sanchez1, C. Arana Bustamante1
ǢW'6!8;1'2;3(82-;,3£3+@T<9'<13(!;<8!£
-9;38@f!ধ32!£2-='89-;@3(!2!8$39
ID t
ABSTRACT
t
Table of Contents
related to the morphological characteristics of food. ThirtyĆYHGLJHVWLYHWUDFWVRIHDFKVSHFLHVRIVHHGHDWHUSporophila
telasco, S. simplex and S. peruviana were analyzed in this study,
obtained from samples collected between 2004-2012, during
the dry and wet season in three agroecosystems (two in Ica
and one in Lima). The composition of the diets was determined;
the proportions of each food item and the weight weighted
average of seed consumed for each seedeater were calculated.
Furthermore, the relationship between beak morphology and
diet of specimens of Sporophila telasco (n=12), S. simplex (n=15)
and S. peruviana (n=14) was assessed, using samples from the
bird collection of the Natural History Museum of San Marcos
(only mature specimens were considered). Measurement
of length, width, height and width of beak were taken from
each one of the individuals. Pearson correlation analysis
IRXQGDVLJQLĆFDQWUHODWLRQVKLS3EHWZHHQWKHZHLJKW
weighted average of seeds consumed, and height and width
of the beaks evaluated. The three species of genus Sporophila
tended to segregate in the consumption of seeds with different
weight. S. telasco frequently eats seeds from 0.12 to 0.62 mg,
S. simplex usually consumes seeds between 0.40 and 2.22
mg, and S. peruviana most commonly eats seeds between
0.62 and 150 mg. The results indicate a possible mechanism
of segregation in the use of resources, through selection by
weight of seeds, which ultimately determines the coexistence.
r39$i#6|,3;1!-£W$31
ORAL PRESENTATION SESSION 24: ECOMORPHOLOGY II
The beak is the trophic apparatus with higher functional
VLJQLĆFDQFHDQGLWVGLPHQVLRQDOYDULDWLRQVDUHGLUHFWO\
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
35
Time goes by: monitoring community diversity and
bird longevity at a cloud forest in Colombia
ID t
ABSTRACT
t
Table of Contents
that reveals that tropical monitoring is feasible and possible.
Monitoring, along with biological studies in the tropics must
be encouraged and enhanced to continue understanding
diversity changes and life history characteristics.
Maria Angela Echeverry-Galvis1*, Natalia1, Jorge
Ahumada2, Sergio, Michaela Hau
ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW329'8=!ধ322;'82!ধ32!£
r1!W'$,'='88@+|/!='8-!2!W'&<W$3
ORAL PRESENTATION SESSION 14: AVIAN POPULATION TRENDS
Monitoring is fundamental for biodiversity conservation;
however, the Neotropics remain behindhand in this aspect.
7KHPDLQUHDVRQVDGGXFHGDUHLQVXIĆFLHQWIXQGLQJSRRU
LQIUDVWUXFWXUHDQGGLIĆFXOWLHVLQJHWWLQJGDWDSXEOLVKHG:H
present data from a bird monitoring initiative developed in
a relict of cloud-mountain forest in Colombia. Data were
gathered during two periods, 1999-2001 and 2008-2011, using
mist netting. Birds were captured and banded to understand
the regulation of life history events, and to assess community
changes using mark-recapture techniques. A total of 64
species and 1248 individuals were captured. Diglossa albilatera
and Cinnycerthia unirufa were, during both periods, the most
DEXQGDQWVSHFLHVVSHFLHVFDSWXUHGGXULQJWKHĆUVWSHULRG
were not captured during the second one; while other 10
new species were added in the second period. Community
structure was analyzed with Whittaker plots (rank abundance)
DQGVKRZHGVLJQLĆFDQWFKDQJHVRYHUSHULRGV,QGLYLGXDOV
from &KORURVSLQJXVćDYRSHFWXV, Cinnycerthia unirufa, Atlapetes
schistaceus, Arremon brunneinucha, Anisognathus igniventris,
Diglossa cyanea, and Ochthoeca diadema were recaptured
after more than 10 years of initial capture, indicating a high
ORQJHYLW\DQGĆUVWOLIHVSDQUHFRUGVIRUPRXQWDLQ1HRWURSLFDO
species. Despite multiple obstacles, we present a dataset
!+'S8!¡8'9'2;!ࣅ329
39
Testing morphology as a predictor of foraging
HFRORJ\DQGPLFURKDELWDWXVHLQD7\UDQWć\FDWFKHU
(Tyrannidae) assemblage from northern Colombia
Esteban Botero-Delgadillo1,2*, Nicholas Bayly1
ǢWV'9'!8$,(38$329'8=!ধ32-2;,''3;836-$9TǣW2-='89-&!&&',-£'
r'#3;'83&|+1!-£W$31
According to community ecology theory, morphology can
be viewed as a correlate of ecological relationships among
coexisting bird species. However, evidence for this relation
comes from studies on bird communities rather than local
assemblages, and mostly focused on temperate latitudes.
In order to determine if this relation holds for Neotropical
avifauna, we used three multivariate approaches to test
the correspondence between morphological and foraging
HFRORJ\GDWDLQD7\UDQWć\FDWFKHUDVVHPEODJHVSHFLHV
in the Santa Marta Mountains, northern Colombia. (i) In two
separate principal components analyses (PCA), we observed
similar species ordinations when using morphological (wing
length, tail length, beak size and shape, tarsus length) or
foraging data (searching and attacking strategies). (ii) When
using morphological traits as predictors in discriminant
function analyses (DFA), 90% of all measured individuals (n =
ZHUHFRUUHFWO\FODVVLĆHGLQSUHYLRXVO\GHĆQHGIRUDJLQJ
categories. (iii) In canonical correlation analyses (CCA), we
{փdփTT
ID t
ABSTRACT
t
ID t
REWDLQHGDVLJQLĆFDQWFRUUHODWLRQEHWZHHQPRUSKRORJLFDO
data and two independent datasets of search and attack
behavior. These results demonstrate that morphology can
accurately predict ecological relations in an assemblage
of Neotropical tyrannids. It was also evident that the best
predictors of foraging strategies and microhabitat use in
this assemblage were bill size and shape, wing length, and
tarsus length. Further studies should test ecomorphological
relations in other Neotropical taxa, in order to identify
subsets of phenotypic traits that could be used as a reliable
proxy of ecological relationships of syntopic birds.
51
Ana Luiza Camargo Catalano
!2!£<-A!$!;!£!23ǧ|+1!-£W$31
We examined in this study vocalizations of individuals of
Thamnophilus doliatus from different locations across Latin
America. Songs from 157 individuals were analyzed using
the following variables: number of notes, patch duration,
repetition rate, peak frequency, duration of the terminal note,
and peak frequency of the terminal note. Since the occurrence
of T. doliatus is widespread in Latin America, we expected
that these variables would have a great variation among
individuals. The songs were divided into sections to measure
variation of repetition rate and frequency. The variables
were correlated with geographic factors such as latitude,
longitude, and elevation to examine geographic variation in
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
acoustic patterns based on subspecies groups. The variables
were strongly correlated with latitude, with individuals from
equatorial locations having faster songs with more notes, a
longer duration, and a terminal note that is lower in frequency.
Also, an acoustic pattern in the peak frequency was observed
ZLWKORQJLWXGH6HYHQVXEVSHFLHVZHUHLGHQWLĆHGEDVHGRQWKHLU
geographic location. Among these, the songs of T. d. intermedius
and T. d. radiatus ZHUHIRXQGWRGLIIHUVLJQLĆFDQWO\LQWKHQXPEHU
of notes, section duration, repetition rate, and peak frequency.
The recently elevated species Thamnophilus capistratus was
DOVRH[DPLQHG\HWVLJQLĆFDQWYDULDWLRQZDVIRXQGRQO\LQ
repetition rate, peak frequency, and in the terminal note. That
song characteristics were more similar between different
species (T. doliatus and T. capistratus) than among subspecies,
it raises the question of whether more than one species is
represented within T. doliatus as presently recognized.
Variation in the song of Thamnophilus doliatus
(Linnaeus, 1764) (Aves: Thamnophilidae) in
different regions of Latin America
ORAL PRESENTATION SESSION 12: BIOACOUSTICS II
ABSTRACT
t
53
The use of suboscines as biological indicators of
forest fragment functional connectivity
L. dos Anjos1*, G. M. Bochio1, B. R. Arakaki1, L. C. Calsavara1, J.
D. Torezan1, H. R. Medeiros1, M. C. Ribeiro2, M. R. Lima1
ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW2-='89-&!&'9;!&<!£!<£-9;!
r££!2/39|9'8$31;'£W$31W#8
ORAL PRESENTATION SESSION 17: HABITAT FRAGMENTATION
We investigated if a particular group of suboscines could
be considered an useful biological indicator in a fragmented
Atlantic Forest landscape in southern Brazil. We tested if the
suboscines group of antbirds-ovenbirds (G1), that comprises
primarily of forest understory insectivorous birds, is a better
ELRORJLFDOLQGLFDWRUWKDQW\UDQWć\FDWFKHUVWLW\UDV*ZKLFK
{փdփTT
ID t
ABSTRACT
t
has a larger diet spectrum and occupancy of forest strata.
We used point counts in a large block of continuous forest,
the Iguassu National Park (INP), and in a fragmented forest
landscape in the north of Paraná. We evaluated if species
of G1 presented higher occupancy when compared to G2 in
a 5 km transect of continuous forest in the INP. Moreover,
we investigated variation in species richness of these two
bird groups in 10 forest fragments across a forest cover
gradient, which was measured using the following: fragment
size, connectivity, vegetation quality and forest cover. A total
of 29 species of G1 and 34 species of G2 were recorded in
the continuous forest. G1 (12 species) presented a higher
rate of full occupancy than G2 (6 species; Contingency
Table, p = 0.037). G2 species did not respond to any of the
measured variables, while G1 species richness increased
with forest connectivity. We argue that the G1 is a useful
biological indicator because species in this group: (1) tend
to have high occupancy in continuous forest (2) tend to be
more sensitive to functional connectivity among forest
fragments, one of best predictors in fragmented landscapes.
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
59
Effects of avian malaria on male behavior and female
visitation in lekking Blue-crowned Manakins
Table of Contents
Mariane Bosholn1*, Alan Fecchio2, Patricia Silveira3,
Érika (EMB) Braga3, Marina Anciães1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW$!&'1@3(!;<8!£
$-'2$'93(8'?'£2-='89-;@TǤW2-='89-&!&'
'&'8!£&'-2!9'8!-9
r#39,3£2W1|+1!-£W$31
Infection by blood parasites of the genus Plasmodium can
affect survival and reproduction in the host, and may affect
the expression of sexual selection traits. Although different
studies highlight the association of parasitism with a decrease
in reproductive success of hosts, it is still uncertain which
ĆWQHVVFRPSRQHQWVDUHDIIHFWHGE\WKHSDUDVLWHV+HQFH
few studies have addressed the role of parasites in honest
signalling among lekking species. Here, we investigated if
infection by Plasmodium spp. compromises rates of vocalization,
dance and social interaction of male Blue-crowned Manakins
(Lepidothrix coronata), and if it affects female preferences in a
Central Amazon population. Behavioral observations coupled
with molecular diagnosis to detect haemosporidian parasites
revealed that infection by Plasmodium affected male activities,
as well as female choice. Furthemore, despite similar visiting
frequencies to both infected and uninfected males, they were
more frequent to males that vocalized and danced more, which
were more frequently not infected. Therefore, we suggest a
role of male vocalization and dance rates as honest signals for
females, indicating male immunity in the studied population.
Thus, male exhibitions would function as an important signal for
sexual selection, used by females as cues about the probability
{փdփTT
ID t
ABSTRACT
t
ID t
of a male being infected. Future studies testing the inheritance
of female preferences and male behaviour rates will add to the
understanding of the role of such behaviors in the evolution
of mechanisms of female preferences with honest signals.
60
José Tomás Ibarra1*, Kathy Martin2
ǢW2-='89-;@3(8-ধ9,3£<1#-!{32ধ)$-!2-='89-&!&!;Õ£-$!&'
,-£'TǣW2-='89-;@3(8-ধ9,3£<1#-!{2=-8321'2;!2!&!
ORAL PRESENTATION SESSION 19: FUNCTIONAL DIVERSITY
Conservation practices commonly focus on measures of species
diversity that merely include information on species richness
(i.e., taxonomic diversity). However, functional diversity
(range, distribution and density of trait values of species in
a community) should be more informative than taxonomic
diversity as it measures those aspects of diversity that affect
ecosystem function. Previous work in the northern hemisphere
has shown that owls may act as surrogates for taxonomic
diversity but little is known on their value as surrogates of
functional diversity. We assessed the surrogacy reliability
of two sympatric owls, 6WUL[UXĆSHV(habitat-specialist) and
Glaucidium nana (habitat-generalist), in Andean temperate
forests of southern Chile. During 2011-2013, we conducted
1,145 owl surveys, 505 avian point-transects and 505
vegetation surveys across 101 sites comprising a range of
conditions from degraded habitat to structurally complex oldgrowth forest stands. We found that only 6WUL[UXĆSHVwas a
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
reliable surrogate for both taxonomic and functional diversity
measures, including the density of vulnerable avian guilds (e.g.,
bamboo understory users and large-tree users) and the degree
of habitat-specialization of the avian community. We found that
forest-stand structural complexity (sites with dense understory
and availability of large trees) was the underlying mechanism
driving the positive relation between forest-specialist owls
and biodiversity. Our results show a tight association between
habitat-specialist owls and avian functional traits that may
be more informative than species richness to prioritize
the conservation of stable, functioning ecosystems.
Habitat-specialist owls, but not generalists, are
reliable surrogates for taxonomic and functional
diversity in Andean temperate forests
r/ধ#!88!|<$W$£
ABSTRACT
t
64
¿La organización de la comunidad de colibríes es
determinada por la dominancia agresiva?
Lopez Segoviano Gabriel1*, Arizmendi MC1
ǢW
!$<£;!&&'9;<&-39<6'8-38'9A;!$!£!T2-='89-&!&
!$-32!£<;Õ231!&'Ì?-$3
r+£9'+3=-!23|,3;1!-£W$31
Para los colibríes, la competencia por alimento es uno de los
principales factores que determinan la organización de la
comunidad. En este estudio, establecemos los mecanismos que
determinan la organización de la comunidad de colibríes dentro
de un corredor migratorio en el noroeste de México. Primero,
establecemos el estatus de dominancia y su relación con el
WDPD³RFRUSRUDOLGHQWLĆFDPRVVLODFRPXQLGDGGHFROLEU¯HVVH
RUJDQL]µGHDFXHUGRDORVSDUFKHVćRUDOHVGRQGHVHDOLPHQWDQ
y por último evaluamos si la energía disponible en cada parche
podría determinar qué especies de colibríes tienen encuentros
agresivos en ellos. Observamos el comportamiento de
{փdփTT
ID t
ABSTRACT
t
ID t
DOLPHQWDFLµQHQSDUFKHVćRUDOHVHQXQERVTXHWHPSODGR
(QFDGDSDUFKHćRUDOUHJLVWUDPRVODVHVSHFLHVGHFROLEU¯HV
el número de interacciones y el tiempo de alimentación.
$GHP£VUHJLVWUDPRVODVHVSHFLHVGHSODQWDQ¼PHURGHćRUHV
presentes y calculamos las calorías totales producidos en cada
SDUFKHćRUDO1XHVWURVUHVXOWDGRVPRVWUDURQTXHODMHUDUTX¯D
de dominancia en trece especies de colibríes (migratorias y
residentes) se relacionó con su tamaño corporal. La distribución
espacial de las especies de colibríes depende de la distribución
de especies de las plantas de las que se alimentan y de la
FDQWLGDGGHHQHUJ¯DSURGXFLGDSRUFDGDSDUFKHćRUDO$V¯ORV
diferentes tipos de recursos y la dominación agresiva de las
especies de colibríes establecen la distribución equitativa de
las especies y reducen traslape en la explotación de recursos.
65
Alejandro Alarcón1*, Sam Shanee2
ǢW93$-!$-Õ2'3;836-$!£8-1!;'329'8=!ধ32'8ÚT
ǣW'3;836-$!£8-1!;'329'8=!ধ32
ORAL PRESENTATION SESSION 25: ECOLOGY AND BEHAVIOR
La Lechucita Bigotona (Xenoglaux loweryi) es un estrígido
endémico del Perú y en peligro de extinción. Habita en
los bosques montanos húmedos de la Cordillera Oriental
de los Andes, entre la región Amazonas y San Martín. La
información sobre su ecología e historia natural es limitada,
siendo el motivo de esta investigación conocer su abundancia
poblacional, vocalización por medio de sonogramas y dieta
a través de heces. El monitoreo se realizó entre febrero
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
y agosto de 2014, en La Jalca y El Toro (Yambrasbamba,
Amazonas). La abundancia poblacional se estimó por el
método de conteo de puntos, apoyado de la provocación
auditiva; las respuestas fueron grabadas y analizadas con el
programa Avisoft-SASLab Pro 5.2.09; y se colectó heces. La
DEXQGDQFLDUHODWLYDIXHs\sLQGNPSDUD
El Toro y La Jalca respectivamente, cantidad considerada
teniendo en cuenta que es rara. Se describieron dos tipos
de vocalizaciones emitidos por un individuo en respuesta a
vocalizaciones pregrabadas, el canto conocido (territorial) y
un nuevo canto (probablemente de inspección), los análisis
demuestran que las frases recurrentes de ambos cantos
GLĆHUHQHQVXFRPSRVLFLµQUHJLVWURTXHDPSO¯DHOUHSHUWRULR
YRFDOFRQRFLGR(QHODQ£OLVLVGHKHFHVVHLGHQWLĆFDURQUHVWRV
de insectos del orden Coleoptera, Orthoptera e Hymenoptera;
tipo de dieta que se observa en otros pequeños estrígidos
como Micrathene whitneyi, Megascops barbarus y Megascops
choliba. Futuras investigaciones en las estaciones biológicas
de la ONG Neotropical Primate Conservation, servirán como
herramientas en la toma de decisiones para su conservación.
Estudios preliminares sobre la ecologia de la
lechucita bigotona Xenoglaux loweryi
r!£'/!2&83!£!8$326!8&3|+1!-£W$31
ABSTRACT
t
67
Evolution of climatic niches in newworld warblers (Parulidae)
Camila Gomez1*, Elkin Tenorio1, Daniel Cadena1
ǢW!#38!;38-3&'-3£3+-!=3£<ধ=!&''8;'#8!&39T2-='89-&!&&'392&'9
r$W+31'AǢǤ|<2-!2&'9W'&<W$3
ORAL PRESENTATION SESSION 23: AVIAN
DISTRIBUTIONS AND GLOBAL CHANGE
Differences in life-history attributes between tropical and
temperate lineages are often attributed to differences in their
{փdփTT
ID t
ABSTRACT
t
climatic niche dynamics. For example, the more frequent
appearance of migratory behaviour in species breeding in
the temperate zone than in species originally breeding in
the tropics is believed to have resulted partly from tropical
climatic stability and niche conservatism constraining tropical
species from shifting their ranges. However, little is known
about the patterns and processes underlying climatic niche
evolution in migratory and resident animals. We evaluated
the evolution of overlap in climatic niches between seasons
and its relation to migratory behaviour in the Parulidae. We
used ordination methods to measure seasonal niche overlap
of 55 resident and 48 migratory species and phylogenetic
comparative methods to assess patterns and modes of
climatic niche evolution. We found that despite travelling up
to thousands of kilometers, migrants track climatic conditions
across the year to a greater extent than tropical residents,
which results in different modes of niche evolution in migrants
and residents. This pattern contradicts the hypothesis of
greater niche conservatism constraining tropical species
from range-shifting and suggests that other factors are likely
involved in shaping the evolution of migration in tropical
and temperate lineages. The long-held notion that tropical
species are more sensititive to climatic change than their
temperate-zone counterparts due to more constrained
niches may not apply to cases in which temperate-breeding
species escape climatic extremes via migratory behaviour.
!+'¢S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
71
Biologia reprodutiva de Rhopias gularis
(Passeriformes:Thamnophilidae) no Sudeste do Brasil
Table of Contents
Daniel F. Perrella1*, Carlos H. Biagolini-Jr.1, Lais RibeiroSilva1, Paulo V. Q. Zima1, Mercival R. Francisco1
ǢW
!8f2-='89-&!&'
'&'8!£&'È3!8£39
r&(6'88'££!|+1!-£W$31
ORAL PRESENTATION SESSION 4: BREEDING BIOLOGY I
Poucos estudos com parâmetros de história de vida têm sido
realizados com aves da Mata Atlântica. Neste estudo, são
apresentadas as primeiras informações sobre a reprodução de
Rhopias gularis, espécie endêmica da Mata Atlântica brasileira.
O trabalho foi conduzido no Parque Estadual Carlos Botelho,
um remanescente que abrange 37.644 ha de Mata Atlântica no
estado de São Paulo. Ao longo de dois períodos reprodutivos
HIRUDPHQFRQWUDGRVQLQKRVDWLYRV
que foram monitorados periodicamente. Como resultado, os
SHU¯RGRVGHLQFXED©¥RHSHUPDQ¬QFLDGRVĆOKRWHVQRQLQKR
duraram 16,8 ± 0,6 e 11,0 ± 0,86 dias, respectivamente.
Atividades de atendimento ao ninho, tais como incubação,
retirada do saco fecal, alimentação e aquecimento dos ninhegos
foram divididas igualmente entre os sexos, sendo que nenhum
investe mais tempo do que o outro em nenhuma atividade.
Há indícios de que a escassez de chuvas durante a primeira
WHPSRUDGDSRGHWHULQćXHQFLDGRWDQWRRVXFHVVRTXDQWRR
início das atividades reprodutivas. Embora o tamanho das
ninhadas de R. gularis (n = 2) esteja de acordo com o padrão
comum para aves tropicais, o alto sucesso reprodutivo estimado
SHODSUREDELOLGDGHGHVREUHYLY¬QFLDGHQLQKRVGH0D\ĆHOG
(56,6%) não corrobora com a hipótese de que haveriam
taxas de predação de ninhos mais altas nos trópicos, a qual
{փdփTT
ID t
ABSTRACT
t
ID t
favoreceria ninhadas menores, indicando que esse paradigma
ainda permanece mal esclarecido. Dessa forma, estudos com
mais espécies da região, em áreas preservadas, poderiam
contribuir para o entendimento de adaptações reprodutivas
e de história de vida dos Passeriformes da Mata Atlântica.
73
ABSTRACT
t
Table of Contents
diversidade (P<0.001) em todas as áreas, sem diferenças
entre elas. Amostramos um total de 143 espécies de aves
consumidoras de artrópodes, porém as diferenças de IPA
HQWUHDV£UHDVQ¥RLQćXHQFLRXRUHVXOWDGRGRH[SHULPHQWR
Dessa forma, a ausência das aves afetou diretamente as
SRSXOD©·HVGHDUWUµSRGHVRTXHSRGHULDLQćXHQFLDURVQ¯YHLV
de herbivoria e a produtividade vegetal. Ao mesmo tempo,
a similaridade das áreas pode indicar que áreas perturbadas
(sede) próximas de áreas conservadas (estágio avançado de
sucessão), mesmo perdendo espécies insetívoras especialistas,
podem manter esse serviço, uma vez que aves generalistas
e insetívoras eventuais garantiriam esse papel funcional.
Efeitos da avifauna insetívora na abundância
e diversidade de artrópodes
Bruna L. Gagetti1,2*, Suelen B.M. Rodrigues1, Augusto J. Piratelli1
ǢW2-='89-&!&'
'&'8!£&'È3!8£39ǣW
<2&!%È3!87<' 33£Õ+-$3&'È3!<£3
r#8<2!W+!+'ষ|+1!-£W$31
ORAL PRESENTATION SESSION 2: TROPHIC INTERACTIONS & DIET
As aves contribuem para diversos tipos de serviços ambientais
como o controle de populações de artrópodes, tendo um
importante papel na regulação de processos ecológicos.
Avaliamos o papel das aves na abundância e diversidade
de artrópodes em diferentes ambientes em uma área de
Mata Atlântica. O estudo foi realizado entre outubro de
2013 e outubro de 2014 em três áreas do Parque Estadual
Carlos Botelho (SP), Brasil (sede e estágios inicial e avançado
de sucessão). Restringimos o acesso das aves em ramos
vegetais utilizando redes de exclusão em 48 indivíduos
de Melastomatacea durante quatro meses, com duas
réplicas (estações chuvosa e seca). Os artrópodes foram
coletados pelo método branch clipping nos ramos com
redes e controle. Paralelamente, foi feita a amostragem
PHQVDOGDDYLIDXQDSRUPHLRGHSRQWRVĆ[RV2VGDGRV
foram analisados por regressão múltipla. A presença das
UHGHVGHH[FOXV¥RUHVXOWRXHPXPDXPHQWRVLJQLĆFDWLYR
tanto da quantidade de artrópodes (P=0,01) quanto da
!+'S8!¡8'9'2;!ࣅ329
78
Conducta exploratoria y migración en Zonotrichia capensis
Yanina Y.P. Poblete1*, Victor V.G. Gutierrez1, Valezca V.C. Cid1,
Cristobal C.V. Venegas1, Pablo P.S. Sabat1, Rodrigo Vasquez1
ǢW29ধ;<;3&'$3£3+Ð!@-3&-='89-&!&T'6!8;!1'2;3&'-'2$-!9
$3£Õ+-$!9T
!$<£;!&&'-'2$-!9T2-='89-&!&&',-£'T!2ধ!+3T,-£'
r@!2-2!63#£';'7|+1!-£W$31
Cuando las especies presentan amplios rangos de distribución,
es probable observar grupos de individuos que se encuentran
sometidos a diferentes presiones de selección, las cuales
pueden conducir a la evolución de diferentes estrategias
adaptativas en base a las condiciones ambientales locales.
$OJXQDVGHHVWDVGLIHUHQFLDVSXHGHQUHćHMDUVHHQDVSHFWRV
morfométricos y conductuales o incluso generar que aquellos
grupos que se encuentran en ambientes extremos, migren.
Considerando estos antecedentes, se caracterizaron rasgos
{փdփTT
ID t
ABSTRACT
t
morfométricos y conductuales de dos poblaciones de la
especie Z. capensis, una de alta altitud (Farellones 2400 m
s.n.m) y otra de baja altitud (Rinconada 600 m s.n.m.). Además,
VHUHDOL]DURQFHQVRVHQ)DUHOORQHVFRQHOĆQGHHYLGHQFLDU
la posible migración en esta población, propiciada por las
condiciones ambientales extremas propias del sector. Se
UHDOL]DURQDQ£OLVLVLVRWµSLFRVFRQHOĆQGHUHVSDOGDUHVWH
registro. Los resultados muestran que existen diferencias
PRUIRP«WULFDV\FRQGXFWXDOHVVLJQLĆFDWLYDVHQWUHDPERV
grupos, siendo los individuos de Farellones de mayor tamaño
corporal y más exploradores en relación a los de Rinconada.
Junto con ello, hemos observado una disminución sostenida
de individuos en Farellones, sin avistamientos durante el
invierno. Los análisis isotópicos muestran que probablemente
este grupo se desplaza a sectores de menor altitud
después de la reproducción. En base a nuestros resultados
podemos concluir que individuos de la misma especie
pueden presentar diferencias morfológicas y conductuales
LQćXHQFLDGDVSRUGLIHUHQWHVSUHVLRQHVDPELHQWDOHVJHQHUDQGR
LQFOXVRSURFHVRVGHPLJUDFLµQDQLYHOVXEHVSHF¯ĆFR
79
Seleção Sexual e os riscos de extinção
em paisagens fragmentadas
Cristina M Silva1*, Érica Hasui1, Luis A Beijo1
ǢW2-='89-&!&'
'&'8!£&'£('2!9
rধ2!W1!+!£,!'9W9-£=!|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
em conectar a paisagem para elas, visto seu maior risco
de predação. Realizamos coletas de presença, através da
técnica de focal, em 79 árvores em pastos de 8 paisagens. As
espécies encontradas foram: Colaptes campestris, Cyanocorax
chrysops, Fluvicola nengeta, Furnarius rufus, Thraupis sayaca,
6LFDOLVćDYHROD6\QDOOD[LVVSL[L=RQRWULFKLDFDSHQVLV7XUGXV
leucomelas, Megarynchus pitanguá, Pitangus sulphuratus, Turdus
UXĆYHQWULV7DQJDUDFD\DQD(ODHQLDPHVROHXFD6DOWDWRUVLPLOLV
Cyclarhis gujanensis, Chiroxiphia caudata, Saltator fuliginosus,
$QWLORSKLDJDOHDWD0LRQHFWHVUXĆYHQWULV3HQHORSHREVFXUD
Pyroderus scutatus, Schiffornis virescens, Tachyphonus coronatus,
Trogon surrucura, Platyrinchus mystaceus. Os melhores modelos
(dAIC<2; weight=0,6704) mostram que dicromatismo
(p<0,001) inibe a presença dessas espécies, porque elas
são mais conspícuas aos predadores, especialmente em
áreas com pouca cobertura vegetal. Além disso, a altura
da árvore (p<0,001) aumenta sua presença, pois também
aumenta a visibilidade da paisagem. A porcentagem de
mata na paisagem é favorável a presença delas, pois
aumenta a permeabilidade da matriz (i.e aumenta cobertura
vegetal). Predadores e a distância das árvores ao fragmento
diminuem a presença delas. Concluímos que essas espécies
podem sofrer com maiores efeitos de isolamento, como
DDXV¬QFLDGHPHWDSRSXOD©·HVYLVWRTXHDHĆFL¬QFLDGH
conectores de paisagem para elas é reduzida. Portanto, elas
tem maiores riscos de sucumbir a vórtices de extinção.
Traços sexuais podem diminuir a sobrevivência da espécie,
pois existe uma relação antagônica entre seleção sexual e
QDWXUDO$VVLPVWHSSLQJVWRQHVSRGHULDPVHUPHQRVHĆFLHQWHV
!+'£S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
95
Frugivoría por aves en Byrsonima crassifolia(Malpighiaceae):
comparación en sus formas cultivada y silvestre
ID t
r-&!8!Ǩ|,3;1!-£W$31
El consumo de frutos por las aves involucra, en la mayoría de
los casos, una relación mutualista planta-frugívoro; diversos
factores intervienen en esta relación y en el proceso de
selección, tales como: el tamaño, color y morfología del fruto,
su calidad nutricional, abundancia y disposición. Poco se conoce
sobre cómo las aves frugívoras interaccionan con las especies
vegetales en áreas de cultivo que tienen representantes en
elmedio silvestre. El objetivo de este trabajo fue determinar las
diferencias y similitudes en la frugivoría de aves entre las formas
silvestres y cultivadas del nanche (Byrsonima crassifolia). Se
llevaron a cabo observaciones focales sobre árboles silvestres
y cultivados, con un total de 216 horas de registro. Se estimó
XQ¯QGLFHGHGLYHUVLGDGGH6KDQQRQVLJQLĆFDWLYDPHQWHPD\RU
en el sistema silvestre que en el cultivado (p<0.05). En ambos
sistemas, la especie Turdus grayi registró la mayor abundancia.
6HUHJLVWUµXQWLHPSRSURPHGLRVLJQLĆFDWLYDPHQWHPD\RUHQ
el consumo individual de frutos en el sistema cultivado (85.9
± 47.46 min vs. 45.7 ± 21.18 min, respectivamente; p<0.01). El
WDPD³RSURPHGLRGHORVIUXWRVIXHVLJQLĆFDWLYDPHQWHGLIHUHQWH
!+'S8!¡8'9'2;!ࣅ329
Table of Contents
(p<0.001), aunque no se registraron diferencias respecto al
promedio de frutos consumidos en ambos sistemas. El análisis
químico mostró que los frutos silvestres ofrecen un mayor
contenido proteico y de grasas que los frutos cultivados.
Con base en el tamaño y en el número de frutos enteros
consumidos, se registró una mayor efectividad de dispersión
de las semillas de los frutos silvestres que de los cultivados.
Rosa Idania Arteaga-Acosta1*, Jorge E. MoralesMávil2, Mauro Galleti3, Laura T. Hernández-Salazar2,
Víctor Rico Gray2, Armando Martínez-Chacón2
ǢW39+8!&3'2'<83';3£3+Ð!T2-='89-&!&'8!$8<A!2!T
ǣW!#W-3£3+Ð!&'£31638;!1-'2;3T29ধ;<;3&''<83';3£3+Ð!T
2-='89-&!&'8!$8<A!2!TǤW!#38!;38-3-3£3+Ð!&!329'8=!%È3T
'6!8;!1'2;3&'$3£3+-!T2-='89-&!&'9;!&<!£!<£-9;!
ABSTRACT
t
98
Noise and social environment affects males
reproductive calls in Zonotrichia capensis:
,QWUDVSHFLĆFYDULDELOLW\RUSODVWLFLW\"
Mauricio Soto-Gamboa1*, Andrés SIlva-Escobar1,
Yesenia Uribe1, Rodrigo Alvar1
ǢW29ধ;<;3&'-'2$-!91#-'2;!£'9@=3£<ধ=!9T
!$<;£!&
&'-'2$-!9T2-='89-&!&<9;8!£&',-£'
r1893;3|<!$,W$£
ORAL PRESENTATION SESSION 8: BIOACOUSTICS I
Recent studies recognize environmental noise as one of several
important factors affecting avian acoustic communication.
In urban areas low-frequency anthropogenic noise is likely
to mask sound transmission. Birds respond in three different
ways to environmental noise: by increasing the song amplitude
(the Lombard effect), by raising the frequency of the sound
above that of background noise, and by reducing interference
by singing during the quiet periods of day. In oscine birds,
VRFLDOLQćXHQFHRQVRQJLVFORVHO\DVVRFLDWHGZLWKDOHDUQLQJ
SURFHVVDQGUHODWHGWRWKHLQćXHQFHRIWXWRUV\HWKLJKO\
stereotyped adult songs are assumed. In this work we
analyzed note shape and spectral cues of male reproductive
songs in Zonotrichia capensis. We evaluated repertoire size
{փdփTT
ID t
ABSTRACT
t
and individual variability of song structure as it relates to
environmental noise and abundance. We recorded 5 min of
VSRQWDQHRXVVRQJIURPLQGLYLGXDOPDOHVDQGTXDQWLĆHG
environmental noise and abundance in the city of Valdivia,
Chile. We also captured, marked, and released 10 individuals,
each of which were recorded six different times following the
same protocol. We analyzed these songs using Multiple Lineal
Regression and Quantile Regression. Results suggest that
environmental noise affects both maximum frequency and
song modulation, and a homogenization of song cues in high
abundances. Finally we found high variation among individuals
in repertoire size and songs cues. These results suggest a
high capacity by male Z. capensis to respond to variation to
environmental factors through both plasticity and interindividual variation in response to environmental challenges.
104 Assessing Atlantic Forest patches in fragmented
agricultural landscapes through a local birdbased index of biotic integrity
Eduardo R. Alexandrino1*, Evan R. Buechley2, James R. Karr3, Cagan
H. Sekercioglu2, Katia M.P.M.B. Ferraz1, Hilton T.Z. Couto1
ǢW9$3£!<6'8-38&'+8-$<£;<8![<-A&'<'-83A\T2-='89-&!&'&'È3
!<£3fcTǣW2-='89-;@3(;!,TǤW2-='89-;@3(!9,-2+;32
ID t
ABSTRACT
t
Table of Contents
managers in the forest habitats assessment through bird
community data. So, we developed and tested a bird-based
Index of Biotic Integrity (IBI) to assess forest habitat quality of
8 patches (3-115ha) located on HML in Southeast Brazil and
compared it against classical approach (general species richness
and abundance, Shannon´s Diversity Index). After 1-year
VDPSOLQJVSHFLHVZHUHLGHQWLĆHGIURPZKLFKFRPSRVHG
candidate metrics. The IBI approach uses existing relationships
between candidate metrics and habitat quality rank (HQR)
to determine the best indicators and then assign an index
for each studies site. Our HQR integrated history of forest
degradation and landscape features. Seven metrics clearly
associated with HQR were included in our IBI (richness of:
threatened species and forest-non-forest species; abundance
of: endemic species, small understory-midstory insectivorous,
forest species, non-forest species and midstory foragers). They
described the general conditions of the forest patch, the lower
strata quality and patch suitability for ecosystems services.
The IBI ranged of 1.28 in the worst forest sites up to 7.39 in
the best, and showed high linear relationship with HQR while
classical approaches did not. Although use of bird-based IBI in
Atlantic Forest has been limited, our results suggest that it is a
promising approach to pinpoint sites for conservation in HML.
r'&<!8&3!£'?!2&8-23|,3;1!-£W$31
Much of the Atlantic Forest has been converted to humanPRGLĆHGODQGVFDSHV+0/\LHOGLQJVPDOODQGLVRODWHGIRUHVW
patches surrounded by agricultural matrices. A variety of
DQWKURSRJHQLFLQćXHQFHVRQWKH+0/PDNHWKHVHSDWFKHV
heterogeneous and with altered natural dynamics, hindering
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
108 Expansion or extinction: the role of competition
in population trend of Chilean Woodstar (E.
yarrellii) and the Peruvian Sheartail (T. cora)
ID t
ABSTRACT
t
Table of Contents
114 0
DUJLQDOYHJHWDWLRQGLIIHUHQWO\LQćXHQFHVIDFHWVRI
functional diversity in waterbird assemblages
Bia A Almeida1*, Luiz dos Anjos2
Ilenia Lazzoni Traversaro1*, Wouter F.D. van Dongen2, Cristián F. Estades1
ǢW2-='89-&!&'9;!&<!£&'!8-2+ÆTǣW2-='89-&!&'9;!&<!£&'32&8-2!
ǢW2-='89-&!&&',-£'U='9,-£'lmTǣW29ধ;<;'(38<9;!-2!#-£-;@
!2&223=!ধ32T3££'+'3(2+-2''8-2+!2&$-'2$'T-$;38-!2-='89-;@
r#-!£1'-&!Ǣӑǣ|,3;1!-£W$31
r-£'2-!£!AA32-|+1!-£W$31
Waterbirds depend upon wetlands and provide many
ecological services, contributing to the maintenance
of environmental functioning. Comprehending how
HQYLURQPHQWDOFKDUDFWHULVWLFVLQćXHQFHZDWHUELUGIXQFWLRQDO
diversity is essential for conservation measures, such as
restoration of degraded systems. Here, we seek to understand
KRZYHJHWDWLRQLQćXHQFHVGLIIHUHQWIDFHWVRIZDWHUELUG
functional diversity and taxonomic richness. We sampled
birds along transects around 22 lagoons at the high Paraná
5LYHUćRRGSODLQ0DUJLQFRYHUDJHSHUFHQWDJHRIWHUUHVWULDO
and aquatic vegetation types was measured. Taxonomic
richness; and functional richness, evenness and divergence
were calculated for each lagoon. We analyzed data through
regression trees. For richness measures, shrubs were the key
determinants for the assemblies. For lower shrub percentages,
in both cases, the absence of aquatic vegetation determined
richness, and, for highest shrub values, shrub percentage was
again a key descriptor. For functional evenness, percentage of
emergent macrophytes was the key determinant. For higher
HPHUJHQWPDFURSK\WHSHUFHQWDJHVćRDWLQJPDFURSK\WHV
were the best descriptor. At last, for functional divergence,
the absence of aquatic vegetation was the best descriptor.
For higher absence values, tree percentage was also a key
determinant. Thus, taxonomic and functional richness are
The Chilean Woodstar (Eulidia yarrellii) and the Peruvian
Sheartail (Thaumastura cora) are two hummingbird species
that have coexisted in the valleys of northern Chile since the
arrival of the sheartails in the 1970s. During this time the
abundance of sheartails have increased, while woodstars have
dramatically declined and have been declared endangered
by the IUCN since 2011. It has been suggested that the
Peruvian Sheartail’s population increase may have had a
negative effect on the abundance of Chilean Woodstars.
8VLQJERWKEHKDYLRXUDOREVHUYDWLRQVDQGĆHOGH[SHULPHQWV
the aim of this study was therefore to test this hypothesis by
quantifying the aggressiveness and territorial competitive
interactions between the two species, and testing whether
sheartails have a greater reproductive output. Overall, the
results suggest that the Peruvian Sheartail may contribute
to the decline in the population of Chilean Woodstar, not
via a greater competitive ability, but probably via a higher
UHSURGXFWLYHFDSDFLW\DQGHIĆFLHQF\RILWVWHUULWRULDOGHIHQVH
strategy. Understanding the dynamics of the interactions
between the two species will form a crucial component for
conservation management plans for the threatened woodstars.
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
described by the same vegetation types. However, vegetation
W\SHVGLIIHUHQWO\LQćXHQFHIXQFWLRQDOGLYHUVLW\IDFHWV7KLV
shows that different facets of diversity are driven by different
variables, which must be considered for the maintenance not
only of waterbird assemblies, but also of ecosystem functioning.
117 Is call repertoire structure correlated to
social strategies in the New World jays? A
review on functional allocation of calls
ID t
ABSTRACT
t
Table of Contents
WKDWIRUPODUJHUćRFNVGXULQJWKHEUHHGLQJVHDVRQDOVRKDYH
more calls dedicated to functional classes of Courtship + Social
Integration. The opposite pattern was found regarding calls
GHGLFDWHGWR&RQćLFW5HVROXWLRQVXJJHVWLQJWKHH[LVWHQFH
RIDWUDGHRIIEHWZHHQFRQćLFWDQGDIĆOLDWLRQYRFDOEHKDYLRU
regardless of overall repertoire size. Given this we emphasize
the importance of achieving detailed data on the poorly known
life history, social systems and call repertoires of the New
World jays to advance on the comprehension of how social
behavior and call repertoires evolved and mutually adapted.
Gabriel L. M. Rosa1*, Jesse Ellis2, Luiz dos Anjos1
ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW3'3££'+'
r+W839!W#-3|+1!-£W$31
Signal repertoires can differ even between closely related
VSHFLHVDQGPDQ\IDFWRUVPD\LQćXHQFHLWVVL]HDQGFRPSOH[LW\
in animal societies, but of these, social and mating systems
have been considered of great importance. We propose a
review and standardization on the terminology based on
currently available call repertoire descriptions of 12 species
of New World Jays. By literature review we summarized 19
different call functions and termed it as “functional types”. We
DOVRFDWHJRUL]HGFDOOVLQWRĆYHIXQFWLRQDOFODVVHVZKLFKZH
considered a conservative approach for consistently compare
signal repertoires across species. The functional classes are:
6RFLDO,QWHJUDWLRQ&RQćLFW5HVROXWLRQ3UHGDWRUUHODWHG
Courtship and Pair & Parental-related. Trough GLM selection
we tested for correlation between social traits obtained
IURPWKHOLWHUDWXUHDQGWKHĆUVWWZRSULQFLSDOFRPSRQHQWV
based on the proportion of calls each species dedicates to
the functional classes we established. We found that species
!+'S8!¡8'9'2;!ࣅ329
119 The response of Setophaga ceruleato different forest
treatments: Preliminary results from a long-term study
Kamal Islam1*, Claire Nemes1
ǢW!££;!;'2-='89-;@
r0-9£!1|#9<W'&<
ORAL PRESENTATION SESSION 11: AVIAN CONSERVATION III
Monitoring responses of migratory songbirds to different
forest treatments is needed to establish informed management
decisions. This information is especially important for species
with precipitous declines in populations, such as the Cerulean
Warbler (Setophaga cerulea), a long-distance Neotropic-Nearctic
PLJUDQWVRQJELUG)RUWKHSDVWĆYHGHFDGHVSRSXODWLRQVRIS.
cerulea have declined by 70% based on annual Breeding Bird
Surveys. It is listed as ‘Vulnerable’ by the International Union for
the Conservation of Nature. Setophaga cerulea breeds in mature
deciduous forests in northeastern and midwestern United
States, and southern Ontario, Canada, and winters along the
eastern slopes of the Andes in northern South America. Since
2007, we have monitored populations of S. cerulea at nine study
{փdփTT
ID t
ABSTRACT
t
sites in southern Indiana, USA. Three sites received unevenDJHGWUHDWPHQWVVLQJOHDQGSDWFKJURXSFXWVVLWHVUHFHLYHG
even-aged treatments (shelterwood and clear-cuts), and 3 sites
served as control (no harvests). Initially, S. cerulea populations
responded positively to even-aged treatments and negatively
to uneven-aged treatments, two years post-harvest. Recently,
populations of S. cerulea have levelled off at the treatment and
control sites. Reproductive success was higher at control sites
than at the 2 treatments sites. However, larger sample sizes are
needed from control sites to fully assess the effects of forest
treatments on reproduction. Our results stress the importance
of studying the long-term effects of forest treatments in
songbird populations to account for inter-year variation in
relative abundance estimates and reproductive output.
121 Nest-predator identity as a key factor to understand
the differences in nest predation between urban
and peri-urban sites in La Paz Metropolitan area
Andrea Salazar1*, Alvaro Garitano-Zavala1
ID t
ABSTRACT
t
Table of Contents
related to the corresponding differences in predation rate in
WKH0HWURSROLWDQDUHDRI/D3D]FLW\$UWLĆFLDOQHVWVZLWKTXDLO
eggs (Coturnix coturnix japonicaPRQLWRUHGZLWKĆOPLQJFDPHUDV
were installed in three urban sites and three peri-urban sites;
the relative abundances for all the bird species were obtained
for each site also. Only the Chiguanco Thrush (Turdus chiguanco)
(CT) and the Mountain Caracara (Phalcoboenus megalopterus)
0&ZHUHLGHQWLĆHGDVQHVWSUHGDWRUVEXWWKHODWHUZDV
found only once and has not been included in the analysis.
The House Wren (Troglodytes aedon+:ZDVLGHQWLĆHGDV
nest-destructor. The nest-predation and the nest-destruction
UDWHVZHUHQRWVLJQLĆFDQWO\GLIIHUHQWEHWZHHQXUEDQDQG
peri-urban sites and the relative abundance of the CT was
not correlated with the total number of predated nests nor
predated eggs per sites. Also, the HW relative abundance
was not correlated with the nest-destruction. The results
suggest that in La Paz Metropolitan area, the absence of nest
predation difference between urban and peri-urban areas
is due to the fact that the relative abundance of the main
predator species is not increased inside the urban matrix.
ǢW29ধ;<;3&'$3£3+Ð!T2-='89-&!&!@38&'!22&8Ì9
r9!£!A!8W6!113|+1!-£W$31
8UEDQL]DWLRQFDXVHVLPSRYHULVKPHQWDQGVLPSOLĆFDWLRQRI
bird communities. The supposed increment of nest predation
inside the cities was proposed as responsible of that, but the
relationship is not clear because in other cities was reported a
decrease of nest predation. It is possible that the differences
between cities are related to the identity of nest predators.
In this study we evaluated if the relative abundance of nestpredator species between urban and peri-urban areas is
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
126 Dieta y disponibilidad de recursos alimenticios para
el loro corona azul norteño Amazona guatemalae
en un paisaje fragmentado de México
Miguel Ángel De Labra-Hernández1*, Katherine Renton2
ǢW39+8!&3'2-'2$-!9-3£Õ+-$!9T2-='89-&!&!$-32!£
<;Õ231!&'Ì?-$3TǣW9;!$-Õ2&'-3£3+Ð!,!1'£!T29ধ;<;3
&'-3£3+Ð!T2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3
r1W&'£!#8!,|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
durante la época reproductiva, utilizando varios alimentos
con relativa frecuencia, lo que podría permitir una mayor
SODVWLFLGDGHQODGLHWDSRUODćXFWXDFLµQGHODGLVSRQLELOLGDG
de recursos alimenticios. El bosque ribereño puede ser un
hábitat cave para el loro ya que este tipo de vegetación
presentó mayor abundancia de recursos alimenticios, y
podría ser utilizado como corredor que conecte parches de
YHJHWDFLµQHQHOSDLVDMHPRGLĆFDGRGH/RV&KLPDODSDV
ORAL PRESENTATION SESSION 13: PARROT ECOLOGY
El loro corona azul norteño (Amazona guatemalae) es el loro
de mayor tamaño en Centro América, y es considerado
dependiente de la selva alta perennifolia, hábitat que
experimenta altas tasas de deforestación y fragmentación.
Poco se sabe de los requerimientos alimenticios del loro
corona azul norteño, o si la fragmentación del hábitat puede
afectar la disponibilidad de los recursos alimenticios del
loro. Determinamos la dieta del loro corona azul norteño
mediante observaciones de forrajeo en la selva alta de Los
Chimalapas, México. Establecimos 30 transectos de fenología
(200 X 6 m) para determinar la disponibilidad de recursos
alimenticios en tres tipos de vegetación de bosque ribereño,
selva alta y vegetación secundaria durante la temporada
reproductiva (marzo) y no reproductiva (septiembre) del loro.
Determinamos variación espacio-temporal en la producción
GHIUXWRVHQFRQWUDPRVVLJQLĆFDWLYDPHQWHPD\RUSURGXFFLµQ
GHIUXWRVHQODWHPSRUDGDUHSURGXFWLYD\VLJQLĆFDWLYDPHQWH
menor producción en la vegetación secundaria. Los loros
consumen principalmente semillas, particularmente de las
especies Dialium guianense y Sloanea sp. Sin embargo, el
loro corona azul presentó un nicho alimenticio moderado
!+'S8!¡8'9'2;!ࣅ329
129 Efecto de las características de las áreas
verdes urbanas sobre la depredación de nidos
DUWLĆFLDOHVHQOD&LXGDGGH0«[LFR
Karla Maryan Rodríguez Hernández1*, María del Coro Arizmendi
Arriaga1, Ian MacGregor Fors2, Adolfo Gerardo Navarro Sigüenza1
ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3T
!$<£;!&&'9;<&-39<6'8-38'9
A;!$!£!TǣW29ধ;<;3&'$3£3+Ð!TWWT'&&'1#-'2;'<9;'2;!#-£-&!&
r1!8@!2!@8!1iǣǣ|,3;1!-£W$31
ORAL PRESENTATION SESSION 5: AVIAN CONSERVATION II
La depredación es la principal causa del fracaso de los nidos
GHODVDYHVVHKDQXWLOL]DGRQLGRVDUWLĆFLDOHVSDUDPHGLU
ODVYDULDEOHVTXHVHFUHHLQćX\HQHQXQJUDGLHQWHXUEDQR
El objetivo de este estudio fue evaluar la relación de la
depredación y las características del área verde. Usamos
senderos peatonales verdes y parques, elaboramos los nidos
utilizando como modelo a una de las especies más comunes en
la Ciudad de México. Examinamos los patrones de depredación
considerando las características de la ubicación del nido, el
área verde y la periferia. Realizamos una regresión logística
P¼OWLSOH\£UEROHVGHUHJUHVLµQSDUDLGHQWLĆFDUODVYDULDEOHV
P£VVLJQLĆFDWLYDV1XHVWURVUHVXOWDGRVVXJLHUHQTXHKD\
{փdփTT
ID t
ABSTRACT
t
mayor depredación dentro de los parques y está determinada
por la cobertura vegetal del interior seguida por la cobertura
de la periferia, así como del diámetro a la altura del pecho de
los arboles donde fueron ubicados los nidos. Esta variable
es sumamente importante en los senderos urbanos pues
en valores mayores a 43.7 centímetros la depredación fue
total. El diámetro a la altura del pecho de los arboles juega
un papel determinante con respecto al tipo y tamaño de los
depredadores, que fueron predominantemente mamíferos
pequeños. Las diferencias en la cobertura vegetal del paisaje
y dentro de las áreas verdes podrían determinar la presencia
y dinámica de depredadores actuando como atractores por
las especies de aves que sustentan. El área urbana actúa como
barrera permitiendo el paso solo a explotadores urbanos que
VHYHQEHQHĆFLDGRVGHORVVXSOHPHQWRVDQWURSRJ«QLFRV
130 Determinación de áreas de alimentación y rutas
migratorias de ardenna creatopus a través de
transmisores, evaluando riesgos de pesca incidental
Verónica López1*, Peter Hodum1, Ryan Carle1, Josh
Adams2, Valentina Colodro1, Jonathan Felis2
ǢW-03239$39@9;'123>£'&+'TǣWWW'3£3+-$!£
<8='@T'9;'82$3£3+-$!£'9'!8$,'2;'8
r='832-$!|3-03239W38+
ID t
ABSTRACT
t
Table of Contents
GHORVGHFOLYHVSREODFLRQDOHV6XVFRORQLDVGHQLGLĆFDFLµQ
se encuentran sólo en Chile, en el Archipiélago de Juan
Fernández (AJF) (30% de población mundial) e Isla Mocha
(70% de la población mundial). Utilizando transmisores GPS y
satelitales, se determinaron zonas de alimentación durante la
época reproductiva y rutas migratorias de individuos en AJF
e Isla Mocha en 6 años, entre 2002-2015. Durante la época
reproductiva, las zonas de alimentación están asociadas a la
plataforma continental de Chile entre los 31.5 y 40.0 latitud
Sur, área donde se concentra la mayor zona pesquera del
País. El 100% del tiempo, las aves se alimentaron en aguas
territoriales. La superposición de áreas de alimentación y
pesquerías, representa una amenazada importante de captura
incidental en redes de enmalle y de cerco. Durante la migración,
se determinaron distancias de vuelo de hasta 8.616 km.
Algunos individuos viajaron hasta Canadá. Se determinaron
dos zonas principales de invernada, una en las costas de Perú
SULQFLSDO]RQDSHVTXHUDGHOSDF¯ĆFR6XU\ODRWUDHQODFRVWD
de México y zona del sur de California, EEUU. Obteniéndose
que durante la migración, están un 82% del tiempo en aguas
WHUULWRULDOHVGHGLIHUHQWHVSD¯VHVGHODFRVWDSDF¯ĆFD6H
considera de suma importancia trabajar con instituciones de
los diferentes países donde migra esta ave, para trabajar en
conjunto riesgos y posibles soluciones para su conservación.
Ardenna creatopus, es un ave marina migratoria declarada
en peligro de extinción en Chile, con una población global
aproximada de 60.000 individuos. Se considera que la captura
incidental por pesquerías puede ser una causa importante
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
131 Redistribution of Yellow-billed Pintails (Anas georgica)
between a wetland and its surrounding landscape
María Paz Acuña1*, Cristián Estades1
ǢW2-='89-;@3(,-£'T'31!ধ$9!2&!2&9$!6'$3£3+@
!#38!;38@!2&-£&£-('$3£3+@!#38!;38@
ID t
ABSTRACT
t
Table of Contents
LQGLYLGXDOVVHHNUHIXJHLQWKHVXUURXQGLQJĆHOGVZKHUH
temporary ponds become available due to increased rainfall.
Considering wetlands as functionally integrated into the
landscape through the movement of birds represents a more
realistic framework for waterfowl conservation planning.
r16!$<2!|<W<$,-£'W$£
Waterfowl populations are normally studied within the
limits of wetlands and their immediate coast, and changes
in the abundance of a given species are usually interpreted
as the result of mortality, recruitment or the movement of
individuals between wetlands. However, to some extent,
most waterfowl species can use non-wetland habitats (e.g.
SUDLULHVDJULFXOWXUDOĆHOGVHWFDQGVRPHPD\HYHQGHSHQG
strongly on these for feeding or nesting. These birds go often
XQGHWHFWHGLQDJULFXOWXUDOĆHOGVGXULQJUHJXODUFHQVXVHV:H
conducted a study aimed at understanding the relationship
between the agricultural matrix and the abundance of Yellowbilled Pintails (Anas georgica) at the estuary of the Itata river,
central Chile. During 2013 and 2014, we conducted 10 surveys
per year to census this species in the estuary and, in parallel,
we estimated its population density outside this wetland
with 20 point count stations distributed in the agricultural
PDWUL[:HXVHGDVFRYDULDWHVWKHSURSRUWLRQRIćRRGHG
areas in the landscape (derived from Landsat ETM), rivers
discharge, and climatic data. The best model explaining the
YDULDWLRQLQFHQVXVQXPEHUVLQFOXGHGDVLJQLĆFDQWQHJDWLYH
effect of average monthly discharge and the density of
Pintails in the matrix (P < 0.001). Our results suggest that,
in periods of high discharge, bank habitat is reduced, and
!+'¢S8!¡8'9'2;!ࣅ329
132 Efectos de la pérdida y fragmentación de hábitat
en rapaces nocturnas (Strigiformes) de la Reserva
de la Biosfera Los Tuxtlas, Veracruz
M.Isabel Herrera-Juárez1*, Patricia Escalante-Pliego1
ǢW29ধ;<;3&'-3£3+Ð!&'£!2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3lm
r#-3£W-9!#'£,'88'8!|+1!-£W$31
Gran parte de la literatura enfocada a la conservación tropical
está dirigida a especies diurnas. Sin embargo, las rapaces
nocturnas (Strigiformes) constituyen uno de los grupos más
amenazados del Neotrópico. En este estudio, se evaluó el
HIHFWRGHODS«UGLGDGHFREHUWXUDYHJHWDO\ODFRQĆJXUDFLµQ
estructural del paisaje en la riqueza, abundancia y uso de
hábitat de especies de rapaces nocturnas de la Reserva de la
Biosfera Los Tuxtlas; el último remanente de bosque húmedo
tropical más al norte del hemisferio occidental. Estimamos
su abundancia relativa a lo largo de un gradiente de pérdida
de cobertura vegetal mediante la detección auditiva y el uso
de vocalizaciones pregrabadas (playbacks). Se registraron
seis de las 10 especies reportadas para la región. La mayor
diversidad se encontró en niveles medios de cobertura e incluso
algunas especies solo estuvieron presentes en áreas con una
cobertura mayor a 60%. La abundancia relativa mostró una
correlación positiva con la proporción de cobertura vegetal,
{փdփTT
ID t
ABSTRACT
t
siendo esta, la principal característica del paisaje que explicó
el uso de hábitat de estas especies. Los resultados indican
que la comunidad se encuentra ya muy depauperada. Las
especies registradas se distinguen por ser tolerantes a la
deforestación y capaces de habitar en sitios de borde y áreas
VHPLDELHUWDV(VWRUHćHMDXQDWHQGHQFLDJHQHUDOHQODULTXH]D
y abundancia de especies, evidenciando la urgente necesidad
de implementar y fortalecer esfuerzos de conservación.
134 Procesos participativos encaminados hacia la
conservación del hábitat en la reserva agroforestal del
Quininí.Educación ambiental como estrategia clave
Jeancarlo E. A. Sánchez Dominguez1*, Jairo Andrés Peña
Torres1, Jennipher Katherine Bernal Villafañe1
ID t
ABSTRACT
t
Table of Contents
de la problemática en cuanto a los hábitos que deterioran la
reserva, reconocimiento del territorio y educación ambiental
con los campesinos y turistas durante las visitas periódicas
realizadas a lo largo del proyecto. El trabajo propone acciones
encaminadas a la protección de la reserva y la solvencia
económica de las familias campesinas mediante alternativas
ecoturísticas basadas en las actividades de observación de
la avifauna de la región; las cuales se articulan con procesos
de participación y organización existentes en la comunidad
(APRENAT: Asociación de Protectores de los Recursos
Naturales de Tibacuy), contribuyendo al mejoramiento
de la calidad de vida de sus habitantes. El desarrollo del
proyecto es un punto de partida para la investigación básica
y la articulación de procesos participativos en comunidades
campesinas asociadas a sistemas agroforestales andinos.
ǢW2-='89-&!&!$-32!£&'3£31#-!
r/''9!2$,'A&3|<2!£W'&<W$3
ORAL PRESENTATION SESSION 22: AVIAN CONSERVATION IV
La Reserva Agroforestal Del Cerro del Quininí ubicada en
el municipio de Tibacuy, Cundinamarca, Colombia, es un
ecosistema estratégico regional que funciona como corredor
biológico y fuente de abastecimiento hídrico; además
cuenta con un gran potencial aviturístico. Actualmente
este territorio enfrenta algunas situaciones que amenazan
su conservación, como fragmentación del bosque nativo,
que rodea algunas propiedades campesinas, mal manejo de
actividades agrícolas y falta de conciencia ambiental de los
visitantes. En respuesta a estos impactos, se han realizado
jornadas de divulgación de la información ecológica relevante
para la protección de la dinámica ambiental, socialización
!+'S8!¡8'9'2;!ࣅ329
141 Utilización de tres métodos en la determinación
de la dieta del cucarachero común (Troglodytes
aedon), en La Molina – Lima, Perú
Flor Hernández
ù'82!2&'A|$38#-&-W38+
Los estudios sobre las dietas de aves se basan en el uso de
metodologías diversas, dependiendo de lo que se tiene como
objetivo, además, de velar por el bienestar de la especie a
evaluar. Sin embargo, muchas de las evaluaciones suelen dar
UHVXOWDGRVDPELJXRV\DTXHHVGLI¯FLOGHĆQLUODVHVWUDWHJLDV
de forrajeo debido a la amplitud de recursos que el ambiente
ofrece a los depredadores, y mucho más, cuando se trata
{փdփTT
ID t
ABSTRACT
t
ID t
de aves insectívoras, a lo cual se le suma la tediosidad de la
LGHQWLĆFDFLµQGHDUWUµSRGRV6HFRPSDUDURQWUHVP«WRGRV
(comportamiento de forrajeo, oferta alimenticia y el contenido
estomacal) con el objetivo de determinar si coinciden sobre
la dieta de un ave insectívora (Troglodytes aedon). Dicha
evaluación, se llevo a cabo en el campus de la Universidad
Nacional Agraria La Molina, durante los meses considerados
dentro de la época reproductiva el ave (Diciembre 2011
hasta Mayo 2012). Se evaluaron en total 9 grupos de esta
especie, pero se colectaron 16 individuos pertenecientes
a 7 grupos. Con la metodología de “comportamiento de
IRUUDMHRëVHYHULĆFµTXHHVWDDYHSUHVHQWDFRPRHVWUDWHJLD
de forrajeo el territorialismo, además, que el comportamiento
más común para capturar sus presas era el “hurgamiento”.
Por otro lado, los resultados registrados por las metodologías
“oferta alimenticia” y “análisis de contenido estomacal”,
UHćHMDURQODSUHGRPLQDQFLDGHORUGHQ&ROHRSWHUDH
Hymenoptera. Finalmente al hacer los análisis de similitud
(cuantitativo y cualitativo) de los órdenes registrados
con los tres métodos, se obtuvo que las metodologías de
RIHUWDDOLPHQWLFLD\FRQWHQLGRHVWRPDFDOUHćHMDQFDVLOD
misma tendencia tanto en abundancia como riqueza.
147 Criterios para evaluar la recuperación de la
!+'£S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
riqueza y abundancia de la avifauna en áreas
desboscadas en selvas tropicales
Oscar Cuya1*, Nadia Sanchez1, Flor Hernández2
ǢWTǣW
r3$<@!|>!£9,6W$31W6'
Después de una perturbación en el ecosistema, ya sea por
causas naturales o actividad humana, surge la necesidad de
saber si el ecosistema volverá a recuperarse, y en respuesta
a ello, se utiliza el criterio de la comparación de muestras
tomadas en las áreas intervenidas con el área control (bosque
primario aledaño), lo cual parece lógico, sin embargo, aceptar
esto es dejar de lado los conocimientos sobre la dinámica de
la sucesión ecológica de los bosques secundarios. Así, este
trabajo propone que las comparaciones deben realizarse con
otros bosques secundarios de la misma edad. Se consideraron
dos criterios, el primero, emplea el principio “antes-despuéscontrol-impacto” y compara los resultados de los inventarios
y censos realizados en el área control. El segundo, plantea
que la recuperación debe medirse con respecto a la dinámica
de bosques secundarios, para lo cual se utiliza la literatura
FLHQW¯ĆFD/RVGDWRVUHFDXGDGRVHQHO\
en el área del proyecto ubicado en Loreto, distritos de
Andoas, Urarinas y Trompeteros, fueron analizados mediante
estimadores de similaridad, así como su funcionalidad en
HOHFRVLVWHPDDJUXS£QGRORVHQJUHPLRVWUµĆFRV6HREWXYR
GLIHUHQFLDVVLJQLĆFDWLYDVHQODFRPSRVLFLµQGHODFRPXQLGDG
de aves entre áreas intervenidas y áreas control del bosque
aledaño, adicionalmente se registró una baja similaridad entre
{փdփTT
ID t
ABSTRACT
t
ambas comunidades (7.14% indice de Jaccard y 13.3% indice se
Sorensen-Dice). Sin embargo, al comparar dicha comunidad con
bosques de sus edad, se encontró que se viene desarrollando
de acuerdo a lo esperado, y paulatinamente seguirá
alcanzando sus características naturales correspondientes
a los diferentes estadios sucesionales que alcance.
148 5
HJLVWURVQRWDEOHVHQHOUHDGHLQćXHQFLDGHO3UR\HFWR
Central Hidroeléctrica Cerro del Águila, Huancavelica-Perú
Nadia Sanchez1*, Margot Cuyos1, Miriam Torres1,
Flor Hernández26RĆD=DPEUDQR1
ǢWTǣW
*[email protected]
Se realizaron 4 evaluaciones de la avifauna en el área de
LQćXHQFLDGHO3UR\HFWR&HQWUDO+LGURHO«FWULFD&HUURGHO
Águila entre 2012 y 2014 como parte de la ejecución de
su Estudio de Impacto Ambiental (EIA) y del Programa de
Monitoreo Biológico (MB) implementado. En cada ingreso
a campo fueron evaluadas 10 estaciones de monitoreo,
ubicadas entre los 1000 y 3 500 m s.n.m. Para el registro de
especies se aplicó el método de censo por puntos de conteo
y capturas con redes de neblina. Fueron registradas un total
de 92 especies de aves entre las que destacan las endémicas
Cranioleuca albicapilla y Atlapetes melanopsis, las amenazadas
Nothoprocta taczanowskii, Vultur gryphus, Buteogallus solitarius,
Andigena hypoglauca y Atlapetes melanopsis, y las especies
migratorias Falco femoralis, Empidonax alnorum y Vireo
olivaceus. Además se reporta la ampliaciones de rango para
las especies Nystalus chacuru, Hemitriccus margaritaceiventer
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
y Coryphospingus cucullatus. Esta zona del valle del Mantaro
permanece relativamente conservada y la inaccesibilidad a
HVWHVLWLRGXUDQWHPXFKRVD³RVGHFRQćLFWRVRFLDOKDIDFLOLWDGR
esta situación de encontrar nuevos registros. Se recomienda
seguir con los monitoreos a nivel altitudinal en las mismas
estaciones de muestreo y generar una lista más completa
de la avifauna presente en esta área. Adicionalmente, se
exhorta a continuar estudios a lo largo del valle del Mantaro
e inventariar las especies que frecuentan con el objetivo de
actualizar el rango de distribución de muchas de ellas.
156 Bird species richness, functional diversity and seasonality
LQDQDUWLĆFLDOćRRGSODLQLQWKH3LUDFLFDEDULYHU%UD]LO
Vivian Robinson1*, Marco Aurélio Pizo1
ǢW2-='89-&!&'9;!&<!£!<£-9;!T29ধ;<;3&'-3$-Í2$-!9T$!16<9&'-3£!83
r=-i8#9|,3;1!-£W$31
IQWKHUHJLRQNQRZQDV7DQTX¥ćRRGSODLQVZHUHIRUPHG
in Piracicaba River (state of São Paulo, Brazil) after the
construction of Barra Bonita dam in 1963. This area became
a hotspot for a variety of water-associated birds, including
VHYHUDOPLJUDWRU\HQGDQJHUHGDQGKDUGWRĆQGVSHFLHV7KLV
area is endangered by the planned expansion of the PiracicabaTietê hydroway. Based on our own survey and literature
search, we found 119 species in 29 families using the area for
reproduction or foraging, 97 of which are wetland-depend
species. There are also 12 species endangered in the state of
São Paulo, and 15 migratory birds. With monthly censuses
conducted from October 2014 to March 2015 in seven
point count stations we recorded 80 species, almost evenly
{փdփTT
ID t
ABSTRACT
t
distributed into eight foraging and eight nesting functional
groups. We found signs of reproduction for 14 species. The
river depth varied monthly from 5.3 m to 9.1 m, leading the
abundance index to range from 38.3 to 344.4 and richness
from 45 to 59. Birds that forage on the surface, such as ducks,
are the most affected by the river depth, which is responsible
for 68% of the variation in their abundance. We predict
that any change in Piracicaba River hydrology can seriously
affect the structure and function of this bird assemblage.
157 Abiotic and biotic factors underlying changes in bird
communities along Andean elevation gradients
Scott Robinson1*, Gustavo Londono2, Jill Jankowski3, Mark Chappell4
ǢW2-='89-;@3(
£38-&!TǣW2-='89-;@TǤW2-='89-;@3(
8-ধ9,3£<1#-!TǥW2-='89-;@3(!£-(382-!f-='89-&'
ID t
ABSTRACT
t
Table of Contents
rates and the communities of nest predators, however, varied
strongly with elevation. Bird community turnover and changes
in nest predation rates were correlated, which suggests that
nest predation may contribute to species turnover, especially
at the lower end of the gradient. At the higher end of the
gradient, the combination of cold temperatures and relatively
KLJKQHVWSUHGDWLRQUDWHVPD\DFWDVDĆOWHUIDYRULQJVSHFLHV
with a slow pace of life (small clutches and low egg mass, long
GHYHORSPHQWDOWLPHV(YLGHQFHRILQWHUVSHFLĆFDJJUHVVLRQ
among closely related species that replace each other along
gradients was found for just a few genera. Instead, most
showed evidence of niche partitioning or even had gaps in their
distributions, a possible indication of selection to minimize
transfer of pathogens. Collectively, our data suggest that biotic
interactions dominate patterns of community turnover, but that
abiotic factors also contribute, especially in harsh environments.
r983#-2932|*12,W<*W'&<
We studied the relative importance of abiotic (temperature)
and biotic (competition) factors underlying the turnover in
bird communities on elevation gradients (300-3700m) in
the Peruvian and Colombian Andes. We measured thermal
WROHUDQFHVXVLQJĆHOGUHVSLURPHWU\RILQGLYLGXDOVRI
350+ species and monitored the success of more than 3000
nests of 500 species. Adults of most species showed little
evidence of thermal stress, even well outside their normal
thermal range; basal metabolic rates scaled with body mass,
but varied little with elevation. Energy expenditure models
suggested that adults of few species are energetically
constrained to particular elevation zones. Nest predation
!+'S8!¡8'9'2;!ࣅ329
159 Análise da efetividade de manejo em uma Unidade
de Conservação: O caso do Parque Estadual da
Serra do Tabuleiro, Santa Catarina, Brasil
Fabrício Almeida1*, Marinez Scherer1
ǢW2-='89-&!&'
'&'8!£&'!2;!!;!8-2!
r(!#8-$-3W#!9-£-3!£1'-&!|+1!-£W$31
Este trabalho teve como objetivo analisar o grau da efetividade
de manejo da IBA - Parque Estadual da Serra do Tabuleiro
(IBA - PAEST), uma unidade de conservação que se destaca
SRUDEULJDUXPGRVPDLRUHVEORFRVFRQW¯QXRVGHćRUHVWD
atlântica de Santa Catarina, abrangendo cinco das seis
{փdփTT
ID t
ABSTRACT
t
ID t
formações vegetais do bioma encontradas no Estado. Apesar
da sua importância para a conservação da biodiversidade
QRVXOGR%UDVLORSDUTXHSRVVXLDLQGDGHĆFL¬QFLDGH
informações para muitos táxons que ocorrem no local,
principalmente com relação as espécies de aves ameaçadas
de extinção. A efetividade de manejo foi avaliada por meio
da Estrutura Global de Monitoramento em IBAs, idealizada
pela BirdLife International em 2006. Este método envolve a
designação de notas para indicadores pré-selecionados nos
itens de pressão, estado e resposta. O sistema foi aplicado
com ênfase em dezessete espécies de aves ameaçadas de
H[WLQ©¥RTXHSRVVXHPK£ELWRVćRUHVWDLVHPDULQKRVQD
UC. Os resultados mostraram que a IBA-PAEST encontrase com uma efetividade de manejo baixa. Os indicadores
UHODFLRQDGRVDRLWHPDPHD©DLGHQWLĆFDUDPTXHDJULFXOWXUD
FD©DGHVćRUHVWDPHQWRH[SDQV¥RXUEDQDHSROXL©¥RSRU
UHV¯GXRVVµOLGRVV¥RRVLPSDFWRVPDLVVLJQLĆFDWLYRVQRORFDO
Os resultados para o item estado mostraram uma perda
GHKHFWDUHVGHFREHUWXUDćRUHVWDOGHQWURGHVHXV
limites. Em termos gerais, o grande número de ameaças
FRPELQDGDVSULQFLSDOPHQWHOLJDGDVDRGHVćRUHVWDPHQWR
podem causar efeitos cumulativos graves sobre a dinâmica
destes ambientes e consequentemente às espécies de aves,
principalmente as ameaçadas de extinção. Portanto, ações
mais efetivas devem ser impostas na UC pelo órgão gestor.
162 Native forest is of higher quality than shade
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
coffee for a Nearctic-Neotropical migratory bird
fuelling for migration in northern Colombia
Nicholas J. Bayly1*, Camila Gómez1, Keith
Hobson2, Kenneth V. Rosenberg3
ǢWV2='9ধ+!$-Õ26!8!£!329'8=!$-Õ2'2'£'3;836-$3T
ǣW2=-8321'2;!2!&!TǤW382'££!#3(82-;,3£3+@
r2-$0W#!@£@|9'£=!W38+W$3
The impact of habitat choice on fuelling behaviour and
migration strategy in birds has rarely been examined, despite
the potential impact of widespread transformation of natural
habitats in key stopover regions. The elevated energetic
requirements of migrating birds means that resource
DEXQGDQFHWKURXJKLWVLQćXHQFHRQIXHOGHSRVLWLRQUDWHV
is expected to be the main determinant of stopover habitat
quality. To test whether shade coffee plantations provide
high-quality habitat relative to pre-montane forests, we
examined six indicators of habitat quality for Tennessee
Warblers (Oreothlypis peregrina) on spring migration in northern
Colombia: 1) rate of body mass change; 2) foraging rates; 3)
ERG\PDVVGLVWULEXWLRQGHQVLW\ćRFNVL]HDQGDJH
and sex ratios. Tennessee Warblers stopped at our study site
IRUWRGD\VDQGOHIWZLWKHQRXJKIXHOWRć\
km. All six measures of habitat quality indicated that premontane forest was of higher quality than shade coffee, with
forest supporting faster rates of foraging and fuel deposition,
KLJKHUGHQVLWLHVDQGODUJHUćRFNVL]HV7KHVHGLIIHUHQFHV
LQćXHQFHGVWUDWHJ\WKURXJKORQJHUVWRSRYHUGXUDWLRQVDQG
lower departure masses in shade coffee, which in turn may
{փdփTT
ID t
ABSTRACT
t
KDYHĆWQHVVFRQVHTXHQFHVWKURXJKFDUU\RYHUHIIHFWV7KH
FRQVXPSWLRQRIIUXLWVLQIRUHVWSUREDEO\PDGHDVLJQLĆFDQW
contribution to the observed habitat differences and we
recommend the inclusion of appropriate fruiting trees in shade
coffee plantations to increase their quality for frugivorous birds.
163 7KHHIIHFWRIODQGVFDSHFRQĆJXUDWLRQDQG
dispersal capacity on habitat availability for
birds of Campos grasslands, RS Brazil
Ricardo Contreras Osorio1*, Santiago Saura2, Fernando Gertum Becker3
ǢW<9'3&' 33£3+Ð!
TǣW;3-9;'1!9@'$<8939
!;<8!£'932;'9TǤW;3$3£3+-!
r8$0@W$32;8'8!9|+1!-£W$31
Campos are recently threatened due to changes in human
practices, from extensive livestock grazing to monoculture
forestry and industrialized agriculture. Presently, native
grassland, crops and tree plantations form heterogeneous
mosaics. Landscape connectivity analysis has shown to
EHDQHIĆFLHQWWRROWRLGHQWLI\NH\DUHDVIRUFRQVHUYDWLRQ
of endangered species based on the amount of available
habitat resulting from its spatial distribution. The aim of
this study was to assess habitat availability for birds with
different dispersal capacities and in different landscape
FRQĆJXUDWLRQV7KHFRQQHFWLYLW\ZDVFDOFXODWHGZLWKD
probabilistic index PCI. Dispersal distance is determining the
DPRXQWRIUHDFKDEOHKDELWDWKRZHYHUVSHFLĆFVLWHODQGVFDSH
FRQĆJXUDWLRQYDULDELOLW\VHYHUDOO\LQćXHQFHVWKHSURSRUWLRQ
in which distance determines reachable habitat. Dispersal
distance had a positive effect over reachable habitat in 99.3%
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
of Campos fragments. The available habitat varied up to
27% in more than 25% of the landscapes only as effect of
FRQĆJXUDWLRQZKHUHLQVRPHORFDWLRQVUHGXFHGXSWR
habitat availability. In the regional scale, all stages of landscape
fragmentation process can be found across Campos in Rio
Grande do Sul, and in areas with mid-low native cover, the
FRQĆJXUDWLRQHIIHFWGHWHUPLQLQJUHDFKDEOHKDELWDWLVVOLJKWO\
higher than and in areas with low or medium cover. Our
results illustrate the effect of changing landscape on habitat
availability for bird communities. With this information new
management practices can be designed for reducing the
impact of landscape change in Campos bird communities.
165 The diet of Procnias nudicollis (Cotingidae), in a
12 year study at east Parana state, Brazil
Bernardo Clausi
@8;£!<
1@8;£!<|+1!-£W$31
Procnias nudicollis is endangered in most of its original range.
Being a specialist frugivore, its diet is not well known. This
study investigates what these birds are eating throughout
the year. Started in July 2003, data comes from regurgitated
seeds from the male perches while singing, collected with seed
traps, combined with direct observations at fruiting trees in
two main study sites: QU in Morretes, PR, and BA in Campina
Grande do Sul, PR. The QU site was a submontane site and
the vocalization season began in early July, after a brief period
of silence between mid February and late June (04 months).
At BA the vocal season starts in late August ending at same
{փdփTT
ID t
ABSTRACT
t
mid February. The plants: a total of 99 tree species have been
LGHQWLĆHGFRPLQJIURPSODQWIDPLOLHVDOOZLWKGUXSHOLNH
ćHVKIUXLWV0\UWDFHDHDQG/DXUDFHDHDUHWKHPRVW
species rich, followed by Moraceae (08) and Sapindaceae
(05), Arecaceae (02), Myrsinaceae (02), Symplocaceae (02)
and another 11 families represented by only one species. The
data is still being gathered. A special study was conducted
with one species Myrcia lajeana, as its one of only 3 species
present in both sites (QU and BA). Male perches proved to be
20x richer in seedlings than random locations in the forest.
At highland area, in a nearby botanically compared site (BV)
distant only 1.5 km from main BA site, the vegetation, specially
tree diversity were remarkable different. The birds in the area
%$VKRZVDYHU\VSHFLĆFVLWHĆGHOLW\ZKDWVXJJHVWVVRPH
limits in natural regeneration. Further study should include
a gps tagging to trace their exact route through the year.
166 Elevational migration in the Yungas Manakin (Chiroxiphia
boliviana, Pipridae): Insights from stable isotopes
Mariana Villegas-Bilbao1*, John G. Blake1, Seth D. Newsome2
ǢW2-='89-;@3(
£38-&!TǣW2-='89-;@3('>'?-$3
r1!8-!2!=-££'+!9|<*W'&<
ID t
ABSTRACT
t
Table of Contents
boliviana prior to the breeding season along an elevational
gradient of the Central Andes of Bolivia; we do this by
HVWLPDWLQJWKHGLIIHUHQFHEHWZHHQ +LQPHWDEROLFDOO\LQHUW
(feathers and claws) and metabolically active tissues (whole
blood) at the beginning of the breeding season. Feathers
are inert once grown and represent hydrogen inputs at the
WLPHRIPROWZKHUHDVFODZVDQGZKROHEORRGUHćHFWPRUH
recent integrations of hydrogen. During breeding seasons
of 2013 and 2014, we sampled 68 individuals at two sites at
the extremes of an elevational gradient in Cotapata National
Park: Sandillani at 1980m, and El Jiri at 1350m. Preliminary
LVRWRSLFDQDO\VHVRIWDLOIHDWKHUVDQGFODZVVKRZVLJQLĆFDQWO\
ORZHUOHYHOVRI +LQIHDWKHUVSDLUHGWWHVWW df = 9, p-value < 0.001) which supports our hypothesis that
C. boliviana migrates along the elevational gradient and
suggests that the species made an uphill migration prior
to the breeding season. These preliminary results provide
insights on C. boliviana natural history and on its potential
behavioral strategies to cope with high elevation conditions.
171 Variaciones ecorregionales y estacionales de Haemoproteus
sp. en aves Passeriformes del Norte Grande de Chile
Luis G. Torres1*, Lucila Moreno1, Daniel González1
Seasonal movement patterns and many other life-history
traits are poorly known for Neotropical birds. Chiroxiphia
boliviana inhabits humid hill forests along the eastern slope of
the Andes of Bolivia and Peru; it has a wider elevational range
(600 to 2300 m) than other members of the genus. Here we
examine if there is partial uphill or downhill movement in C.
r£<;388'9|<&'$W$£
!+'S8!¡8'9'2;!ࣅ329
ǢW2-='89-&!&&'32$'6$-Õ2
Diversos estudios a lo largo del mundo han evidenciado
la presencia de hemoparásitos en aves. En Chile, se han
registrado hemoparásitos pertenecientes a los géneros
{փdփTT
ID t
ABSTRACT
t
ID t
Haemoproteus, Leucocytozoon, Plasmodium, Trypanosoma y
GLVWLQWDVHVSHFLHVGHPLFURĆODULDV(OREMHWLYRGHHVWHHVWXGLR
fue determinar la prevalencia de parásitos sanguíneos en
aves Passeriformes del Norte Grande de Chile y comparar
las diferencias entre ecorregiones (Di Castri, 1968, CNRS
Volumen 4) y estaciones del año. Entre mayo de 2011 y
agosto de 2012 se realizaron cuatro visitas estacionales a diez
localidades correspondientes a las ecorregiones: Desértica de
Litoral, Desértica de Interior, Tropical Marginal y Tropical de
Altura. Fueron capturadas 507 aves (38 especies), incluidas
en nueve familias: Furnariidae, Tyrannidae, Hirundinidae,
Troglodytidae, Turdidae, Thraupidae, Emberizidae, Fringillidae
y Passeridae. De cada ave se obtuvo un frotis sanguíneo, el
cual fue teñido mediante la técnica Diff Quick y analizado
a través de microscopía de luz. En 91 (17,95%) de las aves
(12 especies) se detectó la presencia de hemoparásitos
morfológicamente compatibles con el género Haemoproteus,
siendo la especie más parasitada Phrygilus fruticeti (83,78%;
$WUDY«VGHODSUXHEDGH&KLFXDGUDGR\HOWHVWH[DFWR
de Fisher se detectaron diferencias (p<0,01) en las prevalencias
del hemoparásito entre estaciones en las ecorregiones
Tropical Marginal y Tropical de Altura y también diferencias
ecorregionales durante las estaciones de invierno y verano,
hecho que se puede explicar por las características propias de
cada ecorregión y su relación con las poblaciones de aves.
172 Impacto del cambio climático en la distribución
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
de aves frugívoras en el gradiente altitudinal
Caribe-Villa Mills en Costa Rica
Katherine Araúz-Ponce1*, Viviana Ruiz-Gutierrez2, Bryan Finegan3
ǢW9$<'£!&'39+8!&3T'2;83+832Õ1-$3836-$!£&'2='9ধ+!$-Õ2
@29'Ó!2A!lmTǣW3$0@3<2;!-2-8&#9'8=!;38@TǤW
83+8!1!&'83&<$$-Õ2@329'8=!$-Õ2&'397<'9T'2;83
+832Õ1-$3836-$!£&'2='9ধ+!$-Õ2@29'Ó!2A!lm
r0!8!<A6|$!ধ'W!$W$8
/DVLQYHVWLJDFLRQHVTXHKDQFXDQWLĆFDGRHOLPSDFWRGHO
cambio climático sobre las especies tropicales en gradientes
altitudinales son limitados. Las estimaciones de ocupación
SURYHHQXQDIRUPDHĆFD]GHHVWDEOHFHUO¯QHDVEDVHVGH
distribución para explorar cambios potenciales de especies
utilizando escenarios de cambio. Se estimó la probabilidad
de ocupación y detección de especies de aves frugívoras
en el gradiente altitudinal Caribe-Villa Mills en Costa Rica.
Generamos historiales de utilizando datos de avistamientos
para cuatro ocasiones de muestreo. Aplicamos un modelo de
ocupación de una temporada para una especie implementado
en el paquete unmarked en R. Para ver efectos de condiciones
climáticas sobre la distribución de especies, usamos covariables
bioclimáticas y de elevación como covariables de detección y
ocupación. Los valores estimados de ocupación fueron bajos
DORODUJRGHOJUDGLHQWHDOWLWXGLQDO8WLOL]DQGRORVFRHĆFLHQWHV
de regresión del modelo con más apoyo de los datos, logramos
proyectar la probabilidad de ocupación según el escenario
RCP4.5 al año 2050, resultando en una disminución. Estos
{փdփTT
ID t
ABSTRACT
t
resultados disponen de una mejor evidencia de los impactos del
cambio climático sobre la biodiversidad, siendo uno los primeros
estudios ejemplares sobre el impacto del cambio climático
sobre las comunidades de aves tropicales para bosques
nubosos tropicales de Centroamérica. Este estudio sirve de
guía para otros proyectos en el Neotrópico y de esta manera
llenar el vacío de información que existe del impacto del cambio
climático sobre la avifauna tropical en gradientes altitudinales.
175 Elevational distribution and general ecology of the
Canada Warbler (Cardellina canadensis) in Colombia
Nicholas J. Bayly
V2='9ধ+!$-Õ26!8!£!329'8=!$-Õ2'2'£'3;836-$3
ID t
ABSTRACT
t
Table of Contents
(282 points) and playback experiments (301 points) in mature
forest showed that Canada Warblers occupied elevations
between 1000 and 2250 m, with a tendency to be more
abundant between 1250 and 1500 m. The species was more
abundant in mature forest relative to shade coffee at the
same elevation, and birds in forest foraged primarily in the
mid-levels of vegetation between 5 m and 15 m above the
ground. There was limited evidence for a difference in the
elevational distribution of males and females. The probability
RI&DQDGD:DUEOHUVEHLQJREVHUYHGLQPL[HGVSHFLHVćRFNV
increased with elevation. These preliminary results provide
important baseline information essential to any process that
aims to prioritize habitats or elevations for the conservation
of Canada Warblers on their non-breeding grounds.
2-$0W#!@£@|9'£=!W38+W$3
The Canada Warbler (Cardellina canadensis) is a declining
Neotropical migratory bird that occurs in the Andes of
Venezuela, Colombia, Ecuador and Peru during the nonbreeding period. Despite being a relatively abundant species
in Andean forests, the elevational distribution of the species
and its non-breeding period ecology have yet to be studied in
DQ\GHWDLO'XULQJWKHQRQEUHHGLQJSHULRGRIZH
YLVLWHGĆYHGLIIHUHQWUHJLRQVRI&RORPELDDQGDWHDFKVLWHZH
FDUULHGRXWSDVVLYHĆYHPLQXWHSRLQWFRXQWVDQGRQHPLQXWH
long playback experiments in three habitats: mature forest,
secondary forest, and shade coffee. For all birds detected, we
recorded their perpendicular distance from the transect, age
and sex (where possible), foraging height, and their association
RUQRWZLWKPL[HGVSHFLHVćRFNV%RWKSDVVLYHSRLQWFRXQWV
!+'S8!¡8'9'2;!ࣅ329
189 8
VRGHF¤PHUDVWUDSSDUDLGHQWLĆFD©¥RGH
predadores de ninhos em uma comunidade de
aves da Mata Atlântica do sudeste do Brasil
Lais Ribeiro da Silva1*, Paulo Victor Queijo Zima1, Carlos
Humberto Biagolini Júnior1, Daniel Fernandes Perrella1
ǢW2-='89-&!&'
'&'8!£&'È3!8£39
r89W£!-9|+1!-£W$31
A perda de ninhos é a principal causa de fracasso na reprodução
das aves, sendo a predação um componente importante nas
hipóteses relacionadas às adaptações de história de vida e,
também, comumente relacionada com o declínio populacional
de aves em áreas fragmentadas. Este estudo teve como
foco testar o uso de câmeras trap como metodologia para a
LGHQWLĆFD©¥RGHSUHGDGRUHVGHQLQKRVGHDYHVHPXPD£UHD
{փdփTT
ID t
ABSTRACT
t
ID t
GH0DWD$WO¤QWLFD1DVHVWD©·HVUHSURGXWLYDVH
IRUDPHQFRQWUDGRVQLQKRVGHHVS«FLHVGH
DYHVWRWDOL]DQGRKRUDVF¤PHUDGHPRQLWRUDPHQWR
Dos 148 ninhos, 37 foram predados (25%) e dos 40 eventos
de predação, 26 foram registrados pelas câmeras. Alguns dos
SUHGDGRUHVLGHQWLĆFDGRVIRUDPLeopardus pardalis, Marmosops
incanus, Sapajus nigritus, Amadonastur lacernulatus, Micrastur
UXĆFROOLV3XOVDWUL[NRHQLVZDOGLDQD e Ramphastos dicolorus. TestouVHWDPE«PDHĆFL¬QFLDGRXVRGHXPDRXGXDVF¤PHUDVSRU
QLQKRVHQGRTXHHPRFRUUHUDPSUHGD©·HVGDV
quais 10 foram registradas utilizando apenas uma câmera por
QLQKR-£HPRFRUUHUDPSUHGD©·HVVHQGRTXH
19 foram registradas com o uso de duas câmeras por ninho. As
FDXVDVGDVIDOKDVQRUHJLVWURGDVSUHGD©·HVIRUDPLGHQWLĆFDGDV
como: lotação do cartão de memória, mal posicionamento
e deslocamento da câmera e distância da câmera ao
QLQKR'HVWDPDQHLUDDVF¤PHUDVVHPRVWUDUDPHĆFLHQWHV
para a realização deste tipo de estudo e se mostraram
resistentes às adversidades climáticas. O uso de duas
F¤PHUDVSRUQLQKRQ¥RDSUHVHQWRXGLIHUHQ©DVVLJQLĆFDWLYDV
no registro de predações, sendo importante checagens
mais frequentes para resolução de possíveis problemas.
191 Use of wild food by a reintroduced population of scarlet
!+'¢S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
macaws (Ara macao cyanoptera) in Palenque, Mexico
Ángela María Amaya-Villarreal1*, Alejandro
Estrada1, Nicolás Vargas-Ramírez2
ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3TǣW32ধ)$-!2-='89-&!&!='8-!2!
r!1W!1!@!W=-££!88'!£|+1!-£W$31
The Scarlet Macaw (Ara macao cyanoptera) is an endangered
species in Mesoamerica due to habitat loss, hunting and illegal
WUDIĆF,WVUDQJHKDVEHHQUHGXFHGE\LQ0H[LFR%HWZHHQ
April 2013 and June 2014, a population of 96 individuals of
A. m. cyanoptera was reintroduced in the tropical forests of
Palenque, Mexico. One key indicator of adaptation to the wild
is the ability of macaws to use food in the new habitat. Hence,
the main objective of this study was to document the use
of wild food and habitat range by the reintroduced macaws
between June-November 2014. We surveyed the presence
and feeding activities of macaws along 18 km of trails in the
release site and recorded 283 feeding bouts. Macaws used
140 trees of 31 species (19 families; 84% native species) as
a source of food. Seeds and fruit accounted for 70% of their
diet. The remainder 30% consisted of bark, stems, leaves,
LQVHFWJDOOVćRZHUVDQGVKRRWV)LYHWUHHVSHFLHVZHUHKLJKO\
dominant in their diet. Levin´s index of dietary niche breadth
was 0.260 indicating a narrow diet. Food trees were found in
36 ha, but total range was 59 ha. Habitat areas used by the
macaws displayed a clumped pattern (Morisita index=1.68)
and their distribution was not random (X2 = 8478.62,
P<0.0001). We compared the use of wild food with other,
wild and reintroduced, populations of Scarlet macaws and
{փdփTT
ID t
ABSTRACT
t
discussed the observed patterns in the context of ecological
generalism, high sociality and behavioral innovation. We
concluded that these three factors may have been facilitating
an initial and successful adaptation to the wild by the
reintroduced Scarlet macaws to the rainforest of Palenque.
192 ¿El éxito reproductivo deElaenia albiceps
chilensisvaría durante la temporada reproductiva
en los bosques andino-patagónicos?
Cristian Gorosito1*, Víctor Cueto1
ǢW'2;83&'2='9ধ+!$-Õ297<'£&'32;!Ó!@
9;'6!!;!+Õ2-$!lfm
r6£!2';$8-9ধ!2ǡǣǢ|,3;1!-£W$31
Muchas especies de aves muestran una disminución del
éxito reproductivo con el avance de la temporada de cría.
La especie migratoria Elaenia albiceps chilensis (Tyrannidae)
es la más abundante en los bosques andino-patagónicos,
pero poco se sabe sobre su biología reproductiva. El objetivo
fue evaluar si el éxito reproductivo varía a lo largo de la
temporada de cría. Se realizó una búsqueda de nidos en un
bosque cercano a Esquel, en Argentina. Los nidos (n = 29)
fueron monitoreados diariamente para determinar la duración
GHODVHWDSDVGHQLGLĆFDFLµQ\IXHURQFODVLĆFDGRVHQQLGRV
con puesta temprana (diciembre, n = 14) y con puesta tardía
(mediados de enero, n = 15). Se midieron los huevos y los
pichones hasta que abandonaron el nido. Los nidos tempranos
tuvieron un mayor tamaño de puesta (temp = 3; tard = 2) y
la etapa de puesta fue más prolongada. No hubo diferencias
para la duración de las etapas de incubación y polluelos entre
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
nidos tempranos y tardíos y tampoco en el tamaño de los
huevos y en las tasas de crecimiento de los polluelos. El éxito
reproductivo fue mayor en nidos tempranos (ERtemp = 0,40;
ERtard = 0,22) y la tasa de predación de nidos fue mayor en
los tardíos (TPtemp = 0,50; TPtard = 0,73). Considerando
que los padres atendiendo los nidos tardíos presentaban
acumulación de grasa (i.e., se estaban acondicionando para
la migración), podrían estar derivando menos energía a la
QLGLĆFDFLµQUHćHMDGRHQHOPHQRUWDPD³RGHSXHVWD\PHQRU
éxito reproductivo, siendo este último parámetro reproductivo
afectado también por una mayor tasa de predación.
196 Geographic variation in coloration and morphometrics
in three species of birds along the Purus0DGHLUD,QWHUćXYLXP:HVWHUQ$PD]RQ
)HUQDQGR7HµĆOR1*, Juliana Schietti1, Marina Anciães1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!
r;'3)£3ù|+1!-£W$31
Morphological traits may vary across a species range as a result
of drift or local adaptation. Biogeographic studies in Amazon
W\SLFDOO\GHVFULEHELRGLYHUVLW\DFURVVLQWHUćXYLDUDUHO\ZLWKLQ
them. We test phenotypic variation in three bird species along
WKH3XUXV0DGHLUDLQWHUćXYLXPDQGZKHWKHUWKHREVHUYHG
phenotypes were explained by geographic distance or
HQYLURQPHQWDOKHWHURJHQHLW\&RORUDWLRQLQGH[HVRIUHćHFWDQFH
spectra and morphometry of ca. 5 adult males and 5 females
from 11 localities were contrasted among localities and with
proxies for distance and environmental variation (tree basal
area and bird community). Environmental variation was not
{փdփTT
ID t
ABSTRACT
t
VLJQLĆFDQWO\VSDWLDOO\DXWRFRUUHODWHGDQGWKHUHZHUHQRREYLRXV
barriers to dispersal in the study region. Null expectations were
of no variation or random variation was not explained by tested
YDULDEOHV+DOIRIWKHFDVHVDQDO\]HGVKRZHGLQWUDVSHFLĆF
morphological variation. Coloration varied more frequently
than morphometrics and color was better explained by
environmental heterogeneity, particularly in males, whereas
brightness varied also with distance. Distances explained the
only case of variation in morphometry. These results indicate
that coloration is more labile than morphometric traits and
that plumage color is more adapted to local environments
than brightness, which is, in addition, under the effects of
neutral drift. Higher frequencies of association between
male coloration and the environment suggest a role of sexual
selection on the expression of these phenotypes. We showed
LQWUDVSHFLĆFSKHQRW\SLFYDULDWLRQLQDVSDWLDOH[WHQWXVXDOO\QRW
considered in classical biogeographic studies in the Amazon.
197 Oferta de semillas y su relación con la abundancia
de aves granívoras en distintas etapas de desarrollo
de una plantación de Pinus radiataen Chile
ID t
ABSTRACT
t
Table of Contents
manejo con tala rasa con la que son tratadas las plantaciones.
Este manejo provoca que existan parches con condiciones
microambientales diferentes entre los distintos estados
de crecimiento de los pinos. El objetivo de este estudio es
hacer una estimación de la oferta de semillas disponible
en el suelo de plantaciones de pino de distintas edades (2,
5, 10 y 20 años) y relacionarla con la abundancia de aves
granívoras. El área de estudio está próxima a la localidad de
Dichato (Región del Biobío) en donde se tomaron muestras
de hojarasca en las diferentes edades de pino evaluadas, las
cuales se tamizaron para separar las semillas obteniendo de
esta manera la oferta de semillas. Para evaluar la abundancia
GHDYHVVHKLFLHURQFRQWHRVSXQWXDOHVGHUDGLRĆMR6H
incluyó a la vegetación como covariable, por lo que se hizo
una evaluación del volumen de vegetación en cada rodal. Los
resultados muestran que los rodales de 5 años tuvieron la
mayor oferta de semillas, lo cual puede deberse a que existan
PHMRUHVFRQGLFLRQHVPLFURDPELHQWDOHVTXHEHQHĆFLHQHO
desarrollo de especies de plantas que contribuyan con la
oferta de semillas. En relación a las aves granívoras, hubo
mayor abundancia en los pinos más jóvenes, por lo que se
puede asociar a la oferta de semillas que tengan disponible.
Romina Chiappe1*, Cristián Estades1
ǢW2-='89-&!&&',-£'T
!$<£;!&&'-'2$-!9
38'9;!£'9
@329'8=!$-Õ2&'£!!;<8!£'A!
r$,-!66'W831-2!|+1!-£W$31
&KLOHSRVHHXQDJUDQVXSHUĆFLHGHVXWHUULWRULRGHVWLQDGRD
plantaciones de pino radiata, las cuales han sido utilizadas
como hábitat por diversas especies de aves. A nivel de paisaje
se puede apreciar una heterogeneidad espacial producto del
!+'£S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
206 Las garrapatas duras (Acari: Ixodida: Ixodidae)
en aves silvestres del Neotropico
Daniel González-Acuña1*, José Venzal2, Sebastián
Muñoz-Leal3, Santiago Nava4
ǢW2-='89-&!&&'32$'6$-Õ2TǣW£-;38!£238;'T
ǤW2-='89-&!&&'!3!<£3TǥW!(!'£!
ID t
ABSTRACT
t
Table of Contents
garrapata como parásito. La cantidad de relaciones hospedador
parásito (ave: garrapata) registradas hasta la fecha han sido
425. Futuras prospecciones, principalmente en ambientes
escazamente estudiados, arrojarán con seguridad nuevas
aves como hospedadores para las garrapatas del neotrópico.
Agradecimiento a proyecto FONDECYT 1130948.
r&!2-+32A|<&'$W$£
Las garrapatas duras (Acari: Ixodoidea: Ixodidae) están
representados en el mundo por cerca de 700 especies (78%
del total de garrapatas), 122 de las cuales se han registrado
en el neotrópico. Con el propósito de analizar el estado del
arte de las garrapatas duras descritas en aves neotropicales,
revisamos de manera exhaustiva toda la información publicada
sobre aquellos estudios realizados que involucraran a este
grupo de ácaros parasitando aves neotropicales. En el
neotrópico hasta la fecha se han descrito parasitando aves,
33 especies de garrapatas duras incluidas en tres géneros,
Ixodes con 14 especies, Amblyomma con 17 y Haemaphysalis
con dos. Las especies de garrapatas que presentan una
mayor cantidad de hospedadores descritos son Amblyomma
longirostre con 103 especies de aves, Ixodes auritulus con 64 y
Amblyomma tigrinum con 40. Nueve especies de garrapatas
se han registrado solo sobre un hospedador. En total 292
especies de aves neotrópicales han sido reportadas como
hospedadores de algunas de las 33 especies de garrapatas
duras. Las aves con mayor cantidad de registros de especies
han sido 7XUGXVUXĆYHQWULV con 10 especies, Turdus albicollis
y Turdus amaurochalinus, ambos con siete especies. En 216
especies de aves (74%) se ha registrado solo una especie de
!+'S8!¡8'9'2;!ࣅ329
230 $
IUDPHZRUNIRUPHDVXULQJFRQćLFWLQFRQVHUYDWLRQ
Karen Mustin1*, Morena Mills2, Fernanda Michalski3,
Juliette Young4, Stephen M Redpath5
ǢW
TǣW2-='89-;@3(<''29£!2&TǤW
T
ǥW&-2#<8+,TǦW2-='89-;@3(#'8&''2
r0!8'2W1<9ধ2|+1!-£W$31
&RQVHUYDWLRQFRQćLFWVDUHZLGHVSUHDGFRVWO\DQGFKDOOHQJLQJ
to resolve. They typically arise when conservation goals
compete with other goals such as farming, hunting, recreation,
forestry or other human activities. Examples from the avian
world include: the killing of predatory birds, such as the
hen harrier (Circus cyaneus) in the UK, which impact upon
economically or culturally valuable species such as gamebirds
or livestock; interactions between frugivorous birds, such as
parrots, and commercial orchards; or where forestry activities
are impacted by the protected status of a species, such as
the northern spotted owl (Strix occidentalis caurina) in North
$PHULFD7KHUHLVDQXUJHQWQHHGWRPHDVXUHFRQćLFWWRKHOS
target conservation actions and measure the effectiveness
of these interventions. Such measurements have proved
elusive as they need to incorporate a range of ecological and
social features. Here we propose a framework to measure the
{փdփTT
ID t
ABSTRACT
t
LQWHQVLW\RIFRQVHUYDWLRQFRQćLFWV:HGUDZXSRQOLWHUDWXUH
from institutional analysis and social psychology to extract
FRPSRQHQWVRIFRQVHUYDWLRQFRQćLFWVLQFOXGLQJERWKWKHLVVXHV
ZKLFKDUHDVRXUFHRIFRQćLFWDQGWKHEHKDYLRXUVGLVSOD\HG
We conclude that our methodology will help identify the
LVVXHVZKLFKDUHJHQHUDWLQJKLJKHUOHYHOVRIFRQćLFWZLWKLQ
a system and furthermore, this standard methodology will
facilitate comparison across systems and studies to help
SULRULWLVHLQYHVWPHQWLQFRQćLFWLQWHUYHQWLRQDFWLRQV
239 Territorial behavior of the Grey-Bellied Flowerpiercer
(Diglossa carbonaria) in an urban environment
Daniela Morales Moreno1*, Alvaro Garitano-Zavala1
ID t
ABSTRACT
t
Table of Contents
114 hours per couple in each season. The three couples kept
their territories along the study period, and males and females
defended them equally; three agonistic behaviors (scare, chase
DQGĆJKWDQGWKUHHYRFDOL]DWLRQVDVVRFLDWHGVRQJWKULOODQG
call) were recognized. The agonistic behaviors were performed
WRZDUGVELUGVSHFLHVLQFOXGLQJFRQVSHFLĆFVDQGRQH
carpenter bee, most of the agonistic behaviors were executed
WRFRQVSHFLĆFVDQGKXPPLQJELUGVWRJHWKHUXVLQJDKLJK
rate of scare (range: 27.5 - 53.4%) and chase (40.6 - 62.7%),
LQVWHDGRIĆJKW0DOHVXVHGDKLJKHUUDWHRIVRQJV
(range: 43.8-94.7%) than females to make them conspicuous
to competitors. Therefore, the Grey-Bellied Flowerpiercer is
resident, holds annual territories in urban environments and
behaves agonistically against other nectar-feeding species.
ǢW29ধ;<;3&'$3£3+Ð!T2-='89-&!&!@38&'!22&8Ì9
r&!W138!£'9138'23|+1!-£W$31
Territorialism is energetically demanding and is used by species
LIWKHFRVWEHQHĆWEDODQFHLVDSSURSULDWH,QFLWLHVWKHUHDUH
limited space and food resources for specialized birds, in
particular for nectar-feeding ones, despite this, several bird
species established in urban areas access to nectar resources.
In the Neotropics there are no reports about territorialism
for birds of the genus Diglossa in urban environments. In this
study we evaluated if the Grey-Bellied Flowerpiercer (Diglossa
carbonaria) shows territorial behaviors in an urban area
against other nectar-feeding competitors. Three couples were
monitored in green areas of La Paz city (Bolivia) along wet (NovFeb) and dry season (Apr-Jul), identifying and quantifying all the
behaviors related to territorialism. We used between 84 and
!+'S8!¡8'9'2;!ࣅ329
244 Responses of hummingbirds to land use change:
insights from taxonomic and functional diversity
Boris A Tinoco1*, Vinicio Santillán2, Catherine Graham3
ǢW2-='89-&!&&'£A<!@TǣW-3&-='89-;@!2&£-1!;'
'9'!8$,'2;'8TǤW;32@83302-='89-;@
r#ধ23$3|<!A<!@W'&<W'$
Most of the current knowledge about the effects of land
use change on biodiversity comes from taxonomic diversity
studies; nonetheless, other facets of biodiversity, such as
functional diversity, could also be affected. We sampled
hummingbirds in six landscapes, in the Andes of Ecuador, to
H[SORUHWKHLQćXHQFHRIODQGXVHFKDQJHLQWD[RQRPLFDQG
functional diversity. The land use gradient was characterized
by GIS landscape level variables: landscape diversity, edge
{փdփTT
ID t
ABSTRACT
t
density and coverage of native vegetation. Hummingbirds
were sampled by point counts between 2011 and 2012, from
which we obtained taxonomic and functional diversity indices.
We also explored how different hummingbird functional
WUDLWVPD\LQćXHQFHVSHFLHVUHVSRQVHVWRODQGXVHFKDQJH
by performing a RLQ test, an analysis of environment traits
relationships. Overall the most abundant species included
Metallura tyrianthina, Coeligena iris and Eriocnemis luciani. We
GLGQRWĆQGYDULDWLRQLQWD[RQRPLFGLYHUVLW\DFURVVWKHODQG
use gradient; however, functional diversity decreased in the
most altered landscapes. The RLQ analysis showed associations
between bill length and body size, and characteristics of less
altered landscapes. Considering that functional diversity is
often positively associated with ecosystem functions, the
decreased in functional diversity of hummingbirds driven
by land use change can be detrimental for the pollination
services they provide. This study highlights the importance
considering multiple dimension of biodiversity to have better
understanding of the potential impacts of land use change.
246 Diversity and distribution of avian haematozoa across
an elevation gradient in northern South America
ID t
ABSTRACT
t
Table of Contents
many groups of organisms. Bird species commonly exhibit
narrow elevational distributions and close relatives show sharp
replacements along elevational gradients. Although patterns
of diversity and distribution of avian taxa in the Andes and
other tropical mountains are relatively well known, this is not
the case for bird pathogens, which have been hypothesized to
mediate elevational replacements and to limit the elevational
distributions of species. With the goal of understanding the
ecology and evolution of bird-parasite interactions across
elevational gradients, we studied the distribution of avian
haemosporidian parasites from 700 to 2800 m elevation in the
Sierra Nevada de Santa Marta (SNSM) in Northern Colombia. A
preliminary assessment of parasites detected using microscopy
and molecular analyses based on samples collected from ca.
350 individuals of 65 understory bird species revealed a diverse
parasite assemblage, dominated by Haemoproteus, followed
by Plasmodium and then Leucocytozoon. Tanagers (Thraupidae)
and thrushes (Turdidae) showed high parasite prevalence
relative to other groups. Overall prevalence reached 30% and
peaked at elevations between 1300-1500 m, where parasite
diversity was also high. The peaks in diversity and prevalence
of parasites at mid elevations may be related to turnover in
avian species distributions along the elevational gradient.
Paulo C Pulgarin-R1*, Staffan Bensch2, Daniel Cadena1
ǢW'6!8;!1'2;3&'-'2$-!9-3£Õ+-$!9T2-='89-&!&&'39
2&'9TǣW'6!8;1'2;3(-3£3+@T<2&2-='89-;@
r6$W6<£+!8-2ǦǢ|<2-!2&'9W'&<W$3
Montane areas in the Neotropics are highly diverse and
FRPSOH[V\VWHPVWKDWKDYHSURPRWHGWKHGLYHUVLĆFDWLRQRI
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
248 Avaliação das correntes de educação ambiental
em projetos de birdwatching no Brasil
Guilherme Sementili Cardoso1*, Reginaldo José Donatelli2
ǢWÖ9f8!&<!%È3'1-Í2$-!9-3£Ö+-$!9l 33£3+-!mTǣW!#38!;Ö8-3&'82-;3£3+-!
r+<-9'1$!8|@!,33W$31W#8
O século XXI é marcado pela crescente preocupação mundial
com os temas socioambientais que enfocam a relação entre o
homem e o ambiente. A observação de aves (ou birdwatching)
surge como uma ferramenta de integração entre a conservação,
o desenvolvimento socioeconômico e a educação ambiental.
Todavia, é necessário avaliar se os discursos defendidos pelos
SURMHWRVGHPRQVWUDPSUHRFXSD©¥RFRPSU£WLFDVVLJQLĆFDWLYDV
e transformadoras de educação. Sendo assim, nosso estudo
busca avaliar quais as correntes de educação ambiental
presentes nos projetos birdwatching pelo Brasil. Os projetos
IRUDPVHOHFLRQDGRVSRUXPOHYDQWDPHQWRELEOLRJU£ĆFR
utilizando palavras-chave relacionadas com birdwatching,
educação ambiental, ecoturismo e ornitologia. Escolhemos
apenas os artigos e resumos publicados em periódicos e anais.
Após uma leitura criteriosa, categorizamos as correntes de
HGXFD©¥RGDVSURSRVWDVVHJXQGRRWH[WR8PDFDUWRJUDĆD
das correntes em educação ambiental- de Lucie Sauvé. Foram
LGHQWLĆFDGDVDVFRUUHQWHVSULQFLSDLVHVHFXQG£ULDVSUHVHQWHV
WDQWRQDVFRQFHS©·HVLQLFLDLVTXDQWRQDVSURSRVWDVĆQDLVGRV
HVWXGRV$QDOLVDPRVSURMHWRVHYHULĆFDPRVDSUHGRPLQ¤QFLD
da corrente recursista nas concepções iniciais e propostas
ĆQDLV(PGRVSURMHWRVKRXYHXPDGHVYLRQRGLVFXUVR1D
maioria dos casos, o discurso de sustentabilidade foi desviado
para as correntes recursista ou resolutiva. Num primeiro
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
momento há uma preocupação com temas socioambientais
que se, desviam para a exploração consciente de recursos
e a resolução de problemas. Em 26% dos estudos, houve
um esvaziamento de conteúdo em educação ambiental,
com a diminuição de correntes no decorrer do discurso.
251 Did change spectro-temporal and synchronization
features in the White-eared Ground-sparrow (Melozone
leucotis) duets according to different contexts?
Carolina Méndez1*, Luis Sandoval1
ǢW2-='89-&!&&'39;!-$!
r$!8-;31'2&=!97|+1!-£W$31
Territorial defense and mate guarding are in general the two
main hypotheses of duets functions. Nevertheless, acoustic
characteristics of duets under both functions have rarely
EHHQTXDQWLĆHGLQGHWDLO7KHDLPRIWKLVZRUNZDVWKHUHIRUH
to analyze changes in the spectro-temporal characteristics
and variations of synchronization in White-eared Groundsparrow duets produced under two context: territory defense
and mate guarding. If context affect either the spectrotemporal characteristics or synchronization, we expect to
observe differences when compare duets of the same pair
in each context. We conducted the study in 35 color banded
ground-sparrows pairs in Costa Rica, during breeding season
in 2014. To examine duet characteristics under mate guarding
context, we recorded pair duets produced spontaneously
when members of the pair came into contact. To analyze duet
characteristics under a territory defense context, we recorded
duets produced in response to simulate intrusions simulated
{փdփTT
ID t
ABSTRACT
t
by using acoustic playbacks. To analyze synchronization,
we compared the variation in duration of the initial, middle,
DQGĆQDOVHFWLRQRIGXHWVSURGXFHGXQGHUERWKFRQWH[WV
Spectro-temporal characteristics and synchronization of
duets were similar under both contexts. However, we noted
that when ground-sparrows produced duets in response to
playbacks stimulus, they also approached closer and faster
to the speaker, maybe to elicit more aggressive responses.
We suggest that duets are important in territory defense
and that producing duets with overlapping elements could
also be related to producing more threatening signals.
257 Comportamento reprodutivo do Tangará-
dançarino, Chiroxiphia caudata(Aves, Pipridae)
Paulo V. Q. Zima1*, Carlos H. Biagolini-Júnior1, Daniel F.
Perrella1, Lais Ribeiro-Silva1, Mercival R. Francisco1
ǢW2-='89-&!&'
'&'8!£&'È3!8£39
r6=iA-1!|,3;1!-£W$31
As Aves da família Pipridae, endêmicas da região neotropical,
KDELWDPRHVWUDWRP«GLRGDVćRUHVWDVHSRVVXHPFRPR
característica o hábito alimentar frugívoro. Os machos
de algumas espécies fazem exibições sexuais complexas
para atrair as fêmeas. Das 51 espécies, 29 têm seus ninhos
descritos, cinco têm descrições de períodos de incubação, e
seis têm períodos de permanência dos ninhegos nos ninhos
relatados. O Tangará-dançarino, Chiroxiphia caudata, é comum
HPćRUHVWDV¼PLGDVHVHFXQG£ULDVGDUHJL¥RVXGHVWHGR
Brasil, nordeste da Argentina e leste do Paraguai e dados
de sua biologia reprodutiva são pouco documentados. Aqui
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
analisamos 36 ninhos ativos em duas estações reprodutivas
HHPXPFRQW¯QXRGH0DWD$WO¤QWLFD
bem preservada. Os ninhos foram taças rasas, pendurados por
suas bordas em forquilhas horizontais de pequenos arbustos,
sobre ou próximos aos córregos. Atividades reprodutivas
foram registradas no período de outubro a fevereiro e
tamanhos de ninhada foram invariavelmente de dois ovos. O
período de incubação foi de 18 dias (n = 7 ovos de 4 ninhos),
HRGHQLQKHJRVIRLGHDGLDVQ ĆOKRWHVGHQLQKRV
A estimativa total de sucesso dos ninhos foi de 35%, sendo
maior do que a maioria dos estudos sobre piprídeos que,
possivelmente, foram realizados em ambientes alterados.
Os nossos dados dão suporte à teoria de que na família
Pipridae apenas fêmeas fornecem cuidados parentais.
260 Manejo genético do criticamente ameaçado Formicivora
paludicola: translocações são necessárias?
Mariellen C Costa1*, Crisley Camargo, Leslie Gibbs,
Luis F Silveira, Mercival R Francisco1
ǢW2-='89-&!&'
'&'8!£&'È3!8£39
r1!8-'££'2W$39;!|+1!-£W$31
ORAL PRESENTATION SESSION 20: CONSERVATION GENETICS
Populações de espécies ameaçadas frequentemente são
pequenas e isoladas e podem ter a viabilidade afetada pela
perda de variabilidade genética devido à deriva genética e
à endogamia. Quando estes efeitos se tornam críticos, eles
podem ser amenizados através da translocação de indivíduos
ou da restauração da conectividade das populações. Por isto,
FRQKHFHURVQ¯YHLVGHYDULDELOLGDGHJHQ«WLFDHRćX[RJ¬QLFR
entre populações são primordiais para que as melhores
{փdփTT
ID t
ABSTRACT
t
decisões de manejo sejam tomadas. Formicivora paludicola é
um passeriforme criticamente ameaçado, endêmico de brejos
da Mata Atlântica do Estado de São Paulo, com população
estimada em 250-300 indivíduos, distribuídos em apenas 15
áreas isoladas. As maiores áreas apresentam 20, 30 e 45 ha.
Nesse estudo foram utilizados17 loci de microssatélites para
estimar os níveis de variabilidade genética e a conectividade
entre estas três populações. O grau de estruturação genética
foi um dos maiores já encontrados para aves neotropicais e
análises de coalescência revelaram que são historicamente
estáveis e que o isolamento precede as ações antrópicas de
fragmentação dos habitats. Os tamanhos efetivos populacionais
foram pequenos (31-116 indivíduos), porém sem indícios de
endogamia. Dado que isolamento histórico pode implicar
em adaptações locais, translocações ou reconexão das áreas
poderia implicar em disruptura de complexos adaptativos e
esta prática não é indicada. Uma vez que as ameaças continuam
constantes, sugerimos que novas populações sejam criadas
em áreas protegidas, e que indivíduos de áreas distintas sejam
utilizados para compor estas novas e protegidas populações.
261 $YLIDXQDGD%DFLD+LGURJU£ĆFDGRULR8EHUDELQKD
(Alto Paraná), Triângulo Mineiro, Minas Gerais
Gustavo Bernardino Malacco1*, Eurípedes
Luciano Silva-Júnior1, Dimas Pioli1
ǢW993$-!%È36!8!'9;È33$-3!1#-'2;!£&38-Ç2+<£3-2'-83
r1!£!$$3|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
0LQDV*HUDLVDEUDQJHQGR£UHDJHRJU£ĆFDGHNPt
$LQWHQVLĆFD©¥RGDVDWLYLGDGHVSURGXWLYDVQRV¼OWLPRV
DQRVQD%DFLDSURYRFRXVLJQLĆFDWLYRVLPSDFWRVDPELHQWDLV
resultando em paisagem com 23% da cobertura vegetal
original. Em razão da pressão sobre os recursos hídricos e os
ecossistemas associados, torna-se essencial a implantação
de ações de monitoramento, pesquisa e gerenciamento
da biodiversidade. Dessa forma, entre os anos de 1998 a
2015 realizou-se diagnóstico da avifauna em 31 unidades
amostrais da Bacia. Mais seis áreas foram analisadas mediante
UHVXOWDGRVGHSXEOLFD©·HVW«FQLFDVHRXFLHQW¯ĆFDV3DUD
análise da representatividade da distribuição da avifauna
QD%DFLDRSWRXVHSRUUHFRQKHFHUUHJL·HVJHRJU£ĆFDV
Registrou-se 362 espécies, sendo 353 diagnosticadas em
FDPSRRQGHV¥RFODVVLĆFDGDVFRPRDPHD©DGDVGHH[WLQ©¥R
em alguma lista vermelha (Minas Gerais; Brasil; Global),
com destaque para Sporophila palustris, S. melanogaster, S.
cinnamomea, Alectrurus tricolor, Coryphaspiza melanotis, Geositta
poeciloptera e Urubitinga coronata(QWUHDVUHJL·HVJHRJU£ĆFDV
destacaram-se em riqueza: Bom Jardim (265) e Cerradão
(224). A área de maior riqueza de espécies ameaçadas foi
1DVFHQWHVGRULR8EHUDELQKDHVS«FLHVFRQĆJXUDQGR
se importante local de populações de A. tricolor e de área
de invernada para espécies do complexo dos caboclinhos
(SporophilaVSS2VFDPSRVKLGURPµUĆFRVGHVVDUHJL¥RV¥R
intensamente impactados para retirada de argila refratária,
sendo necessária a urgente adoção de ações conservacionistas.
$%DFLD+LGURJU£ĆFDGRULR8EHUDELQKDORFDOL]DVHQDUHJL¥R
GR$OWR3DUDQ£PHVRUUHJL¥RJHRJU£ĆFDGR7UL¤QJXOR0LQHLUR
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
262 $
YLIDXQDDPHQD]DGDGHODYHUWLHQWHSDFLĆFD
de Nariño-Suroccidente de Colombia
Cristian Flórez-Paí1*, Natalia Bacca-Cortes2
ID t
ABSTRACT
t
Table of Contents
264 Área de acción y uso de hábitat de un juvenil
de Spizaetus isidori en un paisaje fragmentado
de la Cordillera Oriental de Colombia
r$8-9ধ!2*38'A|/!='8-!2!W'&<W$3U$8-9ধ!2(6!-|+1!-£W$31
Daniel Felipe Aristizábal Ramírez1*, Santiago
Zuluaga2, Giovany Guevara1, Fausto Sáenz3
ǢW2-='89-&!&&'!£&!9TǣW83@'$;3Æ+<-£!$8'9;!&!TǤW
<2&!$-Ö2'3;836-$!£
ǢW
fÐ3º!1#Ðf2-='89-&!&!='8-2!TǣW
fÐ3º!1#Ð
Colombia es considerado el país con mayor riqueza de aves
GHOSODQHWD6LQHPEDUJRXQDIUDFFLµQVLJQLĆFDWLYDGHHVWD
biodiversidad se encuentra en peligro de extinción. Estudiamos
ODDYLIDXQDODYHUWLHQWHSDF¯ĆFDGH&RORPELDXELFDGDVHQWUH
\PVQPFRQHOREMHWLYRGHLGHQWLĆFDUODGLYHUVLGDG
de aves y conocer las especies amenazadas presentes en
esta importante región. Durante salidas realizadas entre
el 2007 y 2013 registramos un total de 610 especies de
aves agrupadas en 52 familias y 346 géneros, de las cuales
un total de 108 especies son catalogadas dentro de las
categorías de importancia para la conservación de las aves
$,&$,%$'HQWURGHODVHVSHFLHVUHJLVWUDGDVHQFRQWUDPRV
Neomorphus radiolosus, Dacnis berlepschi, Micrastur plumbeus,
Vireo masteri, Odontophorus melanonotus y Oreothraupis
arremonops catalogadas como las especies de mayor riesgo
de extinción a nivel regional. De igual manera con esta
investigación reportamos 14 especies de aves amenazadas
(Crítico-CR, En Peligro-EN, Vulnerable-VU) de la vertiente
SDF¯ĆFDGHOVXURFFLGHQWHGHOSD¯V\FRQFOXLPRVTXHODYHUWLHQWH
SDF¯ĆFDVHFRQVLGHUDHO£UHDFRQPD\RUFRQFHQWUDFLµQGH
aves amenazadas de Colombia y debe considerarse medidas
de manejo especial por parte de los entes nacionales.
!+'S8!¡8'9'2;!ࣅ329
r&!('!8iǡǧ|,3;1!-£W$31
Spizaetus isidori ocurre en norte de Argentina, Bolivia, Perú,
Ecuador, Venezuela y Colombia. Ha sido categorizada “En
peligro” a nivel mundial, es una de las rapaces neotropicales
menos conocidas y presenta una baja densidad poblacional;
estimándose requerimientos de territorio de 100 km2 por
cada pareja. Este trabajo evaluó el área de acción y el uso
de los diferentes elementos del paisaje de para un juvenil
de la especie. Se realizó el seguimiento del juvenil a partir
de la toma de registros con coordenadas, tipo de hábitat y
actividad, desde su nacimiento hasta los 9 meses de edad,
en los lugares donde este se encontraba perchado. El juvenil
IXHLGHQWLĆFDGRSRUVXFRORUDFLµQGHSOXPDMHGLIHUHQWHDORV
adultos. Los registros fueron tomados cada 25 minutos durante
jornadas de seguimiento diarias entre las 0700-1700 horas,
y se obtuvo un total de 909 puntos. Se aplicó el método del
Mínimo Polígono Convexo al 100% para determinar el área
de acción y por medio del estimador Kernel se calculó el uso
preferencial de hábitat al 95% de probabilidad. Se obtuvo un
área de acción de 149 Ha y las coberturas vegetales al interior
del polígono mostraron porcentajes similares (51% para bosque
nativo y 49% para potrero). Según el estimador Kernel existe
un 95% de probabilidad de uso para el bosque nativo; esto se
{փdփTT
ID t
ABSTRACT
t
debe a que el individuo siempre utilizó perchas en árboles al
interior del bosque, y los potreros solo fueron utilizados para
desplazarse de un parche de bosque a otro. Estos resultados
sugieren gran importancia del bosque nativo para los juveniles
del Spizaetus isidori y corresponden al primer aporte en el
conocimiento del uso de hábitat por parte de la especie.
265 De la efectividad de manejo a la efectividad
de conservación de áreas protegidas, usando
las aves como indicador de evaluación
ID t
ABSTRACT
t
Table of Contents
dependientes de bosque. La densidad de aves fue mayor en
la RFGD y el PNPB. La irremplazabilidad calculada a nivel
mundial es mayor en la RFGD, seguida del PNPB. Se analizan
los resultados de acuerdo a la extensión, diversidad de
ecosistemas, amenazas, antigüedad de creación, manejo y
gestión de las AP, entre otros. A pesar de que las AP evaluadas
son “efectivas”, se sugiere que el cumplimiento de los objetivos
de conservación de las AP en Costa Rica enfrenta mayores
retos de los supuestos previamente y, la información que se
proporciona aquí es sólo una parte de la necesaria para evaluar
la efectividad total y apoyar las decisiones de manejo y gestión.
Yuly Lorena Caicedo-Ortiz
29ধ;<;32;'82!$-32!£'2329'8=!$-Õ2@!2'/3&'-&!-£='9;8'lmf
2-='89-&!&!$-32!£&'39;!-$!W93$-!$-Õ2382-;3£Õ+-$!&'39;!-$!lm
@<£@£$!-$'&3|+1!-£W$31
Las áreas protegidas (AP) son el instrumento de
conservación más consolidado a nivel mundial. Sin
embargo, son relativamente escasos los trabajos que
evalúan su efectividad, principalmente desde un enfoque
ELROµJLFR&RQHOĆQGHHYDOXDUODHIHFWLYLGDGGHWUHV$3FRQ
diferente categoría de manejo en Costa Rica, se comparó
la composición de la avifauna, se determinó la densidad de
ciertas aves dependientes de bosque y se usó el criterio de
irremplazabilidad en la evaluación. En cada AP se realizaron
puntos de conteo para estudiar las aves y se analizaron valores
de irremplazabilidad para la evaluación. En el Refugio de
9LGD6LOYHVWUH*ROĆWR596*VHUHJLVWUDURQHVSHFLHV
139 en el Parque Nacional Piedras Blancas (PNPB) y 158 en
la Reserva Forestal Golfo Dulce (RFGD); el PNPB y la RFGD
presentaron mayor similitud y mayor número de especies
!+'¢S8!¡8'9'2;!ࣅ329
272 Comunidade de aves em áreas de manejo
ćRUHVWDOQD$PD]RQLD2ULHQWDOGR%UDVLO
Miguel Angel Quimbayo1*, Teresa Cristina Magro2, Hilton Thadeu Couto2
ǢW2-='89-&!&'&33£-1!TǣWc
r1-+<'£7|<;W'&<W$3
Este estudo foi desenvolvido no município de Paragominas
(Pará), no Centro de Manejo Florestal Roberto Bauch. As
amostragens de campo foram feitas entre outubro de 2010 e
abril de 2011 durante as temporadas de seca e chuva em seis
£UHDVGHPDQHMRćRUHVWDOFLQFR£UHDVFRPDWLYLGDGHVGHSµV
exploração dos anos 1997, 2000, 2003, 2006 e 2009, e uma
área com atividades de pre-exploração. Foram monitorados seis
transetos de 1 km cada um com seis pontos de contagem por
transeto, com diâmetro de 50 m durante 15 min. Registraram-se
HVS«FLHVQRFHQWURGHGHPDQHMRćRUHVWDOUHSUHVHQWDGDV
por 43 famílias. As famílias com a maior abundancia relativa de
espécies foram Thamnophilidae (9,44%), Tyrannidae (8,26%),
{փdփTT
ID t
ABSTRACT
t
Thraupidae (7,08%) e Trochilidae (6,29%). 16 espécies são
endêmicas e 10 espécies estão em categoria de risco segundo
a IUCN. 235 espécies foram registradas somente nas áreas
GHPDQHMRćRUHVWDOGXUDQWHDWHPSRUDGDGHVHFDHFKXYD
registraram-se 200 e 165 espécies de aves, respetivamente. A
maior riqueza de espécies foi encontrada nas áreas de manejo
exploradas nos anos 2000, 2009, 2003 e 1997 (146, 106, 102
e 100 species, respetivamente). Thamnophilidae foi a familia
mais abundante em todas as áreas amostradas. EncontraramVHGLIHUHQ©DVVLJQLĆFDWLYDVWDQWRHQWUHDV£UHDVGHDPRVWUDJHP
(p<0,005) quanto na interação entre as áreas e as temporadas
de amostragem (p<0,005). As espécies com maior abundância
QDV£UHDVGHPDQHMRćRUHVWDOIRUDPLipaugus vociferans,
Cercomacra cinerascens, Pyriglena leuconota, Pionus menstrus,
Ramphastos tucanus, Amazona farinosa e Ara chloropterus (353,
321, 303, 188, 169, 167 and 152 individuals, respectively).
273 $HURG\QDPLFHIĆFLHQF\RIZLQJPRUSKRW\SHVLQWKHSDUWLDOO\
migratory Forked-tail Flycatcher (Tyrannus savana)
Valentina Gómez-Bahamón1*, Juan J. Gómez1, Ignacio
M. Soto2, Alex E. Jahn3, Daniel Cadena1
ǢW2-='89-&!&&'£392&'9TǣW2-='89-&!&&'<'239
-8'9TǤW2-='89-&!&'9;!&<!£!<£-9;!
ID t
ABSTRACT
t
Table of Contents
a partial migrant comprised of three sedentary subspecies
distributed in Central America and northern South America,
and one austral migratory subspecies that reproduces in
central and southern South America and spends the nonbreeding period in northern South America. A character
that differs among the subspecies is the shape of a notch in
the outermost primary feathers, which is narrower in the
migratory subspecies. In this project we aimed to: 1) determine
LIWKLVFKDUDFWHUGLIIHUVVLJQLĆFDQWO\EHWZHHQWKHVXEVSHFLHV
GHWHUPLQHLIWKH\GLIIHULQDHURG\QDPLFHIĆFLHQF\DQG
determine if notches are correlated with migratory behavior
in a larger phylogenetic context. We determined that 1) the
VKDSHRIWKHIHDWKHUVGLIIHUHGVLJQLĆFDQWO\E\XVLQJ)RXULHU
ecliptics and principal component analysis; 2) that there is
DSRWHQWLDOO\KLJKHUDHURG\QDPLFHIĆFLHQF\LQWKHVKDSHRI
the migratory subspecies by constructing 3D models and
WHVWLQJWKHPXVLQJćLJKWVLPXODWLRQVDQGE\FRQVWUXFWLQJ
robotic models of the wings and testing them in a wind
WXQQHODQGWKDWPRGLĆFDWLRQVRIWKHRXWHUPRVWSULPDULHV
in the family Tyrannidae are not correlated with migratory
behavior. It has been suggested before that this character is
used in sexual selection; thus, in T.savana it could be possible
that it is under both natural selection and sexual selection.
r=W+31'AǢǢ|<2-!2&'9W'&<W$3
ORAL PRESENTATION SESSION 6: ECOMORPHOLOGY I
$QLPDOVWKDWć\UHTXLUHDGDSWDWLRQVWKDWDOORZWKHPWR
accomplish locomotion according to their ecological needs.
0DQ\PLJUDWRU\ELUGVDUHDEOHWRć\ORQJGLVWDQFHVIRVWHUHG
by elongated and pointed wings and lean bodies that allow
them to optimize energy consumption. Tyrannus savana is
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
274 Overwintering strategies of migratory birds:
a novel approach for making inferences on
movement patterns of residents and transients
Viviana Ruiz-Gutierrez1*, William Kendall2, Saracco James3
ǢW3$0@3<2;!-2-8&#9'8=!;38@TǣW3£38!&3336'8!ধ='
-9,!2&-£&£-(''9'!8$,2-;TǤW,'29ধ;<;'(38-8&36<£!ধ329
ID t
ABSTRACT
t
Table of Contents
and transients, in the absence of recaptures of individuals at
multiple sites. The MSORD-SU also allows us to estimate the
proportion of individuals that reside in the study area relative
to the total number of individuals that use the area (residents
+ transients), which is a useful metric for determining the
ecological importance or conservation value of an area.
r=-=-!2!W8<-A|81#3W38+
Patterns of movement in wildlife populations make up the core
foundation of much of our current ecological knowledge. Direct
measures of movement can be made using marked individuals,
but this requires a spatial allocation of capture effort that is not
feasible for most studies. We demonstrate how movements
can be monitored indirectly by accounting for permanent
and temporary emigration, as well as transience. We apply a
multistate open robust design with state uncertainty model
(MSORD-SU) to account and estimate transience, to infer
movement patterns of overwintering migrants. We applied the
MSORD-SU to eight species of Neotropical migrants, using
a data set of captures from 14 countries collected in 20022XUUHVXOWVLGHQWLĆHGRYHUZLQWHULQJPRYHPHQWSDWWHUQV
which were largely independent of prior categorization of
territoriality for each species. The timing of when transients
enter a site varied widely between species, and did not
correlate with when residents entered a site. Residents of all
species were likely to enter a site early in the season, but on
average, individuals did not remain at sites for the full duration
of the overwintering period. The MSORD-SU model is a useful
tool to correct for and estimate dynamics of both residents
!+'£S8!¡8'9'2;!ࣅ329
275 Aportes de la avifauna a la ordenación forestal
en el Departamento del Tolima (Colombia)
Miguel Angel Quimbayo1*, Hugo Nelson Loaiza1
ǢW2-='89-&!&'&33£-1!
r1-+<'£7|<;W'&<W$3
Este estudio fue realizado en bosques naturales del
departamento del Tolima para el desarrollo del Plan General
de Ordenación Forestal. Se muestrearon seis tipos de bosque:
húmedo tropical (bh-T), muy húmedo montano bajo (bmhMB), muy húmedo montano (bmh-M), húmedo montano bajo
(bh-MB), húmedo premontano (bh-PM) y seco tropical (bsT), distribuidos en ocho Unidades de Ordenación Forestal
82)LGHQWLĆFDGDVSDUDGHWHUPLQDUVXXVRFRPR£UHDVGH
protección o de producción. La avifauna fue muestreada
mediante conteo por puntos y capturas con redes de niebla.
Se registraron 317 especies (59 familias y 19 órdenes). Las
familias más representativas fueron Tyrannidae (17,03%),
Thraupidae (11,99%) y Trochilidae (10,09%). Se registraron
cuatro especies endémicas, seis de gran tamaño y amplio
rango de distribución, dos migratorias y cuatro en categorías
de riesgo según la IUCN. En UOF I 154 especies (115 en bs-T
{փdփTT
ID t
ABSTRACT
t
y 125 en bhT), En UOF II 158 especies (94 en bmh-MB, 53
en bmh-M y 69 en bh-MB), en UOF III 51 especies solo en
bmh-M, en UOF IV 97 especies solo en bs-T, en UOF V 63
especies solo en bmh-M, en UOF VI 113 especies (106 en
bh-MB) y 47 en bmh-MB), en UOF VII 139 especies (101 en
bmh-MB, 37 en bh-PM y 57 en bs-T) y en UOF VIII 99 especies
VRORHQEK0%)LQDOPHQWHQRVHLGHQWLĆFDURQ£UHDVSDUD
SURGXFFLµQIRUHVWDO\VLVHLGHQWLĆFDURQ£UHDVIRUHVWDOHVGH
protección para preservación y para uso sostenible en las
cuales se plantean actividades como investigación, vedas y
prohibiciones, monitoreo, educación y sensibilización ambiental.
279 Estrategias para incrementar la funcionalidad de las aves
en la restauración ecológica del bosque sub-andino
Nestor Peralta-Zapata
2-='89-&!&!$-32!£&'3£31#-!f
<2&!$-32!;<8!
2'9;386'8!|+1!-£W$31
El establecimiento de plantas dispersadas por aves bajo perchas
DUWLĆFLDOHVHVXQSURFHVRSRFRHVWXGLDGRHQHO1HRWUµSLFR
que podría usarse como herramienta en la recuperación de
hábitats o en la restauración ecológica. Se puso a prueba, si
en pastizales cercanos a bosques sub-andinos la regulación
del microclima del suelo (con vegetación pionera), el control
GHODKHUELYRU¯DODGLVSRVLFLµQHVSDFLDOGHSHUFKDVDUWLĆFLDOHV
y la cantidad de cobertura vegetal cerca a estas estructuras
afecta el establecimiento de plantas dispersadas por aves. Se
instalaron 40 perchas, que se distribuyeron en dos tipos de
disposición espacial, a los cuales se les aplicaron diferentes
tratamientos. Bajo las perchas se registró el establecimiento
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
de 440 individuos de 22 especies de plantas dispersadas por
aves. Entre las plantas mas abundantes se encuentran Viburnum
triphyllum y Bocconia frutescens. Por su parte se registraron
cerca de 75 individuos de 22 especies de aves visitando las
SHUFKDVDUWLĆFLDOHVCrotophaga ani y Tangara vitrolina fueron
las especies dispersoras que más visitaron las perchas. Hubo
una gran variación en el número de individuos y de especies
de plantas establecidas en los diferentes tratamientos; sin
embargo áreas con cobertura vegetal cerca y con perchas
agrupadas tienden a incrementar la cantidad de especies de
plantas que se establecen y de aves que visitan las perchas.
(QFRQFOXVLµQODVSHUFKDVDUWLĆFLDOHVSXHGHQDXPHQWDUOD
cantidad de plantas nativas de consumo para las aves en la
zona de estudio, sin embargo falta por explorar metodologías
P£VHĆFLHQWHVSDUDRSWLPL]DUODIXQFLµQHFROµJLFDGHOD
dispersión en los procesos de restauración ecológica.
282 $UHUHVSRQVHVWRKHWHURVSHFLĆFPREELQJFDOOV
learned or innate in Neotropical birds?
Luis Sandoval1*, Dave Wilson2
ǢW2-='89-&!&&'39;!-$!TǣW'138-!£2-='89-;@3('>(3<2&£!2&
r#-39!2&3=!£|,3;1!-£W$31
Many birds produce conspicuous mobbing calls that cause
FRQVSHFLĆFDQGVRPHWLPHVKHWHURVSHFLĆFELUGVWRDSSURDFK
and harass the predator. How and why birds respond to the
mobbing calls of other species remains unclear. One possibility
LVWKDWELUGVOHDUQWRDVVRFLDWHKHWHURVSHFLĆFPREELQJFDOOV
with shared predators. Another is that mobbing calls of
{փdփTT
ID t
ABSTRACT
t
ID t
multiple species share structural features that universally
UHćHFWSHUFHLYHGWKUHDWRUIHDU,QWKLVVWXG\ZHH[DPLQHGWKH
mobbing responses of Neotropical birds to the mobbing calls
of Black-capped Chickadees (Poecile atricapillus), which are not
found in the tropics. We broadcast chickadee mobbing calls at
6 locations: 2 in Costa Rica, 2 in Colombia, and 2 in Brazil. At
each location, we also broadcast two controls: the chickadee
“fee bee” song and silence of equal duration. Playbacks were
conducted during the temperate breeding season to ensure
that responses were not obscured by migrants that were
potentially familiar with chickadee vocalizations. For each
WULDOZHTXDQWLĆHGWKHVWUHQJWKRIWKHKHWHURVSHFLĆFPREELQJ
response as the number of species and individuals that
approached the loudspeaker, the closest approach by any bird,
DQGWKHWLPHUHTXLUHGIRUWKHĆUVWELUGWRDSSURDFKWRZLWKLQ
5 m of the loudspeaker. Mobbing responses were strong in
response to mobbing calls and weak in response to songs and
silence. Responses also diminished as the distance between
the chickadee distribution and the playback site increased. Our
VWXG\VKRZVWKDWOHDUQLQJFDQQRWIXOO\H[SODLQKHWHURVSHFLĆF
mobbing responses, and that structural features distinguishing
mobbing calls from other types of vocalizations are important.
287 Principais dialetos de curió (Sporophila angolensis,
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
Passeriforme: Emberizidae) cultivados no Brasil
e suas implicações na conservação a espécie
James Leão Araujo
29ধ;<;3!$-32!£&''97<-99&!1!AÖ2-!c
/!1'9W£'!3|-26!W+3=W#8
Típica da América do Sul o S. angolensis é uma ave utilizada como
“pet” possuindo centenas variações vocais entre populações.
A partir de 1970 dialetos extintos foram vetorizados em
FDWLYHLURHDWXDOPHQWHFULDGRUHVDOHJDPWHUUD©DVHVSHF¯ĆFDV
para cada dialeto. Neste estudo analisaram-se os sete dialetos
mais cultivados no Brasil, observando-se os cantos (notas) a
quantidade, frequência e tempo. Propõe-se a discussão sobre
a relação melhoramento e variabilidade. Os harmônicos foram
extraídos do CD de áudio “50 anos de curió”, para o formato
wav 44,1 KHz-16 bits (mono), com o Nero Wave Editor v10, os
espectrogramas obtidos com o Avisoft v5.2.09, tiveram cantos
numerados sequencialmente e na reincidência assinalou-se
A, B e C a cada número. As vocalizações apresentam de 7 a
15 tipos de notas divididas em módulos de entrada (3 a 12
notas), de repetição (5 a 14 notas) e de fechamento (5 a 12
notas). A espécie possui cantos agudos decrescentes entre 3
a 6 KHz e 0,18s a 0,64s em média. Os dialetos Praia Grande,
Paracambi, Goiana e Vô-vô-viu se afastam do padrão silvestre,
devido a provável retirada de trinados e cantos inatos. A busca
por raças mais alinhadas aos fenótipos pretendidos, através
de cruzamentos endogâmicos, teve como consequência a
redução da variabilidade genética da espécie (COUTO et al.
2012) que sob o ponto de vista da conservação dos recursos
{փdփTT
ID t
ABSTRACT
t
genéticos inviabiliza o uso de aves oriundas desta modalidade
de criação em programas de reintrodução na natureza.
296 Cambios poblacionales de las aves que usan el paso
portachuelo, Parque Nacional Henri Pittier, Venezuela
Miguel Lentino
<2&!$-Õ2-££-!1,'£69c3$-'&!&<&<#32&''2'A<'£!
1-+<'££'2ধ23|(<2&!$-32>,6,'£69W38+
El mantener en una región censos anuales por un largo periodo
de tiempo, permite detectar cambios en las poblaciones, y
es más importante en zonas que son sitios de paso en que la
diversidad y abundancia de aves puede ser explosiva por cortos
períodos de tiempo y que además ser indicadores de la calidad
ambiental. El paso de Portachuelo, es uno de estos sitios en que
pasan miles de aves durante la migración de otoño. Durante los
últimos 25 años se ha registrado a 330 especies que han usado
dicho paso, 53 son migratorias de Norteamérica. Entre 1991VHWUDEDMDURQKRUDVUHG\FDSWXUDURQ
aves. El número total de aves capturadas en ese período declinó
GHDYHVKRUDUHGDHQ/DVHVSHFLHVPLJUDWRULDV
GHFOLQDURQGHDYHVKRUDUHGHQDHQ(O
número de especies que usan el Paso se redujo a 201 al eliminar
las ocasionales. Al comparar los periodos 1991-1995 vs 20102014, se encontró que la comunidad de aves que utilizan el paso
ha cambiado en un 18%. En los últimos cinco años han dejado
de usar el Paso, especies de selva nublada (Haplospiza rustica,
Pipreola aureopectus, Contopus fumigatus, Chlorostilbon alice) y
aumentaron las especies de zonas bajas (Basileuterus culicivorus,
Microcerculus marginatus, Hylophilus aurantiifrons, Basileuterus
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
ćDYHROXV). algunas especies de migratorios han dejado de
ser capturadas en los últimos 5 años (Setophaga castanea y
Vermivora chrysoptera), otras han disminuido su abundancia
(Setophaga striata y Catharus minimus). Los datos indican que
hay una reducción en la abundancia y diversidad de aves.
298 Diversidade Genética da população de Antilophia bokermanni
(Coelho & Silva, 1998) sugere redução populacional histórica
Leilton Luna1*, Thainara Souza1, Weber Silva2, Juliana Araripe1,
Iracilda Sampaio1, Horacio Schneider1, Péricles Sena Rêgo1
ǢW2-='89-&!&'
'&'8!£&3!8ÆTǣW993$-!%È3&''97<-9!'
8'9'8=!%È3&'$399-9;'1!97<Æধ$39
*[email protected]
Antilophia bokermanni é uma ave pertencente ao grupo
dos “manakins” que se encontra criticamente ameaçada de
extinção, sendo endêmica do Estado do Ceará, nordeste do
Brasil. Esta espécie vem sofrendo ameaças à sua perpetuação,
principalmente pela fragmentação e descaracterização do
seu habitat. Este estudo utilizou técnicas de sequenciamento
de regiões do genoma mitocondrial (Região controle e
ND3) para 35 indivíduos, através de métodos de coletas
não invasiva, para avaliar a diversidade genética e aspectos
GHPRJU£ĆFRVGHVWDDYH)RUDPHQFRQWUDGRVPRGHUDGRV
níveis de diversidade genética para os marcadores
avaliados, estando esta distribuída de forma homogênea
ao longo da distribuição da população, refutando processo
de subestruturação dentro da área ocorrência. Os dados
WDPE«PHYLGHQFLDUDPXPSURY£YHOGHFO¯QLRGHPRJU£ĆFR
histórico, em dois distintos períodos, há 40.000 anos, que
{փdփTT
ID t
ABSTRACT
t
compreende o Pleistoceno Tardio e um segundo ponto de
LQćH[¥RK£DSUR[LPDGDPHQWHDQRVDWU£VVHQGRHVWH
FRUUHVSRQGHQGRDR0£[LPD*ODFLDO7DUGLR,GHQWLĆFDPRVXPD
tendência histórica de redução do Nef do A. bokermanni, onde
os níveis de diversidade genética aqui apresentados indicam
que esta ave não encarou drásticas reduções populacionais,
mas sim, vem passando por uma tendência ao decaimento
constante desde sua provável fundação. Portanto, não
somente as pressões antrópicas e ambientais atuais podem
ter levado à sua redução populacional, mas provavelmente a
atual diversidade genética observada nesta população deve
VHUUHćH[RGHSUHVV·HVDPELHQWDLVHFOLP£WLFDVSDVVDGDV
303 Soundscapes and acoustic activity of the avifauna of
Amarakaeri Comunal Reserve, Madre de Dios, Peru
Marconi Campos Cerqueira1*, Andres Hernandez1,
T. Mitchell Aide1, Jessica L. Deichmann2
ǢW2-='89-;@3(<'8;3-$3TǣW'2;'8(38329'8=!ধ32&<$!ধ32
!2&<9;!-2!#-£-;@T1-;,932-!2329'8=!ধ32-3£3+@29ধ;<;'
ID t
ABSTRACT
t
Table of Contents
from a natural gas exploration platform, and approximately
1,500 1-minute recordings were collected from each site in
2FWREHU:HGHYHORSHGVSHFLHVVSHFLĆFPRGHOVIRU
the six bird species. The model accuracy was >60% for all
species. The models were then applied to all recordings from
DOOVLWHVWRGHWHUPLQHSUHVHQFHDEVHQFHDQGDFWLYLW\SDWWHUQV
of six species of birds. Two species, Myrmeciza hemimelaenea
and Thamnophilus schistaceus, were detected in all sites,
whereas +\SRFQHPLVVXEćDYD and Myrmoborus leucophrys were
detected in nine and seven sites respectively. In contrast,
Percnostola lophotes and Myiothlypis bivittata were detected
LQRQO\ĆYHVLWHV$OOELUGVSHFLHVKDGDSHDNRIDFWLYLW\DW
AM. The soundscape analysis was used to determine the
GHJUHHRIVLPLODULW\DQGELUGGLYHUVLW\FRPSRVLWLRQLQWKH
PRUQLQJFKRUXVDPDPRQJWKHVLWHV7KHLGHQWLĆFDWLRQ
of the bird species whose songs contribute to the activity
peaks in the soundscapes indicates that areas within ~250 m
of the platform exhibit lower bird diversity and lower vocal
activity relative to sites >250 meters from the platform.
r1!8$32-W$!1639W$'87<'-8!|+1!-£W$31
Acoustic monitoring is an excellent way to survey many sites
simultaneously, but it continues to be a challenge to extract
GHWDLOHGSUHVHQFHDEVHQFHGDWDIRUPXOWLSOHVSHFLHVRUWR
GHYHORSDELRGLYHUVLW\PHDVXUHPHQWWKDWUHćHFWVWKHRYHUDOO
GLYHUVLW\RIPDQ\VLWHV7KLVVWXG\SUHVHQWVVSHFLHVVSHFLĆF
analyses for six bird species along with soundscape analyses
for 10 sites in the Amarakaeri Communal Reserve using the
ARBIMON II web application. Two portable recorders were
SODFHGDWĆYHGLVWDQFHVDQGP
!+'S8!¡8'9'2;!ࣅ329
304 Abundance patterns of endemic forest
birds in a neotropical savanna
Luane Santos1*, Miguel Ângelo Marini1
ǢW2-='89-&!&'&'8!9Ð£-!
r9!2;39W£<!2'|+1!-£W$31
ORAL PRESENTATION SESSION 16: CONSERVATION AND DISTRIBUTION
Local abundance patterns are recognized into species range
(geographic distribution area). In order, to understand species
abundance patterns is important to assess the relationship with
{փdփTT
ID t
ABSTRACT
t
ID t
climatic and habitat factors. Here we used GLMs with Poisson
distribution to assess hypotheses on bird species abundance
across the geographic distribution: centroid-periphery and
habitat suitability, and to local variables - forest amount and
forest cover (NDVI, Normalized Difference Vegetation Index,
NPEXIIHUDURXQGVXUYH\SRLQWV:HH[SHFWHGWRĆQGD
negative relationship between species abundance and the
distance to the distribution centroid and a positive relationship
with forest amount and forest cover. We estimate a suitability
index using bioclimatic variables in MAXENT. We conducted
point-counts (3-5) in 53 independent forest sites across the
Cerrado central region and estimated abundance of three
endemic bird species. The mean abundance was 5.22±0.72
for Antilophia galeata, 2.98±0.88 for Myiothlypis leucophrys and
4.62±0.71 for Herpsilochmus longirostris:HIRXQGVLJQLĆFDQW
relationships only for Myiothlypis leucophrys. The model
including distance to centroid, habitat suitability and forest
amount explained 36% of the abundance variation. Contrary to
our expectations, species abundance decreased with increasing
amount of forest and increased with distance to the distribution
centroid. Regarding habitat suitability the relationship with
species abundance was positive, abundance increased in
more suitable sites. Thus, we found that at least for one bird
species, abundance probably increases towards the periphery
of the distribution in areas of suitable climatic conditions.
305 Ara macao movements and conservation: A
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
comparison of results and implications from point
counts, ARGOS and GIS tracking technologies
Donald J Brightsmith1*, Janice D Boyd1
ǢW'?!9{2-='89-;@
r&#8-+,;91-;,|$=1W;!1<W'&<
Understanding avian movements is key for conservation,
but differing spatial and temporal movement scales force
researchers to face complex trade-offs between location
frequency, location accuracy, and data collection duration.
Nowhere is this clearer than in the study of psittacines where
protective housing greatly increases the weight of tracking
devices. We have been studying Ara macao movements in Peru
using point counts, Argos satellite telemetry, and GPS tracking
for 9 +years. Point counts show high macaw densities from
WKHSUHEUHHGLQJVHDVRQWKURXJKćHGJLQJZLWKERWKPDFDZ
DEXQGDQFHDQGIRRGVXSSOLHVGURSSLQJSRVWćHGJLQJ$UJRV
telemetry shows that 1) most but not all birds leave the area
post breeding, 2) non-breeding ranges averaged 1384 ± 1183
km2 (N = 9 birds) and 3) birds ranged up to 150 km from the
nest. An experimental GPS collar deployed in 2015 gave us 3
weeks of high precision movement data. The bird spent about
half the time within 50 m of the nest and trips >1 km from the
nest were rare (< 2 per day). Despite the reported importance
of clay licks 1) clay licks were visited only 60% of the days during
breeding, 2) visits did not occur immediately before or after
foraging bouts suggesting clays may not be used to protect
from dietary toxins, and 3) licks were rarely visited during the
non-breeding season. Conservation implications from our
{փdփTT
ID t
ABSTRACT
t
data sets are complementary: Argos data suggest that loss of
habitats up to 150 km away could reduce breeding populations
by reducing post breeding survival and GPS data suggest that
conservation of breeding habitat needs to preserve not only
nest trees but also nearby regions of high food plant densities.
307 (IHLWRVGDIUDJPHQWD©¥RćRUHVWDOQRFRPSRUWDPHQWRVRFLDO
de Corapipo gutturalis em uma paisagem da Amazônia Central
Mariana Tolentino1*, Marina Anciães1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!
r1!8-!2!;3£'2ধ23|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
encontramos leques. Machos jovens se mostraram sensíveis
à métrica de leque, sendo mais frequentes em palcos mais
distantes de outros palcos. Já a distribuição de machos
adultos e a taxa de exibição foram explicadas por fatores da
paisagem. Enquanto machos adultos são mais frequentes em
SDOFRVURGHDGRVSRUPDLRUSRUFHQWDJHPGHćRUHVWDSULP£ULD
a taxa de exibição foi menor em palcos mais próximos a
borda. C. gutturalis, apesar de comum na paisagem, apresenta
PXGDQ©DVFRPSRUWDPHQWDLVGHYLGR¢IUDJPHQWD©¥RćRUHVWDO
que ao longo do tempo pode afetar aspectos populacionais
por mudanças em padrões de movimentação e acasalamento,
o que poderia afetar a viabilidade destas populações.
&RPRHIHLWRGDIUDJPHQWD©¥RćRUHVWDOREVHUYDPVH
principalmente alterações na riqueza e abundância de
espécies. Entretanto, poucos estudos avaliaram efeitos da
fragmentação no comportamento das espécies. Testamos se
o comportamento social de Corapipo gutturalis (Ave-Pipridae),
espécie de sub-bosque com sistema de leque, apresenta
variações em resposta a variações ambientais em uma
paisagem fragmentada da Amazônia Central. Capturamos,
anilhamos e observamos indivíduos da espécie em seus palcos
nos leques em 11 áreas: quatro de fragmentos de 1, três
GHGRLVGHKDHGRLVSORWHVGHKDHPćRUHVWDV
contínuas . Registramos o número de machos jovens e adultos,
e suas taxas de exibição. Testamos o efeito de métricas de
paisagem (distância do palco até a borda mais próxima e
SRUFHQWDJHPGHćRUHVWDSULP£ULDHPXPUDLRGHPH
métricas de leque (distância do palco ao palco e leque mais
próximo), utilizando GLM e comparações de modelos com
verossimilhança. Em fragmentos menores que 10 ha não
!+'S8!¡8'9'2;!ࣅ329
315 Multiple lineages and cryptic diversity in the
Automolus infuscatus complex (Aves:Furnariidae)
Eduardo D. Schultz1*, Camila C. Ribas1
1. 29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!
r'&9#-3|+1!-£W$31
ORAL PRESENTATION SESSION 9: BIOGEOGRAPHY
& PHYLOGEOGRAPHY
Although the Neotropical region harbors more avian species
than any other on Earth, the knowledge of this diversity is still
incipient. Poor taxonomic knowledge leads to underestimating
the number of species and misinterpretation of evolutionary
and biogeographic processes. Examples of this problem are
the species in the genus Automolus, endemic to the Neotropics
and morphologically very similar. Recent studies indicate the
polyphyly of A. infuscatus. However, the lack of a broad sampling
left gaps in the understanding of how many lineages there
are and what are the limits of their distributions. Thereby we
{փdփTT
ID t
ABSTRACT
t
investigated the phylogenetic relationships among the lineages
included in the A. infuscatus complex and other closely related
lineages and assessed their geographical distribution. For this
we broadly sampled nuclear and mitochondrial markers for
the known distribution of each lineage of the complex. Our
results corroborate the non-monophyly of A. infuscatus and
indicate the validation of some of the subspecies described
in the literature, with new insights on their distribution limits.
The remaining species of the complex, A. ochrolaemus, A.
subulatus, A. paraensis, A. leucophtalmus and A. lammi were
PRQRSK\OHWLFLQRXUDQDO\VLV6WLOODGGLWLRQDOLQWUDVSHFLĆF
VXEOLQHDJHVZHUHLGHQWLĆHGVHSDUDWHGE\GLIIHUHQWJHRJUDSKLF
barriers, already known for other bird lineages. The future
comparison of the divergences of different lineages, allied to
GHPRJUDSKLFDQDO\VLVZLOODOORZXVWRHYDOXDWHWKHLQćXHQFH
RIWKHPDLQELRJHRJUDSKLFHYHQWVRQWKHGLYHUVLĆFDWLRQ
of the clade, with implications for the comprehension of
the evolution of the Neotropical forest landscapes.
319 How much does vegetation matter? The importance
of environmental variables for the distribution
of Anopetia gounellei (Aves: Trochilidae)
Erica C. Nolasco1*, Thiago Moura2
ǢW39;+8!&<!;'83+8!132!8;,$-'2$'9!2&2=-8321'2;!£
3&'£-2+f2-='89-&!&'9;!&<!£&'
'-8!&'!2;!2!TǣW 33£3+@
39;+8!&<!;'83+8!1f2-='89-&!&'9;!&<!£&'
'-8!&'!2;!2!
ID t
ABSTRACT
t
Table of Contents
closely relation with dry climates and vegetations, but no
one knows the contributions of them to the species habitat
suitability. To address the issue, we tested the importance of
bioclimatic (temperature, precipitation, evapotranspiration
and elevation) and vegetational variables on a species
GLVWULEXWLRQPRGHOLQJ6'0ĆWWHGIRUb$bJRXQHOOHL. We
run six SDM algorithms and selected for analysis only the
algorithms that performed excellent. We evaluated the
variables importance based on 50 randomizations of each
variable. The climatic variables was the major contributors for
WKHb$bJRXQHOOHLbGLVWULEXWLRQKRZHYHUWKHDUERUHDOFDDWLQJD
vegetation has contributed as much as the temperature
range. Climate is a major driver of species distribution on large
VFDOHVSOD\LQJYHJHWDWLRQDQLPSRUWDQWUROHLQĆQHUJUDLQV
While climate limits the distribution, vegetation constrain
WKHVSHFLHVWRVSHFLĆFDUHDVLQVLGHWKHVHOLPLWV:HIRXQGWKH
VDPHSDWWHUQIRUb$bJRXQHOOHLbGLVWULEXWLRQZKHUHYHJHWDWLRQ
with arboreal structure provide a suitable environment
DQGFRXOGEHDUHćHFWLRQRIELRORJLFDOLQWHUDFWLRQDVIRRG
resources. In the opposite direction, the absence of arboreal
structure could be a dispersion barrier, avoiding populations
FRQWDFWDQGJHQHWLFćRZDVZHOODVDWUHDWWRWKHVSHFLHV
Despite of the great climate contribution, natural vegetation
UHYHDOHGWROLPLWb$bJRXQHOOHLbGLVWULEXWLRQDQGWRFRQWULEXWHWR
the species habitat suitability, a concerning issue on caatinga
region that has 50% of the native vegetation deforested.
r'$23£!9$3|+1!-£W$31
$QRSHWLDbJRXQHOOHLbLVDbVWLObSRRUO\NQRZQKXPPLQJELUGPDLQO\
registered inside the caatinga region; apparently it has a
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
324 Avaliação preditiva de perda de habitat potencial para
$YHVQDUHJL¥RGHLQćX¬QFLDGDURGRYLD%5
Marcelo A. dos Santos Junior1*, Paulo M. de A. Graça1, Vinícius
M. Rocha1, Marina Anciães1, Mario Cohn-Haft1, Fernando H.
T. de Abreu1, Juliana da S. Menger2, André P. Antunes1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!fT
ǣW'£1,3£;A'2;8'(382=-8321'2;!£'9'!8$,f
r1!9/8|-26!W+3=W#8
ID t
ABSTRACT
t
Table of Contents
no desmatamento foi de 5%, e no “com estrada” foi de 11%.
Segundo essas estimativas, até 2012, as espécies perderam
4% do seu habitat potencial original, enquanto que em 2030, a
perda seria de até 8,1% no cenário “sem estrada”, chegando até
16,3% no “com estrada”. Regiões de alta riqueza de espécies
estão localizadas onde atualmente há maior grau de ameaça
e são as mais afetadas pelo desmatamento previsto para
2030 sendo que 36% delas estão fora das áreas protegidas.
A destruição dos habitats, principalmente pelo desmatamento,
é a principal ameaça para espécies na Amazônia. A proposta
de reconstrução da rodovia BR-319, abandonada desde
DPHD©DDELRGLYHUVLGDGHORFDOQRLQWHUć¼YLR0DGHLUD
Purus. Simulamos o desmatamento até 2030 para a região da
BR-319 com software Dinamica-EGO. Desenvolvemos dois
cenários: “sem estrada” que não considera a reconstrução da
BR-319 e “com estrada” prevendo sua reconstrução em 2015.
Modelamos a adequabilidade de habitat para 42 espécies de
Aves usando o software Maxent. Derivamos suas distribuições
potenciais e criamos um mapa de diversidade alfa com o
somatório destas. Validamos os modelos de desmatamento
FRPXPDPRGLĆFD©¥RGRWHVWH)X]]\HRVPRGHORVGHQLFKR
usando a curva ROC. Usamos as estimativas do desmatamento
acumulado até 2012 (PRODES) e as das simulações para avaliar
DHYROX©¥RGDSHUGDGHćRUHVWD8WLOL]DPRVHVWDVHVWLPDWLYDV
também, para calcular a perda de habitat por espécie e avaliar
a diversidade alfa nas áreas afetadas pelo desmatamento.
Comparamos ainda a contribuição das áreas protegidas na
GLYHUVLGDGHDOID$£UHDGHVPDWDGDDW«IRLGH$RĆQDO
da simulação de 20 anos, no cenário “sem estrada”, o aumento
!+'¢S8!¡8'9'2;!ࣅ329
327 Depredación de aves de corral por Spizaetus isidori
(Accipitridae), una aproximación desde el estudio de
sus hábitos de forrajeo y la dimensión humana
Santiago Zuluaga1*, Maria Ãngela Echeverry-Galvis2
ǢW83@'$;3+<-£!8'9;!&!TǣW32ধ)$-!2-='89-&!&!='8-!2!
rA<£<!+!8!6!$'9|+1!-£W$31
El conocimiento de la dieta de Spizaetus isidori es escaso, se
considera que se alimenta principalmente de aves y mamíferos
silvestres, y aves de corral (Gallus gallus). Históricamente
ODGHSUHGDFLµQGHDYHVGHFRUUDOKDJHQHUDGRXQFRQćLFWR
entre la especie y las comunidades humanas en algunas zonas
de Colombia. Este estudio evaluó los hábitos de forrajeo, la
percepción del impacto económico generado por depredación
de aves de corral y la aceptación de las comunidades humanas
hacía el águila. Los hábitos de forrajeo se evaluaron durante
660 horas de observación directa, en dos nido de la especie,
y se registraron datos de ocurrencia y biomasa de las presas.
Se realizaron entrevistas, teniendo como grupo objetivo
18 comunidades campesinas (2.706 habitantes) asentadas
{փdփTT
ID t
ABSTRACT
t
ID t
alrededor del corredor biológico “Farallones de Gachalá
y Medina” departamento de Cundinamarcá, Colombia.
Dentro de las presas aportados por los adultos se registraron
43 ítems presa, distribuidos en 6 taxa. Gallus gallus fue la
especie más importante en términos de biomasa consumida
y Sciurus granatensis en términos de ocurrencia. Se obtuvo
niveles bajos de tolerancia en la competencia por espacio
y alimento. La mayor parte de los entrevistados (54,7%)
considera que el impacto de la pérdida de Gallus gallus, a
causa de Spizaetus isidori, puede hacer que una familia pierda
parte o toda su base económica. El 57% de los entrevistados
manifestó haber tenido pérdidas, con un promedio de 1,3
DYHVD³RYDORUPRQHWDULRHQWUH86(VWHHVWXGLR
describe la situación de la especie desde un enfoque
ecológico y etno-ecológico, permitiendo planear medidas
de conservación que integren las comunidades rurales.
331 Fatores históricos, espaciais e ecológicos
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
determinantes da composição das comunidades de
DYHVćRUHVWDLVGR5LR0DGHLUD3RUWR9HOKR52
Cassiano A.F.R. Gatto1*, Roberta Lúcia Boss2, Mônica Sberze2,
Marconi C. Cerqueira3, João Vitor Silva4, Bruno de Freitas
Xavier5, Luiza Magalli Pinto Henriques1, Marina Anciães2
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW!#38!;Õ8-3&'=3£<%È3'
31638;!1'2;32-1!£fTǤW2-='89-;@3(<'8;3-$3cfTǥW
f$3£3+-!f
cfTǦWf 33£3+-!f
cf
r$!99-!23+!ħ3|+1!-£W$31
3DUDLQYHVWLJDUDLQćX¬QFLDGHIDWRUHVKLVWµULFRVHHFROµJLFRV
na estruturação de comunidades da avifauna do Rio Madeira,
Porto Velho (RO), amostramos 7 módulos PPBio nas duas
margens, em seis expedições (2009-2011). Foram registradas
520 espécies, das quais 386 em censos pontuais (182 pontos;
6.364 indivíduos) e 176 em redes de neblina (17.328 horasrede; 3.379 indivíduos). O Rio Madeira é o principal fator
estruturante, por estabelecer limites de distribuição e segregar
alo-espécies. Apesar de similares em riqueza e abundância,
comunidades em margens opostas apresentam distintas taxas
de captura e detecção de espécies entre as margens para
vários táxons. Na escala regional, encontramos diferenças nas
abundâncias proporcionais de táxons, tanto dominantes quanto
raros, entre margens e módulos (NMDS). ANOVA mistas
GHWHFWDUDPHVSHFLDOLVWDVHPWHUUDĆUPHHDPELHQWHVDODJ£YHLV
DOJXQVGHY£U]HDVRXWURVGHEDL[LRVćRUHVWDLV5HVXOWDGRVHP
geral, foram convergentes e co-variaram sempre em níveis
KLHU£UTXLFRVHVWDEHOHFLGRVLGHQWLĆFDQGRHIHLWRGR5LR0DGHLUD
{փdփTT
ID t
ABSTRACT
t
FRPREDUUHLUDGLVW¤QFLDJHRJU£ĆFDHQWUHPµGXORVHQ¯YHOGH
alteração antrópica como principais fatores estruturantes.
A estrutura da vegetação não foi diretamente relacionada à
abundância de espécies, mas módulos entre margens diferiram
em tamanho e número de árvores, palmeiras e cipós em
três eixos ambientais (PCA), o que demonstra uma provável
LQWHUD©¥RHQWUHDVSHFWRVKLVWµULFRJHRJU£ĆFRVHIDWRUHV
ORFDLVQDHVWUXWXUD©¥RGDVFRPXQLGDGHVGHDYHVćRUHVWDLV
333 What do we know about the rare and Critically
(QGDQJHUHG%ODFNEUHDVWHG3XIćHJEriocnemis nigrivestis
Esteban A. Guevara1*, Elisa Bonaccorso2, Joost F.
Duivenvoorden3, Tatiana Santander G.1
ǢW='9@329'8=!$-Õ2c-8&-('-2$<!&38TǣW'2;83&'2='9ধ+!$-Õ2'2
-3&-='89-&!&@!1#-3£-1Æধ$3T2-='89-&!&'$23£Õ+-$!2&3!1Ì8-$!TǤW
29ধ;<;'(38-3&-='89-;@!2&$39@9;'1@2!1-$9T2-='89-;'-;=!219;'8&!1
ID t
ABSTRACT
t
Table of Contents
each plot using GIS tools. We modeled BBP presence as
a function of microhabitat variables (summarized as PC1
in Principal Component Analysis) and distance to nearest
forest border applying Generalized Linear Mixed Models. In
addition non-metric multidimensional scaling (NMDS) was
employed to characterize hummingbird communities. Our
results suggest that landscape variables play a role in habitat
VHOHFWLRQVSHFLĆFDOO\WKHGLVWDQFHWRQHDUHVWIRUHVWERUGHU
KDGDVLJQLĆFDQWHIIHFWRQRXUKDELWDWPRGHO%%3SUHVHQFH
probability increased with distance to forest borders. On
the other hand NMDS indicates that BBP and the GS do not
overlap spatially. We speculate that, as the species performs
seasonal movements, the avoidance of forest borders
might reduce the physiological stress caused by altitudinal
PLJUDWLRQ2XUĆQGLQJVVXJJHVWWKDWHQVXULQJIRUHVWWUDFW
connectivity, between the altitudinal extremes of the species’
range might be crucial for survival during its annual cycle.
r'+<'=!8!|!='9$329'8=!$-32W38+
7KH%ODFNEUHDVWHG3XIćHJ%%3Eriocnemis nigrivestis is a
Critically Endangered hummingbird endemic to northwestern
high-Andean forests of Ecuador. We investigated habitat
use patterns using landscape and microhabitat information.
In addition, we explored competition hypothesis concerning
%ODFNEUHDVWHG3XIćHJDQG*RUJHWHG6XQDQJHO*6Heliangelus
strophianus. We censused hummingbirds along four 1,2 km
transects during 2007-2011 period. BBP feeding territories
(N=19) and a set of random absence points (N=31) were
mapped for further habitat measurement. Microhabitat
structure at 12,5 m radius circular plots were taken, and
the distance to nearest forest border was estimated for
!+'£S8!¡8'9'2;!ࣅ329
337 Avian diversity and composition in native
and afforested environments in the Northern
Campos Grasslands of Uruguay
Juan A. Martínez-Lanfranco1*, Francisco J. Vilella2, Darren A. Miller3
ǢW'6!8;1'2;3(-£&£-('T
-9,'8-'9!2&7<!$<£;<8'T-99-99-66-;!;'
2-='89-;@TǣWWW'3£3+-$!£<8='@T336'8!ধ='
-9,!2&-£&£-('
'9'!8$,2-;T'6!8;1'2;3(-£&£-('T
-9,'8-'9!2&7<!$<£;<8'T
-99-99-66-;!;'2-='89-;@TǤW'@'8,!'<9'8316!2@
r/!$3£31£|+1!-£W$31
Pampean grasslands are the most extensive grassland
ecosystem of the Neotropics, where habitat loss and
{փdփTT
ID t
ABSTRACT
t
ID t
degradation has been broad. Large scale commercial forestry
has become common practice. However, bird communities
have not been fully characterized in afforested landscapes in
the Pampas. To better understand avian community response
to afforestation we conducted 1573 bird point counts within
native (grasslands and forests) and afforested habitat types
(pine and eucalyptus) of different ages and management
regimes during the 2013-14 breeding season in northern
Uruguay, on land managed by Weyerhaeuser Co. and other
local companies. We documented 3407 individuals of 112 bird
species and used rarefaction to compare species richness and
evenness, and assessed community structure among habitat
types using multivariate techniques. We found higher species
diversity, and compositional differences, in native habitat
types versus plantations. Avian communities in plantations
were more similar to native forests than to grasslands, with
one exception. Newly planted stands, available to some
grassland facultative birds, were more similar to grasslands
than to older plantations or native forests. As plantations
aged, bird community shifted to forest generalist assemblages.
Plantations of similar age under different thinning practices
had different bird communities but similar richness. As
plantation structure can be manipulated with predicable bird
responses, this information will assist bird conservation in
afforested landscapes. Furthermore, relative value of tree
plantations to bird conservation in grasslands should be
compared to other land uses such as intensive agriculture.
341 Landscape Perception and the Value of
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
Secondary Forests for Atlantic Forest Birds
Cassiano A.F.R. Gatto16RĆD&DPSLROR1
ǢWf 33£3+-!
r$!99-!23+!ħ3|+1!-£W$31
Primary tropical forests are being replaced by degraded stands
of secondary vegetation, while the conservation value of these
secondary forests is controversial. Southern Bahia harbors a
highly endemic and threatened Atlantic Forest bird community,
which is spread over a landscape mosaic of plantations and
anthropogenically impacted forests. To understand the
importance of forest classes for these bird species we extended
DORFDOVFDOHVWUXFWXUHEDVHGIRUHVWFODVVLĆFDWLRQLQWRHDUO\
growth, intermediate growth, and mature forests) to the
regional scale and used GLMM to model the responses of
birds (in terms of relative abundance) for forest types across
multiple spatial scales. Most species exhibit an extra-local
LQćXHQFHRIIRUHVWJUDGLHQWVDQGZKLOHWKHVWUHQJWKRIIRUHVW
W\SHLQćXHQFHYDULHGDFURVVVSDWLDOVFDOHVLWZDVVWURQJHVW
at spatial scales between 500 and 2000m. The distinction
between secondary forest classes allowed the recognition of
birds clearly associated to minimally structured intermediate
growth secondary forests. Secondary forests were important
for some threatened and Atlantic Forest endemics (e.g.,
Amazona rhodocorytha), although sensitive birds were more
often associated with mature forests (e.g., Glaucis dohrnii, in
isolated patches of mature forest). Unexpectedly, endemic and
threatened birds were not markedly distinct in their patterns of
landscape spatial response. Our results suggest that minimally
{փdփTT
ID t
ABSTRACT
t
structured secondary forests have an important present
and future role in regional bird conservation. Nevertheless,
mature forest stands clearly do have a unique bird community
and their role as a biotic repository is not replaceable.
352 Revisão dos itens alimentares das aves do cerrado brasileiro
Sérgio Roberto Posso1*, Wagner de Freitas Pereira1, Rosiani
Ramos Lopes Brinck1, Giovana Russo Bom1, Laila Ottoni1,
Lara Augusto1, Leila S. Belini1, Thais G. Marcon1
ǢW
r9863993|,3;1!-£W$31
Não há uma compilação sobre os itens que compõem a
dieta alimentar das aves do Cerrado em uma única fonte,
QHFHVVLWDQGRVHGHUHSHWLGDVUHYLV·HVELEOLRJU£ĆFDV2
objetivo deste trabalho foi obter uma lista das preferências
alimentares das aves do Cerrado brasileiro por meio de
XPDUHYLV¥RELEOLRJU£ĆFD7DOUHYLV¥RIRLUHDOL]DGDFRPR
auxílio do Google Acadêmico. Uma espécie foi considerada
dentro de uma categoria alimentar desde que a literatura
indicasse tal categoria em pelos menos 75% das citações.
Casos em que esta porcentagem não foi atingida a ave foi
considerada onívora. Das 837 espécies de aves ocorrentes no
Cerrado, 97 não foram encontradas referências de estudos
alimentares e, portanto, carecem de estudo. 310 espécies
foram consideradas insetívoras, sendo 96 não-Passeriformes
(NP) e 214 Passeriformes (P); 81 carnívoras NP e apenas um
Passeriforme (Cyclarhis gujanensis); 138 frugívoras (75NP
e 63P); 147 onívoras (57NP e 90P), 35 nectarívoras NP e
apenas um Passeriforme (&RHUHEDćDYHROD); 23 granívoras
!+'¢S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
(seis NP e 17P) e quatro detritívoras (Cathartidae). Trabalhos
com itens alimentares de aves no Cerrado geralmente
indicam um número maior de espécies insetívoras, devido
à entomofauna rica e abundante disponível para as aves
neste bioma. O alto número de Passeriformes onívoros
indica maior plasticidade de uso de recursos alimentares por
aves desta ordem. Esta lista proporciona uma única base de
consulta que será útil para determinação rápida e segura das
LQWHUD©·HVWUµĆFDVGDDYLIDXQDHPWUDEDOKRVGHHFRORJLD
conservação e manejo dos ecossistemas do Cerrado brasileiro.
353 Acciones de conservación con el águila
harpía (Harpia harpyja) en Panamá
Karla Aparicio Ubillús
+<-£!!86Ð!f!2!1Æ
08£!W!6!8-$-3|+1!-£W$31
El águila harpía (Harpia harpyja), una de las mayores rapaces,
es el ave nacional de la República de Panamá, según la Ley 18
del 10 de abril del 2002. Contamos con el Patronato Amigos
del Águila Harpía, creado en 1999, y en donde participan
entidades, empresas y personas interesadas. Administra el
Centro del Águila Harpía situado en el Parque Municipal
Summit (a 30 minutos de la ciudad), que incluye la jaula más
grande con un ejemplar vivo (“Panamá”, una hembra de 5
años de edad nacida en el Metro Zoo de Miami, USA) y una
exhibición interactiva. En algún domingo del mes de abril,
todos los años celebramos el FestiHarpía, una feria a la que
asisten cerca de 5.000 personas, en donde se educa y muy
cerca de la ciudad. En el campo, en el 2014, y continuando
{փdփTT
ID t
ABSTRACT
t
con el programa “Promoviendo el orgullo darienita sobre el
águila harpía como ave nacional de Panamá” se visitaron 4
comunidades vecinas al Parque Nacional Darién. Cabe resaltar
que en Panamá, el Darién es el área más importante para
águilas harpías, ya que es allí donde se encuentran las mejores
poblaciones y el mejor hábitat. Se realizaron actividades
(charlas, presentación de videos, juegos y obras de teatro con
títeres) con 704 estudiantes. Panamá es el único país que tiene
al águila harpía como ave nacional, tiene la jaula más grande,
cuenta con un Patronato que vela por su conservación y es
donde se realizan los mayores esfuerzos en Centroamérica.
357 Avifauna de importancia para la restauración
ecológica comunitaria en la Laguna de la CochaCuenca Alta de la Amazonía Colombiana
Yuri Rosero1*, CRISTIAN FLOREZ1, Jhon
Calderón1, Ruben Jurado1, Arias Yenni2
ID t
ABSTRACT
t
Table of Contents
alguna categoría de amenaza y 39 especies son migratorias.
A partir del análisis de grupos funcionales y el conocimiento
tradicional de la comunidad, se logró determinar aves de
importancia para dar inicio a estrategias de restauración
ecológica comunitaria con especies de aves que aportan
por su función dentro de los ecosistemas (polinizadores y
dispersores). Dentro de las especies encontradas se destaca
Andigena hypoglauca, Penelope montagnii, Trogon personatus,
Coeligena torquata, Turdus fuscater, Cacicus chrysonotus,
como las especies más abundantes, con una alta vagilidad
y consumidores de gran abundancia de especies vegetales
nativas empleadas para los procesos de restauración
ecológica comunitaria. De igual manera con esta investigación
se reportan 20 especies que aportan a los procesos de
restauración ecológica del bosque alto andino y además se
establece uno de los primeros esquemas de monitoreo con el
establecimiento de perchas para aves y parcelas permanentes.
ǢW93$-!$-Õ2TǣW83+8!1!&'!$-32'92-&!96!8!'£'9!883££3f
r$388'3@<8-ǣǣ|+1!-£W$31
358 Genómica de poblaciones em Cyanocorax yucatanicus
con crianza cooperativa en un gradiente ambiental
Las aves son especies claves y de gran importancia en la
recuperación de los bosques, como un proceso clave en la
dinámica de la vegetación natural y cobertura de vegetación
después la perturbación. En el marco del proyecto Territorios
Sostenibles y Adaptados implementado por la Alcaldía de Pasto
y el Programa de Naciones Unidas para el Desarrollo (PNUD)
se realizaron talleres con la comunidad y salidas de campo para
el levantamiento de la línea base de la avifauna presente en la
Laguna de La Cocha. Se obtuvo un total de 213 especies, 148
géneros y 41 familias de aves. 31 especies se encuentran en
Flavia Termignoni1*, PATRICIA ESCALANTE1, Juan P.
Jaramillo-Correa2, Juan Chable3, ScottV. Edwards4
!+'¢S8!¡8'9'2;!ࣅ329
ǢWfTǣWfTǤWTǥW!8=!8&2-='89-;@
r*!W<!1?|+1!-£W$31
Cyanocorax yucatanicus es endémica de la Península de
Yucatán, México, habita en un gradiente ambiental sin barreras
JHRJU£ĆFDVH[SUHVDXQVLVWHPDVRFLDOFRQFULDQ]DFRRSHUDWLYD
SOXUDO\SUHVHQWDYDULDFLµQJHRJU£ĆFDHQGLPRUĆVPRVH[XDO
{փdփTT
ID t
ABSTRACT
t
ID t
El sistema social con crianza cooperativa en aves sugiere la
presencia de alta estructuración genética, altos niveles de
endogamia y baja heterocigocidad. Para entender si dicha
YDULDFLµQJHRJU£ĆFDVHUHćHMDHQODJHQ«WLFDSREODFLRQDO\HQ
el sistema social, colectamos en toda su distribución durante
dos años (2012-2013), datos en aspectos del sistema social y
su relación con variables ambientales como precipitación y
tipos de vegetación. También realizamos bibliotecas genómicas
(ddRAD-tag) de 61 individuos para realizar el análisis de la
genómica de poblaciones. Los resultados sugieren variación
LQWUDHVSHF¯ĆFDHQORVDVSHFWRVHVWXGLDGRVGHOVLVWHPDVRFLDO
en relación a los tipos de vegetación contrastantes nortesur de la península (GLM mínimo, p=0.000). Sin embargo, la
JHQµPLFDSREODFLRQDOFRQaPDUFDGRUHVSROLPµUĆFRV
(SNPs) en equilíbrio de Hardy-Weinberg, indicaron valores
de diversidad genética y heterocigosis entre 0.05-0.2, niveles
de endogamia de cero y una estructura genética casi ausente
(K=2-3). Cyanocorax yucatanicus apesar de expresar crianza
cooperativa y distribuirse en un gradiente ambiental, podría
emplear otras estrategias sociales (no conciderados en este
HVWXGLRFRPRODGLQ£PLFDVGHIXVLµQĆVLµQTXHSRGU¯DQ
homogenizar la diferenciación genética y eliminan la estructura.
Lo cual podría ser sustancial para evitar consanguineidad
y perdida de diversidad genética en esta especie.
362 Occupancy trends of psittacines in Nicaragua over a 20-
!+'¢S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
year monitoring period and the conservation implications
David Hille1*, David A Wiedenfeld2, Martin LezamaLopez3, Donald J Brightsmith4, Michael A Patten1
ǢW2-='89-;@3(0£!,31!TǣW1'8-$!2-8&329'8=!2$@T
ǤW!93!$-)$3TǥW'?!9{2-='89-;@
r,-££'&!=-&|+1!-£W$31
Biodiversity monitoring is a valuable conservation tool when
assessing potential conservation and management decisions
and can be successfully applied to psittacine conservation.
Psittacines are of worldwide conservation concern and
Nicaragua has a representation that are confronted with similar
conservation problems as are seen throughout the world:
habitat loss and pressures from pet trade. We implemented
a national psittacine monitoring program in Nicaragua,
FRQGXFWLQJVXUYH\VLQDQG
to produce a 20-year data set in order to assess population
trends for the 16 species in Nicaragua. Surveys included up to
313 point counts, which broadly spanned the three ecological
regions of the country. We estimated occupancy rates, using
occupancy modeling, for all 4 survey years and tested for
VLJQLĆFDQWRFFXSDQF\UDWHFKDQJHVEHWZHHQ\HDUVXVLQJ
ANOVA tests. Useful models were produced for 11 of the 16
VSHFLHVDQGVLJQLĆFDQWWUHQGVZHUHGHWHFWHGIRUVSHFLHV
5 increasing and 4 decreasing. Conclusions imply that both
increasing and decreasing population trends are driven by
ODQGXVHODQGFRYHUFKDQJHDVDUHVXOWRIGHIRUHVWDWLRQEXW
there may also be evidence to suggest effects of pressures
of pet trade as well. The results help to establish species-
{փdփTT
ID t
ABSTRACT
t
VSHFLĆFSULRULWLHVLQUHVRXUFHDOORFDWLRQIRUFRQVHUYDWLRQDQG
management action to ensure the conservation of psittacine
diversity in Nicaragua and the whole of Central America.
364 Status of threatened bird species in
Colombia: 13 years of change
Luis Miguel Renjifo1*, Angela María Amaya-Villarreal2
ID t
ABSTRACT
t
Table of Contents
responses to conservation actions. Yet most changes were due
to improvements on knowledge. An increase in total number
of threatened species is due to a combination of description
of new species or taxonomic splits, and to a lesser extent to
species whose population status genuinely declined and are
threatened now. Our results emphasize the importance of
periodic assessments considering the dynamism of threats,
and improvement in knowledge and conservation action.
ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3
r£18'2/-(3|/!='8-!2!W'&<W$3
Extinction risk assessments are fundamental for conservation
planning and practice. Periodic assessments allow detection of
new threats as well as monitoring effectiveness in conservation.
We evaluated extinction risk of bird species in Colombia
following the IUCN system. With this purpose we characterized
species distributions using niche and expert models, and
estimated changes in population sizes and distribution based
on species ecology, threats, rates of habitat loss or gain, and
degree habitat fragmentation. Then we compared changes
for Colombian species in 2002 and 2015. We found that 139
species are currently threatened vs. 112 species in 2002.
Currently, one endemic species is extinct, 15 are critically
threatened (10 endemic), 54 are endangered (21 endemic),
and 70 are vulnerable (22 endemic). In addition 27 are near
WKUHDWHQHGDQGGDWDGHĆFLHQW:HIRXQGLPSRUWDQWFKDQJHV
on species status. A total of 26 species were up listed, 52 down
listed, 77 remained in the same category, and several are new
to the list. Some variations were due to genuine status changes
involving declines and improvements on bird populations
and habitats, including a small number species with positive
!+'¢S8!¡8'9'2;!ࣅ329
365 Testing competing models for differentiation in Mexican
tropical lowland birds: a preliminary assessment
Luis A. Sánchez-González1*, Adolfo G. Navarro-Sigüenza1
ǢW
r£!9+|$-'2$-!9W<2!1W1?
Niche divergence has long attracted interest from evolutionary
ELRORJLVWVGXHWRWKHLUSUREDEOHVLJQLĆFDQWUROHLQVSHFLDWLRQ
Among Mexican tropical lowland birds, a high number of
VSHFLHVDUHGLVWULEXWHGLQERWKWKH*XOIVORSHDQGWKH3DFLĆF
slope, yet the environmental conditions seem to be quite
different: in contrast to tropical evergreen forests and high
KXPLGLW\OHYHOVLQWKH*XOIVORSHWKH3DFLĆFVORSHKDUERUV
highly seasonal dry forests. These differences are also evident
in the phenotype of bird populations in both slopes, which
is translated as subspecies in current taxonomic schemes.
:HKHUHWHVWHGWZRFRPSHWLQJGLYHUVLĆFDWLRQPRGHOVDVDQ
explanation for differentiation of bird populations in both
slopes: a) has this differentiation evolved as a consequence of
vicariant mechanisms?, or, b) is this differentiation the outcome
{փdփTT
ID t
ABSTRACT
t
of a gradient differentiation model, in which bird populations
are differentiated as a consequence of adaptation to different
ecological gradients? Preliminar analyses have suggested
mixed support, thus differentiation may be idiosyncratic.
366 Distribuição e conservação de Cyanocorax hafferi nas
FDPSLQDVGRVLQWHUć¼YLRV0DGHLUD3XUXV7DSDX£
Marcelo A. dos Santos Junior1*, Mario Cohn-Haft1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f
r1!9/8|-26!W+3=W#8
ID t
ABSTRACT
t
Table of Contents
populacional usando a densidade e o habitat disponível (dados
da literatura e DP). A espécie teve sua DP prevista para as
FDPSLQDVHFDPSLQDUDQDVGRHQWRUQRVRPDQGRNPt
As áreas protegidas cobrem 90% da distribuição potencial,
sendo que 59% estão dentro de Unidades de Conservação
(UCs) de Proteção Integral, 24% em Terras Indígenas e
8% em UCs de Uso Sustentável. O modelo populacional
com dados da literatura estimaram 6409 indivíduos e o
feito com a DP estimou 35821 indivíduos. Baseado nesses
resultados os graus de ameaça encontrados para a espécie
foram vulnerável e quase ameaçada, respectivamente.
A destruição dos habitats é a principal ameaça para espécies
na Amazônia. A proposta de reconstrução da rodovia BR-319
(Manaus-Porto Velho), expansão madeireira, da agropecuária
HTXHLPDGDVDPHD©DPDELRGLYHUVLGDGHQRVLQWHUć¼YLRV
formados pelos rios Madeira, Purus e Tapauá. Nas campinas
GHVWHVLQWHUć¼YLRVRFRUUHXPDQRYDHVS«FLHGHJUDOKDUHF«P
descrita e já ameaçada por pressão antrópica, Cyanocorax
hafferi. Utilizamos pontos de ocorrência da espécie e de
ninhos de 17 campinas para modelar adequabilidade de
habitat usando o software Maxent. Utilizamos 40% dos
pontos para validação e derivamos a distribuição potencial
(DP) aplicando um limiar de corte, escolhendo probabilidades
iguais e maiores a 10%. Validamos o modelo de nicho usando
a curva ROC. Usamos as áreas protegidas até 2012 para
avaliar a contribuição proporcional na DP. Adicionalmente,
com dados de 11 bandos, a partir do número de indivíduos
no bando e cálculo da área de vida da espécie obtivemos a
densidade de bandos por área. Avaliamos o grau de ameaça
de acordo com a IUCN, baseado em modelos de tamanho
!+'¢S8!¡8'9'2;!ࣅ329
368 Aspectos de la ecología reproductiva del
chorlito cordillerano (Phegornis mitchellii)
en los andes de Chile Central
Andrea Minoletti1*, Fernando Díaz2, Jim Johnson3,
Andrea Contreras1, Anir Muñoz2
ǢW2-='89-&!&&',-£'T
!$<£;!&&'-'2$-!9
38'9;!£'9@&'£!
329'8=!$-Õ2&'£!!;<8!£'A!W!#38!;38-3&'$3£3+Ð!@-&!
-£='9;8'WTǣW'&&'#9'8=!&38'9&'='9@-&!-£='9;8'&',-£'T
TǤW
-9,!2&-£&£-(''8=-$'T£!90!W2$$,38!+'W!2!&!W
r!2&8'!W1-23£'ষ|+1!-£W$31
El Chorlito Cordillerano (Phegornis mitchellii) es una especie
endémica de los humedales altoandinos, siendo una de las
aves playeras más raras del mundo. Su población estimada es
de <10.000 individuos, y su hábitat se encuentra amenazado
por efectos antropogénicos y climáticos. Nuestro estudio es
el primer esfuerzo para determinar aspectos de la ecología
reproductiva de P. mitchellii, desarrollándose en el Valle
{փdփTT
ID t
ABSTRACT
t
ID t
del Río Yeso (-33,64° S, -69,93° O), Chile central. Entre
2010-2014, hemos marcado individualmente 101 aves,
PRQLWRUHDPRVIDPLOLDV\FODVLĆFDPRVODFREHUWXUDGHO
VXHORSDUDFDUDFWHUL]DUHOVXVWUDWRGRQGHQLGLĆFDODHVSHFLH
Nuestros resultados muestran que la temporada reproductiva
se prolonga desde los meses de septiembre-octubre hasta
abril-mayo. La nidada se compone de 2 huevos, los cuales son
incubados por ambos padres durante un periodo cercano
a los 28 días. El cuidado parental se prolonga por cerca de
45 días, para luego formar una segunda nidada en el mismo
VLWLRGHQLGLĆFDFLµQ/RVDGXOWRVWLHQHQXQDDOWDĆGHOLGDGDO
sitio reproductivo y a la pareja, y encontramos una fuerte
DVRFLDFLµQGHORVVLWLRVGHQLGLĆFDFLµQDORVPDQDQWLDOHV
salobres. Los nidos miden en promedio 9,3 cm de diámetro,
formados sobre reducidos sectores de suelo desnudo, y
se componen de barro, ramas secas y piedras de pequeño
tamaño. Nuestro estudio muestra que P. mitchellii forma varias
nidadas pequeñas durante una temporada reproductiva
relativamente larga, probablemente como una estrategia
para aumentar las posibilidades de reproducción ante las
condiciones climáticas extremas del ambiente altoandino.
369 $Q£OLVHĆORJHRJU£ĆFDLQGLFDXQLGDGHVHYROXWLYDV
!+'¢S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
independentes dentro de Lepidothrix coronata
(Spix, 1825) (Aves, Passeriformes)
Camila Reis1*, Juliana Araripe1, Iracilda Sampaio1, Alexandre
Aleixo1, Péricles Rêgo1, Horacio Schneider1
ǢW<9'<!8!'29'1Ð£-33'£&-c2-='89-&!&'
'&'8!£&3!8Æ
r$!8'-9#-3|+1!-£W$31
& PHYLOGEOGRAPHY
Lepidothrix coronata é uma ave amplamente distribuída pela
região Neotropical, principalmente no bioma amazônico. São
atualmente descritas oito subespécies, possuindo uma alta
complexidade comportamental de coorte, com diferenças
HPGHWHUPLQDGRVJUXSRVJHRJU£ĆFRV7DPE«PSRVVXLXPD
alta variação de plumagem, sendo seu elevado número
de subespécies descrito apenas com base morfológica e
GLVWULEXL©¥RJHRJU£ĆFD2SUHVHQWHWUDEDOKRYLVDDYDOLDURV
SDGU·HVĆORJHRJU£ĆFRVGHL. coronata através de análise
comparativa da coloração da plumagem e análises moleculares
baseadas em sequências de genes mitocondriais (ND2 e
COI) e nucleares (G3PDH e Mioglobina) de 133 exemplares
provenientes de distintos pontos da área de ocorrência
no Brasil. Os resultados preliminares obtidos através de
GLVWLQWDVDQ£OLVHVĆORJHQ«WLFDVDSRQWDPSDUDDH[LVW¬QFLDGH
diferentes populações dentro da espécie, com altos valores
de divergência compatíveis com táxons válidos, chegando
a valores superiores a 3% para o marcador ND2. Também
foram encontrados espécimes de colorações similares em
SRSXOD©·HVJHRJUDĆFDPHQWHGLIHUHQWHVHLQGLY¯GXRVGH
FRORUD©·HVGLVWLQWDVGHQWURGDPHVPD£UHDJHRJU£ĆFD
{փdփTT
ID t
ABSTRACT
t
não corroborando com as subespécies descritas. Além
disso, assim como em estudos prévios, grandes rios deste
bioma devem ter atuado como barreiras que promoveram
DGLYHUVLĆFD©¥RGDHVS«FLH3RUWDQWRVXJHULPRVTXH
existam unidades evolutivas independentes dentro de
L. coronata, podendo esta tratar-se de um complexo de
espécies crípticas que merece revisão taxonômica.
370 Atividades de observação de aves realizadas pela
ID t
ABSTRACT
t
Table of Contents
geral, com 1044 alunos, e 7 para multiplicadores, com 174
professores. Atingiu-se 18 escolas municipais, 1 estadual e
4 particulares. Segundo cálculos da Secretaria Municipal da
Educação potencialmente 12075 alunos receberam o conteúdo
através dos multiplicadores. O sucesso das atividades se
deve a regularidade e capacitação dos técnicos envolvidos.
Ao longo dos anos houve aumento da procura por leigos em
relação aos estudantes, redução do conteúdo acadêmico e
maior investimento no curso voltado para professores.
Prefeitura Municipal de São Paulo (PMSP) - 1996 a 2014
Anelisa Magalhães1*, Maria Vicentim, Marcos Vasconcellos, Crede
Ricardo, Tiago Ostorero, Juliana Summa, Marco Silva, Maria Carvalho
ǢW-=-9È3Ì$2-$!&''&-$-2!';'8-2Æ8-!'!2'/3&!
!<2!-£='9;8'c'6!='fǤ
!2'£-9!1!+!£,!'9|+1!-£W$31
A PMSP, através da DEPAVE-3, oferece há 18 anos atividades
de observação. A estrutura e conteúdo das atividades são
adaptadas ao público alvo e objetivos pretendidos. Analisouse duas atividades principais: Mini curso de Observação
de Aves e Observação de Aves como instrumento para
estudo do meio. A estratégia é demonstrar na prática que há
diversidade de fauna na cidade através de uma atividade lúdica.
Os cursos possuem carga horária de 12 horas. O conteúdo
DERUGDW«FQLFDVGHREVHUYD©¥RGHDYHVRĆFLQDVSDUDH[SORUDU
o tema no estudo de ciências (professores), observação
PRQLWRUDGDOLVWDJHPHH[LEL©¥RGDVIRWRJUDĆDVGDVHVS«FLHV
registradas e palestras de convidados. Durante as atividades
são observadas cerca de 50 espécies, número superior às
expectativas dos alunos. Realizou-se 26 cursos para o público
!+'¢¢S8!¡8'9'2;!ࣅ329
377 Geographically Independent Genetic Structure of the
Cantabrian Capercaillie (Tetrao urogallus cantabricus)
Alberto Fameli1*, María Morán Luis2, Rolando Rogríguez Muñoz3,
Alberto Fernández Gil2, María Bañuelos2, Patricia Mirol1
ǢW['82!8&-23-=!&!=-!\!;<8!£$-'2$'9<9'<1TǣW3-2;-3&-='89-;@
'9'!8$,2-;T-'8'9!16<9T2-='89-;@3(=-'&3TǤW'2;8'(38
$3£3+@{329'8=!ধ32T$,33£3(-39$-'2$'9T2-='89-;@3(?';'8
r!£#'8;3(!1'£-|,3;1!-£W$31
The Cantabrian capercaillie (Tetrao urogallus cantabricus:
PHASIANIDAE) constitutes a peripheral subspecies inhabiting
QRUWKHUQ6SDLQ,WLVFRQVLGHUHGDQ(YROXWLRQDU\6LJQLĆFDQW
Unit under high extinction risk, living in patchily distributed
high altitude forests. We extracted DNA from feces collected
LQĆYH]RQHVVHSDUDWHGE\YDOOH\VLQWKH:HVWHUQSDUWRIWKH
Cantabrian Mountains, an area that includes many high quality
habitat zones for the bird. We analyzed 9 microsatellite markers
in order to assess the possibility of genetic structure and
study the effect valleys may have on genetic variability. Global
AMOVA showed that zones differ in terms of allele frequencies
{փdփTT
ID t
ABSTRACT
t
(p=0.005). Pairwise Fst comparisons between zones showed
VLJQLĆFDQWGLIIHUHQFHVEHWZHHQWKHPDOSKD H[FHSW
for the two in the South of the study area, indicating that
the valley between them might not be acting as a barrier to
JHQHćRZ*HQHWLF,QWHUSRODWLRQJDYHVLPLODUUHVXOWVZLWK
high values of genetic difference between all sampling zones
except for the two located in the South. This suggests these
zones could be managed as one. Bayesian analyses performed
either taking or not into account geographic position of
individuals divide the population in two-three clusters with
JHQHćRZEHWZHHQWKHP2QHRIWKHPVHHPVWREHPRUH
common in the Northwest, and other in the Southeast of the
study area, but all of them can be found throughout the study
area. This indicates that the valleys between zones do not act
as barriers to capercaillies movements, and the differences
between sampling zones in terms of allele frequencies may be
maintained by behavioral traits rather than geographic barriers.
386 Interação alimentar entre arara-azul (Anodorhynchus
hyacinthinus), besouros bruquíneos e acuri (Attalea phalerata)
Iara Roberta Azevedo-Niero1*, Wesley R. Silva1
ǢW2-$!16
r-!8!2-'83|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
sofrer predação por larvas de besouros bruquíneos. Como
as araras-azuis forrageiam frequentemente no solo, podem
encontrar sementes infestadas por estas larvas, o que suscita
as seguintes questões: 1) existe algum padrão de infestação das
sementes por estas larvas?; 2) araras-azuis distinguem entre
sementes infestadas e não infestadas?; 3) quando se alimentam
de sementes infestadas, elas ingerem as larvas que encontram?
9HULĆFDPRVVHDSURSRU©¥RGHVHPHQWHVSUHGDGDVSRUEHVRXURV
varia entre os períodos seco e úmido e se dependem da
presença do exocarpo. Examinamos a morfologia das sementes
em busca de pistas que permitissem às araras-azuis distinguir
entre as sementes infestadas e não infestadas. Oferecemos
experimentalmente sementes com e sem larvas a araras-azuis
de vida livre e em cativeiro. A infestação por besouros foi maior
no período seco e nas sementes sem exocarpo. As araras-azuis
não distinguem entre sementes infestadas e não infestadas,
possivelmente porque estas diferem pouco em peso e tamanho
e são visualmente idênticas. Mesmo não selecionando
sementes com e sem larva, as araras-azuis ingeriram as
larvas encontradas nas sementes que abriram. Embora
sejam raros os casos de insetivoria em psitacídeos, nosso
estudo indica que araras-azuis incluem propositadamente
larvas de besouros em sua dieta, um comportamento
que pode ter implicações energéticas para essas aves.
Conhecer a dieta de uma ave vulnerável como a arara-azul
(Anodorhynchus hyacinthinus) é de extrema importância para
direcionar esforços à sua conservação. No Pantanal SulMatogrossense estas aves se alimentam principalmente de
sementes de Attalea phalerata, as quais, uma vez no solo, podem
!+'¢S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
392 Renaturalización: Primer año del programa
de reverdecimiento de Bogotá vinculando a
las aves como eje de la biodiversidad
Julian Eduardo Avila-Campos1*, Nadezhda Juliet Bonilla-Sánchez2
ǢW!8&Ð23;Æ2-$339Ì'£'9ধ23<ধ9TǣW2-='89-&!&!$-32!£&'3£31#-!
r/<'!=-£!$!|<2!£W'&<W$3
Los procesos de urbanización son reconocidos como factores
de intervención humana que representan una amenaza
VLJQLĆFDWLYDSDUDODELRGLYHUVLGDG'XUDQWHHOHVWDEOHFLPLHQWR
de una ciudad se da lugar a procesos que afectan la estructura
y el funcionamiento de las comunidades bióticas, contrastando
las condiciones al interior de ecosistemas notablemente
diferentes. En los últimos 200 años la colonización y el atractivo
económico creciente de la ciudad de Bogotá produjeron
una transformación drástica del paisaje, reduciendo los
espacios del agua, de los bosques nativos y de las más de
200 especies de aves de la sabana, producto de un territorio
HQGXUHFLGR\FDUHQWHGHSODQLĆFDFLµQ(VWDVLWXDFLµQHVW£
siendo afrontada por el equipo de Renaturalización cuyo
objetivo es reverdecer la ciudad y darle nuevas oportunidades
a su biodiversidad valiéndose del proceso de biomímesis y
apostando por el diseño urbano sostenible. Se ha desarrollado
el trabajo del primer año teniendo a las aves como eje
principal de la biodiversidad, procurando evaluar el potencial
de conectividad de las áreas intervenidas para favorecer
su movilidad y aprovechar su función de sombrilla para los
demás componentes del ecosistema. Se implementaron
coberturas vegetales en más de 11.000 m2 de áreas urbanas,
de forma diversa y heterogénea con cerca de 150 especies
!+'¢£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
vegetales que aportan diferentes recursos alimenticios y de
hábitat a las aves. En los sitios endurecidos se produjeron
coberturas no convencionales. Los monitoreos y el interés
de la ciudadanía en la conservación de las aves permitieron
registrar cuatro especies no reportadas para la región y
una casi amenazada (Contopus cooperi) de un total de 82.
393 The Birds of Diadema
Marco Silva1*, Gabriel Macedo1, Vagner Cavarzere2
ǢW
TǣW r1!8$39!1!|+1!-£W$31
Diadema is the city with the second smallest area of
Metropolitan Region of São Paulo, and the second largest
SRSXODWLRQGHQVLW\RI%UD]LOZLWKPtRIJUHHQDUHDSHU
inhabitant. The vegetation remnants are located mainly
near the Billings dam. In these areas, however, there are
irregular occupations and lack of basic sanitation. There
are no studies documenting the birds of Diadema and,
considering the environmental vulnerability of the region,
ZHFRQGXFWHGDELUGVXUYH\RIWKHFLW\:HSHUIRUPHGĆHOG
WULSVDWOHDVWRQFHDPRQWKIURP0D\WR$SULO
during the morning and afternoon using the MacKinnon lists
PHWKRG:HLGHQWLĆHGWKHVSHFLHVE\DXGLWRU\DQGRUYLVXDO
contact with the aid of binoculars. In total, we accumulated
OLVWVKRIVDPSOLQJDQGLGHQWLĆHGVSHFLHVLQ
families and 19 orders, including an individual of Phibalura
ćDYLURVWULV (near threatened category) and an individual of
Parabuteo unicinctus (vulnerable category). There was a high
{փdփTT
ID t
ABSTRACT
t
dominance of a small number of species. Pitangus sulphuratus
- the most abundant species - was present in 50% of the
lists. We observed most of the species in the protected areas
on the banks of the Billings. We didn´t register understory
VSHFLHVZKLFKLVDUHćHFWLRQRIHQYLURQPHQWDOGHJUDGDWLRQ
and fragmentation processes. Despite Diadema´s social and
environmental problems, the species richness we found is
relatively high for an urban area. The results of this study are
important for future work such as environmental education
programs, comparisons with birds from other areas with
different degrees of environmental degradation and human
impacts affecting the birds of urban environments.
395 Functional diversity and habitat use of Andean
ćRFNVLQPDQDJHGDJURIRUHVWU\ODQGVFDSHV
Molly E. McDermott1*, Amanda D. Rodewald2, Stephen N. Matthews3
ǢW,-3;!;'2-='89-;@TǣW382'££2-='89-;@TǤW,-3;!;'2-='89-;@
r1$&'813ħWǨǦ|39<W'&<
Agroforestry systems contribute to tropical biodiversity
conservation by providing habitat for functionally diverse
bird communities. Among these assemblages are foraging
ćRFNVWKDWSURYLGHLPSRUWDQWHFRV\VWHPVHUYLFHVVXFKDV
pest control and seed dispersal. Socioeconomic pressures
KDYHIDYRUHGFRQYHUVLRQDQGVLPSOLĆFDWLRQRIDJURIRUHVWU\
potentially altering ecological functioning. We studied foraging
JXLOGVKDELWDWXVHPLJUDWRU\DQGWD[RQRPLFFODVVLĆFDWLRQRI
PL[HGVSHFLHVćRFNVWREHWWHUXQGHUVWDQGFRPSRVLWLRQDQG
functional diversity among different agroforestry systems. In
-DQ)HEZHVXUYH\HGćRFNVLQVKDGHFRIIHH
!+'¢S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
shade-cardamom, secondary forest, and silvopastures in the
Colombian Andes. Silvopastures supported smaller, less diverse
ćRFNVZLWKIHZHU1HRWURSLFDOPLJUDQWVSDUWLFXODUO\3DUXOLGV
fewer resident forest specialists (insectivores and understory
species), and more common generalist species. Otherwise,
distribution of species among foraging guilds was constant
DQGIDPLOLHVZHUHHYHQO\GLVWULEXWHGLQćRFNVDPRQJKDELWDWV
Richness and abundance of rare forest species increased
with surrounding woodland cover and forest connectivity,
indicating the importance of the landscape for conservation.
Our research demonstrates that suitability of agroforestry
IRUIXQFWLRQDOO\GLYHUVHćRFNVPD\EHLPSURYHGE\HQKDQFLQJ
vegetative structure in farms and forest connectivity. Though
LQWHQVLĆFDWLRQPD\UHSODFHELUGFRPPXQLWLHVZLWKIXQFWLRQDOO\
simpler ones comprised of habitat generalists, our results
indicate that some services (e.g., seed dispersal by frugivores)
may be maintained in agroforests with adequate tree cover.
404 Revisão sistemática de Zimmerius gracilipes (Aves:Tyrannidae)
Ítalo Aguiar1,2*, Alexandre Aleixo1, Horacio Schneider2
ǢW<9'<!8!'29'1Ð£-33'£&-TǣW2-='89-&!&'
'&'8!£&3!8Æ
r-;!£38+!+<-!8|+1!-£W$31
$SULPHLUDĆORJHQLDGRJ¬QHURZimmerius elevou ao nível
de espécie Zimmerius acerDQWHULRUPHQWHFODVVLĆFDGDFRPR
subespécie de Z. gracilipes. Isso levou a alguns problemas
WD[RQ¶PLFRVHGLĆFXOGDGHVQDGHOLPLWD©¥RGDV£UHDVGH
distribuição de Z. gracilipes e Z. acer, pela ausência das
populações do sudeste amazônico e do nordeste brasileiro
{փdփTT
ID t
ABSTRACT
t
ID t
nas análises. O objetivo deste estudo é esclarecer os
OLPLWHVLQWHUHVSHF¯ĆFRVHQWUHGLIHUHQWHVSRSXOD©·HVGHZ.
acer e Z. gracilipes com base em dados moleculares. Foram
utilizadas 34 sequências de DNA dos genes COI, ND2 e BF5.
$VĆORJHQLDVIRUDPHVWLPDGDVFRPEDVHQRVFULW«ULRVGD
Máxima Verossimilhança e Inferência Bayesiana, e estimada
DGLYHUVLGDGHQXFOHRW¯GLFD7RGDVĆORJHQLDVUHFXSHUDUDPD
PRQRĆOLDUHF¯SURFDHQWUHZ. gracilipes e Z. acer com alto apoio
estatístico. As subespécies de Z. gracilipes foram recuperadas
FRPRSDUDĆO«WLFDVFRPXPDGLYHUVLGDGHQXFOHRW¯GLFDLQIHULRU
a 1% entre elas. Z. acer apresentou uma divisão entre as
populações da Guiana e as do sudeste amazônico e nordeste
brasileiro, com alto valor de suporte. Esses dois clados
possuem distância genética de 1,2%, indicando um processo
GHGLYHUVLĆFD©¥RDORS£WULFR2VUHVXOWDGRVFRUURERUDPRV
OLPLWHVJHRJU£ĆFRVHVWDEHOHFLGRVDWXDOPHQWHentre Z. gracilipes
e Z. acer, baseados em caracteres morfológicos e vocais, com
as populações do escudo das Guianas, sudeste amazônico e
nordeste brasileiro reconhecidas como Z. acer, e as do oeste
Amazônico como Z. gracilipes. No entanto, é necessário ainda
LQFOXLUDPRVWUDVGHSRSXOD©·HVGRLQWHUć¼YLR0DGHLUD
7DSDMµVSDUDHVWDEHOHFHURSRVLFLRQDPHQWRĆORJHQ«WLFR
como pertencente ao clado Z. gracilipes ou Z. acer.
405 Waterbirds community structure and
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
population trends in Western Ecuador
Mateos Judith1*, Agreda Ana2, Santander Tatiana2,
Guevara Esteban2, Luzuriaga Nivia3
ǢW2-='89-&!&'2Ì2&'A'£!@3TǣW='9@329'8=!$-32T
ǤW2-='89-&!&'2;8!£&'£$<!&38
r/<&-;1!;'39|+1!-£W$31
The study of community structure and population trends of
waterbirds is important to understand mechanisms behind
changes in aquatic ecosystems. We rely on bird count data
collected twice a year over a nine-year period (2004-2012)
to document the structure and changes in bird communities.
Our study area encompasses seven wetlands in the coastal
region of Ecuador which includes estuaries, inland freshwater
DQGDUWLĆFLDOVDOWSRQGVLH(FXDVDO(DFKVSHFLHVUHFRUGHG
during counts was assigned a diet and migratory behavior
according to bibliography. We applied a Principal Component
Analysis to describe community structure. Then, a Generalized
Linear Mixed Model was applied to determine drivers of the
community structure and explore time trends. Response
variable were the bird counts and explanatory variables were
\HDUGLHWPLJUDWRU\VWDWXVDQGVHDVRQDOLW\%HVWĆWWHGPRGHO
was the linear response of bird counts against year with diet
and seasonality as factors. Wilson’s Phalarope was the most
abundant species. Many boreal migrants remain in Ecuador
during northern summer while austral migrants show large
ćXFWXDWLRQV:HIRXQG\HDUO\GLIIHUHQFHVLQDEXQGDQFHVGXH
to seasonality and diet. Counts of boreal migratory species
exhibit an overall positive trend, while sedentary species
{փdփTT
ID t
ABSTRACT
t
seem to be declining. Species feeding on invertebrates are
the only dietary group with a positive trend. Other species
analyzed showed a negative trend. Multivariate methods
are straightforward approach to describe community
structure. Diet and seasonality are the most important
factors explaining species abundances. Sites like Ecuasal
Ponds are important wintering sites for boreal migrants.
410 Phylogeny of the polytipic species Piprites
chloris (Temmink, 1822; Pipritidae)
Sidnei Dantas1*, Carlos Eduardo Portes1,
Gragory Silva2, Alexandre Aleixo1
ID t
ABSTRACT
t
Table of Contents
02 nuclear genes for ca. 60 individuals, covering most of
the range of the species, making morphometric and vocal
measures in the available material, and checking for consistent
morphological (color) differences between the populations.
Preliminary results using the mitochondrial genes produced
a mostly non-resolved tree, although there were some wellsupported clades, like the one from Belém Endemism Center,
corresponding to P.c. grisescens, and two non-sisters clades in
Atlantic forest, separated by the São Francisco river, hence
the unnamed population and P.c. chloris. Relations between
these clades are not clear yet, and analysis with more
robust data are in progress to better clarify these questions.
Morphological and vocal analysis are also in progress.
ǢW<9'<!8!'29'1-£-33'£&-TǣW29ধ;<;3&'-3$-Í2$-!9g
r91&!2;!9|@!,33W$31
& PHYLOGEOGRAPHY
Piprites chloris is a forest canopy Suboscine species with seven
subespecies distributed over Amazon and Atlantic Forests in
South America. The subspecies differ mainly in underparts
color, seemingly showing little or no geographic variation in
song. Some populations occupy relatively small ranges under
severe deforestation and may be on risk of extinction, once
P. chloris is highly sensitive to environmental disturbance.
Two populations in particular, P.c. grisescens restricted to
Belém Endemism Center in East Pará State, and a recently
discovered population in the states of Pernambuco and
Alagoas, are certainly to be given a high status of extinction
threat in a near future. In the present work, we are making
a phylogeny of the species allying molecular, morphological
and vocal data. We are sequencing 03 mitochondrial and
!+'S8!¡8'9'2;!ࣅ329
412 Temporal changes in body condition correlated
among species in hummingbird assemblages?
Vitor A. Lima1*, Jaqueline E. Persegona2,
Felipe L. Shibuya2, James J Roper3
ǢW2-='89-&!&'-£!'£,!TǣW2-='89-&!&'
'&'8!£&3
!8!2ÆTǤW2-='89-&!&'-£!'£,!T
r=!8!</3W£-1|+1!-£W$31
A espécie migratória Tyrannus savana de ampla distribuição no
Brasil, apresenta-se em sub-espécies, com destaque T. savana
savana (raça meridional), que realiza migração até Equador,
Colômbia, Guiana, Curaçao, Trinidad e Texas. Ocorre na
Amazônia entre fevereiro a julho, sendo sua área de invernada
os campos e adjacências dessa região. Para o Planalto Central
do Brasil migra de julho a agosto, se reproduzindo de setembro
{փdփTT
ID t
ABSTRACT
t
ID t
a dezembro. A partir de setembro, passa o seu segundo
pico migratório, provavelmente de aves que se reproduzem
no Sul do Brasil, Argentina e Uruguai. Após a reprodução
no Planalto Central, se deslocam para o Norte de janeiro a
fevereiro. Durante buscas de ninhos ativos de aves, nas áreas
GHLQćX¬QFLDGLUHWDGRUHVHUYDWµULRGD$+(-LUDX5RQG¶QLD
foram registrados ninhos ativos de T. savana (N=7), na
localidade dos Igarapés: Jirau, Raul e Mutum, tributários do Rio
Madeira, entre os meses de outubro a dezembro de 2014. Em
MDQHLURGHHMDQHLURIHYHUHLURGHIRUDPUHJLVWUDGRV
jovens e adultos nas localidades supracitadas, diferentemente
do esperado em literatura no qual os indivíduos retornam e
se reproduzem no Planalto Central. As aves da população do
Sul do Brasil se reproduzem um pouco mais tarde que as do
3ODQDOWR&HQWUDOVHQGRHQFRQWUDGRVĆOKRWHVQRVQLQKRVHP
janeiro, deixam o Rio Grande do Sul em fevereiro e março,
voltando a este Estado em setembro. Portanto comportamento
semelhante pode estar acontecendo concomitantemente
HP5RQG¶QLD(VWH«RSULPHLURUHODWRQDOLWHUDWXUDFLHQW¯ĆFD
de registro reprodutivo na Amazônia de T. savana.
421 An attempt to solve the enigmatic taxonomy of
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
the ‘San Isidro Owl’ (Ciccaba aff. huhula)
Juan F. Freile1*, Mitch Lysinger2, Heimo Mikkola3, Elisa Bonaccorso4
ǢW31-;Ì$<!;38-!23&''+-9;83982-;3£Õ+-$39TǣW!#!Ó!9!2
9-&83TǤW2-='89-;@3(!9;'82
-2£!2&TǥW'2;83&'2='9ধ+!$-Õ2&'£!
-3&-='89-&!&@!1#-3£-1Æধ$3T2-='89-&!&'$23£Õ+-$!2&3!1Ì8-$!
r/(8'-£'3|@!,33W$31
Ciccaba huhula and C. nigrolineata have allopatric distributions
in the Neotropical lowlands and foothills. In 1999-2000, an
isolated population of Ciccaba was discovered in subtropical
forests at San Isidro, Napo province, northeast Ecuador
(2,050 m elevation). Individuals of this population appear
intermediate between C. huhula and C. nigrolineata, suggesting
hybrid origin. However, these species ranges in Ecuador are
separated by the Andean massif (4,000 m elevation on average),
making the contact between C. huhula and C. nigrolineata very
unlikely. C. huhula only ranges below 1,000 m elevation in
Amazonian Ecuador, with no known altitudinal movements.
Further, there are specimens labeled as C. huhula from Jujuy,
Argentina (c. 2,500 m elevation), which apparently resemble
“San Isidro Owl”, while there are specimens from AndeanAmazonian slopes of Colombia morphologically intermediate,
though more similar to C. nigrolineata. Colombian specimens
were described as C. spilonotus but later synonymized with
C. nigrolineata. The enigmatic taxonomy of the San Isidro
population possibly even sheds doubt on the group as a
whole. We are undertaking comparative analyses of plumage,
vocalizations, and ecological niches of the “San Isidro Owl”,
C. huhula and C. nigrolineata. Our study suggests differences
{փdփTT
ID t
ABSTRACT
t
in ecological niches among the three forms. Vocalizations are
generally similar, but the San Isidro population utters some
calls not known for C. huhula and C. nigrolineata. We need to
revise more specimens, vocalizations, and genetic material of
C. huhula, C. nigrolineata (including C. “spilonotus”), to elucidate
the taxonomy of the “San Isidro Owl” and its close relatives.
422 0
L[HGVSHFLHVELUGćRFNVDNH\WR
understand tropical bird communities
Jenny Munoz1*, Jill Jankowski1
ǢW
ID t
ABSTRACT
t
Table of Contents
species. This study took place along an environmental gradient
(400-3400m) on the eastern slope of the Andes in Peru. In
WKLVVWXG\ZHVKRZWKDWOLNHORZODQGVćRFNVPLGDQGKLJK
HOHYDWLRQćRFNVDUHGLYHUVHDQGFRKHVLYHPXOWLVSHFLHVJURXSV
that exhibit communal territoriality over years. Moreover,
based in the co-ocurrence patterns, and elevational ranges
of species, we suggest that facilitation-mediated effects
play an important role in the range limits of species. Range
GLIIHUHQWLDWLRQEHWZHHQćRFNLQJDQGQRQćRFNLQJVSHFLHV
was comparable to species level-range divergence of noncongeners indicating large impacts on range limits. Facilitation
may be an overlooked factor in bird communities structure.
r<!2-;!ǡǣǧ|+1!-£W$31
Understanding the importance of species interactions on
community structure is a long-standing goal in ecology. While
many studies have focused on negative biotic interactions,
the role of other processes has received less attention, in
particular facilitation. In birds, facilitation occurs in mixed
VSHFLHVćRFNVLQZKLFKLQGLYLGXDOVRIVHYHUDOGLIIHUHQWVSHFLHV
IRUDJHDVDVWURQJO\DVVRFLDWHGJURXSWRREWDLQEHQHĆWV
from the association. These complex associations had been
described in several different habitats during the last century,
however there are still a lot of debate in the stability and
strength of these associations and the role they play in
communities. In this study we assess the stability (space and
WLPHRIćRFNVDORQJDQHOHYDWLRQDOJUDGLHQWDQGWHVWWKHUROH
of facilitation in the co-ocurrence and distributional patterns
of birds To address these questions, we integrated data from
ćRFNREVHUYDWLRQVRFFXUUHQFHDQGHOHYDWLRQDOUDQJHVRI
!+'S8!¡8'9'2;!ࣅ329
427 Caracterización y dinámica de la Avifauna de
las sabanas inundables de la Reserva Natural
La Palmita, Casanare, Colombia
Diego Carantón Ayala1*, Manuela Restrepo Chica1
ǢW
<2&!$-Õ2'9'8=!!;<8!£!!£1-;!
r$!8!2;Õ2ǣ|+1!-£W$31
Las sabanas inundables de Colombia y Venezuela, se
caracterizan por una topografía plana y zonas particularmente
bajas que corresponden a áreas que se inundan durante la
estación de lluvias. La fuerte dependencia de la dinámica
hídrica hace este ecosistema único y vulnerable. Estudiamos
la composición, riqueza y estructura, así como la variación
estacional y los grupos de dieta de la comunidad de aves
en los principales hábitats (sabana, bosque y esteros), en el
centro de investigación Reserva Natural La Palmita (Casanare,
Colombia).Realizamos censos por transectos distribuidos en
{փdփTT
ID t
ABSTRACT
t
ORVK£ELWDWVFXDQWLĆFDPRVODDEXQGDQFLDUHODWLYD\DQDOL]DPRV
los índices de diversidad para cada hábitat en temporada
GHOOXYLDV\VHFD6HLGHQWLĆFDURQHVSHFLHVGHDYHV
en lluvias y 223 en temporada seca. Los esteros y bosques
que cubren menos área en la Reserva, albergan el 70% de la
avifauna total. La riqueza de especies presentó variaciones
estacionales en los tres hábitats, siendo máximas en bosques.
En los esteros la riqueza aumenta durante las lluvias, mientras
que en bosques y sabanas aumenta durante la época seca.
Encontramos interacción entre la avifauna de los tres hábitats.
Las sabanas y los bosques presentan especies exclusivas y
las comparaciones de estructura entre coberturas mostro
GLIHUHQFLDVVLJQLĆFDWLYDVHQWUHODVHVWDFLRQHVGHOOXYLD\
seca, dando un aumento en la riqueza y la abundancia de
ciertas especies para la época seca. La avifauna estudiada
alberga una importante sección de los llanos del Orinoco y
es clave la implementación de medidas de conservación.
429 Testing for a shared biogeographic history: bird speciation
ID t
ABSTRACT
t
Table of Contents
(Furnariidae, Trochilidae, Thraupidae, Emberizidae) with trophic
differences (insectivores, nectarivores, frugivores, mix diets),
all mountain forest species and similar geographic distributions
in the Andes of South and parts of Central America were
tested. Co-estimation of relationships and divergence times
from mitochondrial Cyt-b and ND2 genes for all sister species
groups was done through Bayesian analysis (*Beast). The
phylogenetic trees and divergence times suggest in four clades
non-concordant topologies. When members of the groups
include Central American forms, they are the oldest inside
each group, but its spatial relationships and divergence times
change in the Northern Andes. Divergence times for the
FRGLVWULEXWHGVLVWHUVSHFLHVJURXSVLQWKH1RUWKHUQ$QGHV
expand 4MY and must be explained as the result of recurrent
events (repeated climatic changes) separating allopatrically the
VSHFLHVSDLUVJURXSVLQGLIIHUHQWSHULRGVRIWLPH6RPH*ODFLDO
Interglacial cycles affected the distributions and divergence
in the same geographical locations, but sorted differently the
geographical populations even though having similar ecologies.
in the Northern Andes using comparative phylogeography
Sergio Cordoba-Cordoba1,2*, Peter Andolfatto1, Henry S. Horn1
430 Exploring the morphology of migration: Are
ǢW8-2$';322-='89-;@TǣW93$!$-323+3;!2!&'82-;3£3+-!
subspecies of Tyrannus diverging via diet?
r9'8+$38&3#!|@!,33W$31
Maggie P MacPherson
& PHYLOGEOGRAPHY
<£!2'2-='89-;@
Co-distributed species could have a shared evolutionary
history with a concerted response to a single event, or have
spatial congruence but temporal differences, favoring more
independent evolutionary paths but with similar spatial
outcomes. Five different species pairs in four separate lineages
!+'S8!¡8'9'2;!ࣅ329
11!$6,'|;<£!2'W'&<
Migrants are thought to have increased opportunistic foraging
strategies compared to residents, and there is evidence that
heterogeneous populations (of specialized individuals) are
{փdփTT
ID t
ABSTRACT
t
ID t
ecological generalists. This phenomenon, termed individual
specialization, has been shown in many taxa and such
phenotypic variation within populations has also been linked
to species thought to be at the cusp of radiations; typically
island species such as GeospizaĆQFKHV+HUH,XVHXQLYDULDWH
measures of bill morphology across Kingbird (Tyrannus) species
and subspecies to answer the question: Are migrant versus
resident subspecies of Tyrannus diverging via diet. There are
13 species of Tyrannus, 5 of which have both resident and
PLJUDQWVXEVSHFLHV8VLQJ6WXGHQWVWWHVWVDQGFRHIĆFLHQWV
of variation in bill morphometrics I found that migrants and
residents differed in bill morphology in addition to migrants
having increased variation in their morphologies. For example,
in Tyrannus savana: nMigrant=371, nResident=90; t-test: bill
ZLGWK3ELOOGHSWK3FRHIĆFLHQWRIYDULDWLRQELOO
width migrant=0.084, bill width resident=0.064, bill depth
migrant=0.082, bill depth resident=0.059. Using principal
component analysis (PCA) and discriminant analysis, I discuss
WKHPRUSKRORJ\RIUHVLGHQWQ VSHFLHVVXEVSHFLHV
LQGLYLGXDOVYHUVXVPLJUDQWQ VSHFLHVVXEVSHFLHV
individuals) Tyrannus including wing (wing length and Kipps
index) and tail measurements. This research shows how diet
(individual specialization within populations in addition to
specialist versus generalist population life history strategies)
could contribute to divergence in mainland radiations of birds.
438 9
DULDFLµQLQWUDHVSHFLĆFDHQODIRUPD\GLPHQFLRQHV
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
de los nidos de cuatro especies de aves
Karla Conejo-Barboza1*, Gilbert Barrantes1
ǢW2-='89-&!&&'39;!-$!
r0!£-2!#!8#3A!|+1!-£W$31
Los nidos son el resultado de la combinación del
FRPSRUWDPLHQWRWDPD³RGHVDUUROORI¯VLFRHLQćXHQFLD
ĆORJHQ«WLFDGHVXFRQVWUXFWRU(VWDHVWUHFKDUHODFLµQKD
llevado a extrapolar las descripción del nido de una especie
DRWUDVUHODFLRQDGDV$QLYHOLQWUDHVSHF¯ĆFRODIRUPDGHORV
QLGRVYDU¯DVHJ¼Q£UHDJHRJU£ĆFDFOLPD\VXVWUDWR1XHVWUR
objetivo es analizar la variación en los nidos de cuatro especies
GHDYHVGHXQDPLVPD£UHDJHRJU£ĆFDDQDOL]DQGRODVPHGLGDV
morfométricas usadas por otros autores y las propuestas en
este estudio. Analizamos 12 nidos de Amazilia tzacatl , 17 de
Quiscalus mexicanus , 60 de Turdus grayi y 34 de Zonotrichia
capensis y tomamos 19 medidas externas y 5 internas, las cuales
consideramos como sistemas de medición independientes.
Utilizamos análisis de componentes principales para determinar
cual sistema de medición (incluyendo los de otros autores)
GHĆQHPHMRUODIRUPDGHOQLGRVHJ¼QODHVSHFLH&RQIRUPH
DXPHQWDHOQ¼PHURGHYDULDEOHVSRUQLGRVHGHĆQHQPHMRUORV
grupos correspondientes a cada especie, pero existe una zona
de traslape entre los nidos de Z. capensis, T. grayi y Q. mexicanus.
A pesar de esto, los nidos de este último presenta al menos
dos formas. Los nidos de A. tzacatl formaron siempre un grupo
separado de las otras especies. Al analizar las variables internas,
a lo largo del CP1 (86% de la variación) sólo las cámaras de
Q. mexicanusQRHVWDEDQELHQGHĆQLGDV3DUDGLIHUHQFLDU
{փdփTT
ID t
ABSTRACT
t
nidos entre especies no basta con conocer sus dimensiones
y menos cuando están basadas en pocos ejemplares. Es
posible que la variación que presenta Q. mexicanus le permita
usar varios sustratos y favorezca su éxito reproductivo.
443 Short term impacts of selective logging on Amazonian
birds: a study in Jamari, Rondônia, Brazil
Luiz Mestre1*, Samuel Nienow2, Ricardo Krul1, Luciana Festti1
ID t
ABSTRACT
t
Table of Contents
were large frugivores and terrestrial insectivores; and in logged
sites small arboreal frugivores and omnivores. The species
FODVVLĆHGDVPRVWVHQVLWLYHWRLPSDFWVDQGKDELWDWVSHFLDOLVWV
DUHVLJQLĆFDQWO\PRUHDEXQGDQWLQSUHVHUYHGVLWHV6HOHFWLYH
logging is impacting locally some bird guilds and species, and
it is not known how long the community starts to recover.
Finally, we emphasize the importance of continued monitoring
of selective logging areas in tropical forests to understand
the long-term impacts on Amazonian bird communities.
ǢW2-='89-&!&'
'&'8!£&3!8!2ÆTǣW29ধ;<;3,-$3
'2&'9&'329'8=!%È3&!-3&-='89-&!&'
r£<-AW1'9;8'|<(68W#8
ORAL PRESENTATION SESSION 3: AVIAN CONSERVATION I
This study compared the Amazonian bird communities in
selective logging sites and preserved areas in Floresta Nacional
do Jamari, Rondônia, Brazil. We compared the structure of
bird communities (richness, abundance and composition) by
sampling eight sites in preserved forests and eight in logged
areas (after one to three years regeneration, from 2011 to
2013). Each site was sampled by 12 mist-nets for 2 days, and
24 point counts per treatment. We registered 240 bird species.
We captured by mist nets 76 species (618 ind) in preserved
sites, and 77 species (465 ind) in logged sites. Preserved sites
ZHUHQRWVLJQLĆFDQWO\GLIIHUHQWIURPORJJHGVLWHVVWUXFWXUH
richness and abundance) for mist-netted birds. However, we
FDSWXUHGVLJQLĆFDQWO\PRUHQHFWDULYRUHVDQGVPDOOLQVHFWLYRUHV
in logged forests. We registered by point counts 133 species
(1572 ind) in preserved sites, and 115 species (1070 ind) in
logged sites. We found consistent differences comparing the
bird community structure sampled in preserved versus logged
sites. The most abundant birds observed in preserved sites
!+'¢S8!¡8'9'2;!ࣅ329
444 Assessing the exposure of the threatened and
endemic Atlantic Forest species of Hemitriccus(Aves,
Tyrannidae) to future climate change
Carlos Eduardo C. E. Arlé1*, Michelle M. T. C. Andreu1,
V. S. Schwan1, R. R. Fortes1, M. L. Lorini1
ǢW2-='89-&!&'
'&'8!£&39;!&3&3-3&'!2'-83l2--3m
r0!&<!8£'|+1!-£W$31
Climate change (CC) has already started to induce responses
on several species, and will have far-reaching impacts on
biodiversity. Therefore, assessing species? CC vulnerability
has great importance to support decision in conservation
actions. Ecologic Niche Models (ENMs) provide a useful tool for
assessing exposure to CC. Here, we applied ENMs approach
to estimate the exposure of Hemitriccus mirandae, H. kaempferi
and H. furcatus to future CC and the implications for their
conservation status. These birds are endemic to the Atlantic
)RUHVWKRWVSRWDQGFODVVLĆHGUHVSHFWLYHO\DV9XOQHUDEOH
(VU), Endangered (EN) and VU by the IUCN. We performed
{փdփTT
ID t
ABSTRACT
t
environmental suitability modelling associating occurrence
records to bioclimatic variables. We used six algorithms in an
ensemble forecasting approach to model current and future
(2050, under A2a scenario) climatically suitable areas. From the
present to 2050, climatically suitable areas that are covered by
IRUHVWVKRZHGDVLJQLĆFDQWORVVIRU H. mirandae, 85.8%
for H. kaempferi and 42.6% for H. furcatus. According the IUCN
criterion A3(c), they should be then categorized, respectively,
as EN, Critically Endangered (CR) and VU. Despite not changing
category, H. furcatus showed a substantial range loss, whilst
the other two species are predicted to change towards the
more threatened category. Thus, this study suggests that CC
can be a severe threat increasing the extinction risk to these
species. We highlight the importance of additional studies
to assess vulnerability, and recommend that CC impacts
should be considered in long term conservation strategies
for these and other species endemic to the Atlantic Forest.
ID t
ABSTRACT
t
Table of Contents
been a long held debate that has not been addressed in
birds. In this study we used a phylogeographic approach
based on one mitochondrial gene (NADH subunit 2) and a
comprehensive geographical sampling of the Pantepui region
to characterize the genetic differentiation of populations of
Myioborus warblers. Four species of this genus are distributed
within the region: M. miniatus occupies the lower slopes of
most tepuis, whereas a monophyletic group composed of
three endemic species (M. castaneocapillus, M. albifacies, M.
cardonai) is present in upper-montane habitats. M. miniatus
populations were largely genetically undifferentiated, with
few differences when compared to populations from the
central Andes. However, upper-montane species were clearly
differentiated in three monophyletic groups showing a complex
pattern of plumage coloration. Both results support a dynamic
Pliocene-Pleistocene scenario of dispersal and vicariance
challenging the idea of the Pantepui consisting on isolated
habitat islands with highly differentiated communities.
448 Myioboruswarblers from the Pantepui region:
old endemism of sky island populations?
Jorge L. Pérez-Emán1*, Irby Lovette2
ǢW29ধ;<;3&' 33£3+Ð!@$3£3+Ð!836-$!£T2-='89-&!&'2;8!£&''2'A<'£!TǣW
382'££!#3(82-;,3£3+@!2&'6!8;1'2;3($3£3+@!2&=3£<ধ32!8@-3£3+@
r/38+'W6'8'A|$-'29W<$=W='
451 La observación de aves como iniciativa de
conservación participativa; proyecto AICAs
Putumayo, Colombia de CORPOAMAZONIA
Orlando Acevedo-Charry1,2*, Vanessa Perdomo1, -$;38
W!6'8!f38'231, 3,2W<'9'9f-92'8391
& PHYLOGEOGRAPHY
ǢW TǣW2-='89-;@3(<'8;3-$3TÐ3-'&8!9$!16<9
The tepuis (table mountains) of northern South America
represent an archipielago of sky islands characterized by an
important endemism. The relative importance of isolation
and dispersal in this region, known as the Pantepui, has
La conservación y monitoreo de avifauna en la región
Neotropical requiere de participación activa desde la
ornitología y un compromiso de pobladores locales para
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
ID t
asegurar su continuidad. Resulta entonces necesario buscar
iniciativas que fomenten la articulación entre el sector
académico y las comunidades locales de Latinoamérica.
Desde 2010, la autoridad ambiental del sur de la Amazonia
colombiana CORPOAMAZONIA inició un proyecto de
establecimiento de Áreas de Importancia para la Conservación
de Aves en Putumayo, al sur de Colombia. Desde ese
momento, se iniciaron una serie de esfuerzos en recopilación
y levantamiento de información, así como capacitación a
observadores de aves de las comunidades del Putumayo
en tres fases: 1) valle de Sibundoy o Andes superiores del
Putumayo, 2) piedemonte del Putumayo, y 3) llanura amazónica
del Putumayo. Los pobladores locales que iniciaron los
procesos de capacitación son ahora observadores de aves
agremiados y comprometidos con la conservación de su
entorno, y algunos han empezado a contribuir con información
de la avifauna a nivel nacional; como la segunda localidad
en Colombia de Doliornis remseni y el primer registro en
Colombia de Glaucidium parkeri. Además de la capacitación y
levantamiento de información, se ha planteado la publicación
de guías de campo locales que sirvan de herramienta a los
observadores de aves en formación. La guía de aves del valle
de Sibundoy ya se publicó, se encuentra en impresión la guía
de aves del piedemonte del Putumayo y se está elaborando
la guía de aves de la llanura amazónica del Putumayo.
452 Acciones de conservación para las aves de las
!+'£S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
Lagunas de Volcán, provincia de Chiriquí, Panamá
Karla Aparicio Ubillús
+<-£!!86Ð!f!2!1Æ
08£!W!6!8-$-3|+1!-£W$31
$ORFFLGHQWHGH3DQDP£HVSHF¯ĆFDPHQWHHQODORFDOLGDG
de Volcán en la provincia de Chiriquí, existe un sistema de
lagunas a 1,200 msnm, que forma parte de las áreas núcleo
de la Reserva de Biosfera La Amistad Panamá, está dentro
del Megasitio La Amistad y a esa altitud, es la única área
compuesta por un complejo de hábitats entre áreas boscosas,
arbustos, cafetales, espejos de agua y marismas, que son el
refugio de por lo menos 150 especies de aves. Por dos años
consecutivos (2010 y 2011) se realizaron monitoreos de las
aves (4 pulsos) desde enero a abril y se documentaron especies
que hacen de este sitio como uno de los preferidos para la
observación de aves. En el 2013-2014, se inició otro proceso
para establecer el Plan de Conservación para la Subcuenca del
Río Caisán, Chiriquí con la metodología de Estándares Abiertos.
'HORVREMHWRVGHFRQVHUYDFLµQLGHQWLĆFDGRVSDUDHOVLWLR
se seleccionaron a la Penelope purparacens y a las Lagunas
GH9ROF£Q6HGHĆQLHURQODVDPHQD]DV\VHJ¼QHO0,5$',
DOVLWLR&DLV£QVHOHGHWHUPLQµXQDFDOLĆFDFLµQGHDPHQD]D
de ALTO y el análisis de viabilidad de sus cuatro objetos de
conservación resultó REGULAR, lo cual es preocupante
porque con esta investigación se evidencia el deterioro
de la subcuenca ocasionado principalmente por acciones
antropogénicas. Se presenta una propuesta de indicadores para
evaluar el estado y condición de los objetos de conservación.
{փdփTT
ID t
ABSTRACT
t
453 Relationships between landscape structure and
trophic guilds of birds in Azapa valley, Chile
Francisco Santander1*, Juan Aguirre2, María Angélica
Vukasovic1, Sergio Alvarado1, Cristián Estades1
ID t
ABSTRACT
t
Table of Contents
using these resources due to the high replacement of native
vegetation has suffered from development of agriculture.
454 Evolution of avian eggshell structure: evidence
ǢW2-='89-;@3(,-£'TǣW2-Õ2&'82-;Õ£3+39&',-£'
for adaptation across elevational gradients?
r($3/9!2;!2|<W<$,-£'W$£
David Ocampo1*, Carlos Daniel Cadena1, Gustavo A. Londoño2
ǢW!#38!;38-3&'-3£3+Ð!=3£<ধ=!&''8;'#8!&39T'6!8;!1'2;3&'-'2$-!9
-3£Õ+-$!9T2-='89-&!&&'392&'9T3+3;ÆT3£31#-!T
ǣW'6!8;!1'2;3&'-'2$-!9-3£Õ+-$!9T2-='89-&!&T!£-T3£31#-!
7KHLGHQWLĆFDWLRQDQGDQDO\VLVRIHFRORJLFDOJXLOGVKDYHEHHQ
fundamental to understand the processes that determine the
structure and organization of communities. Studies about
birds communities and his relationships with the landscape
structure are scarce in the valleys of the Atacama desert. We
estimate the density of trophic guilds of carnivore, granivore,
LQVHFWLYRUHDQGQHFWDULYRUHELUGVZLWKĆ[HGFRXQWVSRLQWV
in 109 stations (6 points per station) during spring (October)
between 2006 and 2014. In addition, in every station we
characterize the percentage of vegetation cover, along with
other variables such as the abundance of water, bare soil
and human constructions, among others. Using regression
analysis (GLM) we determine that density of carnivores is
H[SODLQHGVLJQLĆFDQWO\DQGSRVLWLYHO\SRQO\E\WKH
presence of water. The density of insectivorous birds and
QHFWDUIHHGLQJZDVH[SODLQHGVLJQLĆFDQWO\DQGSRVLWLYHO\E\
the coverage of water, trees, parks, olives and citrus. A positive
association between landscape features and granivores guild
was detected only detected a negative association with the
presence of water, bare soil and meshes to control aphids.
The importance of exotic vegetation like olive trees, citrus
gardens and parks indicate that the birds of the valley are
!+'S8!¡8'9'2;!ࣅ329
r&W3$!163Ǣǡ|<2-!2&'9W'&<W$3
To understand the elevation distribution in birds is important to
consider their breeding biology and how birds are responding
to different nesting conditions. It’s known, that eggshell of
birds evolved to colonize novel environments, to guarantee
the correct embryonic development during incubation. Since
eggshell structure is leading the gas exchange between the
embryo and the external ambient, the shell should be thicker
and with less pore density to reduce the water loss and gas
exchange in dry and cold ambient, like high-elevation, to avoid
the desiccation of the embryo. One ideal place to test this
hypothesis of adaptation of the eggshell in tropical birds is the
Andes. We evaluated differences in gases conductance rates
and eggshell structures, using gases diffusion experiments and
scanning electron microscopy. Our functional experiments,
involving more than 100 species of Neotropical birds, support
the hypothesis that gas diffusion rates across the eggshell
vary along elevational gradients. Comparative phylogenetic
analyses indicated that eggshell conductance is highly
labile evolutionarily and we documented patterns of trait
{փdփTT
ID t
ABSTRACT
t
evolution consistent with adaptation by natural selection to
better retain water vapor in environments with higher gas
diffusion rates. However, the mechanisms related to eggshell
characteristics underlying this pattern are not the same across
our study groups. We found at least two different strategies
in variations of the eggshell structure to cope for differences
in the gasses diffusion rate of the environment, involving
changes in pore characteristics and eggshell thickness.
455 Diversidad y composición de la avifauna en un gradiente
altitudinal de Norte de Santander, Colombia
Carol Andrea López R.1*, Nabhi Romero R.2, Daira
Ximena Villagran3, Linda Carolina Díaz D.4
ǢW2-='89-&!&'&!+Õ+-$!@'$23£Õ+-$!&'3£31#-!TǣW
2-='89-&!&!$-32!£&'3£31#-!TǤW2-='89-&!&-9;8-;!£
8!2$-9$339Ì&'!£&!9TǥW32ধ)$-!2-='89-&!&!='8-!2!
r$£36'AW$32938$-3W99!|+1!-£W$31
La variación altitudinal de las montañas genera gradientes
climáticos, lo que conduce a hábitats y coberturas vegetales
distintas, y a su vez, a comunidades faunísticas diferentes.
El departamento de Norte de Santander, que hace parte de
ODFXHQFDKLGURJU£ĆFDGHO&DWDWXPERWLHQHXQDYDULHGDGGH
ambientes desde los 30m hasta los 4000m. Predominan los
ecosistemas del Zonobioma húmedo tropical del Catatumbo,
y comprende las zonas de piedemonte de la cordillera
oriental en Colombia. El presente estudio tuvo el objetivo
GHLGHQWLĆFDUODFRPSRVLFLµQGHODDYLIDXQDHQXQJUDGLHQWH
altitudinal desde los 80m hasta 1925m. Para esto se realizaron
!+'£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
recorridos de observación de aves durante 16 días y se
GHWHUPLQµODFRPSRVLFLµQćRU¯VWLFDGHO£UHD6HGHVDUUROOµ
XQDQ£OLVLVGHFODVLĆFDFLµQHQWUHODVFREHUWXUDVYHJHWDOHV
LGHQWLĆFDGDVXWLOL]DQGRHO¯QGLFHGH%UD\&XUWLVFRQHOĆQ
GHLGHQWLĆFDUVL«VWDVVHDJUXSDEDQHQODVGLIHUHQWHVDOWXUDV
estudiadas. Se registró un total de 3611 individuos de 184
especies en 15 coberturas vegetales a lo largo del gradiente
DOWLWXGLQDO/DFRPSRVLFLµQćRU¯VWLFDGRPLQµFRQODVHVSHFLHV
Myrsine guianensis y Vismia baccifera para el gradiente
de 900 m a 1925 m; y con las especies Cupania americana,
;\ORSLDDURPDWLFD\3URVRSLVMXOLćRUDSDUDHOJUDGLHQWH
inferior. La similitud más representativa (cercana al 50%)
estuvo entre las coberturas de Bosque de galería y Mosaico
de cultivos, pastos y espacios naturales, y entre Vegetación
secundaria alta y Bosque fragmentado con vegetación
secundaria. A medida que el gradiente altitudinal cambia,
la diversidad de aves y plantas es diferente, aumentando
la riqueza de especies de gran interés para la región.
460 Distribuição histórica e declínio populacional
da espécie Pyrrhura griseipectus
Fabio Nunes1,2*, Ileyne Lopes1, Weber Silva1, Ciro Albano1,
Alberto Campos1, jason Mobley1, Luiz Mestre2
ǢW7<!9-9TǣW
r(!#-3|!7<!9-9W38+
O periquito da cara suja é considerado criticamente ameaçado
GHH[WLQ©¥RFRP£UHDGHYLGDUHVWULWD¢VćRUHVWDV¼PLGDV
de serras do Nordeste brasileiro. Neste estudo avaliamos
{փdփTT
ID t
ABSTRACT
t
ID t
a tendência populacional da espécie comparando dados
pretéritos e atuais de ocorrência. Os dados foram obtidos
em 25 expedições, combinando consulta a 10 museus, busca
ativa em campo e 268 entrevistas com moradores, conduzidas
entre 2008 a 2014. Dos 50 exemplares analisados em museus,
29 possuíam procedência detalhada. Já os levantamentos
etnobiológicos apontaram a ocorrência pretérita da espécie
em ao menos 15 localidades desde a década de 1950. Os
levantamentos de campo apontaram a presença atual da
espécie apenas no Ceará, na Serra de Baturité, em Quixadá; e
uma nova localidade, em Ibaretama (CE). Apesar da descoberta
destas novas localidades, nossos resultados apontam uma
cronologia indubitável de decréscimo da espécie em menos
de 50 anos. Na década de 50 registramos 15 pontos de
ocorrência em quatro estados brasileiros (CE, RN, PB, PE),
na década de 1970 registramos 11 pontos (CE e PE), na
década de 1990 oito pontos, e 2014 apenas três localidades
(descritas acima). Deste modo, mostramos um declínio
histórico alarmante da área de ocorrência e consequentemente
número de indivíduos, provocadas principalmente pela
SHUGDGHKDELWDWHRWU£ĆFRLOHJDOGHDQLPDLVVLOYHVWUHV
461 Beyond new species: deforestation in unexplored
!+'£S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
areas in the Amazon basin may lead to an
irreversible loss of ornithological knowledge
Marco A. Rêgo1*, Glaucia Del-Rio1, Vitor Q. Piacentini2,
Morton L. Isler3, Gustavo A. Bravo4
ǢW<9'<13(!;<8!£$-'2$'3<-9-!2!;!;'2-='89-;@TǣW$!&'1@
3(!;<8!£$-'2$'93(8'?'£2-='89-;@TǤW'6!8;1'2;3('8;'#8!;'
33£3+@f-8&9T!ধ32!£<9'<13(!;<8!£-9;38@T1-;,932-!2
29ধ;<ধ32TǥW<9'<&' 33£3+-!&!2-='89-&!&'&'È3!<£3
r6@83&'8<9|+1!-£W$31
Fields such as avian taxonomy, systematics and evolution are
KLJKO\GHSHQGHQWRQVFLHQWLĆFVSHFLPHQVDQGWKHLQIRUPDWLRQ
associated with them. Furthermore, the geographic provenance
RIVSHFLPHQVLVDOVRXVHIXOIRUGHĆQLQJSURWHFWHGDUHDV
Because deforestation in Amazonia has increased exponentially
during the last 40 years and forecasts are highly pessimist,
informed conservation actions are crucial. Using Ornithological
Gazetteers and point locality data from nearly 30,000 museum
specimens of the widely distributed genera Phaethornis,
Hypocnemis, Myrmotherula, Epinecrophylla, and Willisornis, we
assembled a database representing Amazonian collecting
sites during the last 200 years. Mapping and combining these
data with deforestation predictions, we identify current and
potential gaps in ornithological knowledge in Amazonia. Our
results show that ca. 64% of the Amazon basin has never been
surveyed, and within the next 35 years more than 48% of this
unsampled area is expected to be lost due to deforestation.
Amazonia is a natural laboratory for biogeographical studies
that provides important insights on ecological and evolutionary
{փdփTT
ID t
ABSTRACT
t
processes. Thus, beyond new species, unique habitats, and
genetic diversity, current deforestation trends could lead
to a striking loss of knowledge on biogeographic patterns,
contact zones and ecological interactions. The creation of
protected areas and implementation of strict deforestation
regulations might represent a useful tool to mitigate diversity
ORVVLQ$PD]RQLD8OWLPDWHO\ZHVXSSRUWFRQWLQXRXVVFLHQWLĆF
collection of bird specimens to subsidize conservation and
explore a fundamental part of Neotropical diversity.
462 Geographic variation of Henicorhina
leucophryspopulations in Venezuela
Fernando Machado-Stredel1*, Jhonathan Miranda1,
John Klicka2, Jorge L. Pérez-Emán1
ǢW29ধ;<;3&' 33£3+Ð!@$3£3+Ð!836-$!£T2-='89-&!&'2;8!£
&''2'A<'£!TǣW'6!8;1'2;3(-3£3+@{<80'<9'<13(
!;<8!£-9;38@!2&<£;<8'T2-='89-;@3(!9,-2+;32
r(W1!$,!&3W9;8'&'£|+1!-£W$31
H. leucophrys (Troglodytidae) has eighteen subspecies
distributed from Mexico to Bolivia, being one of the most
diverse group in the wren family. Five of these taxa can be
found in northern Venezuela and have been described on the
basis of subtle plumage differences but individual variation
has not been thoroughly evaluated. Previous studies of
pairs of subspecies in altitudinal gradients in Ecuador and
Colombia have shown considerable genetic divergence. In
this study we aimed to characterize the geographic variation
RIWKHĆYHVXEVSHFLHVGLVWULEXWHGLQ9HQH]XHODXVLQJWZR
mitochondrial genes (ATPase6-8) and classical morphological
!+'£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
characters. Our phylogeographic analysis showed seven
lineages with considerable amount of genetic differentiation
between them (6-8%), suggesting that at least the subespecies
tamae, meridana and venezuelensis were paraphyletic. We
DOVRIRXQGSUHYLRXVO\XQNQRZQVLJQLĆFDQWGLIIHUHQFHVLQ
tail, tarsus and bill lengths and, using colorimetric analysis
with digital photography, we found concordant patterns
of differentiation on the color of ventral plumage patches
and on the pattern of streaks on the throat. We discuss
WKHFRQVHTXHQFHVRIWKHVHĆQGLQJVIRUWKHFXUUHQWVSHFLHV
taxonomy and highlight the importance of using multiple
characters when describing the geographic variation of species.
465 Aphrastura spinicaudachange their reproductive
strategy with altitude in the Andean
temperate forest of South America
Tomás A. Altamirano1*, J. Tomás Ibarra2, Mariano De la
Maza3, Sergio A. Navarrete4, Cristián Bonacic1
ǢW
!<2!<9;8!£-9-£&£-('!#38!;38@T32ধ)$-!2-='89-&!&
!;Õ£-$!&',-£'TǣW'2;8'(3866£-'&329'8=!ধ32'9'!8$,T
2-='89-;@3(8-ধ9,3£<1#-!T!2!&!TǤW!ধ32!£
38'9;8@'8=-$'T
ǥW9;!$-Õ239;'8!&'2='9ধ+!$-32'9!8-2!9!2&'2;'8(38
!8-2'329'8=!ধ32T32ধ)$-!2-='89-&!&!;Õ£-$!&',-£'
r;!!£;!1-|<$W$£
Elevational gradients have been proposed as a driver of change
in avian reproductive life history strategies. The eventual
shorter breeding season and higher predation risk at high
altitudes can produce a decline in fecundity, a reduction of
clutch sizes, and an increase in parental care and survival.
{փdփTT
ID t
ABSTRACT
t
ID t
We studied whether the breeding strategy of Aphrastura
spinicauda varies along an elevation gradient in the Andean
temperate forests of Chile. We installed 240 nest-boxes
between 260 and 1,115 m a.s.l., and monitored the breeding
activity of 162 nests over two seasons (2010-2011, 2011-2012).
As predicted, the breeding season was 28% and 55% shorter in
highland forests during the two seasons. Timing of egg laying
(1 egg every second day) and incubation period (average 15
days) did not vary with altitude. We found smaller clutch sizes
(average 4.1 vs. 4.5), a fewer number of nestlings per clutch
(average 3.5 vs. 4.2), and longer nestling period (22.2 vs. 21.6
days) in highland than lowland forests. The breeding success
declined with altitude, mainly due to predation by Dromiciops
gliroides which was 83% in highland and 35% in lowland
IRUHVWV2XUĆQGLQJVVXJJHVWWKDW$SKUDVWXUDVSLQLFDXGD
change its reproductive strategy along altitudinal gradients
to a slower one, likely as an adaptation to shorter breeding
seasons. Yet, these changes do not appear to compensate for
the increased predation rates at higher elevations, questioning
WKHSRWHQWLDODGDSWLYHVLJQLĆFDQFHRIWKLVVWUDWHJ\
466 Conectividad de humedales altoandinos y diversidad de los
!+'£S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
ensambles de aves en la región de Tarapacá, Norte de Chile
Paola Araneda1*, Walter Sielfeld1, Vinko Malinarich2,
Venecia Herrera1, Cristian Carrasco1
ǢW'2;83&'2='9ধ+!$-Õ2'2'&-31#-'2;'T2-='89-&!&
8;<838!;TǣW'8=-$-3+8Ð$3£!!2&'83
r!8!2'&!W6!3£!|+1!-£W$31
Las aproximaciones tradicionales a la conservación de
humedales, centradas en la protección de sitios aislados,
pueden ser estrategias poco exitosas a largo plazo. La
ecorregión altoandina posee el mayor porcentaje de especies
exclusivas de Chile, debido a que corresponden a especies de
distribución local o cuyo límite distribucional sur es el altiplano
chileno. El objetivo de este trabajo es caracterizar los ensambles
GHDYHVHQKXPHGDOHVDOWRDQGLQRV3DUDHVWRVHFODVLĆFDURQ
6 humedales y se realizaron conteos estacionales. Utilizando
diversidad alfa, beta temporal, beta espacial y gamma se
evaluaron las conexiones bióticas de los humedales. Se registró
un total de 66 especies distribuidas en 24 familias. Las más
representativas fueron Furnariidae, Tyrannidae, Thraupidae,
Anatidae, Phoenicopteridae, Charadriidae y Scolopacidae.
Las especies migratorias corresponden a Pluvialis dominica,
Calidris bairdii, C. melanotos, C. pusilla, 7ULQJDćDYLSHV y Phalaropus
tricolor. Los humedales con mayor diversidad alfa corresponden
DVLWLRVFRQDOWDKHWHURJHQHLGDGHVSDFLDOORVFXDOHVGLĆHUHQ
VLJQLĆFDWLYDPHQWHGHORVVLWLRVP£VKRPRJ«QHRVS
La variabilidad climática de la zona genera altos valores de
diversidad beta temporal. La diversidad beta espacial no
PRVWUµGLIHUHQFLDVVLJQLĆFDWLYDVHQWUHORVHQVDPEOHVS!
{փdփTT
ID t
ABSTRACT
t
sin embargo, se observa una tendencia al agrupamiento
entre humedales de las mismas características. La diversidad
registrada en los humedales representa >50% de la diversidad
gamma para la ecorregión. Se concluye que humedales de la
zona presentan conexiones bióticas, interactuando unos con
otros, aunque estos presenten características distintas.
468 Diseño y establecimiento de una biblioteca bioacústica
de referencia de las aves del Suroccidente Colombiano
Carlos M Trujillo-Torres1*, Ronald A. FernándezGómez2, Jhon Jairo Calderón-Leyton1
ǢW8<63&'2='9ধ+!$-Õ2'2$3£3+Ð!=3£<ধ=!T2-='89-&!&
&'!8-Ó3TǣW!#38!;38-3-3£3+Ð!&'£31638;!1-'2;3T
29ধ;<;3&''<83';3£3+Ð!T2-='89-&!&'8!$8<A!2!
r$1;8</-££3ӑӐ|+1!-£W$31
Mantener una adecuada, buena y exacta documentación de
las grabaciones acusticas, así como de la información biológica
y metadatos asociados a cada registro es fundamental
SDUDHOWUDEDMRFLHQW¯ĆFRFRQORVVRQLGRV(VWHREMHWLYRVH
logra Diseñando y estableciendo una Biblioteca de sonidos
ambientales que tenga un sistema funcional que regule todo
el proceso de obtención, almacenamiento, administración y
XVRĆQDOGHFDGDUHFXUVRVRQRUR'DGDODSRVLFLµQJHRJU£ĆFD
estratégica de Nariño, en medio de los Andes del norte y
del Sur, la implementación y articulación de la biblioteca
acústica en la Universidad de Nariño en conjunto con otras
entidades gubernamentales y no gubernamentales, permitirá
estructurar y consolidar las bases para el desarrollo de las
investigaciones en bioacústica en el suroccidente de Colombia y
!+'£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
en el Ecuador. Para la implementación de la Fonoteca SONARse siguen procesos de almacenamiento y gestión de archivos
sonoros, diseño de manuales, formatos de datos y metadatos,
protocolos de obtención, almacenamiento y manejo, diseño
de manuales para el acceso y uso de los archivos sonoros y
sus datos asociados. Adicionalmente se realizan procesos
de compilación y recolección de información acústica, de
LGHQWLĆFDFLµQ\FRPSOHPHQWRGHORVYDF¯RVGHLQIRUPDFLµQ
acústica para las aves de la región. Esto ha permitido
integrar diversas áreas del conocimiento en el estudio
biológico, comportamental, evolutivo y de la conservación
de las especies, las temáticas ambientales, las propiedades
físicas de los sonidos naturales y el trabajo con sonido.
470 The Critically Endangered Hooded Seedeater
(Sporophila melanops) is a capuchino with a melanistic
cap and complicates the taxonomy of the group
Juan I. Areta1*, Vitor de Q. Piacentini2, Elisabeth Haring3, Anita
Gamauf3, Luis F. Silveira2, Erika Machado2, Guy M. Kirwan4
ǢWfTǣW<9'<&' 33£3+-!&!2-='89-&!&'&'
È3!<£3l mTǤW<9'<13(!;<8!£-9;38@-'22!T'2;8!£
'9'!8$,!#38!;38-'9TǥW
-'£&<9'<13(!;<8!£-9;38@
r'96383)£!|@!,33W$31W!8
Known solely from a unique male collected in central Brazil in
the 19th century, the Critically Endangered Hooded Seedeater
Sporophila melanops has been one of the great enigmas of
Neotropical ornithology. We reanalysed the morphology of
the type specimen, as well as a female specimen postulated
to represent the same taxon, and sequenced mitochondrial
{փdփTT
ID t
ABSTRACT
t
ID t
DNA (COI and Cyt-b) of both individuals. We visited the type
locality and its environs on multiple occasions at different
seasons, searching for birds with similar morphology to the
type, without success. Available evidence demonstrates that
the type of S. melanops is not closely related to Yellow-bellied
Seedeater S. nigricollis, as has been frequently postulated,
but is in fact a representative of the capuchinos clade. Our
morphological analysis indicates that the most likely possibility
is that the male specimen is a Dark-throated Seedeater
6UXĆFROOLV collected within its wintering range, acquiring
breeding plumage and showing melanism on the cap feathers;
alternatively, it may be a melanistic-capped individual of a
local population of seedeaters known to breed in the Esteros
del Iberá, Corrientes, Argentina, to which the name 6UXĆFROOLV
might be applicable, whilst the name S. plumbeiceps might
be available for what is currently known as6UXĆFROOLV. The
purported female specimen pertains either to S. nigricollis or
to Double-collared Seedeater S. caerulescens. Morphological
conclusions agree with our molecular results. A hybrid origin
of S. melanops cannot be ruled out from the available data,
but seems unlikely. We conclude that Sporophila melanops
is not typical of any natural population of seedeaters.
471 Fragmentación de hábitat deSpizella worthenien
!+'£S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
la Meseta Central del Altiplano Mexicano
Mirna Almejo-Ramos1*, Laura Scott-Morales2, Patricia
9HOD&RLIĆHU3, Carlos Palomera-García1
ǢW'2;832-='89-;!8-3&'£!39;!<8T2-='89-&!&&'<!&!£!/!8!T
ǣW
!$<£;!&&'-'2$!9
38'9;!£'9T2-='89-&!&<;Õ231!&'<'=3
'Õ2TǤW29ধ;<;3'$23£Õ+-$3&'32;'88'@T!16<932;'88'@
r8!139W1-82!!|+1!-£W$31
El gorrión de Worthen (Spizella wortheni) es una especie de
la familia Emberizidae, endémica del Altiplano Mexicano que
actualmente se considera en peligro de extinción. La escasa
información existente sobre la especie, resulta en un vacío
sobre su verdadero estado poblacional y distribución. El
objetivo principal de este trabajo es analizar la fragmentación
del hábitat natural de la especie y su distribución a partir de
registros de anidación en la Meseta Central del Altiplano
Mexicano dentro de los estados de Coahuila, Nuevo León y
6DQ/XLV3RWRV¯6HUHDOL]µXQDFODVLĆFDFLµQVXSHUYLVDGDGH
la imagen satelital Landsat 8, 2014 en la cual se ubicaron 14
clases de vegetación; el análisis de fragmentación se llevó
a cabo mediante Fragstats ver 4.2. Durante la temporada
de reproducción mayo-julio 2012 a 2014 se encontraron
QLGRVHQ0DWRUUDO'HV«UWLFR0LFUµĆOR/RVSDUFKHV
habitados por la especie tienen un promedio de 11,943 ha
(± 4491.8) con un máximo de 20621 ha, y un mínimo de
0.59 ha. La distribución de los nidos en cada estado fue de
27 en Nuevo León, 25 en Coahuila y 39 en San Luis Potosí.
El grado de fragmentación es de 0.5898 y los parches
habitados presentan un promedio de 12.76 km al parche
{փdփTT
ID t
ABSTRACT
t
mas cercano. Se determinó que existe una correlación
SRVLWLYDHQWUHHOQ¼PHURGHQLGRVSRUSDUFKH\ODVXSHUĆFLH
GHOSDUFKHS /RVUHVXOWDGRVFRQĆUPDQ
una distribución fragmentada de la especie con pequeñas
poblaciones distribuidas en toda la Meseta Central del Altiplano
0H[LFDQRGRQGHODSHUPDQHQFLDGHVXSHUĆFLHVDPSOLDVGH
0DWRUUDO'HV«UWLFR0LFUµĆORHVUHOHYDQWHSDUDODQLGDFLµQ
475 3DWURQHVELRJHRJU£ĆFRVGHODDYLIDXQDGHDOWD
montaña en el Departamento de Nariño
Edna Calpa1*, Elkin Noguera-Urbano2, Jhon Jairo Calderón-Leytón1
ǢW8<63&'2='9ধ+!$-Õ2'2$3£3+Ð!=3£<ধ=!T2-='89-&!&
&'!8-Ó3TǣW'6!8;!1'2;3&'-3£3+Ð!=3£<ধ=!T
!$<£;!&&'
-'2$-!9W2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3
r#-3'&2!,|+1!-£W$31
& PHYLOGEOGRAPHY
En este estudio se analizaron los patrones de riqueza y las áreas
de endemismo de la avifauna de alta montaña del departamento
de Nariño. Para ello se revisaron registros de distribución
de las aves en catorce complejos paramunos de Nariño, se
FXDQWLĆFDURQORVQ¼PHURVGHUHJLVWURV\ULTXH]DGHDYHVSRU
complejo paramuno para determinar vacíos de información, se
aplicó una prueba de correlación no paramétrica de Spearman
entre la riqueza de cada complejo paramuno y su área para
evaluar la tendencia de la relación riqueza-área considerando
que en las islas existe una relación directa entre las dos
YDULDEOHVĆQDOPHQWHVHDSOLFµXQ$Q£OLVLVGH3DUVLPRQLDGH
(QGHPLVPRVSDUDLGHQWLĆFDUODV£UHDVGHHQGHPLVPR6H
obtuvieron 1.231 registros de aves para ocho páramos en 31
!+'£¢S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
localidades; seis páramos no presentan información sobre
aves. Los registros representaron a 178 especies, incluidas
las especies migratorias. El análisis de correlación entre el
número de especies y el área indicó una relación positiva
SHURQRVLJQLĆFDWLYDORFXDOLQGLFDTXHKD\XQDOHYHWHQGHQFLD
VHPHMDQWHDODVLVODV)LQDOPHQWHVHLGHQWLĆFDURQFLQFR£UHDVGH
endemismo con un anidamiento progresivo desde los páramos
del occidente de Nariño hasta incluir en una gran área todos
los páramos, la conformación de las áreas de endemismo
indica que ocurrieron diferentes procesos de expansión
y contracción durante los ciclos glaciares e interglaciares
del Pleistoceno y el Holoceno, los cuales han aislado
progresivamente la biota, pero en este caso desde el occidente.
481 Aproximación a la vulnerabilidad de la
avifauna al cambio climático en un paisaje del
departamento de Cundinamarca, Colombia
Juan Miguel Ruiz Ovalle
<2&!$-Ö2$3;8Ö6-$3f3£31#-!
/183$!2&'-|@!,33W$31
En el trópico las aves de zonas altas, en especial las endémicas,
son muy afectadas por el cambio climático. Buscamos evaluar
su vulnerabilidad al cambio climático en una región de los andes
GH&RORPELD\VH³DODUDTXHOODVP£VYXOQHUDEOHV6HGHĆQLHURQ
seis paisajes, caracterizando el uso, la cobertura de vegetación
y el grado de fragmentación del territorio. Se determinó la
composición de la avifauna para corroborar la ocurrencia
de especies en el territorio y complementar su información.
{փdփTT
ID t
ABSTRACT
t
Para la evaluación de la vulnerabilidad al cambio climático,
VHLGHQWLĆFDURQGHWHUPLQDQWHVELROµJLFRVDIHFWDGRVSRUHO
cambio climáico usando la información de campo, el criterio
de experto y la información secundaria. Cada especie fue
FDOLĆFDGDHQWUH\GHSHQGLHQGRGHOQ¼PHURHLPSRUWDQFLDGH
los determinantes afectados. El 14% tuvo vulnerabilidad baja,
el 15% vulnerabilidad media y el 4% vulnerabilidad alta. De las
especies más vulnerables sobresalen las encontradas a más
GHPGHDOWLWXG\RVRQH[FOXVLYDVGHOERVTXHQDWXUDO
482 Revisiting ecogeographic hypotheses behind
latitudinal morphological variation: climatic
correlates of body size in Torrent Ducks
Natalia Gutierrez-Pinto1*, Elkin A. Tenorio2
ǢW2-='89-;@3(-!1-TǣW29ধ;<;3<1#3£&;
ID t
ABSTRACT
t
Table of Contents
5. Precipitation seasonality; 6. Productivity) by evaluating the
latitudinal morphological variation of Torrent ducks. Using
body mass data together with climatic data along four rivers
from Colombia, Peru and Argentina; we built generalized linear
models for each hypothesis and compared them using the
$NDLNH,QIRUPDWLRQ&ULWHULRQ$,&WRGHĆQHZKLFKYDULDEOHRU
variable combination) better explain spatial variation in Torrent
GXFNPRUSKRORJ\$OWKRXJKDOOPRGHOVVLJQLĆFDQWO\H[SODLQHG
some level of morphological variation, temperature seasonality
was the variable that better explained changes in body size;
FRQWUDU\WR%HUJPDQQèVUXOHSUHGLFWLRQVZHGLGQRWĆQGPHDQ
temperature as the most important predictor of body size
variation. The mechanism relating seasonality and Torrent duck
morphology implies that larger organisms cope better with
sudden environmental changes typical of greater latitudes? and
have better survival chances during resource shortage periods.
r2+<ধ|#-3W1-!1-W'&<
Latitudinal patterns of body size variation have been widely
studied in varied organisms. The observed increase in body
size towards higher latitudes in many endotherms has been
explained as a method to enhance body heat conservation
in cold habitats, which is known as the Bergmann’s rule. Still,
many environmental conditions other than temperature
also vary with latitude (i.e. precipitation, seasonality, and
productivity) and may also induce morphological changes
coherent with the observed pattern. We tested six hypotheses
using different climatic variables as predictors of body size
variation (1. Mean temperature; 2. Mean precipitation; 3. Mean
temperature and precipitation; 4. Temperature seasonality;
!+'£S8!¡8'9'2;!ࣅ329
491 Isolation of microsatellite markers in two sympatric
tinamou species, the Ornate Tinamou (Nothoprocta
ornata) and Darwin’s Nothura (Nothura darwinii)
Lina Maria Giraldo Deck1*, Alvaro Garitano-Zavala2,
Jan Christian Habel1, Harald Meimberg3
ǢW'6!8;1'2;(Ü8¿03£3+-'<2&¿039@9;'11!2!+'1'2;c'$,2-9$,'2-='89-;É;
Ü2$,'2TǣW29ধ;<;3&'$3£3+Ð!c2-='89-&!&!@38&'!22&8Ì9TǤW29ধ;<;
(Ü82;'+8!ধ='!;<89$,<;A(389$,<2+c2-='89-;É;(Ü83&'20<£;<8-'2
r£-2!W+-8!£&3|;<1W&'
Knowledge about natural history in tinamous is still scarce
and microsatellite markers are a helpful tool to elucidate
genetic aspects of mating systems and population structures
{փdփTT
ID t
ABSTRACT
t
in this familiy. In the present study 54 novel microsatellite
loci were isolated in two sympatric tinamou species, 30 in the
Ornate Tinamou (Nothoprocta ornata) and 24 in the Darwin’s
Nothura (Nothura darwinii7KH\ZHUHWHVWHGIRUDPSOLĆFDWLRQ
VXFFHVVJUDGHRISRO\PRUSKLVPDQGFURVVDPSOLĆFDWLRQ,Q
the Ornate Tinamou 25 loci were polymorphic and in the
Darwin’s Nothura 12, with moderate to high number of alleles
per locus (2-13 alleles for the Ornate Tinamou and 2-14 alleles
for the Darwin’s Nothura). The loci showed an expected
heterozygosity (HE) ranging from 0.061-0.909 in the Ornate
Tinamou and in the Darwin’s Nothura from 0.044-0.908.
7KHFURVVDPSOLĆFDWLRQZDVPRGHUDWHZKHUHRIWKHORFXV
WD[RQFRPELQDWLRQVVXFFHVVIXOO\DPSOLĆHG7KHVH
loci will be valuable tools for parentage tests and population
analyses in the Ornate Tinamou and the Darwin’s Nothura.
ID t
ABSTRACT
t
Table of Contents
of sedentary birds are also less pointed than those that are
migratory, and their AR is 15% lower than in migratory species.
My comparisons of the ecological and taxonomic variables that
FRXOGLQćXHQFHWKH:/DQG$5RIVHGHQWDU\VSHFLHVVKRZHG
effects of different magnitude. Elevation, vegetation type,
sensitivity to habitat disturbance, and range size had no effect
on either of the two metrics used. However, both foraging guild
and taxonomic family showed strong effects that are highly
VLJQLĆFDQW7KHWZRGLIIHUHQWPHWULFVRIZLQJVKDSHXVHGLQWKLV
investigation support the predictions of Seebohm’s Rules that
the wings of sedentary birds are more rounded and carry more
weight than any other bird with published data. The higher
WL and lower AR of sedentary species found in my study
suggests that these birds are less constrained by long-distance
movements than their migratory counterparts and that they
can pay the cost of an increased wing-loading and aspect ratio.
497 The wings of neotropical birds are more rounded
and carry more weight: a test of Seebohm’s rules
Ernesto Ruelas Inzunza
2-='89-&!&'8!$8<A!2!
8<'£!9W<=|+1!-£W$31
7KHZLQJVRIELUGVDQGRWKHUć\LQJDQLPDOVDUHVKDSHGE\
FKDUDFWHULVWLFVRIWKHLUćLJKW+HUH,WHVWWKHSUHGLFWLRQV
of Seebohm’s Rules using bird data from 71 species (347
individuals) of birds from different habitat types and elevations
in Costa Rica. I calculated the wing-loading (WL) and aspect
ratio (AR) of these species obtained the same metrics for 10
long-distance migrants. The mean WL of Neotropical birds is
20.73 N m-2, 23% larger than that of migratory birds. The wings
!+'££S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
502 Ecological and socio-economic factors
affecting extinction risk in parrots
George Olah1*, Stuart H.M. Butchart2, Andy Symes2,
IIiana Medina Guzmán3, Ross Cunningham1, Donald
J. Brightsmith4, Robert G. Heinsohn1
ǢW
'22'8$,33£3(2=-8321'2;!2&3$-';@T,'<9;8!£-!2
!ধ32!£2-='89-;@TǣW-8&-('2;'82!ধ32!£TǤW'6!8;1'2;3(
$3£3+@T=3£<ধ32!2&'2'ধ$9T'9'!8$,$,33£3(-3£3+@T,'
<9;8!£-!2!ধ32!£2-='89-;@TǥW$,<#3;?3ধ$-8&'!£;,'2;'8T
'6!8;1'2;3(';'8-2!8@!;,3#-3£3+@T'?!9{2-='89-;@
r+'38+'W3£!,|!2<W'&<W!<
Psittaciformes (parrots) face many threats in the wild and,
as a group, are considered amongst the most endangered
ELUGV+HUHZHFRQĆUPWKDWSDUURWVKDYHDORZHU5HG/LVW
Index of species survival than comparable bird species groups
ZDWHUELUGVUDSWRUVSLJHRQVJDPHELUGVDQGbVHDELUGV2XU
comparative analyses investigating the factors associated
ZLWKKLJKH[WLQFWLRQULVNLQSDUURWVFRQĆUPHGHVWDEOLVKHG
WUHQGVIRXQGLQRWKHUWD[DDQGbDOVRSURYLGHQHZLQVLJKWV2XU
PRGHOVLQFOXGHGLQWULQVLFELRORJLFDOOLIHKLVWRU\DQGbHFRORJLFDO
DWWULEXWHVDVZHOODVH[WHUQDODQWKURSRJHQLFWKUHDWVDQGbVRFLR
economic variables of the countries where the parrots occur,
while controlling for phylogenetic dependence among species.
We found that the likelihood of threatened status in extant
parrot species relates to historical distribution size, forest
GHSHQGHQF\ERG\VL]HJHQHUDWLRQWLPHDQGbSURSRUWLRQRI
human population living in urban areas in their home range.
The degree of threat (IUCN Red List category) was further
shown to be dependent on the GDP per capita of the countries
!+'£S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
RIRFFXUUHQFHVLQJOHFRXQWU\HQGHPLVPDQGbZKHWKHUWKH
VSHFLHVDUHXVHGDVSHWV:HDOVRLGHQWLĆHGVHYHUDOLPSRUWDQW
threats closely associated with urbanization that are raising
the extinction risk of parrots. We highlight countries where
conservation needs to be prioritized. Our results are important
for understanding the factors associated with endangerment
DQGbH[WLQFWLRQLQWKLVKLJKO\WKUHDWHQHGWD[RQRPLFJURXS
505 Chiroxiphia lanceolata y el Bosque Seco Tropical
del Valle Alto del Magdalena-Colombia
Katherine Certuche-Cubillos1*, Mario J Gômez-Martínez1,
Raul Sedano2, Raul Sedano2, Julian LLano Mejia1
ǢW2-='89-&!&&'£3£-1!TǣW2-='89-&!&&'£!££'
r0!;$'8;<$,'|+1!-£W$31
El saltarín cola de lanza (Chiroxiphia lanceolata), es un piprido
IUXJ¯YRURSHTXH³RFRQPDUFDGRGLPRUĆVPRVH[XDOTXHVH
distribuye desde el sur de Centroamérica (Sureste de Costa
Rica) hasta el Norte de Suramérica (extendiéndose hasta
noreste de Venezuela). En Colombia en la cuenca del río
0DJGDOHQD]RQDGHYLGDGH%RVTXH6HFRWURSLFDObVHGLVWLQJXHQ
dos poblaciones, una al sur distribuida en el Valle Alto del
Magdalena y otra al norte en la Región Caribe. Estudiamos una
población de C. lanceolata en Venadillo, Tolima, Alto Valle del
Magdalena, Colombia. Describimos aspectos de historia natural
del saltarín a partir de observaciones y 164 capturas entre
los años 2012-2014. La consulta de especímenes de museo
permitió establecer que esta población del sur se caracteriza
por tener un menor tamaño en atributos como la cuerda alar y
{փdփTT
ID t
ABSTRACT
t
longitud total comparado con la población del norte. Anillamos
el 74% de los individuos capturados y recapturamos 15
individuos. C. lanceolata es una especie frugívora y abundante
en esta localidad, que dispersa las semillas de al menos 11
especies vegetales, incluyendo las del árbol endémico Trichilia
oligofoliolata. A partir del registro de parche de incubación
encontramos un pico reproductivo entre febrero y mayo; el
seguimiento del estado del plumaje nos indicó una época de
PXGDHQPD\R\MXQLR(OK£ELWDWTXHSUHĆHUHHVWHSLSULGRHQ
la localidad corresponde a bosques primarios y secundarios
con sotobosques densos diversos en arbustos y lianas.
507 Distribuição e conservação do Barranqueiro-do-
Nordeste (Automolus lammi): uma espécie ameaçada
do Centro de Endemismo Pernambuco
Yuri Mendes1*, Flávia Pinto2, Luciano Naka1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3TǣW
ID t
ABSTRACT
t
Table of Contents
governo brasileiro e “vulneravel” pela IUCN. O objetivo deste
trabalho foi i) estimar a extensão de ocorrência (EO), ii) a
área de ocupação (AO), e iii) avaliar o status de conservação
de A. lammi, utilizando MNE e estimativas populacionais
em campo. Para modelar a distribuição de A. lammi usamos
o Programa MaxEnt e incluímos todas as 17 localidades
de ocorrência conhecidas para esta espécie. Baseados em
dados climáticos, calculamos a EO de A. lammi HPNPt
PHQRUGRTXHRVRVNPtHVWLPDGRVQDELEOLRJUDĆD
Utilizando camadas do uso do solo no Programa ARCGis,
UHWLUDPRVDV£UHDVLQDGHTXDGDVVHPYHJHWD©¥RćRUHVWDO
GD(2HFDOFXODPRVXPD$2SRWHQFLDOGHNPt%XVFDV
DWLYDVHPFDPSRFRQĆUPDUDPDSUHVHQ©DGH$ODPPLHP
fragmentos relativamente grandes (>100 ha), mas continuamos
realizando esforços em campo para estimar as densidades
populacionais, validar os modelos, e determinar o tamanho
mínimo de fragmento onde esta espécie ainda sobrevive.
r@<8-8!-!|@!,33W$31W#8
As modelagens de nicho ecológico (MNE) tem um papel
importante para descrever a extensão de ocorrência
potencial das espécies, auxiliando na avaliação do estado de
conservação de espécies raras ou ameaçadas de extinção.
Ao mesmo tempo, o uso de MNE podem ser úteis para
orientar futuras buscas em campo de espécies pouco
conhecidas ou com poucos pontos de ocorrência. Nós
aplicamos técnicas de modelagem para estudar o status de
conservação de Automolus lammi, espécie de ave restrita ao
centro de endemismo Pernambuco na Floresta Atlântica do
nordeste e atualmente considerada como “em perigo” pelo
!+'S8!¡8'9'2;!ࣅ329
508 Ecología funcional de ensamblajes de aves a
través de gradientes de cobertura vegetal en
bosques secos interandinos de Colombia
Néstor Espejo1*, Nathalie Morales1, Jorge Posada1
ǢW
<2&!$-Õ2!;<8!
r63A3@&-&&-|+1!-£W$31
El Bosque Seco Tropical (Bs-T) es un ecosistema amenazado
en Colombia, con distribución actual aproximada al 2% de su
cobertura original. En el marco de un plan de rehabilitación de
hábitat para la fauna, debido a la construcción y llenado de la
{փdփTT
ID t
ABSTRACT
t
represa del Quimbo en el alto Magdalena (Huila, Colombia),
se realizó un análisis de la ecología funcional de ensamblajes
de aves asociados a un gradiente de coberturas vegetales
(pastos limpios a relictos de Bs-T). Se evalúo la calidad de
hábitat de cada una de las coberturas y se determinó grupos
funcionales de aves con análisis de agrupamiento y distancias
de Goward, usando diferentes rasgos funcionales (masa,
dieta, sensibilidad ecológica, dispersión) recolectados con
transectos y redes de niebla entre septiembre de 2014 y
abril de 2015. Los grupos funcionales presentan diferencias
VLJQLĆFDWLYDVHQODFRPSRVLFLµQ\SDWURQHVGHDEXQGDQFLDFRQ
una menor redundancia funcional en los bosques y con mayor
diversidad funcional en arbustales. Las tendencias observadas
indican que la composición de grupos funcionales varía en el
gradiente de coberturas y los variables que explican mejor sus
abundancias estan relacionados con factores bióticos (biomasa
de insectos y cobertura arbórea) en especial para insectívoros
\IUXJ¯YRURV(VWDHYDOXDFLµQ\FXDQWLĆFDFLµQGHODGLYHUVLGDG
funcional permitió realizar una aproximación a las causas y
factores que mejor explican la presencia y abundancia de
grupos funcionales en un gradiente de complejidad vegetal.
514 Bird songs in the shelf: temporal patterns of songs
and vocal output are lost in sound archives
Oscar Laverde1*, Paula Caycedo2, Paulo Pulgarin1, Carlos Daniel Cadena1
ID t
ABSTRACT
t
Table of Contents
in behavioral ecology. However, information on the vocal
output is lacking for most species. In this study, we asked
whether the number of recordings of avian vocalizations
in three different sound archives and the times when such
UHFRUGLQJVZHUHREWDLQHGUHćHFWHVWLPDWHVRIYRFDORXWSXWDQG
temporal patterns of vocal activity obtained through systematic
monitoring of wild bird populations in three tropical forest sites.
%DVHGRQDVDPSOHRIPRQWDQHVSHFLHVZHIRXQGVLJQLĆFDQW
relationships between the number of recordings of species
detected through continuous monitoring over several months
and the number of recordings archived in sound collections. In
addition, daily activity patterns based on data collected through
continuous monitoring over several days did not differ from
those based on recordings archived in sound collections in 12 of
15 species of lowland birds. Annual patterns in vocal activity of
two species estimated based on recordings in collections closely
resembled previously published patterns. We conclude that
recordings in sound collections contain valuable information
about the vocal output and temporal patterns in vocal activity
of birds. This opens the possibility of using sound collections to
assess vocal output and to consider it as a variable of interest
in studies on the ecology and evolution of birds and other
animals that use acoustic signals for communication. We make
UHFRPPHQGDWLRQVIRUĆHOGZRUNHUVFRQWULEXWLQJWRVRXQG
archives to maximize the potential usefulness of their material.
ǢW2-='89-&!&&'£392&'9TǣW29ধ;<;3£'?!2&'8=32<1#3£&;
r3,!8!$3|+1!-£W$31
Understanding the frequency with which birds sing (vocal
output) is critical to address a variety of research questions
!+'S8!¡8'9'2;!ࣅ329
{փdփTT
ID t
ABSTRACT
t
532 Capacidade de dispersão das aves de ambientes
ribeirinhos no baixo Rio Branco, Roraima
Bruna Costa1*, Gisiane Lima1, Daniele Mariz1, Heverly
Menezes1, Yuri Raia1, Santiago Claramunt2, Luciano Naka1
ID t
ABSTRACT
t
Table of Contents
resposta das aves ao experimento propôs que a capacidade
de dispersão não é homogênea, apresentando diferenças
no alcance do vôo, acreditando que o padrão de suas asas
seja um dos fatores para essa variação na dispersão.
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3TǣW1'8-$!2<9'<13(!;<8!£-9;38@
r#8<2!1-8'£@Ǣӑ|+1!-£W$31
As aves são consideradas boas dispersoras, mas existe
variação na capacidade de voar. Esta variação pode estar
relacionada como o formato das asas, mas existem poucos
estudos que relacionem o vôo e a morfologia alar. Este
estudo avaliou a capacidade de dispersão das aves em
habitats ribeirinhos da Amazônia, testando se variáveis
morfométricas explicam o sucesso ou fracasso das aves em
atravessar um corpo dágua. Para realizar os experimentos,
capturamos aves e estas foram transportadas a 100, 200, e
300 m da margem, onde eram soltas para que retornassem
a margem. Realizamos 495 experimentos em 86 espécies
diferentes, de 21 famílias. Para correlacionar o resultado
dos experimentos com variáveis morfométricas, mediu-se as
aves, em campo e espécimes taxidermizados. Estas medidas
foram aplicadas em três equações (Índice de Kipp, Razão do
Aspecto, Capacidade de Transporte). Cerca de 67% das aves
obtiveram sucesso em atravessar a distância testada (36 spp.
tiveram 100 % de sucesso), e 15 spp. (6%) não atravessaram.
Duas famílias (Troglodytidae e Thamnophilidae) tiveram
sucesso em menos de 50 % dos experimentos, sugerindo uma
baixa capacidade de dispersão. O índice de Kipp foi o melhor
preditor de resposta aos experimentos, sugerindo que ele
seja importante para prever a capacidade de dispersão. A
!+'S8!¡8'9'2;!ࣅ329
542 6
SHFLHVVSHFLĆFGLIIHUHQFHVLQUHODWLYHH\HVL]H
are related to patterns of edge avoidance in an
Amazonian rainforest bird community
Diego Gil1*, Cristina Martínez Ortega1, Eduardo S.A. Santos2
ǢWTǣW2-='89-&!&'&'!3!<£3
r&-'+3W+-£|$9-$W'9
Eye size shows a large degree of variation among species, even
after correcting for body size. In birds, relatively larger eyes
have been linked to predation risk, capture of mobile prey,
and nocturnal habits. Relatively larger eyes enhance visual
acuity and also allow birds to forage and communicate in lowlight situations. Complex habitats such as tropical rain forests
provide a mosaic of diverse lighting conditions, including
differences among forest strata and at different distances
from the forest edge. We examined in an Amazonian forest
ELUGFRPPXQLW\ZKHWKHUPLFURKDELWDWRFFXSDQF\GHĆQHGE\
edge avoidance and forest stratum) was a predictor of relative
eye size. We found that relative eye size increased with edge
avoidance, but did not differ according to forest stratum.
Nevertheless, the relationship between edge avoidance and
UHODWLYHH\HVL]HVKRZHGDQRQVLJQLĆFDQWSRVLWLYHWUHQGIRU
species that inhabit lower forest strata. Our analysis shows
that birds that avoid forest edges have larger eyes than those
living in lighter parts. We expect that this adaptation may
{փdփTT
ID t
ABSTRACT
t
allow birds to increase their active daily period in dim areas
of the forest. The pattern that we found raises the question
of what factors may limit the evolution of large eyes.
551 Ectoparasites increase bacterial load on avian eggshells
Gustavo Tomás1*, David Martín-Gálvez2, Magdalena Ruiz-Rodríguez3,
Juan M. Peralta-Sánchez4, Manuel Martín-Vivaldi4, Juan J. Soler3
ǢW2-='89-&!&Ì$2-$!!8ধ$<£!8&'3/!lmTǣW<836'!23£'$<£!8
-3£3+@!#38!;38@T<836'!2-3-2(381!ধ$929ধ;<;'TǤW9;!$-Õ2
?6'8-1'2;!£&' 32!98-&!9l fmTǥW2-='89-&!&&'8!2!&!
r+;31!9|''A!W$9-$W'9
While direct detrimental effects of parasites on hosts are
relatively well documented, other more subtle but potentially
important effects of parasitism are yet unexplored. Biological
activity of ectoparasites, apart from skin injuries and blood
feeding, often results in blood remains, or parasite faeces
that accumulate and modify the host environment. In this
way, ectoparasite activities and remains may increase
nutrient availability that may favor colonization and growth
of microorganisms including potential pathogens. Here, by
WKHH[SHULPHQWDODGGLWLRQRIKHPDWRSKDJRXVćLHVCarnus
hemapterus, a common ectoparasite of birds) to nests of
spotless starlings Sturnus unicolor during incubation, we
explore this posible side-effect of parasitism which has rarely,
if ever, been investigated. Results show that faeces and blood
UHPDLQVIURPSDUDVLWLFćLHVRQVSRWOHVVVWDUOLQJHJJVKHOOVDW
the end of incubation were more abundant in experimental
than in control nests. Moreover, eggshell bacterial loads of
different groups of bacteria including potential pathogens
!+'S8!¡8'9'2;!ࣅ329
ID t
ABSTRACT
t
Table of Contents
were also higher in experimental nests. Finally, we also
found evidence of a link between eggshell bacterial loads
and increased embryo mortality, which suggests a bacterialmediated negative effect of ectoparasitism on host offspring.
Trans-shell bacterial infection might be one of the main
causes of embryo death and, consequently, this hitherto
unnoticed effect of ectoparasitism may be widespread in
nature and can profoundly affect our understanding of
ecology and evolution of host-parasite interactions.
569 The usefulness of beta diversity of wild bird
communities for conservation policies and
sustainable urban planning in La Paz city
Jackeline Campos Pastén1*, Álvaro Garitano-Zavala1
ǢW29ধ;<;3&'$3£3+Ð!f2-='89-&!&!@38&'!22&8Ì9
r/!$0'£-2'W$!16396|+1!-£W$31
When the conservation of Protected Areas is planned, alpha
diversity is used as the main biological indicator, while beta
diversity is frequently ignored. In La Paz city (Bolivia) 27 periurban and urban areas were declared as protected, but most of
them have no management plans or conservation actions and
currently several are being lost because of urban growth. We
calculated alpha and beta diversity of wild bird communities
in 18 Municipal Protected Areas (MPAs), in order to compare
with the diversity values of three types of urban environments:
“hard urban” (HU), “functional green areas” (FA) and “wild
fragments” (WF). Beta diversity for each MPA was the average
of the distance values of all the combinations of point-count
{փdփTT
ID t
ABSTRACT
t
pairs; as distance measure we used the quantitative Morisita
index. The alpha diversity was measured with the total richness
(S) and average exp-Shannon index (expH). Alpha diversity of
each of the MPAs (range of S: 46 to 8; range of expH: 7.30 to
4.51) did not exceed the alpha diversity of FAs (S = 42; expH =
6.66) nor WFs (S = 45; expH d = 6.63), but the beta diversity
RI03$VUDQJHWRZDVVLJQLĆFDQWO\KLJKHUWKDQWKH
beta diversity values of FA and WF (0.39 and 0.53). Results
show that the biological value of MPAs is underestimated
when alpha diversity is used to describe bird communities.
Consideration of beta diversity of bird communities would
LPSURYHXUEDQGHYHORSPHQWSROLFLHV,QWKHVSHFLĆFFDVH
of the La Paz city results suggest that the better way for
biological conservation is to protect all the MPAs and their
total area, in order to maintain their habitat heterogeneity.
576 Deslocamento altitudinal de aves na Serra do Mar
do Estado de São Paulo, Sudeste do Brasil
Fabio Schunck1*, Luis Fabio Silveira1
ID t
ABSTRACT
t
Table of Contents
de campo. Foram usadas 20 redes de neblina e as aves foram
PDUFDGDVFRPDQLOKDVGR&(0$9(,&0%LR)RUDPDQLOKDGRV
2.684 indivíduos, pertencentes a 98 espécies. Foram feitas
555 recapturas (45 espécies), sendo que 40 indivíduos (14
espécies) foram recapturados em cotas altitudinais distintas
das quais eles foram capturados e anilhados originalmente.
A família mais representativa foi Dendrocolaptidae, com 4
espécies. Oito tipos de deslocamentos foram detectados,
sendo 5 de 200 m e 3 de 400 m de altitude, além de alguns
indivíduos que se deslocaram por mais de uma cota, como
Rhopias gularis. Estes deslocamentos foram realizados em
períodos distintos ao longo do estudo, sem um padrão
temporal evidente, indicando a princípio uma aleatoriedade
entre os mesmos, porém novas análises serão realizadas
comparando estes dados com as informações obtidas de
maneira simultânea através do método quantitativo de
pontos de escuta. Mesmo não detectando padrões claros
de migração altitudinal, estas informações sugerem que
pelo menos outras 9 espécies ainda não citadas na literatura
realizam algum tipo de deslocamento vertical na Serra do Mar.
ǢW<9'<&' 33£3+-!&!
r(!#-3i9$,<2$0|@!,33W$31W#8
Os movimentos altitudinais de aves na Mata Atlântica e da
Serra do Mar ainda são pouco conhecidos. Para compreender
melhor este padrão, foram selecionados quatro pontos de
estudo situados em um gradiente localizado entre 30 e 800
m de altitude a.n.m. no Núcleo Curucutu do P.E. da Serra do
Mar, São Paulo, Brasil (23°59 ‘S, 46° 44’W). Entre maio de
2007 e junho de 2011, cada ponto foi amostrado por três
dias consecutivos por estação do ano, totalizando 142 dias
!+'S8!¡8'9'2;!ࣅ329
577 Habitat use and home ranges for focal avian species
in a highly fragmented Andean landscape
Carolina Montealegre-Talero1*, Luis Miguel Renjifo1
ǢW32ধ)$-!2-='89-&!&!='8-!2!
r#-3$!83|+1!-£W$31
/DQGVFDSHPRGLĆFDWLRQDQGIUDJPHQWDWLRQDUHZLGHVSUHDG
processes across the world and, as a consequence, ecosystem
connectivity is lost and local extinction of species occurs. This
{փdփTT
ID t
ABSTRACT
t
ID t
trend is particularly critical in the tropics, which harbor the
vast majority of earth’s biological diversity. Restoration of
corridors to enhance habitat connectivity has been proposed
as a valuable tool for increasing diversity at regional scales.
To evaluate the functionality of restored corridors, we
studied six bird species in a gradient of response to habitat
fragmentation. We placed radio-transmitters and followed
overall 13 individuals (from the six species) and evaluated
their home ranges and habitat use, using VHF radio telemetry,
across a landscape composed by pastures for cattle, remnants
of riparian forest, restored corridors, isolated trees, roads
and country houses. We found that all species mostly used
riparian forests and restored corridors over other type of
habitat to move across the landscape, regardless their habitat
association. None of the marked birds used isolated trees.
Calculated home ranges varied from 0.57 to 14.04 ha. Some
marked individuals were nesting and this might have affected
WKHYDOXHRIKRPHUDQJHV7KLVLVWKHĆUVWVWXG\WRHYDOXDWH
the importance of restored corridors for the movement
and habitat use of bird populations in a highly fragmented
but biodiverse location in the Central Colombian Andes.
578 Bioacoustics monitoring techniques to determine dpatial and
!+'S8!¡8'9'2;!ࣅ329
ABSTRACT
t
Table of Contents
temporal activity of forest birds on Socorro island, Mexico
Eduardo Iñigo-Elias1*, David Coso Muriel2, Antonio
Ortiz Alcaraz2, Alfonso Aguirre Muñoz2
ǢW382'££!#3(82-;,3£3+@TǣW8<63&'$3£3+-!@329'8=!$-32&'9£!9
r''-ǣ|$382'££W'&<
)RUHVWELUGFRPPXQLWLHVLQWKH3DFLĆFLVODQGVRI0H[LFRDUH
SRRUO\VWXGLHGDQGbIHZELRDFRXVWLFVGDWDKDVEHHQUHFRUGHG
(e.g., calls, songs). Yet many avian taxa are threatened
DQGbVRPHSHUKDSVDOUHDG\H[WLQFW:HWHVWZKHWKHUDFRXVWLF
surveys are an effective tool for monitoring species in remote
DQGbKDUGWRDFFHVVVLWHV+HUHZHSUHVHQWSUHOLPLQDU\UHVXOWV
IURPERWKPDQQHGDFRXVWLFUHFRUGLQJVDQGbDXWRQRPRXV
UHFRUGLQJVWRPRQLWRUODQGbELUGVSHFLHVRQIRXUKDELWDWRQ
6RFRUUR,VODQGbRIWKH5HYLOODJLJHGR$UFKLSHODJRRI0H[LFR:H
compare call rates for eight target bird species at different
WLPHRIWKHGD\DQGbREWDLQHGVSHFLHVSUHVHQFHGHWHFWLRQ
index. Multiple acoustic recordings were obtained from eight
WDUJHWODQGbVSHFLHVDQGbYRXFKHUHGDFRXVWLFVSHFLPHQVZHUH
VHFXUHIURP0DUFKDQGbDQDO\]HG,QDGGLWLRQ
four automatic recording units Song Meter SM2+ Recorder
ZHUHGHSOR\HGRQHSHUHDFKVSHFLĆFKDELWDWDQGbUHFRUGHG
DXWRQRPRXVO\HYHU\PLQDWWKHEHJLQQLQJRIHDFKKRXU
KUEHWZHHQb$SULO$WRWDORIPLQRIDXWRQRPRXV
recordings were analyzed. Our preliminary results suggest
that acoustic sensors could contribute to long-term monitoring
efforts of active vocal avian species in low diverse avian
DVVHPEODJHVDQGbZLWKUHODWLYHORZQRLVHVRXQGVFDSHV
{փdփTT
ID t
ABSTRACT
t
587 Female-biased sex ratio in the globally endangered
Lears Macaw (Anodorhynchus leari)
(ULFD3DF¯ĆFR1*, Thiago Filadelfo2, Tiago Ribeiro3,
Francisco V. Denés1, Cristina Miyaki3, José Tella1
ǢW3Ó!2!-3£3+-$!£;!ধ32TTǣW'6!8;1'2;3( 33£3+@T
2-='89-&!&'&'8!9Ð£-!TǤW2-='89-&!&'&'È3!<£3
ID t
ABSTRACT
t
Table of Contents
the macaws principal food item. Rainfall from all four periods
IDLOHGWRVLJQLĆFDQWO\SUHGLFWWKH65DQGQRUDLQIDOOPRGHOKDG
a better rank than the null model. Further research is needed
to understand the causes of the female-biased SR in Lears
Macaw nestlings and to assess the SR in the adult population.
r'8-$!6!$-)$3ӑǢ|+1!-£W$31
There is evidence for maternal control of the sex ratio (SR)
of offspring of birds modulated by food availability. In order
WRRSWLPL]HWKHLUĆWQHVVZHOOIHGIHPDOHVPD\SURGXFH
more offspring of the sex that is larger and more costly to
rear, or of the sex where reproductive variance is larger. We
assessed the SR of nestlings of the monogamous Lears Macaw
(Anodorhynchus leari), to test for correlation with rainfall, a
proxy of food availability. We collected blood samples from
63 nestlings (35 broods) at the Canudos Biological Station
in Canudos, Bahia, over four breeding seasons (2009-2012).
Sexing was performed by PCR with primers P2 and P8. They
were sexed as 39 females and 24 males, resulting in a primary
65IHPDOHVPDOHRI7KHVHFRQGDU\65FRQVLGHULQJ
RQO\ćHGJHGQHVWOLQJVZDV:HXVHGELQRPLDO*/0V
to test if rainfall in the Canudos area predicts the primary
SR for the 2009-2012 period. Because precipitation can
be locally irregular in this biome (Caatinga), we used four
different time periods as alternative explanatory variables:
three, six and twelve months prior to January (the average
peak of egg-laying activity), and also the previous OctoberNovember accrue, omitting December to account for the
WLPHODJEHWZHHQUDLQIDOODQGIUXFWLĆFDWLRQRI/LFXULSDOPV
!+'¢S8!¡8'9'2;!ࣅ329
{փdփTT
POSTERS
,3;3#@29'¡13&wø329'$!
ID t
ABSTRACT
t
ID t
Posters
4
Impactos da fragmentao de habitat nas
comunidades de aves de Cerrado sensu stricto
Renata D. Alquezar1*, Ricardo B. Machado1
ǢW2-='89-&!&'&'8!9£-!
r8'2!;!£7<'A!8|192W$31
POSTER SESSION: BIOGEOGRAPHY, PHYLOGEOGRAPHY
& POPULATION GENETICS
6
A fragmentação é um processo que envolve perdas de
habitat e isolamento de manchas de vegetação nativa, e tem
afetado negativamente muitos biomas em todo o mundo.
Neste trabalho investigamos os impactos da fragmentação de
habitat sobre a avifauna em duas regiões com distintos níveis
de fragmentação no Cerrado. Amostramos duas unidades
de conservação e três fragmentos do entorno de cada UC.
Durante os meses de abril, junho, agosto e outubro de 2013,
amostramos 64 pontos com técnicas de bioacústica para
caracterizar as comunidades de aves das regiões estudadas.
8WLOL]DPRVJUDYDGRUHVDXWRP£WLFRVHSRVWHULRULGHQWLĆFD©¥RGDV
espécies gravadas, enquanto a paisagem das regiões estudadas
IRLFODVVLĆFDGDSDUDLGHQWLĆFD©¥RGRJUDXGHIUDJPHQWD©¥RGD
região. Registramos 168 espécies de aves, distribuídas em 18
ordens e 44 famílias. A região mais fragmentada apresentou
54% de áreas antrópicas no entorno dos fragmentos, além de
uma maior proporção de espécies onívoras e granívoras dentro
dos fragmentos e maior proporção de espécies carnívoras
dentro da UC. A região menos fragmentada apresentou
Page 98, Posters
ABSTRACT
t
Table of Contents
18% de áreas antrópicas e nenhuma resposta em relação
à composição de guildas. As variáveis ‘tamanho da área’,
‘composição do entorno’ e ‘região’ foram importantes para
explicar os padrões de riqueza encontrados. Neste estudo
encontramos que as áreas abertas do Cerrado não possuem
espécies de aves altamente sensíveis à fragmentação, muito
provavelmente devido à estruturação natural da vegetação.
Concluímos, entretanto, que a fragmentação no Cerrado
DEHUWRFDXVDXPLPSDFWRPDLVVLJQLĆFDWLYRQDDOWHUD©¥RGD
composição das espécies de aves do que na riqueza de espécies.
Vocal variation of three species of antbirds
(birds: Thamnophilidae) associated to a riverine
barrier in the Rio Branco basin, Amazônia
Rassa Sales1*, Luciano Naka1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3
r8!-+<'88!i|,3;1!-£W$31
POSTER SESSION: BIOACOUSTICS
%LUGSRSXODWLRQVFDQGHYHORSSKHQRW\SLFDQGRUJHQHWLF
differentiation when isolated on opposite sides of a geographic
barrier. It remains unclear, however, whether vocal changes
develop before or after other phenotypic characters (such as
plumage), and whether changes in vocal characters precede
genetic isolation. Changes in bird vocalizations are important
because they can be linked to the speciation process as
pre-zygotic isolation barriers. We studied morphological,
genetic and vocal variation in three bird species from the
family Thamnophilidae (Thamnophilus amazonicus, T. murinus,
and Herpsilochmus dorsimaculatus) across the Rio Branco, a
well-known biogeographic barrier located in the Brazilian
{փdփTT
ID t
ABSTRACT
t
ID t
state of Roraima. Two different subspecies of Thamnophilus
amazonicus (cinereiceps and divaricatus) replace one another on
opposite sides of this river and they show marked phenotypic
(plumage) and genetic differentiation (~4%). Populations of H.
dorsimaculatus across the Rio Branco represent a single taxon,
but they are genetically differentiated (~2%) and reciprocally
monophyletic, but show no consistent morphological
differentiation. Finally, T. murinus lacks any genotypic or
phenotypic variation across the river. None of the three species
shows consistent variation across the river in the 15 vocal
parameters measured. These results suggest that different
selective pressures may be acting upon morphological,
genetic and vocal characters, and that vocal differentiation
may develop in isolated populations only after a considerable
amount of time has passed, and after morphological changes
have already been established in the populations.
22
Daniela Gomez1*, Roman Ruggera1, Luis Rivera1, Yanina Tejerina,
Ever Tallei1, Marisel Morales, Rodrigo1, Natalia Politi1
r1!&!2-'£!+31'A|+1!-£W$31
POSTER SESSION: COMMUNITY ECOLOGY
La captura con redes de niebla es una herramienta útil para
el muestreo de aves de sotobosque y la tasa de captura es
un índice que informa sobre su efectividad. En las Yungas
del noroeste de Argentina la información disponible de las
especies de aves obtenida a través de esta metodología es
Page 99, Posters
Table of Contents
escasa. El objetivo de este trabajo es conocer las variaciones
en las tasas de captura en 19 sitios de los distintos pisos
altitudinales: Selva Pedemontana, Selva Montana y Bosque
Montano (Yungas) y Pastizal de Altura. Dado que el
esfuerzo de muestreo fue diferente en cada piso altitudinal,
estandarizamos dicho esfuerzo calculando la tasa de
FDSWXUDQ¼PHURGHFDSWXUDVKUHGKUHG UHG
abierta durante 1 hora). En cada sitio colocamos entre 8 y
12 redes de niebla durante las temporadas reproductiva y
no reproductiva, entre los años 2008 y 2015. Calculamos
la frecuencia de captura de las especies para cada piso y
temporada. En un total de 13856 h-red capturamos un total
de 1930 individuos correspondientes a 123 especies de aves.
$UUHPRQćDYLURVWULV\7XUGXVUXĆYHQWULVIXHURQHQJHQHUDO
las especies más frecuentemente capturadas en todos los
pisos altitudinales. La mayor tasa de captura fue de 44,8
LQGLYLGXRVKUHG\VHUHJLVWUµHQOD6HOYD3HGHPRQWDQD
para la temporada reproductiva; la tasa más baja fue para la
Selva Pedemontana en la temporada no reproductiva (7,68
LQGLYLGXRVKUHG/DVWDVDVGHFDSWXUDYDULDURQHQWUH
los distintos pisos y temporadas probablemente debido a la
dinámica temporal y espacial de las aves de sotobosque.
Variaciones en las tasas de captura de aves a lo largo del
gradiente altitudinal de las Yungas Australes de Argentina
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!&'
</<@TT<T</<@T8+'2ধ2!
ABSTRACT
t
27
Rynchops nigeris affected by human disturbance in resting sites
Bianca P. Vieira
2-='89-;@3(£!9+3>
#-!2$!#-3<(9$|+1!-£W$31
POSTER SESSION: BEHAVIOUR
7KHćLJKWLQLWLDWLRQGLVWDQFHLVDXVHIXOPHDVXUHRIWKH
susceptibility of birds to disturbance. Migratory species expend
{փdփTT
ID t
ABSTRACT
t
high level of energy travelling from one place to another
and human approaching may affect refuel in resting sites.
Here the appropriate buffer distances to avoid disturbance
during the Rynchops niger wintering period in coastal areas
ZHUHHYDOXDWHG2QHSHUVRQDSSURDFKHGćRFNVLQWKUHH
coastal areas in southern Brazil between 2011 and 2015.
&RUUHODWLRQRIEXIIHU]RQHVZDVWHVWHGDFFRUGLQJWRćRFN
size and composition, distance of beginning disturbance,
EHKDYLRXUDQGHQYLURQPHQWDOIDFWRUV7KLUW\QLQHćRFNVXSWR
500 individuals in homogeneous or mixed with less numbers
of gulls and terns were tested. Flight initiation distances had a
mean of 15 m (max. of 45 m). Buffer zones were not related to
HQYLURQPHQWDOIDFWRUVRUćRFNVL]HDQGFRPSRVLWLRQ,QFUHDVLQJ
RIćLJKWLQLWLDWLRQGLVWDQFHVZDVFRUUHODWHGWRWKHGLVWDQFHRI
beginning disturbance and with tide, showing that disturbance
can affect birds even when beginning from long distances.
Also, Rynchops niger do not wait for humans getting closer
when there is not enough available area to stay. Rynchops niger
landing distance was negatively correlated to wind, probably
because it is harder escaping against wind. Results indicate
that installing walkways and fenced observatories limited to a
FRQVHUYDWLYHEXIIHU]RQHRIDWOHDVWPDZD\IURPWKHćRFNV
preferred zones should prevent people crossing resting areas
DQGGLVWXUELQJELUGV$VDQDGGLWLRQDOEHQHĆWSODWIRUPVRI
observation are also educational, leisure and tourism attractive.
Page 100, Posters
ID t
ABSTRACT
t
32
Primeros reportes de piojos (Phthiraptera) en
cazamoscas de Chile (Passeriformes, Tyrannidae)
Table of Contents
Danny Fuentes1*, Armando Cicchino2, Daniel Gonzlez-Acua1
ǢW
!$<£;!&&'-'2$-!9';'8-2!8-!9T2-='89-&!&&'32$'6$-2T
ǣW2-='89-&!&!$-32!£&'!8&'££!;!T8+'2ধ2!W
r&!22@(<'2;'91=|+1!-£W$31
POSTER SESSION: PARASITISM & AVIAN DESEASES
Los piojos (Insecta: Phthiraptera) son parásitos comunes en
aves que se relacionan estrechamente con sus hospedadores.
En aves cazamoscas, a pesar de su abundancia en el Neotrópico,
el estudio de sus piojos ha sido escaso; ésto es aún más marcado
en Chile. Este trabajo pretende contribuir al conocimiento
de la Phithirapterofauna en aves de la familia Tyrannidae en
Chile. Para esto se buscaron piojos en aves depositadas en
la colección del Museo Nacional de Historia Natural, aves
capturadas mediante redes niebla y en necropsias de aves
encontradas muertas. Los Phthiraptera fueron preservados en
DOFRKRODOSDUDVXSRVWHULRUPRQWDMHHLGHQWLĆFDFLµQ(Q
Muscisaxicola albilora se encontraron los piojos Machaerilaemus
maestus y Picicola sp.; en Muscisaxicola cinereus se colectó
Picicola sp.; en Muscisaxicola maculirostris se encontró Picicola
sp.; en Muscisaxicola maclovianus se colectó Myrsidea sp. y
Picicola sp.; en0XVFLVD[LFRODćDYLQXFKD la especie Picicola
pseudofoedus; en Xolmis pyrope se aisló Picicola foedus, P.
pseudofoedus y Menacanthus sp.; en Elaenia albiceps los piojos
Tyranniphilopterus delicatulus, Menacanthus cfr. distinctus y
Ricinus cfr. invadens; en Agriornis montanus se encontró P.
pseudofoedus; en Agriornis lividus las especies P. pseudofoedus y
Quadraceps sp.; en Tachuris rubrigastra se colectó a Philopterus
titicacae, en Anairetes parulus a Machaerilaemus laticorpus y
{փdփTT
ID t
ABSTRACT
t
ID t
Ricinus sp. y en Colorhamphus parvirostris a Machaerilaemus sp.
Con excepción de los piojos colectados en E. albiceps, todos
representan nuevos registros para cazamoscas chilenos
y nuevos representantes para la biodiversidad de Chile.
(VWXGLRĆQDQFLDGRSRUSUR\HFWR)21'(&<7
36
ABSTRACT
t
Table of Contents
in all years. These overstaying birds could be juveniles or
adults not ready to breed. The species constant presence could
DOVREHUHODWHGWRDFRQVWDQWćX[RIPLJUDQWVIURPGLIIHUHQW
colonies using the same site. Inter-annual changes showed a
VLJQLĆFDQWGHFUHDVHLQSRSXODWLRQRFFXS\LQJWKH5(6([7KH
RESEx surroundings suffered great changes with the Southern
([SUHVVZD\ODQGĆOODIIHFWLQJWKHPDULQHELUGDVVHPEODJH
'LVSHUVLRQLQWKLVSRSXODWLRQFRXOGEHUHODWHGWRORVVRIĆVK
stocks and also to loss of habitat due to beaches shifting for
PDQJURYHIRUHVWV'LUHFWPDQDJHPHQWRIPXGćDWVDQGĆVKLQJ
activities could help recovering population at the RESEx.
Population of Rynchops niger in the Reserva
Extrativista Marinha do Pirajubaé, southern Brazil
Ceclia G. Pereira1*, Bianca P. Vieira2
ǢW
'&'8!£2-='89-;@3(!2;!!;!8-2!TǣW2-='89-;@3(£!9+3>
r$'$-+!#8-'£!6#|@!,33W$31W#8
POSTER SESSION: CONSERVATION: DIVERSITY & DISTRIBUTION
Rynchops niger LVDPLJUDWRU\ELUGGHSHQGHQWRQĆVKVWRFNV
in calm waters. This species occurs along Santa Catarina
FRDVWOLQHLQFOXGLQJEHDFKHVDQGPXGćDWVDWWKHZHVWED\V
of the Island of Santa Catarina, southern Brazil. In one of the
bays is the Reserva Extrativista Marinha do Pirajubaé (RESEx),
a 1,712 ha protected area with mangrove forests and 953 ha
RIPXGćDWVXVHGE\R. niger+HUHZHYHULĆHGVHDVRQDODQG
inter-annual changes in population abundance from 2000
to 2012 in the RESEx. We gathered data from different
monitoring and analyzed abundance per month over the years.
The maximums were between December and May, except in
2009 when the species were present only in December and
-DQXDU\0D[LPXPVDURXQGELUGVLQĆUVW\HDUVGURSSHG
to 213 individuals in 2012. Minimums occurred from June to
November with species present in all months. Minimums stayed
around 50-100 individuals in all years. Most birds used the
RESEx during non-breeding periods, yet overstaying occurred
Page 101, Posters
37
Ecologia alimentaria de psittacidos en la selva
pedemontana de las yungas australes, Jujuy, Argentina
Anala Benavdez1*, Luis Rivera1, Natalia Politi1
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!&'</<@
r!2!£-!#ӑǧ|+1!-£W$31
POSTER SESSION: DIET & TROPHIC INTERACTIONS
Existe poca información sobre la dieta y patrones de
alimentación de psittácidos de las Yungas Australes. Conocer
este aspecto es necesario para diseñar estrategias de manejo
y conservación adecuadas. Nuestro objetivo es entender los
patrones de alimentación espaciales y temporales de siete
especies de psittácidos de la selva pedemontana de las Yungas
Australes. Entre enero del 2014 y marzo 2015, en tres sitios de
selva pedemontana realizamos 1227 transectas de observación
directa de 300 metros de longitud, en estación húmeda y seca.
En total se obtuvieron 254 registros de alimentación de seis de
los siete psittácidos citados para la zona de estudio forrajeando
sobre 22 especies de árboles. En la estación seca consumieron
{փdփTT
ID t
ABSTRACT
t
principalmente semillas (47,63%) y en la húmeda frutos
\ćRUHV6HUHJLVWUµD3\UUKXUDPROLQDH
alimentándose (n=98 puntos de alimentación) de 17 especies de
árboles durante todo el año. Solo se registró en la estación seca
a Amazona aestiva (n= 80) alimentándose de nueve especies
y a Primolius auricollis (n=11) de tres especies. En la estación
húmeda, Psittacara mitratus (n=17) y Psittacara leucopthalmus
(n=7) se alimentaron de tres especies. Las principales especies
consumidas fueron: Anadenanthera colubrina (26,38%) en la
estación seca y Juglans australis (13,38%) en la húmeda, siendo
en general la familia Fabaceae la más importante en la dieta
de los loros de la selva pedemontana. Los resultados sugieren
que los patrones de alimentación de los loros varían a lo largo
del año probablemente relacionado con la disponibilidad
de recursos alimenticios en la selva pedemontana.
38
(GDSKLFSK\VLRJQRPLFDQGćRULVWLFGHWHUPLQDQWV
of Amazonian avian biodiversity
Nargila Gomes de Moura1*, Jos Barlow2, Erika Berenguer2, Joice
Ferreira3, Toby Gardner4, Ima Vieira1, Alexander Charles Lees1
ǢW<9'<!8!'29'1-£-33'£&-TǣW!2$!9;'82-='89-;@TǤW1#8!6!
1!A32-!8-'2;!£TǥW;3$0,3£12=-8321'2;29ধ;<;'
ID t
ABSTRACT
t
Table of Contents
of undisturbed and degraded primary forest in two regions
of the Brazilian Amazon. We collected data from 171 300m
transects where, in addition to bird community composition,
we measured live and dead wood biomass, tree species
composition, understorey density, canopy openness, and soil
content of aluminium, calcium, potassium and phosphorus,
VLOWDQGFOD\:HXVHGWKHGHFLVLRQWUHHFODVVLĆFDWLRQPHWKRG
Random Forests to uncover associations between forest
VWUXFWXUDODQGHGDSKLFGHWHUPLQDQWVDQGERWKVSHFLHVVSHFLĆF
and community wide patterns of occurrence. We found that
tree biomass, richness of plants and calcium were the most
important community-wide variables in both landscapes but
that this generalisation hides extremely idiosyncratic and
VSHFLHVVSHFLĆFUHVSRQVHVWRRXUHQYLURQPHQWDOGHWHUPLQDQWV
7KHEHVWPRGHOOHGELUGVSHFLHV5t!ZHUHPlatyrinchus
platyrhynchos, Myiornis ecaudatus and Lipaugus vociferans
in Paragominas and Chiroxiphia pareola, Lipaugus vociferans
and Pteroglossus aracari in Santarém. Our results highlight
WKHQHDULPSRVVLELOLW\RIĆQGLQJDçVLOYHUEXOOHWèYDULDEOHWKDW
neatly captures environmental variation at the community
level and highlights the need for more nuanced analyses to
DLGWKHIRUPXODWLRQRIPRUHHIĆFLHQWFRQVHUYDWLRQSODQV
r2!8+-£!13<8!|@!,33W$31W#8
Amazonia is far from homogenous and for avian communities
the relationship between vegetative structure and edaphic
characteristics is likely to be a key determinant of the
organization and structure of these assemblages. Here we
aimed to understand what forest structural characteristics and
soil variables dictate the occurrence of bird species in areas
Page 102, Posters
{փdփTT
ID t
ABSTRACT
t
40
Distributional correlates, population sizes and
conservation status of endemic bird taxa from an
isolated coastal mountain in northern South America
ID t
ABSTRACT
t
Table of Contents
Species also varied in their tolerance to habitat loss, while
population densities varied with elevation in some taxa.
Despite the fact that not all of the species studied are currently
OLVWHGDVWKUHDWHQHGRXUJDSDQDO\VHVVXJJHVWWKDWVSHFLĆF
conservation actions are required to avoid deterioration in
their population status, given their limited distribution.
Esteban Botero-Delgadillo1,2*, Nicholas Bayly1, Camila Gmez1,
Sandra Escudero-Pez1, Paulo C. Pulgarn-R.1, Mara Isabel Moreno1
ǢWV'9'!8$,(38$329'8=!ধ32-2;,''3;836-$9TǣW2-='89-&!&&',-£'
r'#3;'83&|+1!-£W$31
POSTER SESSION: CONSERVATION STATUS AND THREATENED SPECIES
The Sierra Nevada de Santa Marta (SNSM) is a coastal
mountain range in northern Colombia that harbors ca. 70
endemic bird taxa, although such endemism remains relatively
poorly known. This applies to many species threatened with
extinction, recently split species, and taxa that have been
recently reinstated as full species. Most of these rangerestricted birds are still subject to high levels of habitat
loss, and there is little information regarding their habitat
UHTXLUHPHQWVDQGWKHLUFRQVHUYDWLRQQHHGV:HUHSRUWWKHĆUVW
results of a long-term study of the SNSM endemics focused
on determining (i) the environmental factors explaining their
restricted presence; (ii) their extent of occurrence (EOO),
area of occupancy (AOO) and rates of habitat loss; (iii) their
patterns of habitat use; (iv) their population and conservation
status; and (v) their main information gaps. Combining point
locality data and information on population density and habitat
XVHZHIRXQGWKDWWKH$22VRIWKHĆYHVSHFLHVDQDO\]HGWR
date are more restricted than previously described, despite
having included more geographic data in our analyses than
any previous study. We also found that each species presence
was limited by distinct climatic factors, but all were correlated
with the seasonality of precipitation and temperature.
Page 103, Posters
46
Population dynamics of waterbirds in
a tailings dam in Central Chile
Mauricio Pez1*, Cristian Estades1
ǢWT2-='89-&!&&',-£'
r16!'A|@1!-£W$31
POSTER SESSION: POPULATION DYNAMICS & DEMOGRAPHY
Mining waste materials resulting from processing of mineral
resources are usually stored in tailings dams. These reservoirs
may act as ecological traps as they attract many watebird
species that may be exposed to high concentrations of heavy
PHWDOV8VLQJVHDVRQDOFHQVXVGDWDIRXUFHQVXVHV\HDU
we studied the changes in the waterbird populations that
colonized the Ovejería tailings dam (North of Santiago de
Chile), from its creation in 1999 through the winter of 2012.
In order to explain the changes observed in the abundance
of the recorded species we used Generalized Linear Models,
including an autoregressive term, and different predictors (i.e.
time since creation, season, precipitation, temperature, size of
the reservoir, introduction of the carp Cyprinus carpio in 2005).
7RWDOELUGDEXQGDQFHVKRZHGDVWURQJLQFUHDVHGXULQJWKHĆUVW
ĆYH\HDUVRIWKHVWXG\EXWDIWHUDGHFOLQHZDVREVHUYHG
in both , total abundance and species richness. Carp presence
{փdփTT
ID t
ABSTRACT
t
ID t
in the reservoir was the best predictor of the bird community
composition, since the populations of over 50% of the species
VLJQLĆFDQWO\FKDQJHGWKHLUDEXQGDQFHDIWHUWKHLQWURGXFWLRQ
RIWKLVH[RWLFĆVK%HVLGHVPRVWRIWKHODWWHUFKDQJHVZHUH
highly consistent, with many populations of piscivorous species
LQFUHDVLQJWKHLUQXPEHUVZKLOHDOOKHUELYRURXVDQGĆOWHULQJ
species populations decreased. Although our study cannot rule
out an impact of the site’s toxicity on the analyzed populations,
the trends observed during 14 years of continuous monitoring
GRQRWVKRZDQ\HYLGHQWVLJQVRISRSXODWLRQFRPPXQLW\
disfunctionality that could be attributed to such an effect.
55
Pedro T. S. M. Moura1*, Leonardo F. F. Frana1
r6'&83;'3)£313<8!|+1!-£W$31
Table of Contents
a uma única guilda alimentar (36 insetívoros, 17 onívoros,
6 carnívoros, 6 granivoros, 2 necrófagos, 2 nectarívoros
e 1 frugivoro), 34 espécies que incluíam itens secundários
na dieta (ins.+sec. = 21, gran.+sec.= 11, rug.+sec.= 2) e
30 espécies com dieta mista (carn.+ins.= 6, nect.+ins.= 3,
ins.+frug.= 2, frug.+gran.= 1 e ect.+ins.+frug.= 1). Para três
espécies não encontramos informações. A predominância de
insetívoros parece ser comum em ambientes da Caatinga. O
número de espécies generalistas foi maior mesmo entre as
restritas a uma única guilda como os insetívoros, a maioria
oportunistas. Diferente do encontrado na Floresta Atlântica,
onde a estabilidade ambiental permite especializações. A
GLVWULEXL©¥RQDVJXLOGDVWUµĆFDVGDFRPXQLGDGHSRGHVHU
resultante de adaptações à condição de sazonalidade climática
da Caatinga que age sobre os padrões de uso do recurso.
(VWUXWXUDWUµĆFDGHXPDFRPXQLGDGHGHDYHV
da Depressão Sertaneja Setentrional
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
ABSTRACT
t
57
Get acquainted with your enemy
Ricardo C. Meireles1*, Filipe C. R. Cunha2, Julio, C. R. Fontenelle3
2WLSRGHK£ELWRDOLPHQWDUFRPXPHQWHLQćXHQFLDSURFHVVRV
ELROµJLFRVPXGDGHSHQDVHUHSURGX©¥RHGHPRJU£ĆFRV
(sobrevivência e abundância) das aves. Nosso objetivo foi
UHDOL]DUPRVXPDFDUDFWHUL]D©¥RWUµĆFDGHXPDFRPXQLGDGH
de aves. Desenvolvemos este estudo em uma área ao norte
da Caatinga. A listagem das espécies foi obtida através
de capturas por redes de neblina e observações de rotina
QD£UHDGHHVWXGRQ|GHRFDVL·HV HQWUHVHWH
DJR$YDOLDPRVDSUHIHU¬QFLDDOLPHQWDUGDFRPXQLGDGH
FRQVXOWDQGRELEOLRJUDĆDVHVSHFLDOL]DGDVGHGLHWD(QFRQWUDPRV
121 espécies, cerca de 46% das espécies listadas para o
5LR*UDQGHGR1RUWH,GHQWLĆFDPRVHVS«FLHVUHVWULWD
ǢW2-='89-&!&'
'&'8!£&'-39!TǣW2-='89-;@3(
<8-$,TǤW29ধ;<;3
'&'8!£&'-2!9'8!-9
Page 104, Posters
r8$1'-8'£'9|,3;1!-£W$31
Birds, in general, can recognize their predators and can adopt
different strategies to avoid the predation. In order to explore
the bird`s discrimination ability in such predator recognizing,
VHYHUDOĆHOGH[SHULPHQWVZHUHGHYHORSHGLQ6RXWKHDVWHUQ
%UD]LO7RDFFHVVWKLVLQIRUPDWLRQPRGHOVDQGRUYRFDOL]DWLRQV
of closely related owl species were presented to the local bird
community, meaning different levels of danger and familiarity.
Then, composition and intensity of mobbing was measured.
{փdփTT
ID t
ABSTRACT
t
We found that birds were not able to discriminate owl species
within the same genus (Asio and Glaucidium), whether they
were familiar or not (sympatric or allopatric). Nevertheless,
in a different threat level, when birds were presented to
diurnal owl species (less closely related and with distinct
diets), the mobbing against the dangerous predator was less
intense but in larger groups, compared to non-dangerous
predator. This result suggests that birds can access general
information about familiar predators and extrapolate when
in front of unfamiliar predators. We also provided evidences
that birds may recognize distinct predators and the threats
they might represent, and choose strategies accordingly to
its degree of risk. We highlight that birds exhibit complex
predator recognition systems, allowing them to respond in
two different ways: detailed discrimination among familiar
situations, and generalization while in unfamiliar situations.
58
Primeros reportes de parásitos deSporagra barbata (Aves:
Fringillidae) en distintas regiones ecológicas de Chile
Danny Fuentes1*, Armando Cicchino2, Sergey
Mironov3, Daniel Gonzlez-Acua1
ǢW
!$<£;!&&'-'2$-!9';'8-2!8-!9T2-='89-&!&&'32$'6$-2TǣW
2-='89-&!&!$-32!£&'!8&'££!;!T8+'2ধ2!WTǤW 33£3+-$!£29ধ;<;'T
<99-!2$!&'1@3($-'2$'9T2-='89-;';90!@!1#!201'2;Ǣ
ID t
ABSTRACT
t
Table of Contents
aves del neotrópico, el presente trabajo pretende determinar la
fauna parasitaria de S. barbata, y además establecer si existen
variaciones en la prevalencia e intensidad del parasitismo
en siete regiones ecológicas de Chile. Se analizaron 125
ejemplares capturados con redes niebla y 22 que se les
practicó necropsia parasitaria. Las muestras extraídas fueron
conservadas en alcohol al 70% para su posterior montaje e
LGHQWLĆFDFLµQ(QMLOJXHURVGHODVDYHVDQDOL]DGDV
se encontraron ectoparásitos, 48 de ellos (33%) tenían 770
£FDURVLGHQWLĆFDGRVFRPRStrelkoviacarus critesi Spory,
1965; 680 como Proctophyllodes spini Atyeo & Braasch 1966; 67
como Knemidocoptes jamaicensis Turk, 1950; uno como Analges
passerinus Linnaeus, 1758 y tres ácaros pertenecientes a la
tribu Schoengastiini. En 21 aves (14%) se encontraron 54 piojos,
IXHURQLGHQWLĆFDGRVFRPRMyrsidea serini Seguy, 1944;
21 como Philopterus roehreri Eichler, 1956 y 15 como Ricinus
carolynae Nelson, 1972. No se encontraron endoparásitos
en los individuos necropsiados. Existieron diferencias
VLJQLĆFDWLYDVHQODSUHYDOHQFLDHLQWHQVLGDGGHSDU£VLWRVHQODV
distintas regiones ecológicas. Todos los parásitos encontrados
constituyen nuevos reportes parasitológicos para la especie
Sporagra barbata, por lo que el presente estudio entrega nueva
información sobre parásitos de aves presentes en Chile, lo
cual aumenta el conocimiento de la biodiversidad del país.
r&!22@(<'2;'91=|+1!-£W$31
El fringílido Sporagra barbata Molina, 1782, a pesar de ser un
ave abundante y de extensa distribución en el cono sur de
Sudamérica, no presenta estudios referidos a sus parásitos.
Con el objetivo de aumentar el conocimiento del parasitismo en
Page 105, Posters
{փdփTT
ID t
ABSTRACT
t
62
Towards a cohesive and critical socioornithology for the Neotropics
ID t
ǢW32ধ)$-!2-='89-&!&!;£-$!&',-£'ǣW2-='89-;@3(8-ধ9,3£<1#-!T
ǤW2-='89-;@3(!;'8£33TǥW2-='89-;@3('38+-!T
ǦW2-='89-;!;&'!8$'£32!TӐW'2;83&'9;<&-391#-'2;!£'9&'£
38;'&',-£'TǧW2-='89-&!&!$-32!£&'<'239-8'9
r/ধ#!88!|<$W$£
POSTER SESSION: OUTREACH & ENVIRONMENTAL PROGRAMMES
Page 106, Posters
Table of Contents
social sciences and the humanities (e.g. ecology, history,
environmental education, ethnosciences, ontology, political
ecology, arts). We provide cases from Argentina, Chile, Costa
Rica, Ecuador, Panama and Latin American immigrants in
North America, to illustrate how the analysis of the interwoven
nature of bird-human relationships informs about multi-scale
and multi-dimensional drivers impacting bird-people systems.
We suggest that ornithologists working on conservation
initiatives in the Neotropics require an interdisciplinary
training with local relevance because of the reciprocal links
between regional environmental and social problems.
Jos Toms Ibarra1,2*, J. Cristbal Pizarro3, Antonia
Barreau2, Fausto O. Sarmiento4, Mnica Martnez
Mauri5, Csar Piones Caete6, Celeste Medrano7
Bird-human relationships represent the complex linkage
between biological and cultural diversity, and thus integrative
but also critical approaches are needed for their effective
conservation. The Neotropics is a vast ecozone including
Mexico, Central America, South America and the Caribbean,
with the world’s greatest bird diversity and nearly 1,000
human languages. Neotropical languages and other cultural
dimensions (e.g. ontology, medicine, food, politics, art) are
inextricably linked to birds. This link is evident in the way that
HQYLURQPHQWDOGHIRUHVWDWLRQGHVHUWLĆFDWLRQXUEDQVSUDZO
and social (poverty, inequalities, cultural erosion) problems
synergistically impact avian and human communities. However,
increasing academic ultra-specialization narrowly treats causes
of environmental problems, and isolates their impacts over
either bird or human communities within the ecozone. We
propose a cohesive and critical ‘socio-ornithology’ that aims
to (i) understand bird-human relationships as units comprising
interconnected systems, and (ii) examine environmental
problems drawing on critical stands from natural sciences,
ABSTRACT
t
63
Invasive exotic birds in Brazil: implications on biodiversity
of local populations and plans of management.
Gabriela Franzoi1*, Isadora Fluck Essig1, Amanda Simes Souza2
ǢW2-='89-&!&'
'&'8!£&'!2;!!8-!TǣW2-='89-&!&'&'8!9£-!
r+!#8-'£!(&8-|+3;1!-£W$31
The invasion of natural environments by alien species is
considered the second leading cause of biodiversity loss. About
400 invasive bird species have been catalogued worldwide. In
Brazil, there are four alien bird species that have come from
other continents: Columba livia, Passer domesticus, Estrilda astrild
and Bubulcus ibis. This study aimed to analyze the ecological
changes that these species cause to native communities,
and possible ways to control and prevent its spread. The
occupation maps found in the literature pointed out the main
problems related to these four species of birds in Brazil. C.
livia, P. domesticus and E. astrild species, whose introductions
ZHUHDUWLĆFLDOHDVLO\VHWWOHGLQ%UD]LOFDXVLQJJUHDWGDPDJH
{փdփTT
ID t
ABSTRACT
t
ID t
to native populations. For example, C. livia is a viral disease
vector able to infect other birds; P. domesticus is an aggressive
competitor for nesting space, while E. astrild is a disperser of
exotic seeds. The species B. ibisZDVĆUVWUHFRUGHGLQ%UD]LO
in 1960s, but there is still a contest if the introduction was
QDWXUDORUDUWLĆFLDO+RZHYHULWLVXQGHQLDEOHWKDWWKHSUHVHQFH
of B. ibis negatively affects the native fauna, by competition
with other egrets and predation of the endemic lizard Euprepis
atlanticus in Fernando de Noronha Island, among other
animals. In a future study, species colonization models will
be performed in order to analyze their distribution potential,
and predict the possible spread of invasive species. Thus,
this tool can be used to control these species in an attempt
to reduce the imbalance that they cause in the ecosystem.
66
Mariana L. Campagnoli1*, Alexsander Z. Antunes2
ǢW29ধ;<;3&'-3-Í2$-!9fTǣW29ধ;<;3
£38'9;!£
POSTER SESSION: ECOLOGY & CONSERVATION
IN HUMAN MODIFIED LANDSCAPES
Biological invasion is a more and more common process
in natural environments around the world, being a much
GLVFXVVHGVXEMHFWLQWKHVFLHQWLĆFFRPPXQLW\,QDQLQYDGHG
habitat, the function of the invasive species needs to be
evaluated. The State Parks Alberto Löfgren and Cantareira, São
Paulo southeastern Brazil, are suffering from varying degrees
of invasion by three species of invasive exotic palms (IEPs). To
help managers in their decision making process, the present
Page 107, Posters
Table of Contents
VWXG\LQWHQGHGWRYHULI\KRZWKH,(3VGHQVLW\LQćXHQFHV
the understory bird assemblages in these parks. Both point
counts and mist nets were used together to avian survey and
the point-centered quarter sampling, allied with the counting
of IEPs individuals, characterized the vegetation structure.
Three treatments with IEPs density’s low, medium and high
were compared concerning richness, diversity, abundance and
trophic structure of the avifauna. IEPs density and bird richness
DQGDEXQGDQFHGLIIHUHGVLJQLĆFDQWO\EHWZHHQWKHWUHDWPHQWV
A negative relation was encountered between IEPs density
and bird richness, abundance and diversity. Therefore, an
environment can suffer reduction of bird species when there
is an invasion. However, the palm cutting in the areas with high
density of IEPs could result in a very sudden change in the
vegetation, leading to the loss of the birds’ habitat. We suggest
then, the cut of the individuals used in landscaping present
near the buildings of both parks and constant monitoring of
the Cantareira region, in order that invasion does not spread.
Impact of density of invasive exotic palms on
forest understory birds in Southeastern Brazil
r1!8-!2!$!16!+23£-|+1!-£W$31
ABSTRACT
t
68
Divergencia genética y morfométrica de dos
XQLGDGHVJHRJU£ĆFDV\PRUIROµJLFDVGHQWUR
de(XSKRQLDDIĆQLV(Aves: Fringillidae)
A. Melisa Vázquez-López1*, Blanca Estela Hernández Baos2
ǢW39+8!&3'2-'2$-!9-3£+-$!9TǣW<9'3&' 33£3+!T
!$<£;!&
&'-'2$-!9T2-='89-&!&!$-32!£<;231!&'Ì?-$3
r!£1!1'£-9!|@!,33W$31W1?
POSTER SESSION: SYSTEMATICS & TAXONOMY
Dentro de (XSKRQLDDIĆQLV se reconocen dos subespecies donde
FDGDXQDUHSUHVHQWDXQDXQLGDGJHRJU£ĆFD\PRUIROµJLFD
{փdփTT
ID t
ABSTRACT
t
a) godmani distribuida en el Oeste de México, con las plumas
cobertoras de la cola color blanco y b)DIĆQLVdistribuida desde
el Este de México hasta el Noreste de Costa Rica, con las
plumas cobertoras de la cola color amarillo. El objetivo de
este trabajo fue determinar las unidades evolutivas dentro
de (DIĆQLVutilizando caracteres genéticos (mitocondriales y
nucleares) y morfométricos. Con los datos genéticos se obtuvo
XQDĆORJHQLD\UHGHVGHKDSORWLSRVUHFRQRFLHQGRGRVJUXSRV
FRQJUXHQWHVFRQODVXQLGDGHVJHRJU£ĆFDV\PRUIROµJLFDV
descritas. Respecto a los análisis morfométricos se realizaron
en forma separada para ambos sexos, debido a que los machos
presentan medias mayores en las variables tomadas. En la
prueba de ANOVA se observa que los individuos del linaje
godmani, presentan mayores dimensiones en el ala y base del
pico respecto a DIĆQLV Mientras que los individuos del linaje
DIĆQLVWLHQHQODFROD\HOSLFRP£VODUJR(QHO$Q£OLVLVGH
Componentes Principales los individuos de Centroamérica,
forman un grupo con menores dimensiones en el ala y base del
pico. Nuestros resultados son congruentes con los de otros
estudios, donde se demuestra que existen linajes recientes
en las tierras bajas de Mesoamérica, donde generalmente el
Oeste de México contiene linajes endémicos respecto al Este
de México y Centroamérica. Recomendamos reconsiderar el
estatus taxonómico de ambos linajes, elevándolos a especies,
ya que, representan dos unidades evolutivas independientes.
Page 108, Posters
ID t
ABSTRACT
t
70
Ninho, ovos e ninhegos de Rhopias gularis (Passeriformes:
Thamnophilidae) no Sudeste do Brasil
Table of Contents
Daniel F. Perrella1*, Carlos H. Biagolini-Jr.1, Lais RibeiroSilva1, Paulo V. Q. Zima1, Mercival R. Francisco1
ǢW
!8f2-='89-&!&'
'&'8!£&'3!8£39
r&(6'88'££!|+1!-£W$31
POSTER SESSION: NESTING BIOLOGY & REPRODUCTION
Rhopias gularis, espécie endêmica da Mata Atlântica e
pertencente ao complexo Myrmotherula, recentemente tem sido
alvo de discussões acerca de sua taxonomia. O presente estudo
compreende a descrição do ninho, ovos e ninhegos associada
à possível posição taxonômica da espécie. Entre outubro
de 2013 e janeiro de 2014, foram encontrados 12 ninhos
ativos da espécie no Parque Estadual Carlos Botelho, um dos
UHPDQHVFHQWHVGH0DWD$WO¤QWLFDPDLVVLJQLĆFDWLYRVGRHVWDGR
de São Paulo. Os ninhos tinham formato de taça profunda,
Ć[DGDVSRUVXDVERUGDVHPJDOKRVKRUL]RQWDLVHPIRUTXLOKDH
construídas entre 34 e 70 cm de altura nas margens ou sobre
riachos na mata. O material dos ninhos consistia principalmente
HPUD¯]HVĆQDVĆODPHQWRVGHIXQJRQHJURHIROKDVVHFDVGH
samambaia. Em dois ninhos observou-se um ponto de costura
passando por uma folha, que foi trazida sobre a câmara
incubatória formando um telhado. As medidas dos ninhos
foram 73,6 ± 9,8 mm de diâmetro externo, 58,6 ± 7,5 mm de
diâmetro interno, 58,5 ± 8,1 mm de altura interna e 68,4 ± 12,0
mm de altura externa. Todos continham dois ovos brancos com
machas e pintas marrom-escuras e avermelhadas. Os ovos
(n = 18) mediram 19,0 ± 0,8 mm de comprimento, 14,5 ± 0,4
mm de largura e pesaram 2,2 ± 0,2 g. Recém-nascidos eram
rosados e desprovidos de plumas. A arquitetura dos ninhos,
{փdփTT
ID t
ABSTRACT
t
ID t
ovos e ninhegos foi similar aos de outras espécies pertencentes
ao complexo Myrmotherula, sugerindo que tais características
Q¥RV¥RLQIRUPDWLYDVRVXĆFLHQWHSDUDUHFRQVWUXLUDVĆORJHQLDV
baseadas em DNA que validaram o gênero monotípico Rhopias.
72
ABSTRACT
t
Table of Contents
megacephalum e 97 para R. fuscicauda. As espécies utilizam
com frequência o bambu para procurar e capturar presas,
porém R. megacephalum demonstrou ser mais especializado
nos substratos do bambu. Foram encontradas diferenças
VLJQLĆFDWLYDVQDVYDUL£YHLVVXEVWUDWRGHDWDTXHPDQLSXOD©¥R
do alimento, comportamento pós-ataque, altura do forrageio,
altura do ataque, distância percorrida no ataque, número de
poleiros e tempo médio de procura por poleiro. As diferenças
encontradas entre as duas espécies possivelmente explicam
a coexistência das mesmas em um mesmo local e habitat.
(VWUDW«JLDVGHIRUUDJHLRSUHIHU¬QFLDGHKDELWDWHFRH[LVW¬QFLD
de Ramphotrigon fuscicauda e R. megacephalum no leste do Acre
Tomaz Melo
2-='89-&!&'
'&'8!£&3$8'
;31!A21'£3|,3;1!-£W$31
POSTER SESSION: HABITAT USE
O sudoeste da Amazônia possui uma grande diversidade
de aves e dentre elas destacam-se as aves especializadas
HPćRUHVWDVFRPEDPEXV1HVVDUHJL¥RREDPEXSRGHVHU
considerado um elemento chave da paisagem. O objetivo deste
trabalho foi investigar a coexistência, preferência de habitat
e comportamento de forrageio das espécies Ramphotrigon
megacephalum e R. fuscicauda, ambas consideradas especialistas
de bambus e que são simpátricas nessa região. O estudo
foi conduzido de novembro de 2013 a setembro de 2014
em dois fragmentos no leste do estado do Acre: Fazenda
Experimental Catuaba, em Senador Guiomard e Reserva
Florestal Humaita, em Porto Acre. Para a coleta dos dados
foram utilizadas parcelas permanentes do Programa de
Pesquisa em Biodiversidade-PPBio. O modelo nulo revelou
que a distribuição das duas espécies nas áreas de estudo
«DRDFDVRVHPXPDLQćXHQFLDUDRFRUU¬QFLDGDRXWUD
Ambas espécies demonstraram preferência pelo habitat
GHEDPEXFRPUHOD©¥RVLJQLĆFDWLYDFRPDGHQVLGDGHGH
colmos. Foram registrados 109 eventos de forrageio para R.
Page 109, Posters
74
Breeding territory of the Great-billed SeedFinch Sporophila maximiliani
Fálvio Ubaid1*, Cesar Augusto Bronzatto Medolago2,
Mercival Roberto Francisco2, Luís Fábio Silveira3
ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&'
9;!&<!£!<£-9;!TǣW2-='89-&!&'
'&'8!£&'3!8£39TǤW
<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3
r*!=-3<#!-&|+1!-£W$31
%UHHGLQJWHUULWRU\LVGHĆQHGDVDVSDFHH[WHQVLRQDQG
time-duration occupied by a species. Many Passerine birds
establish territories during the breeding season when males
sing to attract females and aggressively confront neighboring
FRQVSHFLĆFVWRGHIHQGWKHLUVSDFH,QPRVW1HRWURSLFDO
birds the breeding territory area is unknown, impeding the
developmemnt of conservation strategies. The Great-billed
Seed-Finch, Sporophila maximiliani, is critically endangered,
ZLWKIHZUHFHQWUHFRUGVLQWKHĆHOG&DSWLYHEUHHGLQJLVZHOO
known, but no information is available about the breeding
{փdփTT
ID t
ABSTRACT
t
biology in the wild. On December 2014 we found a pair in the
ĆUVWGD\RIQHVWEXLOGLQJRQ0DWR*URVVR6WDWH0DOHWHUULWRU\
was spot-mapped using a gps considering singing-perches
and feeding points. Two observers carried out the notes from
Dec 2014 to Jan 2015, from sunrise until about 11am, and
sometimes in the afternoon until dusk. More than 85% of the
territory defended by the male was in an area of 0.313ha. The
male sang from the highest perches, although lower perches
were also used. The territory was established especially in
view of strategic feeding points of sawgrass bushes (Scleria
VS%HVLGHVWKHVRQJWKHWHUULWRU\GHIHQVHLQYROYHGćLJKWV
toward possible predators near the nest. Sometimes the female
accompanied the male and attacked other bird species (e.g.
Pitangus sulphuratus). Local residents reported that the species
still suffers great hunting pressure in the region. Historically,
the illegal capture is certainly the main factor of decline of
wild populations. These new data should be used in future
FRQVHUYDWLRQSURMHFWVVSHFLĆFDOO\LQUHLQWURGXFWLRQSURSRVDOV
75
Respostas comportamentais de aves a vocalizações de
potenciais predadores no Pantanal Matogrossense
Sandro Gonalves Moreira1,2*, Vitor Campos1
ǢW2-='89-&!&'&'8!9£-!TǣW'2;832-='89-;8-3&'!;39&'-2!9
r9!2&83'$,3!=-9|,3;1!-£W$31
Aves formam um grupo de vertebrados em que as interações
LQWHUHVSHF¯ĆFDVV¥RIUHTXHQWHVPHUHFHQGRGHVWDTXHD
predação, que corresponde a uma importante pressão
ambiental, sendo um dos principais elementos da seleção
Page 110, Posters
ID t
ABSTRACT
t
Table of Contents
natural, de maneira que a detecção de um predador pode
ser determinante para a sobrevivência de um indivíduo. O
objetivo deste trabalho foi averiguar a capacidade de aves
em reconhecer potenciais predadores por suas vocalizações.
Foram emitidos playbacks com vocalizações de Rostrhamus
sociabilis, Accipiter bicolor e )DOFRUXĆJXODULV em seis diferentes
áreas da RPPN do Sesc Pantanal,Mato Grosso, no período
de 26 a 30 de maio de 2014, registrando-se, logo após
cada playback, as respostas comportamentais das aves
locais. As aves mostraram-se indiferentes às vocalizações
de Rostrhamus sociabilis, mas apresentaram, na maioria
das vezes, respostas defensivas às vocalizações Accipiter
bicolor e )DOFRUXĆJXODULV, o que indica a capacidade de
reconhecimento de potenciais predadores locais, corroborando
a existência de um processo coevolutivo entre as espécies.
76
(YLGHQFLDGHDOWDHVWUXFWXUDĆORJHRJU£ĆFDGHQWUR
de la especie Habia rubica (Aves: Cardinalidae)
Sandra Marisol Ramírez Barrera1*, Blanca Estela
Hernández Baos1, John Klicka2
ǢW2-='89-&!&!$-32!£<;231!&'Ì?-$3TǣW<80'<9'<1
3(!;<8!£-9;38@!2&<£;<8'T2-='89-;@3(!9,-2+;32
r1!8-A3£ǦǡӐ|@!,33W$31W1?
Las especies neotropicales poseen una compleja historia de
GLYHUVLĆFDFLµQSURGXFWRGHODLQćXHQFLDTXHHMHUFHQGLYHUVRV
IDFWRUHVJHRJU£ĆFRVHFROµJLFRVFOLP£WLFRV\JHROµJLFRV
sobre los linajes que determinan los patrones de distribución
GHVXVSREODFLRQHV/DĆORJHRJUDI¯DDQDOL]DGLFKRVSDWURQHV
{փdփTT
ID t
ABSTRACT
t
GHYDULDFLµQJHRJU£ĆFDDQLYHOJHQ«WLFR(QHVWHWUDEDMR
exploramos la estructura genética de las poblaciones de Habia
rubica con el objetivo de proponer una hipótesis acerca de
VXKLVWRULDHYROXWLYD\SURFHVRVGHGLYHUVLĆFDFLµQ3DUDHOOR
realizamos un análisis multilocus utilizando secuencias de cinco
marcadores moleculares, cubriendo el área de distribución
de la especie, desde México hasta Sudamérica. Con estos
datos se obtuvo una hipótesis acerca de la historia evolutiva
(utilizando Mr. Bayes), una red de haplotipos y un análisis
de tiempos de divergencia. Nuestros resultados muestran
que la especie Habia rubica se encuentra conformada por
dos clados principales, uno que incluye las poblaciones de
México y Centroamérica y otro que incluye las poblaciones de
Sudamérica. Dentro de cada uno de éstos clados se reconocen
ocho haplogrupos cuyos límites tienen una correspondencia
FODUDFRQDOJXQDVGLVFRQWLQXLGDGHVJHRJU£ĆFDVLPSRUWDQWHV
como el Istmo de Tehuantepec en México, la Cordillera
de Talamanca e Istmo de Panamá en Centroamérica y la
meseta Brasileña en Sudamérica. La coincidencia entre la
estructura genética de estos haplogrupos y la compleja
HVWUXFWXUDĆVLRJU£ĆFDGHODUHJLµQ0HVRDPHULFDQD
GHVFULEHXQDKLVWRULDGHGLYHUVLĆFDFLµQPXFKRP£VDFWLYD\
compleja hacia el norte de la distribución de esta especie.
Page 111, Posters
ID t
ABSTRACT
t
77
Caracterización conductual en Geranoaetus melanoleucus y
su utilidad para la determinación de zonas reproductivas.
Table of Contents
8-9ধ!2
£38'9ǢrT!8$-!£'£;8!1ÐǢ
ǢW2-='89-&!&';8363£-;!2!&'-'2$-!9&'£!&<$!$-Õ2
r$32;!$;3|<1$'W$£
El plano regulador de la Región Metropolitana de Santiago de
&KLOHHVSHFLĆFDTXHVHSXHGHQGHVDUUROODUFRQVWUXFFLRQHV
KDVWDORVPVQP/DH[SORVLµQGHPRJU£ĆFDTXHKDVXIULGR
la ciudad ha obligado a reinterpretar los usos de los suelos para
que adquieran la categoría de aptos para la construcción, lo que
provoca pérdida de biodiversidad del sector. Una de las especies
que se ha visto afectada por esta situación es él acitrípido
Geranoaetus melanoleucus, quien cumple un importante rol en la
regulación de especies vectores de enfermedades, debido a que
HVXQGHSUHGDGRUWRSHHQODWUDPDWUµĆFD
Considerando estos antecedentes, se quiso determinar la
importancia ecológica para el ave de una quebrada sometida
a un incipiente proceso de urbanización, ubicada en el sector
de San Carlos de Apoquindo (33° 24’ S, 70° 28’ O). Se utilizo el
método animal focal para caracterizar la frecuencia y duración
de las conductas realizadas por las aves durante los períodos
UHSURGXFWLYR\QRUHSURGXFWLYR6HGHĆQLHURQGLIHUHQWHVWLSRV
de vuelo, conductas reproductivas y aperchado. Los vuelos
con mayor frecuencia durante ambos períodos fueron vuelo
planeado rectilíneo (VPR) y vuelo circular ascendente (VCA).
El rango horario de mayor actividad se estableció entre las
12:00-13:00 y 15:00-16:00. Las conductas reproductivas y los
vuelos de caza aumentaron en el periodo reproductivo. En base
{փdփTT
ID t
ABSTRACT
t
ID t
a estos resultados se puede concluir que esta quebrada cumple
un rol ecológico importante para la reproducción de esta ave.
80
Aspectos ecológicos das assembleias de aves
em áreas com dinâmica de morte massiva do
bambu (Guadua sp.) no Acre, Brasil
ABSTRACT
t
Table of Contents
Curtis foi de 92,7%. Houve uma correlação entre as duas áreas
em relação ao número de espécies por guilda. Áreas de Floresta
Aberta com Bambus madura diferem daquelas em que o bambu
morreu apenas com relação à composição de espécies de aves.
2-='89-&!&'
'&'8!£&3$8'
Determinants of tree species preference for
foraging by insectivorous birds in a woodland
dominated by alien tree species in Puerto Rico
;31!A21'£3|,3;1!-£W$31
William Beltrn1*, Joseph M. Wunderle2
ǢW'6;W3(!;<8!£$-'2$'9T2-='89-;@3(;,'!$-)$TǣW2;£W
29ধ;<;'3(836-$!£
38'9;8@T
38'9;'8=-$'
Tomaz Melo
Os bambus do gênero GuaduaWHPXPDLQćX¬QFLDPXLWR
forte nos ambientes que ocorrem no sudoeste da Amazônia,
podendo ser considerados elementos-chave desses sistemas.
Bambus do gênero Guadua morrem após eventos de
IUXWLĆFD©¥RHPPDVVD1HVWHFRQWH[WRRREMHWLYRGHVWHWUDEDOKR
IRLRGHFRPSDUDUDULTXH]DFRPSRVL©¥RHVWUDWLĆFD©¥RH
guildas alimentares de aves em uma área com a presença do
bambu e outra que o bambu morreu em anos recentes no
Parque Estadual Chandless, município de Manoel Urbano,
Acre, Brasil. Os dados foram coletados percorrendo as trilhas
em cada uma das áreas através de busca ativa entre 22 de
novembro e 03 de dezembro de 2014. Foram comparadas
DULTXH]DGHHVS«FLHVFRPSRVL©¥RHVWUDWLĆFD©¥RYHUWLFDOH
guildas alimentares entre as áreas. Um total de 201 espécies
foi registrado e a riqueza de espécies na área 1 foi de 145
espécies e a da área 2 foi de 142 espécies. O índice de Jaccard
para a similaridade na composição de espécies entre as áreas
foi de 42,8%. A comparação da distribuição de frequências das
espécies por estrato não diferiu entre as áreas. A semelhança
na composição de guildas entre as áreas pela análise de Bray-
Page 112, Posters
81
r>-££-!1#'£;8!2ǣǡǡǦ|+1!-£W$31
We tested the foliage palatability hypothesis that predicts avian
insectivores will preferentially forage in tree species with the
greatest abundance of their arthropod prey, which in turn are
associated with the tree?s foliage nutrition and palatability. The
hypothesis was tested in a novel Prosopis-Leucaena woodland
LQ3XHUWR5LFRE\GHWHUPLQLQJIRUDJLQJSUHIHUHQFHVRIĆYH
LQVHFWLYRURXVELUGVSHFLHVIRUVL[WUHHVSHFLHVĆYHDOLHQRQH
native) and relating preferences to foliage arthropod biomass
and leaf chemistry. The most frequently preferred tree species
for foraging were the alien 3URVRSLVMXOLćRUD (preferred by
ĆYHELUGVSHFLHVDQGDOLHQPithecellobium dulce (preferred by
four bird species). Both species had high arthropod biomass,
KLJK1FRQWHQWORZOLJQLQ1UDWLRVDQGORZKHPLFHOOXORVH
content. Compounds, previously known to affect herbivore
responses to Albizia lebbeck and Leucaena leucocephala, may
explain low arthropod biomass despite high N content in
Albizia and avoidance of Leucaena by 4 bird species despite its
{փdփTT
ID t
ABSTRACT
t
ID t
high arthropod biomass. The native Bucida buceras had tough
leaves with low N content, low arthropod biomass, and only
1 bird species showed a weak preference for foraging in it.
Some alien tree species had highly palatable foliage with high
arthropod biomass and hence were preferred for foraging
by avian insectivores as predicted. High foliage palatability
of some alien tree species may weaken the effect of enemy
release (i.e., alien species escape their specialized predators and
parasites in a new environment) in novel plant communities.
82
ABSTRACT
t
Table of Contents
com teia de aranha. Uma câmara incubatória rudimentar foi
confeccionada com material mais delicado. As medidas dos
ninhos foram: diâmetro externo - 85,0 e 93,0mm; diâmetro
interno - 55,0 e 60,0mm; altura - 75,0 e 83,0mm e profundidade
- 40,0 e 45,0mm. Apenas a fêmea construiu os ninhos. O
SULPHLURQLQKRIRLĆ[DGRHPWU¬VUDPRVGHAcilepdopsis
echitifolia, acima de uma poça rasa com 40cm de profundidade,
distante 40cm da superfície da água. O segundo foi construído
em um arbusto de Curatella sp., distante 2m do chão. Em cada
ninho foram colocados dois ovos, com intervalo de um dia
entre as posturas. Os ovos são branco-acinzentados, com
manchas marrons e pretas, mais concentradas no polo maior.
As medidas dos ovos (n = 2) foram: 20 x 16,9mm e 2,4g) e
21,1 x 16,6mm e 2,9g). Os ovos são semelhantes aos das
demais espécies de Sporophila. O ninho possui características
intermediárias aos dos caboclinhos, que são construídos com
PDWHULDOĆQRHEDVWDQWHHQWUHOD©DGRFRPF¤PDUDLQFXEDWµULD
evidente e dos coleirinhos e patativas, que fazem ninhos com
paredes menos espessas e acabamento mais grosseiro.
Biologia reprodutiva deSporophila maximiliani:
descrição do ninho e ovos
Cesar A. B. Medolago1*, Flvio Kulaif Ubaid1, Mercival
Roberto Francisco2, Lus Fbio Silveira3
ǢW83+8!1!&'Õ9f+8!&<!3'1$3£3+-!''$<8939!;<8!-9T
2-='89-&!&'
'&'8!£&'3!8£39TǣW'6;3&'-Í2$-!91#-'2;!-9
f2-='89-&!&'
'&'8!£&'3!8£39f!16<9383$!#!TǤW'3&'
82-;3£3+-!T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3
r$'9!81'&3£!+3|@!,33W$31W#8
Muitas espécies do gênero Sporohila estão ameaçadas de
H[WLQ©¥RHPYLUWXGHGDGHVWUXL©¥RGRK£ELWDWHGRWU£ĆFR
O bicudo, Sporophila maximiliani, é a espécie do gênero mais
ameaçada, com pouquíssimos registros recentes na natureza.
Descrevemos aqui dois ninhos da espécie, provavelmente do
mesmo casal, encontrados em dezembro de 2014 e janeiro
de 2015 em uma área inundável no Estado do Mato Grosso,
Brasil. Os ninhos possuíam forma de taça e foram construídos
SULQFLSDOPHQWHFRPFDXOHVĆQRVHJDYLQKDVGHCassytha
ĆOLIRUPHVDO«PGHIROKDVHLQćRUHVF¬QFLDVGHJUDP¯QHDVXQLGRV
Page 113, Posters
83
Interactions network between frugivorous birds and
plants in an Atlantic Forest area in southeastern Brazil
Suelen B. M. Rodrigues1*, Bruna L. Gagetti1, Augusto J. Piratelli1
ǢW
!8f!16<9383$!#!
r9<'£'2#&'138!'9|,3;1!-£W$31
POSTER SESSION: INTERSPECIFIC RELATIONSHIPS & NETWORKS
Studies on interaction networks are an important tool to
understand ecological patterns and processes driving the
complexity of a community. Some of these patterns are related
{փdփTT
ID t
ABSTRACT
t
to the stability and suggest a key role played by generalist
species having many interactions. This study aims to analyze a
network of interactions between plants and frugivorous birds
in different environments of Atlantic Forest in southeastern
Brazil stressing the importance of generalist species in such a
mosaic. The research was carried out in Carlos Botelho State
Park (SP) in three areas (open area, initial and late successional
stages), and records of interactions were performed by direct
observation by transects, focal and camera traps. The network
was represented by 52 species of birds and 13 species of
plants, with a nested pattern (NODF = 38, p <0.001), with a
low connectance (18%) and low average degree of species
(9.38 and 2.35, plants and birds, respectively). The plant
species having higher amount of interaction and frequency of
visits were Miconia tristis and Myrsine guianensis, while Dacnis
cayana, Camptostoma obsoletum, Ramphastos dicolorus and
Tangara sayaca were the most interacting bird species. These
VSHFLHVFRQWULEXWHGVLJQLĆFDQWO\WRWKHQHVWLQJRIWKHQHWZRUN
showing their importance for the stability of the community.
84
Histórico do recebimento de Tyto furcatapela
Polícia Militar Ambiental de Mossoró, RN
Pedro T. S. M. Moura1*, Maxson C. A. S. Souza1, Liana
M. P. C. Cavalcanti1, Leonardo F. F. Frana1
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
ID t
ABSTRACT
t
Table of Contents
em torno da espécie Tyto furcata é bastante conhecida devido
aos inúmeros encontros com pessoas em áreas urbanas e
semiurbanas. O objetivo aqui foi elucidar as principais causas do
recebimento de indivíduos de T. furcata na Sede do 3º Pelotão
de Proteção Ambiental de Mossoró-RN. Foram recebidos 11
exemplares da espécie entre abril e dezembro de 2014. Destes,
seis eram ninhegos retirados dos ninhos em habitações, quatro
foram vítimas de arma de fogo e um de envenenamento. Com
H[FH©¥RGHXPGRVĆOKRWHVTXHIRLUHVJDWDGRHPORFRGHYLGRR
estrutura do teto em que estava o ninho ter desabado, todos
os outros foram entregues pela população no 3º PPAM. A
espécie é responsável por cerca de 70% das ocorrências locais
envolvendo aves de rapina. Nossos dados mostraram a remoção
GHĆOKRWHVGRVVHXVQLQKRVHPHVWUXWXUDVDUTXLWHW¶QLFDV
humanas como sendo a principal causa de entrada da espécies
na instituição. Uma consequência do característico barulho
SURYRFDGRSHORVĆOKRWHVHPEXVFDGRDOLPHQWRWUD]LGRSHORV
pais. O preconceito com a espécie, principalmente devido
ao mito da rasga-mortalha (nome local da espécie), deve ser
a motivação para o segundo maior tipo de registro, sendo
os adultos atacados com arma de fogo por serem mais
esquivos à captura manual. Como é comum na relação entre
o ser humano e aves de rapina, a falta de compreensão da
biologia das espécies, de programas de educação ambiental
e a ausência de planejamento das estruturas urbanas
JHUDPFRQćLWRVIDWDLVSDUDRVLQGLY¯GXRVGHT. furcata.
r6'&83;'3)£313<8!|+1!-£W$31
6¥RPXLWRVHDQWLJRVRVFRQćLWRVH[LVWHQWHVHQWUHDQLPDLV
silvestres e humanos. Dentre eles, a problemática que gira
Page 114, Posters
{փdփTT
ID t
ABSTRACT
t
85
Feeding habits of Harpia harpyja in the
1RUWKHUQ3DQWDQDOvVćRRGSODLQV%UD]LO
ID t
ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&'9;!&<!£
!<£-9;!TǣW2-='89-&!&'6!8!3'9'2=3£=-1'2;3&39;!&3'&!
'+-3&3!2;!2!£TǤW29ধ;<;3
'&'8!£&'!;383993T$!16<9<-!#f
'£!-9;!TǥW29ধ;<;3&'-3-Í2$-!9T2-='89-&!&'
'&'8!£&'!;3
83993TǦW2-='89-&!&'&'<-!#TTӐW 329<£;38-!
The Harpy Eagle Harpia harpyja is a canopy predator of
neotropical rainforests. The species diet has been described
for the Amazon forest, the Brazilian Atlantic forest and the
forest enclaves in the Cerrado. It’s presence was only recently
FRQĆUPHGIRUWKH3DQWDQDO7ZRQHVWVLQWKH3DQWDQDOZHUH
VWXGLHGIURPWRDQGWKHLGHQWLĆHGIHHGLQJLWHPVDUH
presented herein. All prey remains and pellets were collected in
the nest or bellow from Sep-Oct 2009, Jul and Oct-Nov 2010,
Jan 2011, and Nov 2013. Skulls, mandibles, teeth, squeletons,
claws, feathers, hair, beak and feet were used to identify prey to
the lowest taxonomic level possible. Direct observation of preys
that were carried to the nests were also source of information.
Most of the collected material (80%) has been already
LGHQWLĆHG3ULPDWHVUHSUHVHQWHGRIWKHLQGLYLGXDOV
consumed. The most frequent prey was Alouatta caraya with
37% of all specimens (n = 50). Birds represented 16.3% of this
sample, however only Ramphastos tocoKDVEHHQLGHQWLĆHG
Other prey species were Sapajus cay, Coendou prehensilis,
Page 115, Posters
Table of Contents
Caluromys philander, a young deer (Mazama sp.), rodents, as
ZHOODVSULPDWHVDQGELUGVUHPDLQVQRW\HWLGHQWLĆHG'LUHFW
observations showed Dasyprocta azarae brought alive to the
nest. Male once used an Crypturellus undulatus or medium-size
rail in pre-copulation courtship feeding. Most prey (90.7%) are
arboreal species. Apparently, scarcity of food resources is not
the main reason Harpy Eagle lack records in the Pantanal. Our
results provide new information about the diet of the Harpy
Eagle in a region where this top predator is poorly known.
Flávio Ubaid1*, Luciana Ferreira2, Samuel Borges Oliveira
Jr.3, Thiago Borges Fernandes Semedo4, Tafnys Hadassa
da Cunha Ferreira5, Paulo de Tarso Zuquim Antas6
r*!=-3<#!-&|+1!-£W$31
ABSTRACT
t
90
Límite de especies en el complejo Catharus occidentalis
utilizando genes mitocondriales y nucleares.
J. Santiago-García1*, B. E Hernndez-Baos1
ǢW<9'3&' 33£3+!£(3293W'88'8!T'6!8;!1'2;3
&'-3£3+!=3£<ধ=!T
!$<£;!&&'-'2$-!9T2-='89-&!&
!$-32!£<;231!&'Ì?-$3TÌ?-$3W
TÌ?-$3W
r+!8$-!i/'9<9(Ǣ|@!,33W$31W1?
El principal objetivo de la delimitación de especies es el
conocimiento de la diversidad biológica, por lo que en la
última década los estudios basados con secuencias de DNA se
han incrementado. Dichos estudios se están utilizando para
explorar diferentes niveles taxonómicos, entre ellos a nivel
HVSHF¯ĆFR%DMRHVWDVSUHPLVDVHQHVWHWUDEDMRXWLOL]DPRV
secuencias de genes mitocondriales (ND2) y nucleares (ACOI-I9
y Ornitidina descorboxilasa) para explorar los límites de
especies, en el zorzal endémico mexicano (Catharus occidentalis),
e investigar el grado de estructuración genética poblacional,
para así poder documentar la presencia de más de un linaje
{փdփTT
ID t
ABSTRACT
t
evolutivamente independiente, ya que esta especie presenta
dos poblaciones distribuidas alopátricamente a lo largo de
los principales sistemas montañosos del país. Los resultados
demuestran que la diferenciación genética es baja entre las
poblaciones de la especie Catharus occidentalis, concluyendo
que es posible que esta especie se encuentre por un proceso
de estructuración poblacional, en vez de un proceso de
especiación. En otros trabajos se ha encontrado el mismo
patrón , por lo que especies que habitan en bosques templados
presentan inicios de estructuración genética, sin embargo,
existen otros trabajos en donde la diferenciación genética es
alta y por lo tanto se han llegado a considerar que las especies
estudiadas representan más de una especie diferente.
91
Aspectos reprodutivos do galo-da-serra (Rupicola
rupicola, Linnaeus, 1766, Aves) no complexo do Maroaga
e Iracema Falls, Presidente Figueiredo – AM
Francisco N. Franco1*, Obed, G. Barros1,
Rodrigo Giro1, Juliana, N. Moraes1
ǢW'2;832-='89-;8-3&338;'f
r-1<;!#-£-9;!|@!,33W$31W#8
ID t
ABSTRACT
t
Table of Contents
ninhos ativos nos paredões, grutas e cavernas do Complexo
Maroaga e de Iracema Falls. Os dados sobre comportamento
foram obtidos a partir de observação direta realizado entre
Junho e Outubro de 2010, neste intervalo foram realizadas
varreduras para contagem e observação de ninhos ativos.
Foram encontrados 19 ninhos no Complexo Maroaga e 4
ninhos em Iracema Falls e um total de 6 arenas para as duas
áreas. Os ninhos encontravam-se tanto em fendas, em algumas
cavidades dos paredões, assim como em cavernas e grutas
e quase sempre associados à presença de um corpo d’água
nas proximidades. Nas arenas, foi registrada um variação
de 2 a 9 machos, estes apresentaram comportamentos de
agressividade, denotando um alto grau de competitividade
pelo domínio da arena, com o uso de asas, bicos, voos rápidos
e vocalizações características para expulsar o competidor.
As fêmeas quase não foram visualizadas nas arenas, mas
foram observadas com maior frequência nos ninhos em
períodos noturnos. Os aspectos descritos contribuem para o
conhecimento do processo reprodutivo da espécie indicando
uma forte seleção de fatores como paredões rochosos e
presença de corpos d’água, indicando que estes ambientes
devem ser protegidos para a manutenção da espécie.
O Galo-da-Serra (Rupicola rupicola Linnaeus,1766) é uma
ave endêmica da Amazônia, que apresenta comportamento
reprodutivo em sistema de “Lek” onde machos cortejam
I¬PHDVXVDQGRDUHQDVHPćRUHVWDVGHFDPSLQDHGH
FDPSLQDUDQDFRPVXEERVTXHPDLVDEHUWR$HVS«FLHQLGLĆFD
em paredões rochosos ou em cavernas. Sendo assim, o objetivo
deste estudo foi descrever o comportamento e a frequência
GHVWDVDYHVHPDUHQDVDO«PGHYHULĆFDUDRFRUU¬QFLDGH
Page 116, Posters
{փdփTT
ID t
ABSTRACT
t
97
3ULPHUUHJLVWURGHQLGLĆFDFLµQ\FDPELRVHQ
la abundancia de Amazona aestivaen la Selva
Pedemontana del Noroeste Argentino
ID t
r9$,!(W!£'/!2&83|+1!-£W$31
El loro hablador (Amazona aestiva) es una especie con amplia
GLVWULEXFLµQHQ6XGDP«ULFD(Q$UJHQWLQDODHVSHFLHQLGLĆFD
en huecos de árboles en bosques de la Región Chaqueña,
mientras que en otoño e invierno se desplaza hacia la Selva
Pedemontana de las Yungas Australes. En este estudio
describimos un nido de Loro hablador y los cambios en
abundancia en la Selva Pedemontana, en la provincia de
Jujuy. Se estimó la abundancia en la estación seca y en la
húmeda a través de transectas lineales y se inspeccionaron
huecos en árboles en 100 ha con una minicámara adosada a
un palo extensible de 15 m. El 14 de Noviembre del 2014 se
encontró un nido de loro hablador en un hueco excavado por
Campephilus leucopogon en un cebil colorado (Anadenanthera
colubrina) con un adulto incubando huevos. El 2 de Diciembre
en el nido encontrado se registraron dos pichones. El mayor
número de individuos de loro hablador se registró en el mes
de Agosto (n=321) y desde Octubre a Marzo disminuyeron
las abundancias (x=10,33 - SD=11,18). La mayor abundancia
registrada coincide con la época que la especie visita
cultivos para alimentarse en la Selva Pedemontana. La
menor abundancia en la estación húmeda coincide con los
Page 117, Posters
Table of Contents
desplazamientos que la especie realiza hacia la ecoregión del
Chaco para reproducirse. Sin embargo, nuestro estudio sugiere
TXHWDPEL«QQLGLĆFDHQOD6HOYD3HGHPRQWDQD(VWHHVHOSULPHU
nido documentado para esta especie en este tipo de bosque.
Alejandro A. Schaaf1*, Analia Benavidez2, Luis
Osvaldo Rivera2, Natalia Politi2
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!&'</<@T329'/3
!$-32!£&'2='9ধ+!$-32'9-'2঩)$!9@$2-$!9lm
ABSTRACT
t
99
Características de las cavidades en árboles y
redes de interacciones aves-árboles en la selva
Pedemontana de las Yungas Australes
£'/!2&83W$,!!(ǢrT31!2<++'8!ǢT329;!2A!-=!2$3ǢT
='8!££'-ǢT<-99=!£&3-='8!ǢT!;!£-!3£-ধǢ
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!&'</<@T329'/3
!$-32!£&'2='9ধ+!$-32'9-'2঩)$!9@Ì$2-$!9lm
r9$,!(W!£'/!2&83|+1!-£W$31
Muchas aves de ecosistemas boscosos usan cavidades en
£UEROHVSDUDQLGLĆFDUUHIXJLDUVHRDOLPHQWDUVH/DVSREODFLRQHV
de estas aves suelen estar limitadas por la disponibilidad de
cavidades y resultan sensibles ante cambios en la composición
y estructura de los bosques provocados por actividades
antrópicas. El objetivo de este trabajo es describir las
características de las cavidades originadas por descomposición
de la madera , de las excavadas por carpinteros y de la red
de aves usuarias de huecos en árboles en un sector de selva
Pedemontana de Jujuy, Argentina. En 100 ha encontramos 196
cavidades de descomposición en 163 árboles de 14 especies
con un diámetro a la altura del pecho (DAP) de 44,2 ± 18,7 cm.
Estas se encontraron mayormente en &DO\FRSK\OOXPPXOWLćRUXP
(40,5%) y Phyllostylom rhamnoides (32,5%). Encontramos
50 cavidades excavadas en 40 árboles de 9 especies con
un DAP de 52,90 ± 20,4 cm. La mayoría de las cavidades
{փdփTT
ID t
ABSTRACT
t
excavadas se encontraron en Anadenanthera colubrina (34%)
y &DO\FRSK\OOXPPXOWLćRUXP (20%). En total se registraron
103 interacciones entre 15 especies de aves y 12 árboles
diferentes. &DO\FRSK\OOXPPXOWLćRUXP y los árboles muertos en
pie presentaron la mayor cantidad de interacciones. Entender el
rol que tienen ciertas especies arbóreas y los árboles muertos
permitirá mejorar los lineamientos de manejo forestal y
DVHJXUDUODFRQVHUYDFLµQGHODVDYHVTXHQLGLĆFDQHQKXHFRV
Comentario del revisor: Precisa de una edicion mas adequada.
100 ,GHQWLĆFDWLRQRIGLVWLQFWJHQHWLFOLQHDJHVLQWKHFDSWLYH
population of the endangered Crax blumembachii
provide guidelines for ex-situ conservation
Mariellen C. Costa1*, Crisley Camargo2, Luís
Fábio Silveira3, Mercival R Francisco4
ǢW2-='89-&!&'
'&'8!£&'3!8£39TǣW29ধ;<;3&'-3-Í2$-!9&'
3;<$!;<T2-='89-&!&'9;!&<!£!<£-9;!£-3&''97<-;!
-£,3T
3;<$!;<TT8!A-£TǤW<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3T
T3!<£3TT8!A-£TǥW'6!8;!1'2;3&'-Í2$-!91#-'2;!-9T
2-='89-&!&'
'&'8!£&'3!8£39T!16<9383$!#!T383$!#!TT8!A-£
r1!8-'££'2W$39;!|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
programs were started independently during the 70s, and
more than 220 animals have been released into the wild
so far. In this study we analyzed 121 adult birds from four
breeding facilities, using 8 microsatellite loci and Bayesian
clustering methods. The results revealed two distinct groups
that were in Hardy-Weinberg equilibrium and did not present
VLJQLĆFDQWHYLGHQFHVRILQEUHHGLQJ+RZHYHURQO\RQHOLQHDJH
has been successfully reproduced in captivity. The observed
VWUXFWXULQJPD\UHćHFWIRXQGLQJHIIHFWEXWZHDOVRFDQQRW
exclude the possibility that these populations were structured
in the wild. We suggest that a combination of individuals from
the two lineages, or admixted animals with high levels of
heterozigosity should be used in future reintroductions. We
also recommend animals not to be released in areas where
the species still occurs naturally, in order to avoid disrupting
potential genetic adaptive complexes. Importantly, the
conservation of Crax blumenbachii depends on the preservation
of Brazilian Atlantic Forest and coordinated efforts between
breeding facilities, researchers and governmental authorities.
101 Key factors in nest-site selection in burrowing
parrot: implications for conservation
Captive populations of endangered species are often small,
isolated, and founded by a limited number of individuals,
which makes them more susceptible to genetic drift and
inbreeding effects. Thus, understanding the levels of population
structuring and genetic variability is important for developing
management strategies. The Crax blumenbachii is endemic
to the Brazilian lowland Atlantic Forests and is considered
extinct in most of its original distribution. Two captive breeding
Myriam Ramírez Herranz1*, Renzo Vargas-Rodríguez1,
Rodrigo Ros1, Enrique Novoa1, Francisco A. Squeo1
Page 118, Posters
ǢW2-='89-;@3(!'8'2!T!'8'2!T,-£'
r1@W8W,'88!2A|+1!-£W$31
Nest site selection is one of the main behaviors that affects the
ĆWQHVVRIDQRUJDQLVPDQGbWKHSRSXODWLRQG\QDPLFV7KHUHIRUH
{փdփTT
ID t
ABSTRACT
t
it is expected that birds rigorously evaluate the nesting site,
GLUHFWLQJWKHLUFKRLFHVEDVHGRIELRWLFDQGbDELRWLFFRPSRQHQWV
of the environment. Identifying these variables on endangered
species such as Cyanoliseus patagonus bloxami, a subspecies
of the Burrowing Parrot endemic to Chile, could help restore
degraded reproductive habitats. The objective of the present
study was to determine patterns of selection of reproductive
UDYLQHVDQGbLGHQWLI\YDULDEOHVPRVWVWURQJO\UHODWHGWRWKLV
selection. We characterize all ravines present at Los Choros´s
creek, Region of Coquimbo (Chile), where we evaluated
HQYLURQPHQWDOPRUSKRORJLFDODQGbELRORJLFDOYDULDEOHV
The results indicated that reporductive ravines have south
RULHQWDWLRQbPHDQ rsrFGV5 S ,Q
DGGLWLRQUHSURGXFWLYHUDYLQHVKDGPRUHDUHDDPRUHVSHFLĆF
VXEVWUDWHDQGbZHUHIDUWKHVWIURPDQWKURSRJHQLFGLVWXUEDQFHV
than non-reproductive ravines,especially in ravines with higest
QXPEHURIQHVWb7KHbUHSURGXFWLYHUDYLQHbVHOHFWLRQbSDWWHUQ
can be an important tool, in possible habitat disturbance
scenarios of the burrowing parrots, to mitigate the effect
of productive activities in their breeding areas.
103 Banding and Recovering of Scarlet Ibis Eudocimus ruber in
Babitonga Bay, North Coast of Santa Catarina State, Brazil
ID t
ABSTRACT
t
Table of Contents
the estuary of Babitonga Bay, north coast of Santa Catarina
state. The species built their nests in a mixed colony. This
study aimed to tag chicks of Scarlet ibis using color bands and
get information about distribution through visual recoveries.
For three breeding seasons we captured manually the chicks:
FDWFKHVLQFDWFKHVLQDQG
FDWFKHVLQ:HWDJJHGFKLFNVDQGFRQGXFWHG
surveys along the estuary to detect the individuals. We
recorded 30 visual recoveries in this period. Twenty seven
records of young birds (between 10 days and 9 months old)
were made near the colony. Three records were made by
collaborators on the coast of São Paulo state. One individual
with nine months old was recorded in Cananéia city, 180 km
(straight line) from the colony. Other two records were made
in Praia Grande city, 350 km (straight line) from the colony.
These animals were one young with 11 months, and another
with 10 months old. Banding average was 36 per year, and
the recovery rate 29% on period. The majority (80%) of the
recoveries were near the colony, where they probably stay the
ĆUVWPRQWKVRIWKHLUOLIH/RQJGLVWDQFHUHFRYHULHVGHPRQVWUDWH
that the species conducts large displacements. This behavior,
combined with continued population growth, contribute with
the restocking of this species, including southern Brazil.
Alexandre V. Grose1*, Marta J. Cremer2, Nei Moreira1
ǢW
TǣW
r!£'W+839'|,3;1!-£W$31
POSTER SESSION: DIVERSITY & DISTRIBUTION
Scarlet-Ibis (Eudocimus ruber) occurred along the coast of
Brazil, but remained extinct for about 150 years in Santa
Catarina state. In 2011, the species was observed again in
Page 119, Posters
{փdփTT
ID t
ABSTRACT
t
105 Latitudinal variation in life history strategies of Tyrannus
savana: The relationship between reproduction and migration
ID t
ABSTRACT
t
Table of Contents
107 Cartilagines membranose in Furnariida (Tyranni,
Passeriformes): a new feature for the Tracheophone syrinx
Vanesa Bejarano1*, Alex Jahn1, Diego Tuero2
Ana Galvo1*, Luiz P. Gonzaga1
ǢW'6!8;!1'2;3&' 33£3+-!T2-='89-&!&'9;!&<!£!<£-9;!-3£!83TǣW
'6!8;!1'2;3&'$3£3+!T'2ধ$!@=3£<$-2T2-='89-&!&&'<'239-8'9'
29ধ;<;3&'$3£3+!T'2ধ$!@=3£<$-2&'<'239-8'9lmT
ǢW2-='89-&!&'
'&'8!£&3-3&'!2'-83
r=!2'9!W#'/!8!23|+1!-£W$31
POSTER SESSION: MIGRATION
Understanding the mechanisms that drive the geographic
variation in reproductive investment and success of migratory
birds at tropical and south-temperate latitudes could generate
new knowledge about life history theory in general and a better
understanding of the risks different bird populations face
across the planet. We are studying population-level variation
in life history strategies of migratory Fork-tailed Flycatchers
(Tyrannus savana) at different latitudes, in Argentina and
Bolivia and in the state of São Paulo, Brazil. Our objective is
to determine the mechanisms that determine reproductive
success between latitudes, testing whether time of arrival in
spring at the breeding site affects reproductive investment and
success more than local factors such as food availability and
nest microhabitat. Through daily monitoring of nests, census
of nest predators and sampling of arthropods, we found higher
FOXWFKVL]HVDWKLJKODWLWXGHVEXWQRVLJQLĆFDQWGLIIHUHQFHLQ
reproductive success between latitudes, even though food
availability is higher at higher latitudes. Food availability may
explain most of the latitudinal variation in clutch size. The next
phase of this research includes incorporating spring migration
timing, as well as life history data and nest site characteristics,
to explain variation in reproductive success and investment.
Page 120, Posters
r!+!£=!3|#-3£3+-!W<(8/W#8
POSTER SESSION: MORPHOLOGY
The Cartilagines membranose are two paired thin cartilages,
embedded in the ventral and dorsal regions of the left and right
syringeal Membranae tympaniformes mediales. Despite known
for many passerine taxa (both oscines and suboscines), these
small structures remain unreported from the Furnariida, which
is recognized for its distinctive Tracheophone syrinx. Our aim
was to report the occurrence and describe the morphological
variation of these cartilages among the Furnariida. We analysed
128 syringes, including 55 species representing the 10 families,
12 subfamilies and seven tribes of this parvorder. The Cart.
membranosa dorsalis is present in all taxa except Formicarius.
Its shape varies, being found as a straight stripe, a falciform
bar or an ellipse (the last being typical to Melanopareia). This
cartilage shows different degrees of development, varying
both in extent and in thickness, from a thin and small stain
(eg. Thamnophilus) to a protuberant and widely spread nodule
(eg. Furnarius). On the other hand, the Cart. membranosa
ventralis is not so widely distributed among taxa neither so
variable: it is restricted to some taxa within Melanopareiidae,
Thamnophilidae, Grallariidae, Dendrocolaptidae and
Furnariidae, and its shape is always a tiny elongated ellipse.
Both cartilages may be fused together, in association with
the Ligamentum interbronchiale, as observed in some species
of Dendrocolaptidae and Furnariidae. The discovery of
{փdփTT
ID t
ABSTRACT
t
these structures in the relatively well known Tracheophone
syrinx reveals a promising source of potentially informative
phylogenetic characters, and highlights that even a traditionally
studied bird organ can still conceal unknown features.
109 Estimación de supervivencia aparente para
Manacus vitellinus(Pipridae) en Campo Chagres,
Parque Nacional Chagres, Panamá
ID t
ABSTRACT
t
Table of Contents
con el único estudio previo realizado en el Parque Nacional
Soberanía en Panamá para M. vitellinus de ~0.47 (sin corrección
de transitorios). Al igual que otros estudios, nuestros resultados
concluyen que las primeras estimaciones de supervivencia que
produjeron valores muy altos (>80%), no son representativas
para todas las especies tropicales, ya que éstas estimaciones
varían entre especies y sitios. Nuestros resultados contribuyen
al conocimiento sobre las estimaciones de la tasa supervivencia
SDUDVDOWDULQHVGHWLHUUDĆUPH\HQHVSHFLDOSDUD3DQDP£
Katherine Araz-Ponce1*, Viviana Ruiz-Gutierrez2, Karla Aparicio
ǢW9$<'£!&'-3£3+!T2-='89-&!&<;231!&',-8-7<T
ǣW3$0@3<2;!-2-8&#9'8=!;38@
r!8!<A01|+1!-£W$31
/DVHVWLPDFLRQHVGHWDVDVGHPRJU£ĆFDVSDUDDYHV
1HRWURSLFDOHVVRQSRFDV\VHHQFXHQWUDQJHRJU£ĆFDPHQWH
y taxonómicamente limitadas. Se estimó la tasa de
supervivencia para Manacus vitellinus en un bosque caducifolio
y semicaducifolio de 12 hectáreas en Campo Chagres, Parque
Nacional Chagres en Panamá. Generamos historiales de
captura-recaptura utilizando datos del 2007 al 2011 de una
estación del programa de Monitoreo de Supervivencia Invernal
0R6,$QDOL]DPRVORVGDWRVXWLOL]DQGRODPRGLĆFDFLµQGH
tiempo desde marcamiento (TSM) del modelo general de
Cormark-Jolly-Seber en el Programa MARK. El modelo TSM
se acopla bien a datos de anillamiento de aves en el trópico,
ya que corrige el efecto de individuos transitorios, para que
las probabilidades de supervivencia no sean subestimadas.
Analizamos 53 individuos anillados en Diciembre para
cuatro ocasiones de captura. La probabilidad estimada de
supervivencia para M. vitellinus fue de ~0.46. Este valor coincide
Page 121, Posters
111 New and noteworthy bird records for Rondonia
state, southwestern Brazilian Amazonia, with
comments on range extensions of some species
Fernando, A. Valerio1*, Marcelo, F. Vasconcelos2, Rodrigo
Morais2, Luiz, G. Mazzoni2, Eduardo, J.c Gazzinelli2, Alyne
Perillo2, Augusto Alves2, Leticia, F. Pedroso2
ǢW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&'
'&'8!£&'-39!TǣW<9'<
&'-'2$-!9!;<8!-9T32ধ($-!2-='89-&!&'!;3£-$!&'-2!9'8!-9
r(W=!£'8-3$!8=!£,3|+1!-£W$31
The hydrographic basin of the Madeira River is one of
the richest ornithological regions in the world, however
knowledge on distribution of several species is still scarce
even with inventories already performed. We present new
and noteworthy bird records for this state, which were
documented by recording of vocalizations, photographs
and specimens (deposited in the Ornithological Collection
of the Museum of Natural Sciences of PUC Minas). The
studies were carried out in the municipality of Porto Velho,
{փdփTT
ID t
ABSTRACT
t
between September 2012 and June 2014. New and rare
ornithological records were present for both banks of the
Madeira River: Micrastur buckleyi, Clytoctantes atrogularis,
Hylopezus whittakeri, Chamaeza nobilis, Automolus melanopezus,
Synallaxis albigularis and Periporphyrus erythromelas. We
also comment on range extensions of each species.
112 The overlooked Ornithological Collection of the
Museum of Natural Sciences of PUC Minas
Marcelo F. Vasconcelos1*, Fernando, A. Valerio2, Luiz,
G. Mazzoni1, Alyne Perillo1, Rodrigo Morais1, Leticia F.
Pedroso1, Paula Rodrigues1, Filipe, A. Aramuni1
ǢW<9'<&'-'2$-!9!;<8!-9T32ধ)$-!2-='89-&!&'!;3£-$!&'-2!9
'8!-9TǣW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&'
'&'8!£&'-39!
r1(=!9$32$'£39|+1!-£W$31
The Ornithological Collection of the Museum of Natural
Sciences of PUC Minas (MCNA) is one of the least known in
the country, never mentioned in any review of the Brazilian
collections of birds. Nevertheless, MCNA holds 4,328
VSHFLPHQVRIWD[DRIZKLFKDUHLGHQWLĆHGDWVSHFLHV
OHYHO7KLVFROOHFWLRQSUHVHQWHGDVLJQLĆFDQWLQFUHDVHLQ
specimens during the last four years, when 2,479 specimens
(more than 55% of the total) were included. The collection
has the largest geographical representation of the Brazilian
states of Minas Gerais (MG), Rondonia (RO) and Para (PA).
The MCNA has the largest osteological collection of MG and
is one of the most important in Brazil, holding skeletons of
rare species that are not represented in any other collection
in the world. The entire collection is data digitalized, based on
Page 122, Posters
ID t
ABSTRACT
t
Table of Contents
the last nomenclatural revision of the Brazilian Committee
of Ornithological Records. Recently, the collection has
been visited by Brazilian and foreign researchers.
113 Implicâncias e ameaças na riqueza e
distribuição de aves do Chaco paraguaio
Romina Cardozo1*, Ricardo B. Machado1
ǢW2-='89-&!&'&'8!9£-!
r2!&-!831-2|+1!-£W$31
O Chaco paraguaio, que faz parte da diagonal de formações
abertas de América do Sul, é dividido em cinco ecorregiões:
Chaco húmido, Chaco seco, Pantanal, Médanos e Cerrado.
Essa variedade de ambientes permite a existência de uma
grande diversidade de aves na região. A expansão do cultivo
GDVRMDHLQWHQVLĆFD©¥RGDSHFX£ULDW¬PSURYRFDGRXPD
grande ameaça à biodiversidade local. O objetivo da pesquisa
foi gerar mapas de riqueza de aves para as ecorregiões Alto
Chaco, Matogrosense e Bajo Chaco e avaliar as pressões
causadas pelos desmatamentos. Os mapas de riqueza foram
baseados em pontos de ocorrência das espécies disponíveis
em bases de dados online, na literatura e em instituições
DPELHQWDLVGR3DUDJXDL$VSODQLOKDVIRUDPĆOWUDGDVH
ordenadas utilizando o software R e os pontos e mapas foram
trabalhados no software ArcGis 10.2.1. Das 715 espécies de
aves que ocorrem no Paraguai, 501 habitam o Chaco paraguaio.
Os resultados sugerem uma alta riqueza de aves em cada
UHJL¥RRUQLWRJHRJUDĆFDRTXHHYLGHQFLDDLPSRUW¤QFLDGD
conservação do Chaco para conservação das aves do corredor
de savana de América do Sul. As mudanças da cobertura da
{փdփTT
ID t
ABSTRACT
t
terra e principalmente o aumento do desmatamento no Chaco
paraguaio são as principais ameaças de perda de hábitat e que
LQćXHQFLDPQDGLVWULEXL©¥RHULTXH]DGDVDYHV5HFRPHQGDVH
realizar pesquisas de campo para atualizar as bases de dados
de aves do Paraguai e promover novos sítios de amostragem.
115 Modulariy in plants-frugivore birds network associated
to sequential fruiting of congeneric species
Adriano Marcos Silva1*, Pietro Kiyoshi Maruyama2,
Lus Pedro Mendes Paniago1, Celine Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!TǣW2-='89-&!&'9;!&<!£&'!16-2!9
r!&8-!23W#-3£3+-!|@!,33W$31W#8
(FRORJLFDODQGHYROXWLRQDU\IDFWRUVLQćXHQFHWKHSUHVHQFH
of modules in species interaction networks. Although
modules might be expected at different hierarchical levels,
evidences of modularity in plant-frugivore networks are still
lacking. We tested whether the interaction networks formed
by frugivorous birds and Miconia plants are modular and
evaluated how modules were divided. To do so, we used four
networks of Miconia and their frugivorous birds (three from
Brazilian Cerrado and one from a rainforest in Panama). We
TXDQWLĆHGPRGXODULW\XVLQJELQDU\DQGZHLJKWHGDOJRULWKPV
and also tested the relationship between bird traits (body
mass, frugivory level, migratory behavior and phylogeny) in
relation to within and among-module connectivity indices.
If considering only binary information, networks did not
present distinct modular structure. Nevertheless, by including
interaction strength, modules can be detected in all four
Miconia - birds networks. None of the bird traits, however,
Page 123, Posters
ID t
ABSTRACT
t
Table of Contents
were related with the connectivity indices. The possible
ćXFWXDWLRQRIIUXJLYRURXVELUGVDEXQGDQFHVFRXSOHGZLWKWKH
DV\QFKURQLFIUXFWLĆFDWLRQRIMiconia might favor the formation
of temporal modules comprising birds and plant species
with phenological overlap, ensuring the seed dispersal and
facilitating the coexistence in sympatry. Bird traits had little
effect in the role that each species play within the modular
network, probably because the frugivorous assemblages
were dominated by small-bodied and opportunistic species,
with small trait variation. Support: FAPEMIG, CAPES.
118 The puzzling call repertoires of Neotropical and Neartic Jays
Gabriel L. M. Rosa1*, Luiz dos Anjos1
ǢW2-='89-&!&'9;!&<!£&'32&8-2!
r+W839!W#-3|+1!-£W$31
Social in essence, corvid call repertoires provide useful
information about several aspects of their sociality. Unlike
typical passerines, which commonly have simple call
repertoires and complex songs, corvids usually have complex
call repertoires and a very low intensity, although extremely
complex song. Among corvids, there are 37 spp. endemic
to the American continent, those are called the New World
Jays (NWJ). Call repertoire descriptions are available for only
12 of these species, and for the remaining 25 information
is scarce or absent. Since Hardy (1969, The Condor 71) no
attempts of wide comparison among corvids were made.
Therefore, we present here the known call repertoires of
the NWJ, except for Aphelocoma, and propose a preliminary
assessment on function and acoustic structure variation of
{փdփTT
ID t
ABSTRACT
t
the non-described call repertoires. We revised the available
literature and examined 1383 recordings (31h) containing
calling sequences of NWJ, mostly obtained from sound
collections. We listed all distinguishable call types by visual
LQVSHFWLRQDVVLVWHGE\VSHFWUDOFURVVFRUUHODWLRQĆHOG
observations, and behavioral notes provided by the authors of
most recordings, estimating the most likely functions of nondescribed calls. We described the basic repertoire structure
for most species, although more sampling is necessary for a
more complete assessment of the NWJ call repertoires. We
found that several classes of calls are shared among groups
of species and address potential questions to be answered.
We make here a call for collaboration among Neotropical
ornithologists to pursue an even more detailed review on
the puzzling NWJ acoustic communication and sociality.
120 Diet Composition of Cerulean Warbler
(Setophaga cerulea) Nestlings
Sasha A. Auer1*, Jennifer R Wagner2, Kevin W Barnes1, Kamal Islam1
ǢW!££;!;'2-='89-;@TǣW-8+-2-!3£@;'$,2-$29ধ;<;'!2&;!;'2-='89-;@
ID t
ABSTRACT
t
Table of Contents
decade, Cerulean Warbler offspring diet has not been studied.
We determined the prey types (insects and arachnids) that
Cerulean Warbler parents fed their young over the 20112013 breeding seasons and compared the proportions of
GLIIHUHQWSUH\W\SHVWRSUH\DYDLODELOLW\:HLGHQWLĆHGD
total of 351 prey items (n =34 in 2011, n =17 in 2012, and
n =300 in 2013) at 24 nests. Although the proportion of
Lepidoptera larvae (caterpillars) deliveries varied annually and
seasonally, caterpillars were the most frequently delivered
prey item. Caterpillar availability decreased and noncaterpillar prey deliveries increased proportionally during
the latter part of the breeding season. Non-caterpillar prey
items included Orthoptera, Diptera, Neuroptera, Arachnida,
Coleoptera, Hemiptera and Phasmida. Many songbirds rely
on an abundant supply of caterpillars to raise their young,
and their nesting phenology has evolved to coincide with
peaks in abundance of caterpillars. These species may be
particularly prone to the effects that changes in vegetation
composition and climate likely have on the life cycle and
abundance of their food source and these effects may
QHJDWLYHO\LQćXHQFHWKRVHVRQJELUGVèUHSURGXFWLYHVXFFHVV
r9!9,!!<'8|+1!-£W$31
The Cerulean Warbler (Setophaga cerulea) is one of the fastest
declining Nearctic-Neotropical wood warblers, decreasing at
a rate of approximately 3% per year. It is listed as a species of
concern in the United States and as endangered in Canada.
Population declines are primarily due to habitat loss in the
eastern U.S. and on the wintering grounds in South America.
Despite a substantial increase in research during the past
Page 124, Posters
{փdփTT
ID t
ABSTRACT
t
122 Desplazamientos del Mirlo de Agua (Cinclus
schulzi) en Yala, Jujuy, Argentina
Rodrigo Aroz1*, Pedro G. Blendinger2, Natalia Potili1, Luis O. Rivera1
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!9</<@lmW
TǣW29ধ;<;3&'$3£3+!'+-32!£W
ID t
ABSTRACT
t
Table of Contents
GHHOORVĆHOHVDOVLWLRGHLQYLHUQR3DWURQHVGHGHVSOD]DPLHQWRV
similares han sido descripto para otras especies del género
en las que sólo se desplaza parte de la población.
123 Fenología de cría de un nido de Águila Poma
r83&8-+3i!8!3AӑǤ|,3;1!-£W$31
(Spizaetus isidori) en Argentina
Rodrigo Aroz1*, Juan Manuel Grande2, Joaqun
Cereghetti2, Carmen Lopez2
Cinclus schulzi es una especie categorizada como Vulnerable,
endémica de los bosques montanos de las Yungas Australes
de Argentina y Bolivia, asociada a ríos de montaña y la
menos conocida de la familia Cinclidae. La investigación
sobre los desplazamientos y territorialidad de esta especie
es importante para formular estrategias de conservación.
Estudiamos sus movimientos en el río Yala, Jujuy, Argentina
entre los 1500 y 1900 msnm. Desde Julio de 2013 a Octubre
de 2014, capturamos individuos con redes de niebla y los
marcamos con un código de anillos de colores. Luego se
regresó al lugar para registrar la posición de los individuos
marcados. Se capturaron 12 individuos en 2013 y 10 en
2014 y se registraron 97 recapturas visuales cada una fue
georeferenciada. Cuatro individuos que crían en el sitio de
estudio permanecieron en sus territorios todo el año (de
3-11 recapturas) mientras 8 individuos en 2013 y 10 en 2014
sólo fueron observados entre mayo y septiembre (1-10). Dos
invernantes recapturados por última vez en septiembre de
2013 fueron recapturados en junio y agosto de 2014. A partir
de mayo de 2014 aparecieron nuevos individuos en el área
de estudio que dejaron de detectarse a partir de septiembre.
Llegamos a la conclusión de que Cinclus schulzi es una especie
que tiene individuos residentes, otros invernantes con algunos
Page 125, Posters
ǢW'2;83&'2='9ধ+!$-32'9@8!29('8'2$-!9</<@lmWTǣW'2;83
6!8!'£9;<&-3@329'8=!$-2&'£!9='9!6!$'9'28+'2ধ2!T
!$<£;!&
&'-'2$-!9?!$;!9@!;<8!£'9T2-='89-&!&!$-32!£&'!!16!
r83&8-+3i!8!3AӑǤ|,3;1!-£W$31
El águila poma es una de las rapaces neotropicales menos
conocidas. Esta categorizada como amenazada y se distribuye
desde el noroeste argentino hasta Colombia y Venezuela. Se
conoce poco de su fenología en el norte de su distribución
y prácticamente nada en el sur. La puesta en Colombia es
en abril y la eclosión en mayo, aunque esto parece variar.
En Bolivia un nido tenía un huevo en Mayo de 1936. El 17
de febrero de 2014 encontramos el primer nido de Águila
Poma para Argentina. Realizamos 65 horas de observación y
se colocó una cámara trampa en el nido. El 11 de febrero de
2014 el pichón del año anterior permanecía con los padres
que ya suministraban material al nido para el siguiente evento
reproductivo. El acondicionamiento del nido fue más intenso
DPHGLDGRVGHDEULO$ĆQHVGHDEULOSULQFLSLRVGHPD\RVH
observaron 4 cópulas en 7 horas de observación. La puesta fue
entre el 27 de Mayo y el 4 de Junio y la eclosión el 9 de julio.
Una vez eclosionado los adultos rellenan el nido con material,
{փdփTT
ID t
ABSTRACT
t
formando una plataforma que terminan cuando el pichón
tiene poco más de un mes. Los adultos aportaron material
fresco desde Febrero hasta los primeros días de Noviembre.
El pichón está en condiciones de volar a mediados de octubre,
pero permanece cerca del nido, y es alimentado por sus padres
GHQWURGHOPLVPRKDVWDĆQHVGHQRYLHPEUH)LQDOPHQWHHO
pichón permanece con los padres hasta mediados de febrero.
124 Conservation status of diurnal raptors in Venezuela
Adrián Naveda-Rodríguez
ID t
ABSTRACT
t
Table of Contents
of strict protected (SPA) areas in the conservation of birds
of prey. EOO ranged from 10,423 km2 to 907,223 km2,
AOO values ranged from 6,566 km2 to 903,193 km2; four
VSHFLHVPHWWKH%FULWHULRQDQGZHUHUHFODVVLĆHG7KHJDS
analysis revealed that the representation of species EOO
and AOO within SPA had mean values of 20% and 24%,
respectively. In theory, SPA are assuming an effective role
in the protection of species geographic distribution. Raptor
conservation in Venezuela must be thoroughly planned,
territorial re-ordering to enhance the connectivity among
SPA would improve the protection of birds of prey.
!>03<2;!-2!2$;<!8@c,''8'+8-2'
<2&
!&8-!2W2!='&!|+1!-£W$31
Natural history data are crucial for extinction risk assessment.
This information is non-existent for almost all species of raptors
in the Neotropics. Here, I evaluate the conservation status of
64 species of diurnal raptors in Venezuela based on extent
of occurrence (EOO) and area of occupancy (AOO) derived
from geomatic-based geographic distribution modeling and
gap analysis. I modeled the geographic distribution of raptors
species to quantify distribution areas using the maximum
entropy modeling techniques with 6271 presence records
(3988 from Venezuela, 2283 from Brazil, Colombia, Ecuador,
French Guyana, Guyana, Panama), nine environmental
YDULDEOHVWKDWZHUHEHOLHYHGWRLQćXHQFHWKHJHRJUDSKLF
distribution of raptors. EOO and AOO were used to re-evaluate
the conservation status of diurnal raptors in Venezuela,
applying Criteria B of the IUCN Red List. Furthermore, a
gap analysis was performed to evaluate the effectiveness
Page 126, Posters
125 Geographic patterns of species richness
of diurnal raptors in Venezuela
Adrián Naveda-Rodríguez1,2*, Keith L. Bildstein1, F. Hernn Vargas2
ǢW!>03<2;!-2!2$;<!8@ǣW,''8'+8-2'
<2&
r!&8-!2W2!='&!|+1!-£W$31
Knowledge of a species’ geographic distribution is crucial
to assessing its vulnerability. It is also important to know if
protected areas provide effective protection for raptor species.
Here, we examine the species richness (S) patterns, factors
predicting S and the effectiveness of protected areas (EPA) in
the conservation of diurnal raptos in Venezuela. We modeled
geographic distributions (SDM) of 64 raptor species using
ENM. Nine climatic and seven landscape metrics were used
as environmental predictors. SDM were stacked to examine
S and predictors of S were investigated using regression
models. This study evaluated S patterns in the 13 bioregions
{փdփTT
ID t
ABSTRACT
t
GHĆQHGIRU9HQH]XHOD$JDSDQDO\VLVZDVSHUIRUPHGWR
evaluate the EPA in the conservation of raptor diversity.
40 species showed a continuous distribution, whereas as
disjunct distributions were observed in 24 species. S differed
among bioregions; six pairwise compared bioregions did
not show differences. Highest S values were located in the
Guayana Massif and the mountains of northern Venezuela.
6ZDVH[SODLQHGPDLQO\E\ODQGVFDSHIHDWXUHVVSHFLĆFDOO\
canopy height, land cover and terrain slope. Environmental
heterogeneity affected the distribution of S and is therefore
important in conservation planning for Neotropical raptors.
Responses from environmental variables used to predict
S were scale-dependent; it is necessary to standardize
PHWKRGVH[SHULPHQWDOGHVLJQWRVWXG\WKHELRJHRJUDSK\
of raptors. Priority-setting for the conservation of raptor
in Venezuela must consider restricted range species, even
if they are not threatened. A territorial re-ordering is
urgent to improve the protection of this group of birds.
127 Effect of human disturbance on two waterbird
species in an estuary of Central Chile
Mara Anglica Vukasovic1*, Cristin F. Estades1
ǢW2-='89-&!&&',-£'
ID t
ABSTRACT
t
Table of Contents
migratory species. However, the very same factors that favor
birds, also attract many humans that come to these ecosystems
ORRNLQJIRUĆVKDQGUHFUHDWLRQDPRQJRWKHUXVHV6LQFH
2010 we have been monitoring populations of the American
Oystercatcher (Haematopus palliatus) and the Black Skimmer
(Rynchops niger) at the estuary of the Itata river, Central Chile
FDPSDLJQV\HDUFHQVXVHVRQFRQVHFXWLYHGD\VFDPSDLJQ
On the same dates we also have recorded different variables
related to the level of human activity (number of: people
RQWKHEHDFKGXQHVSHRSOHLQWKHZDWHURIIURDGYHKLFOHV
FDWWOHKRUVHVDQGGRJV$GGLWLRQDOO\GXULQJWKHEUHHGLQJ
seasons of 2013 and 2014 we monitored the Oystercatcher
nests (and banded some nestlings) located in the dune area
south of the river. There was an important increase in the
KXPDQDFWLYLW\GXULQJWKHĆYH\HDUVRIVWXG\8VLQJD*/0
(accounting for seasonality and temporal autocorrelation) we
found that the abundance of Black Skimmers was negatively
associated to the number people in the water (bathers and
ĆVKHUPHQ+RZHYHUZHGLGQRWĆQGDQ\VXFKHIIHFWRQ
the numbers of Oystercatchers. The fact that we observed
very little recruitment of the later species (most nests were
destroyed by off-road vehicles and cattle) suggests that this
population may be acting as a sink. Our results highlight
the need to regulate the human use of estuaries in Chile.
r1=<0!93=-$|<$,-£'W$£
Estuaries are key habitats for many waterbirds because of
their high productivity and strategic location along coasts,
which makes them particularly important as stopover sites for
Page 127, Posters
{փdփTT
ID t
ABSTRACT
t
133 Nest architecture, patterns of nestling growth
and parental behavior in the Fire-eyed Diucon
(Xolmis pyrope) in north-central Chile
Rodrigo A. Vsquez1*, Esteban Botero-Delgadillo1
ǢW2-='89-&!&&',-£'
r8=!97<'A|<$,-£'W$£
Although a recent work in central Chile provided detailed
descriptions of the breeding phenology and patterns of nestling
growth in the Fire-eyed Diucon (Xolmis pyrope), the available
information on its breeding ecology is still geographically
limited, being mostly localized on the south-central part
of its distributional range, thus limiting the possibility to
generalize if such breeding patterns are common to its
HQWLUHUDQJH%DVHGRQĆYHQHVWVIRXQGGXULQJ
at the Fray Jorge National Park, Chile, at the northernmost
limit of its distribution, we present new ecological data to
compare with information from previously studied localities.
Most nests showed a similar architecture and construction
materials as nests reported in central populations, but we
found some structural differences related with the local
nesting habitat, suggesting that nest variation could be
caused by availability of local materials and not by population
differences. Nestling growth rates showed that at least
during 2014, nestling development was slower in Fray Jorge
than in central Chile, but further study are necessary to
FRQĆUPLIWKLVLVDFRQVHTXHQFHRIDJURZWKUDWHODWLWXGLQDO
gradient or local effects causing retarded development. Video
recording of the entire nestling period showed that both
parents attend the nest and that the number of visits, and the
Page 128, Posters
ID t
ABSTRACT
t
Table of Contents
rates of feeding and fecal sacs removal tended to increase
as the nestlings grew. We also found that parents can feed
ćHGJOLQJVGXULQJWZRZHHNVRUPRUHDIWHUćHGJLQJDQGWKDW
a family can cover an area of ca. 2.3 ha during daily foraging.
135 Community of birds visiting salt licks at the lower
Purus River in the Brazilian Central Amazon
Carolina Bertsch1*, Marina A. R. M. Vieira1
ǢW29ধ;<;3-!+!<
r&!<#'2;32-|+1!-£W$31
Salt licks are spatially limited sites where animals may go to
ingest soil (geophagy), drink water or hunt. Geophagy has
EHHQGRFXPHQWHGIRUELUGVPDLQO\IRUKHUELYRUHVIUXJLYRUHV
species such as parrots, pigeons, cracids and grouses), and its
function is thought to be detoxication, cytoprotection, digestion
facilitator and as a dietary source of additional vitamins and
minerals. Documenting the diversity of species at salt licks gives
an indication of their importance within the area, which could
help focus future land management decisions. Salt licks are
also key areas of special management by local hunters, as it has
been previously documented in the SDR Piagaçu-Purus. Here
we describe avian community (species richness and visitation
rates) visiting two types of salt licks: natural (hereafter “NSL”)
DQGDUWLĆFLDOPDQPDGHZLWKUHĆQHGVDOWLQSXWRUê$6/ëRQHV
A camera-trap survey was conducted in 15 active hunting
salt licks (7 ASL and 8 NSL) between April 2014-March 2015.
Sampling effort was of 1033 camera trap*days (646 in ASL and
387 in NSL). Twelve salt licks had a total of 81 independent
avian records, being the vast majority of them (80%) in natural
{փdփTT
ID t
ABSTRACT
t
salt licks. Avian capture success was almost 9 times higher in
QDWXUDOWKDQLQDUWLĆFLDOVDOWOLFNVZKLFKFRXOGEHH[SODLQHGE\
differences in mineral composition and habitat characteristics
in both types of salt licks. Cameras recorded at least 15 species
of birds, being the most frequent: Mitu tuberosa, Aramides
cajanea, Leptotila rufaxilla and Psophia leucoptera. This diversity
of avian species using salt licks, probably for mineral ingestion,
highlights the importance of those areas for birds as well.
138 Habitat Fragmentation and Species Richness of
Wetland Birds: at a Local and Landscape Scale
Carol Cerda-Pea1*, Jaime R. Rau2
ǢW2-='89-&!&&'39!+39TǣW!#38!;38-3&'$3£3+!T'6!8;!1'2;3&'
-'2$-!9-3£+-$!9{-3&-='89-&!&T2-='89-&!&&'39!+39T!16<993823
ID t
ABSTRACT
t
Table of Contents
the total studies undertaken (n= 37). Also, it was found that
larger areas contain more species, according to the theory
of Island Biogeography. The mechanism underlying this
pattern has not been totally determined, but the area per se
K\SRWKHVLVKDELWDWKHWHURJHQHLW\DQGELUGVSHFLHVVSHFLĆF
UHTXLUHPHQWVZRXOGEHWKHPRVWVLJQLĆFDQWPHFKDQLVPV
where area-dependent species would be responsible for this
pattern. Community structure is one of the least studied
features; despite this, it seems that there is a nested structure
of the composition of waterbird species associated with this
type of environment, where the smaller fragments are poor
fractions of the large ones. This phenomenon can be extended
at both local and landscape scale, which would allow us to
identify important colonization areas, therefore of conservation
interest according to the theory of Island Biogeography.
r$!83£$'8&!W6'!|!£<1239W<£!+39W$£
The area is considered one of the most important factors
determining the presence and species richness in wetland
fragments, including waterbirds, but do not know how
accepted is this. So the aim of this review was to assess the
area-species richness relationship of birds in wetlands at a local
and landscape scale, also the existence of a nested structure
between different fragment sizes. For this, studies in wetlands
that tested the relationship between birds species richness
(S) with habitat characteristics, were reviewed and only the
studies which include the area as a variable were selected,
which were from 1978-2013. According to this review, area is
the best explanatory variable accounting for species richness,
EHFDXVHLWLVWKHYDULDEOHPRVWIUHTXHQWO\LGHQWLĆHGLQ
Page 129, Posters
139 Association between the Charadriiformes birds distribution,
habitat attributes and trophic options in Lenga estuary
Carol Cerda-Pea1*, Pedro F. Victoriano2, Ricardo Figueroa3
ǢW2-='89-&!&&'39!+39TǣW'6!8;!1'2;3&' 33£3+!T
!$<£;!&
&'-'2$-!9!;<8!£'9@$'!23+8)$!9T2-='89-&!&&'32$'6$-2T
32$'6$-2T,-£'TǤW2-&!&&'9-9;'1!9!$<ধ$39T
!$<£;!&&'-'2$-!9
1#-'2;!£'9@'2;83f,-£'T2-='89-&!&&'32$'6$-2T,-£'
r$!83£$'8&!W6'!|!£<1239W<£!+39W$£
Waterbirds distribution and abundance in wetlands could
be explained by a series of hypothesis in which the trophic
resources appear to be the main factor. However, this remains
unproven for many wetlands, considering the changes in soil
that may change the prey that birds feed on. We test the
{փdփTT
ID t
ABSTRACT
t
ID t
hypothesis that food resources (i.e macro-invertebrates)
determine the abundance and spatial distribution of Numenius
phaeopus, Himantopus melanurus and Vanellis chilensis
more than other habitat variables. The main objective was to
analyze the relationship between the three aforementioned
species trophic options and other environmental factors
in two spatial scales and different seasons. The study was
conducted in Lenga wetland in the Bío-Bío Region of Chile from
April 2013 to March 2014 and involved monthly recording of
bird abundance as well as other environmental factors (e.g
prey resources and abiotic characteristics of their habitat).
As it was predicted, the results show that the distribution
patterns associated with the abundance of birds were more
correlated with the availability of their trophic resource (R=
0.194; p=0.04) rather than with the other variables; but,
this may change depending on the season, being the trophic
variables more closely correlated with the cold season
(R=0.439; p<0.05). In addition, it is revealed that there are
differences linked to use at a micro-habitat level. This study
highlights the importance of food resources when it comes to
birds distribution and use of wetlands such as Lenga, as well
as the species intrinsic characteristics, specialization degree
about their habitat use, their prey and their trophic niche.
140 Variación en la composición de la avifauna en
Page 130, Posters
ABSTRACT
t
Table of Contents
XQJUDGLHQWHDOWLWXGLQDOGHOćDQFRRFFLGHQWDO
de la Cordillera Occidental, Colombia
Diego A. Carantn
2-='89-&!&!$-32!£&'3£31#-!
$!8!2;32ǣ|+1!-£W$31
Las montañas del neotrópico ofrecen un escenario apropiado
para entender la organización de las comunidades‚ el
recambio de especies, la disposición en gremios y grupos
taxonómicos y la diversidad. Conocer la riqueza a través
de gradientes altitudinales permitiría entender como un
escenario de cambio climático podría afectar la distribución
GHHVSHFLHVHQORV$QGHV(VWHWUDEDMREXVFDLGHQWLĆFDUHO
recambio en la composición y riqueza sobre un gradiente
altitudinal (800 a 3400m) entre el PNN Las Orquídeas y el
Páramo de Frontino‚ (Cordillera Occidental de Colombia). Se
establecieron cinco intervalos a través de una delimitación
altitudinal (<1000m, 1000-1500m, 1500-2000m, 20002800m, >2800). Los resultados preliminares muestran una
composición de 465 especies de aves‚ con las comunidades
más diversas en los rangos de 1000-1500m (231 especies) y
1500-2000 m (221 especies) y luego decrece a mayor altitud.
/DVPD\RUHVDĆQLGDGHVVHFRPSDUWHQFRQODVVHFFLRQHV
DOWLWXGLQDOHVFRQWLJXDV6HLGHQWLĆFDURQVLHWHJUXSRVGHGLHWD
y un aumento en la riqueza de estos en las elevaciones medias
del gradiente. Los grupos de dieta más diversos muestran una
disminución drástica a mayores elevaciones, debido a una
menor productividad. La compleja topografía es un factor que
LQćX\HHQODFRPSRVLFLµQHQXQJUDGLHQWH8QDDOWDYDULDFLµQ
{փdփTT
ID t
ABSTRACT
t
en la composición concentra las especies endémicas en ciertas
franjas y un alto número de especies se afectaría frente a un
escenario de cambio climático. Los bosques montanos del
norte de la Cordillera Occidental albergan una alta diversidad
LQćXHQFLDGHODDYLIDXQDGHORV$QGHV\HO&KRFRELRJHRJUDĆFR
142 6HDVRQDOćXFWXDWLRQLQWKHXVHRIDFRPPXQDOURRVW
by Diopsittaca nobilis in São Paulo city, Brazil
ID t
ABSTRACT
t
Table of Contents
$WRWDORIćRFNVZHUHUHFRUGHGOHDYLQJWKHURRVW
ZLWKDQDYHUDJHVL]HRILQGLYLGXDOVćRFNPLQ PD[
DQGRIWKHVHćRFNVPRYHGWRWKH1RUWKDQG
Northeast, towards Butantã district, Butantan Institute
and “Cidade Universitária” (USP), while 23.3% moved to
southwest, towards Vila Sônia district. This communal roost
is used permanently by the birds, which are considerably
abundant at the roost, which attests its regional importance
for the urban population of D. nobilis in the megacity.
Raquel R. Colombo
f-3£!83
8!7<'£$3£31#3|@!,33W$31W#8
The establishment of Psittacidae populations from releases
and captivity escapes in urban areas occurs worldwide,
but ecological studies focusing on these populations are
uncommon, especially in tropical regions. Many Psittacids
make use of communal roosts to overnight, whose use may
vary temporally. In this study, we analyzed the seasonal
ćXFWXDWLRQLQWKHQXPEHURIDiopsittaca nobilis (Linnaeus,
1758) using a communal roost - comprised by 23 individuals
of Roystonea oleracea (Arecaceae) - in São Paulo city, SE
Brazil. Nine morning counts were made between 2012 and
WKHĆUVWZLWKRQHFRXQWDQGHLJKWZLWKWKUHHFRXQWV
in subsequent days), in a total of 25 samples. The population
was composed on average by 116 individuals (± 36.3), with
lower numbers in October and January, and higher values in
April and May (max = 213 individuals). The amplitude of the
DQQXDOćXFWXDWLRQF\FOHVDYHUDJHGDERXWLQGLYLGXDOVs
21.6), and the highest amplitude occurred in 2012 (85.0 ±
Page 131, Posters
145 Morphological variation and taxonomy of Sirystes
sibilator (Vieillot, 1818) (Aves: Tyrannidae)
Leonardo Esteves Lopes1*, Luiz Pedreira Gonzaga2
ǢW2-='89-&!&'
'&'8!£&'-39!TǣW2-='89-&!&'
'&'8!£&3-3&'!2'-83
r£'3W$'88!&3|+1!-£W$31
Sirystes sibilator is a widespread species in the Neotropical
region, where it inhabits the forest canopy. Five subspecies
are traditionally recognized for this species, but it was recently
proposed, based on vocalizations and limited morphological
data, to split this monotypic genus in four species. We
conducted a morphological revision of the genus based on
the examination of 514 museum specimens, including all
name-bearing types available. Data presented here support
the recognition of four species in the genus, which can be
diagnosed by vocal and morphological data: 1) S. sibilator
(including atimastus, which represents the mid-point of a clinal
variation), distributed across almost all Brazilian territory S
of the Amazon river and E of the Tapajós river, also reaching
{փdփTT
ID t
ABSTRACT
t
E Bolivia, E Paraguay and NE Argentina; 2) S. albogriseus,
a Trans-Andean species distributed from Panama to W
Colombia and NW Ecuador; 3) S. albocinereus, a Cis-Andean
species distributed from NW Venezuela to central Bolivia, also
reaching extreme W Brazil and 4) S. subcanescens, distributed
from French Guyana, Surinam, Guyana and Brazil, N of the
Amazon river, also reaching W Brazil, W of the Madeira river.
:HLGHQWLĆHGSRVVLEOHK\EULGVEHWZHHQS. sibilator and S.
albocinereus from central Bolivia, and correct the range and
diagnosis of S. subcanescens, a name that has been frequently
misused in the literature. We also present a redescription of all
four recognized species, reviewing its range and natural history.
146 Análisis de la comunidad de aves de la Estación
ID t
ABSTRACT
t
Table of Contents
12.9% del total de aves anilladas. La mayor riqueza se obtuvo
en agosto y noviembre (2012); en marzo, agosto y diciembre
(2013), y en enero y agosto (2014). La mayor abundancia se
obtuvo en los meses de agosto, noviembre y diciembre (2012);
marzo, agosto y noviembre (2013); y en enero, julio y agosto
(2014). El 20.8% del total de aves anilladas presentaron una
muda activa en los meses de Junio a Agosto. En estos meses
también se registró la mayor cantidad de individuos sin grasa
corporal. Es posible que como Santa Eulalia tiene temporadas
secas y húmedas muy marcadas, la variación estacional
UHSHUFXWDHQODĆVLRORJ¯DGHODVDYHV6HUHFRPLHQGDFRQWLQXDU
con las evaluaciones a nivel de gradientes altitudinales para
determinar los patrones de muda y la dinámica poblacional
de las aves comunes en los diferentes puntos de evaluación.
Biológica Río Santa Eulalia– Huarochirí, Lima- Perú
Flor Hernndez1*, Alexis Diaz1, Erica Berrocal1, Yaqueline
Tenorio1, Julio Salvador1, Kevin Chumpitaz1, Tania Poma1
ǢW
rù'82!2&'A|$38#-&-W38+
150 Descrição do ninho e período reprodutivo de Crax
globulosa no Rio Juruá, Amazonas, Brasil
Gabriel A. Leite1*, Izeni Pires Farias2, Carlos Augusto Peres3
ǢWTǣW
TǤW2-='89-;@3(!9;2+£-!
r+!#8-'£A33#-3|,3;1!-£W$31
A pesar de su alta diversidad, se sabe muy poco de la historia
natural de las aves en Perú. El anillamiento de aves permite
generar datos sobre riqueza y abundancia de las comunidades
de aves. Este trabajo se desarrolló en la Estación Santa Eulalia
(Huarochirí, Lima - Perú), entre junio 2012 y diciembre 2014. Se
evaluó la variación de la riqueza y abundancia de especies de
DYHV\VHGHWHUPLQµVXYDULDFLµQĆVLROµJLFD(QWRWDOVHDQLOODURQ
940 individuos, pertenecientes a 33 especies (15 familias), 3 de
las cuales son especies endémicas. Se lograron 122 recapturas,
pertenecientes a 14 especies (9 familias), y representando el
Page 132, Posters
O mutum-piuri (Crax globulosa) é uma espécie ameaçada
de extinção e endêmica da bacia Amazônica, onde ocorre
H[FOXVLYDPHQWHHPćRUHVWDVGHY£U]HD'DGRVVREUHD
UHSURGX©¥RGDHVS«FLHV¥RHVFDVVRV$£UHDGHHVWXGRĆFDQD
Reserva de Desenvolvimento Sustentável Uacari, no município
de Carauari, AM. O ninho foi encontrado no dia 22 de agosto
de 2014 no igarapé Marari, margem direita do rio Juruá. No
dia 5 de setembro na tentativa de colocar uma câmera trap
próximo ao ninho a fêmea voou e não voltou mais. O ninho
{փdփTT
ID t
ABSTRACT
t
IRLYHULĆFDGRHFRQWLQKDGRLVRYRVEUDQFRVPHGLQGR[
mm, 92 x 64 mm e pesando 200 e 204 gr cada. Estava em uma
forquilha cercado por cipós a 9 m do solo e 3,5 m do igarapé
Marari, medindo 46 cm de largura e 24 cm de altura, composto
principalmente de gravetos e forrado por folhas secas e verdes.
1RGLDGHRXWXEURIRLREVHUYDGRXPĆOKRWHGHXPDVHPDQD
junto com os pais na margem direita do Marari, no mesmo dia
na outra margem um jovem macho de pelo menos três meses
foi observado, estava próximo ao solo, mas voou para o dossel.
No dia 15 de outubro em outro local do Marari, dois machos
jovens de pelo menos quatro meses foram observado junto
com os pais no dossel. Na Colômbia foram observados fêmeas
FRPY£ULRVĆOKRWHVMRYHQVJHUDQGRDSRVVLELOLGDGHTXHI¬PHDV
tem grandes ninhadas. O período reprodutivo da espécie
parece ser o mesmo encontrado na Colômbia, Peru e em
Codajás no Brasil, onde dois indivíduos capturados possuíam
gônadas bem desenvolvidas em julho. O auge da reprodução
entre os meses de junho a outubro na região condiz com a
«SRFDGDVHFDWHQGRGLVSRQLELOLGDGHGHWHUUDSDUDRĆOKRWHV
andarem até conseguirem voar, antes de alagar novamente.
151 Reprodução de Bucco macrodactylus no
médio rio Juruá, Amazonas, Brasil
Gabriel A. Leite
ID t
ABSTRACT
t
Table of Contents
de B. macrodactylus é descrito, além do cuidado parental. O
ORFDOGHHVWXGRĆFDQRULR-XUX£GHQWURGD5'68DFDULQR
município de Carauari, AM, Brasil. O monitoramento do ninho
foi realizado por meio de observações diretas e gravações
de vídeos. Foram anotados a frequência e tipo de presa que
RVSDLVOHYDYDPDRVĆOKRWHV2QLQKRIRLHQFRQWUDGRQRGLD
GHGH]HPEURGHĆFDYDGHQWURGHXPDFDYLGDGHHPXP
cupinzeiro arborícola, estava a 2,45 m do solo, com abertura
de 5 cm e profundidade de 19 cm. Durante 43 horas em seis
dias ele foi monitorado. Ambos os pais levaram alimento para
RVGRLVĆOKRWHVYH]HVXPDP«GLDGHSUHVDVSRUKRUD
'DVSUHVDVIRUDPLGHQWLĆFDGDVVHQGRTXHQDPDLRULD
foram invertebrados da ordem Orthoptera. Foram gravadas
duas tentativas de predação do ninho por um marsupial.
No dia seguinte, foi observado o comportamento dos pais
WHQWDQGRID]HURVĆOKRWHVDEDQGRQDUHPRQLQKR8PGRV
adultos estava com alimento no bico, mas em vez de chegar
HGDURDOLPHQWRHOHSRXVDYDQDHQWUDGDHTXDQGRRVĆOKRWHV
iam pegar a presa ele voava. Depois de algumas tentativas os
ĆOKRWHVDEDQGRQDUDPRORFDO2QLQKRGHB. macrodactylus é
conhecido por um único registro no Peru, também feito em
um cupinzeiro arborícola a 2,5 m do solo. A maior frequência
de insetos da ordem Orthoptera pode estar relacionada
ao fato do ninho estar próximo a uma área de plantação
de milho, onde a abundância desse tipo de presa é alta.
+!#8-'£A33#-3|,3;1!-£W$31
Bucco macrodactylus pertence à família Bucconidae, no qual
seus representantes constroem ninhos em buracos em
barrancos e cupinzeiros arborícolas. Neste trabalho, o ninho
Page 133, Posters
{փdփTT
ID t
ABSTRACT
t
152 Descrição dos ninhos de Myrmotherula
assimilis e Hypocnemoides maculicauda, no
médio rio Juruá, Amazonas, AM
Gabriel A. Leite1*, Marcelo Henrique Mello Barreiros
ǢW
+!#8-'£A33#-3|,3;1!-£W$31
$VćRUHVWDVLQXQG£YHLVQD$PD]¶QLDSRVVXHPGRLVSHU¯RGRV
muito distintos, onde esse ambiente propicia um hábitat
IDYRU£YHOSDUDHVS«FLHVGHWHUUDĆUPHTXDQGRHVW£VHFR
e se torna fonte de recursos para muitas espécies quando
está alagado, pois nesse período diversas espécies vegetais
IUXWLĆFDP(VSHFLDOPHQWHSDUDHVS«FLHVGHDYHVTXHV¥R
residentes nesse ambiente, o período das cheias é época de
reprodução, pois aproveitam a grande oferta de recursos
para a prole. Aqui apresentamos dados inéditos sobre a
reprodução de duas espécies de áreas alagadas, Myrmotherula
assimilis e Hypocnemoides maculicauda, dentro do RDS Uacari,
no médio rio Juruá, Amazonas, Brasil. O ninho de M. assimilis
foi encontrado no dia 9 de março de 2015, medindo 6 cm de
altura, 3 cm de profundidade e 5,5 cm de diâmetro na entrada.
Era construído com pequenas raízes e algumas folhas secas,
além de estar 38 cm do nível da água. O mesmo continha
dois ovos marrom claro com manchas marrom escuras e a
fêmea foi observada incubando. O ninho de H. maculicauda
foi encontrado no dia 11 de março de 2015, continha um
único ovo de cor roxa, construído com pequenas raízes
escuras, além de folhas verdes e secas, estava a 18 cm do
nível da água e o macho foi observado incubando. As suas
medidas eram 17 cm de altura, 7 cm de profundidade e 5
Page 134, Posters
ID t
ABSTRACT
t
Table of Contents
cm de diâmetro na entrada. Dados reprodutivos das duas
espécies são escassos, com apenas registros de adultos de
M. assimilisDOLPHQWDQGRĆOKRWHVHPRXWXEURHH. maculicauda
em agosto. Para muitas espécies neotropicais, dados de
história natural ainda permanecem obscuros, sendo que
esses podem nos ajudar a compreender como essas espécies
conseguem sobreviver nesse ambiente tão peculiar.
153 How does data availability bias extinction
risk assessments of migratory birds?
Veronica F Gama1*, Morena Mills1, Judit Szabo2, Richard
A Fuller1, Simon P Blomberg1, Hugh P Possingham1
ǢW,'2-='89-;@3(<''29£!2&TǣW!8;2'89,-6(38
;,'!9;9-!2f<9;8!£!9-!2
£@>!@
r='832-$!W+!1!|<7W'&<W!<
The availability of data on migratory birds around the world
is highly heterogeneous, which affects the accuracy of their
extinction risk assessments. In some countries, such as England,
the USA and Australia, there are comprehensive historical
data, largely collected by the birdwatching community.
Compared to the world average, Australia has a higher
SURSRUWLRQRIPLJUDWRU\ELUGVFODVVLĆHGDVWKUHDWHQHGDQG
recent studies have shown that even more mobile species
could be considered threatened if additional data were used.
In contrast, Brazil is among the countries with little data on
migratory birds, and this shortage may impact the number of
VSHFLHVFODVVLĆHGDVWKUHDWHQHG,QWKLVSDSHUZHLQYHVWLJDWH
if the addition of data to the assessment would increase the
{փdփTT
ID t
ABSTRACT
t
proportion of threatened migratory birds in Brazil. We obtain
geographical distribution data (area of occupancy and extent
of occurrence) and reassess the extinction risk for a subset of
Brazilian migratory and non-migratory birds using structured
expert elicitation. This method was used in the “Action Plan for
Australian Birds” in 2010, the results of which were adopted
by the global IUCN Red List. In this paper we (1) quantify how
the proportions of threatened and non-threatened migratory
and non-migratory Brazilian birds change by the addition of
new data, (2) gather and produce valuable data for migratory
ELUGVLQ%UD]LODQGZHSURSRVHVSHFLĆFVWUDWHJLHVIRU
extinction risk assessments in data poor environments.
154 Effects of cattle ranching on avian assemblages
ID t
ABSTRACT
t
Table of Contents
same points. Taller vegetation occurred in areas with lower
stocking density, as expected (F2,160 = 18.94, p < 0.001,
7XNH\+6'S1RVLJQLĆFDQWGLIIHUHQFHVZHUHIRXQG
on species richness (F2,160 = 1.58, p = 0.20) or abundance
(F2,160 = 1.90, p = 0.15) among stocking levels. However,
some grassland dependent species were more abundant
at high stocking (e.g. Anthus sp.) while others occurred only
at low stocking rates (e.g. Cistothorus platensis). Preliminary
results highlight the importance of maintaining a vegetation
mosaic, through the management of cattle stocking rates,
providing a variety of habitats available for birds. The next
step is to get more information that helps to verify what is
the best management techniques for the conservation of
grassland specialist species, since they are more threatened.
in the Pampas grasslands of South Brazil
Tiago Filipe Steffen1*, Graziela Dotta1, Juliana
Pestana Souza1, Carla Suertegaray Fontana1
155 Factors affecting escape distance in some Neotropical birds
ǢW!#38!;8-3&'82-;3£3+-!T<9'<&'-Í2$-!9''$23£3+-!T
Augusto Joo Piratelli1*, Gabriela Rodrigues Favoretto2,
Marina Franco de Almeida Maximiano3
ǢW2-='89-&!&'
'&'8!£&'3!8£39T'6;3W-Í2$-!91#-'2;!-9cTǣW
2-='89-&!&'
'&'8!£&'3!8£39TǤW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!
The Pampas grasslands are represented by several ecological
systems, including the Shallow Soils’ Region in the central-west
SDUWRI5LR*UDQGHGR6XOVWDWH3HULRGVRIZDWHUGHĆFLWKDYH
reduced the pressure of agrarian expansion in this region, that
has been historically used for ranching activities, which allowed
the persistence of a large percentage of native grasslands.
We evaluated the effects of three levels of cattle stocking
density – low, medium and high – on bird species richness and
abundance by carrying out 160-point counts in eight study
sites. We also measured variation in vegetation height at these
r6-8!;'££-|<(9$!8W#8
Page 135, Posters
7KHćLJKWLQLWLDWLRQGLVWDQFHKDVEHHQXVHGHLWKHUWRXQGHUVWDQG
WKHFRVWEHQHĆWWUDGHRIIVUHODWHGWRWKHULVNRISUHGDWLRQ
or as an important tool for wildlife managers. Although this
variable is well-discussed for temperate regions, it is still
poorly known in the Neotropics. Here we analyze the escape
behavior of some Neotropical birds, comparing an urban to
DQRQXUEDQDUHD:HWHVWHGIRUWKHLQćXHQFHRIVLWHVXUEDQ
vs. non-urban area), approaching (by one vs. two people),
{փdփTT
ID t
ABSTRACT
t
daytime (morning vs. afternoon), seasons (breeding vs. nonbreeding) and body mass on the determination of the initial
),'DQGĆQDO))'ćLJKWGLVWDQFHVDFURVVGLIIHUHQWVSHFLHV
We predict that FID will be greater in rural areas and under
a greater threat (higher number of predators approaching)
in the afternoon and in the non-breeding season. We also
expect a direct relationship between body mass and FID and
between FID and FFD. We sampled 11 species after measuring
HVFDSHEHKDYLRUVDQGZHFRQĆUPHGRXUSUHGLFWLRQV
IRUVLWHVĆYHVSHFLHVGD\WLPHRQHVSHFLHVDQGUHMHFWHG
our premise about seasons for one species. Mean FID was
strongly affected by body mass, and directly affected FFD.
Adjustments in FID are, most likely, an important adaptive trait
in urban habitats and may partially explain the predominance
of species with higher ecological plasticity in cities.
158 0RGHORVGHRFRUU¬QFLDGHDYHVFRPRIHUUDPHQWD
SDUDLGHQWLĆFD©¥RGHIUDJPHQWRVćRUHVWDLVXUEDQRV
prioritários para a conservação em Manaus
Beatriz Cirino1*, Cintia Cornelius Frische2
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!A32-!TǣW
2-='89-&!&'
'&'8!£&31!A32!9
ID t
ABSTRACT
t
Table of Contents
ćRUHVWDVSUHVHUYDGDVHLQGLFDGRUDVGHDPELHQWHVDQWURSL]DGRV
e modelos de ocorrência como ferramenta de seleção de
áreas prioritárias para a conservação (APC). Caracterizamos
quantitativamente a paisagem, obtivemos dados de qualidade
ambiental e realizamos censos de aves em 30 fragmentos
ćRUHVWDLV8WLOL]DPRVDDERUGDJHPGHVHOH©¥RGHPRGHORVSDUD
determinar a relação entre a ocorrência das espécies e métricas
de paisagem e qualidades dos fragmentos. Encontramos
que fragmentos grandes e com maior área núcleo tem
maior probabilidade de ocorrência de espécies indicadoras
GHćRUHVWD3RU«PDPDLRULDGRVIUDJPHQWRVFRPHVWDV
características encontram-se nas regiões periféricas da cidade,
onde atualmente existem altas taxas de desmatamento devido a
empreendimentos imobiliários ou invasões. O campus da UFAM
(~600 ha) foi o único fragmento que apresentou alta prioridade
para conservação no centro da cidade. Fragmentos pequenos
e com menor qualidade ambiental tiveram maior probabilidade
de ter espécies indicadoras de ambientes antropizados. Estes
fragmentos, no entanto, tem um papel fundamental para
a manutenção da conectividade entre os fragmentos com
alta prioridade para conservação. Os dados desta pesquisa
auxiliam na elaboração de diretrizes para gerenciamento das
UCs existentes e no planejamento de novas UCs em Manaus.
r#-!382-;3|+1!-£W$31
)UDJPHQWRVćRUHVWDLVHP£UHDVXUEDQDVDMXGDPQDPHOKRULD
da qualidade de vida da população humana através dos
serviços ecossistêmicos que oferecem. Nosso objetivo foi
LGHQWLĆFDUIUDJPHQWRVćRUHVWDLVSULRULW£ULDVSDUDFRQVHUYD©¥R
em Manaus (AM). Utilizamos espécies de aves indicadoras de
Page 136, Posters
{փdփTT
ID t
ABSTRACT
t
160 Reporte de nidos de Geositta peruviana y
Pseudoasthenes cactorum en la Zona Reservada
Lomas de Ancón (ZRLA) Lima–Perú
ID t
ABSTRACT
t
Table of Contents
161 ,GHQWLĆFDQGRDYHVHPXPVDQWX£ULRHFROµJLFRQR
sul do Brasil, Florianópolis, Santa Catarina
Fabrcio Almeida
Jennyfer Zuiga1*, Katia Monzn2
2-='89-&!&'
'&'8!£&'!2;!!;!8-2!
ǢW2-='89-&!&!$-32!£!@38&'!2!8$39TǣW2-='89-&!&!$-32!£&'8</-££3
(!#8-$-3W#!9-£-3!£1'-&!|+1!-£W$31
r/'22@/ǡǣǣǦ|+1!-£W$31
$LGHQWLĆFD©¥RGHDYHVHPDPELHQWHVQDWXUDLVSURSRUFLRQD
subsídios importantes para o monitoramento ambiental, pois
elas estão presentes em todos os ecossistemas da Terra, com
exceção das profundezas do oceano. Além de serem ótimas
bioindicadoras, as aves proporcionam serviços ambientais
importantes, tais como a dispersão de sementes, a polinização
e o lazer. Nesta perspectiva, o trabalho objetivou apresentar
os registros de aves mais importantes dos ecossistemas da
praia do Santinho, Florianópolis, Santa Catarina, Brasil. Esta
localidade pode ser considerada como um santuário ecológico,
devido à alta diversidade de espécies registradas. Entretanto, a
região vem passando por um processo acelerado e desordenado
de expansão urbana. Visando reverter este quadro, uma
unidade de conservação está sendo concebida para proteger as
espécies in situ. O levantamento se fez através de observação
GLUHWDHRXSRULGHQWLĆFD©¥RGDVYRFDOL]D©·HVVHQGRTXHR
mesmo é fruto de mais de dez anos de monitoramento da área.
O total registrado soma 162 espécies de aves, distribuídas em
55 famílias, o que representa aproximadamente 23% das aves
com ocorrência no Estado de Santa Catarina e 46% das aves
registradas para Florianópolis. Dentre elas, quatro espécies são
citadas na lista vermelha de ameaçadas de extinção do Estado
de Santa Catarina (Ramphocelus bresilius, Rallus longirostris,
Geositta cunicularia e Thalasseus maximus). A localidade é um
La Zona Reservada Lomas de Ancón (ZRLA) localizada en
Lima, Perú, administrada por el Servicio Nacional de Áreas
1DWXUDOHV3URWHJLGDV6(51$13FRPSUHQGHXQDVXSHUĆFLH
de 10 962,14 hectáreas de desierto costero, alberga hábitats de
especies endémicas y formaciones vegetales singulares dentro
del ecosistema Lomas costeras. Es denominada también como
?oasis de niebla?, ?cinturón fértil? o ?prados en el desierto?
debido a la presencia de neblina y al desarrollo estacional de
la vegetación. Entre la fauna endémica se encuentran dos
especies de aves, el Minero Peruano (Geositta peruviana)
y Canastero de los Cactus (Pseudoasthenes cactorum)
ORVFXDOHVQLGLĆFDQHQOD=5/$(QHOSHULRGRGHDJRVWRD
noviembre de 2014; durante el recorrido por los senderos
establecidos en la ZRLA, reconocimos nidos de estas dos
especies endémicas y caracterizamos los hábitats presentes:
Loma de Herbáceas, Tillandsiales, Cactáceas Dispersas y
Cactáceas Columnares. Encontramos 11 nidos en actividad
del Minero Peruano en la Loma de Herbáceas y 5 nidos del
Canastero de los Cactus en las Cactáceas Columnares. Estos
resultados son aportes preliminares para la conservación
y gestión de la Zona Reservada Lomas de Ancón.
Page 137, Posters
{փdփTT
ID t
ABSTRACT
t
importante sitio para descanso e alimentação de espécies
migratórias, tanto as do hemisfério sul, quanto as do hemisfério
norte, comprovando a importância da área para a manutenção
da biodiversidade na costa atlântica do sul do Brasil.
164 &L¬QFLD&LGDG¥QR%UDVLOFRQWH¼GRGHZHEVLWHFRUURERUDFRP
OLWHUDWXUDFLHQW¯ĆFDVREUHDELRORJLDUHSURGXWLYDGH3LSULGDH
Sandro G. Moreira1,2*, Miguel ngelo Marini1
ǢW2-='89-&!&'&'8!9£-!TǣW'2;832-='89-;8-3&'!;39&'-2!9
ID t
ABSTRACT
t
Table of Contents
DQR,QIRUPD©·HVQ¥RGHVFULWDVQDOLWHUDWXUDFLHQW¯ĆFDIRUDP
ninho de Lepidothrix nattereri, com 2 ovos sendo incubados,
em Paranáíta (MT); ninho de Xenopipo atronitens, contendo
2 ovos, em Aripuanã (MT) e ninhos de Ilicura militaris em
Guanhães e Nova Lima (MG), Santa Maria Madalena e Rio
de Janeiro (RJ), Apiaí (SP), Blumenau e São José (SC), com
informações sobre construção do ninho, incubação e cuidados
parentais. O site wikiaves.com, além de divulgar a ornitologia
fora do meio acadêmico, parece possuir potencial em fornecer
LQIRUPD©·HVFLHQW¯ĆFDVUHIHUHQWHV¢VDYHVEUDVLOHLUDV
r9!2&83'$,3!=-9|,3;1!-£W$31
&L¬QFLD&LGDG¥«XPDIRUPDGHJHUDUGDGRVFLHQW¯ĆFRVSHOD
cooperação entre pesquisadores e cidadãos da sociedade.
O site wikiaves.com divulga informações sobre aves que
ocorrem no Brasil, pela participação de observadores, que
inserem informações referentes às mesmas. O objetivo deste
trabalho foi comparar os registros relacionados à reprodução
de Pipridae no site com o conhecimento existente na literatura.
Foram analisados 13.209 registros, dos quais 262 referiam-se
à reprodução. O comportamento de corte foi visto em 116;
42 referiam-se ao conteúdo de ninhos, sempre com ninhada
de 2, como esperado. Os comportamentos de construção do
ninho, incubação e cuidado parental foram vistos em 97, em
todos realizados por fêmeas, esperada estratégia antipredação.
Registros de reprodução foram feitos em todos os meses,
sendo abril o mês com menor número e novembro com o
maior; a atividade mais precoce foi a corte de Chiroxiphia
pareola, e registro mais tardio o de um ninhego de Manacus
manacus, ambos feitos em maio, demonstrando que as
atividades reprodutivas concentram-se na segunda metade do
Page 138, Posters
167 9LQWHDQRVV¥RVXĆFLHQWHVSDUDTXHHVS«FLHVGHDYHV
GHSHQGHQWHVGHćRUHVWDVUHFRORQL]HPXPD£UHDGH
restinga após mineração no nordeste do Brasil?
Arnaldo Vieira-Filho1*, Helder Araujo1 Maria Regina Barbosa1
ǢW2-='89-&!&'
'&'8!£&!!8!Ð#!
r!82!£&3,=-'-8!|+1!-£W$31
Historicamente muitas áreas de restinga localizadas no
nordeste brasileiro sofreram ou sofrem forte pressão antrópica,
principalmente decorrida da especulação imobiliária e de
atividades industriais, acarretando na redução e fragmentação
de habitats naturais. Portanto, nós objetivamos avaliar se a
Q¥RFRORQL]D©¥RGHXPD£UHDUHćRUHVWDGDSRUHVS«FLHVGH
DYHVGHVXEERVTXH«LQćXHQFLDGDSHODGLVW¤QFLDHQWUHD£UHD
UHćRUHVWDGDHRIUDJPHQWRFRPYHJHWD©¥RQDWLYD3DUDWDQWR
nós capturamos 200 indivíduos de 13 espécies de aves na
área nativa e translocamos aproximadamente 60% destes
SDUD£UHDUHćRUHVWDGD-£SDUDYHULĆFDURGHVORFDPHQWRGH
{փdփTT
ID t
ABSTRACT
t
indivíduos na área nativa, os 40% restante dos espécimes
capturados foram liberados nos locais de capturados. Os
espécimes foram capturados entre Junho de 2008 e Abril
de 2010 com o monitoramento estendendo-se até Setembro
de 2011. Do total de indivíduos translocados, 58 foram
recapturados no fragmento de restinga nativa, enquanto
VRPHQWHXP1 IRLUHFDSWXUDGRQD£UHDUHćRUHVWDGD
'LDQWHGLVVRYHULĆFDPRVTXHGRVLQGLY¯GXRV
retornaram a área nativa e permaneceram no mesmo.
'LDQWHGLVVRQµVFRQFOX¯PRVTXHDV£UHDVUHćRUHVWDGDV
não são capazes de manter as espécies de aves estudada e
que essas espécies possuem a habilidade de cruzar a matriz
entre os fragmentos amostrados. A não colonização da área
UHćRUHVWDGDSRGHHVWDUDVVRFLDGDDHVWUXWXUDHFRPSRVL©¥R
GDYHJHWD©¥RHQFRQWUDGDQRIUDJPHQWRUHćRUHVWDGR
168 Revisão das guildas alimentares de aves
brasileiras não Passeriformes do cerrado
Wagner de Freitas Pereira1*, Ana Paula Moretto Arajo1, Mayara da
Silva Reis1, Rosiani Ramos Lopes Brinck1, Srgio Roberto Posso1
ID t
ABSTRACT
t
Table of Contents
das aves não-passeriformes do Cerrado brasileiro por meio
GHXPDUHYLV¥RELEOLRJU£ĆFDTXHVHUYLU£FRPREDVHSDUD
FRQVXOWDHPDSHQDVXPD¼QLFDIRQWH$UHYLV¥RELEOLRJU£ĆFD
foi realizada com o auxílio do Google Acadêmico. Uma espécie
foi considerada dentro de uma categoria alimentar desde que
a literatura indicasse tal categoria em pelos menos 75% das
citações, caso contrário foi considerada como onívora. De
384 espécies de não-passeriformes ocorrentes no Cerrado,
30 não foram encontradas referências de estudos alimentares
e, portanto, carecem de estudo. Das restantes, 96 espécies
foram consideradas insetívoras, 81 carnívoras, 75 frugívoras,
57 onívoras, 35 nectarívoras, seis granívoras (Zenaida
auriculata, Columbina minuta, C. talpacoti, C. picui, C. cyanopis
e Scardafella squammata) e quatro detritívoras (Cathartidae).
Trabalhos com itens alimentares de aves no Cerrado
JHUDOPHQWHLQGLFDPXPQ¼PHURPDLRUGHHVS«FLHVLQVHW¯YRUDV
carnívoras, devido à fauna rica e abundante disponível para
as aves neste bioma. Esta lista proporciona uma única base
de consulta que será útil para determinação rápida e segura
GDVLQWHUD©·HVWUµĆFDVGDDYLIDXQDHPWUDEDOKRVGHHFRORJLD
conservação e manejo dos ecossistemas do Cerrado brasileiro.
ǢW
r(8'-;!9>6|+1!-£W$31
São raros os dados sobre a dieta das aves não-passeriformes
do Cerrado e não há uma compilação de dados alimentar
destas em uma única fonte. Necessita-se de várias fontes
SDUDVHYHULĆFDUWDLVSUHIHU¬QFLDV$LQGDQ¥RK£SDGU¥RVRE
qualquer critério em relação à determinação da predominância
alimentar das aves não-passeriformes. Desse modo, o objetivo
deste trabalho é obter uma lista das guildas alimentares
Page 139, Posters
{փdփTT
ID t
ABSTRACT
t
173 Análise da comunicação sonora de Myiozetetes cayanensis
(Aves, Tyrannidae) revela uma ampla variedade de
sinais sonoros e contextos comportamentais
Dnilson O. Ferraz1*, Leiliany Negro de Moura1, Amanda de
Almeida Monte1, Felipe Reis Castro1, Maria Luisa da Silva1
ǢW2-='89-&!&'
'&'8!£&3!8Æ
r#-3i('88!A|,3;1!-£W$31
A comunicação pode ser caracterizada como o comportamento
em que os emissores usam sinais para alterar o comportamento
do receptor. O presente estudo apresenta uma contribuição
à compreensão do comportamento vocal de Passeriformes
Suboscines. Descrevemos o repertório vocal de Myiozetetes
cayanensis e a correspondência das vocalizações com
os respectivos contextos comportamentais utilizando
a técnica do playback da vocalização. A coleta de dados
ocorreu na Universidade Federal do Pará em Belém-Pa e no
Parque Ecológico de Gunma em Santa Bárbara do Pará-Pa.
Registramos as vocalizações com o auxílio de gravador digital
e microfone ultradirecional. Encontramos um repertorio
constituído por 15 vocalizações. A vocalização 1, em dueto,
IRLLQWHUSUHWDGDFRPRRFDQWRGHUHFRQKHFLPHQWRHVSHF¯ĆFR
Esta vocalização estaria relacionada, juntamente com
pelo menos outras três vocalizações, a comportamentos
de defesa territorial além de representar uma forma de
manutenção da coesão do casal. A vocalização 3 pode ter
função de alarme pois a emissão era motivada pela presença
de intrusos nas proximidades do ninho. Entretanto, a espécie
não mostrou comportamento de fuga durante testes com
esta vocalização. Foram observados seis sinais sonoros com
Page 140, Posters
ID t
ABSTRACT
t
Table of Contents
provável função de contato, pois em resposta ao playback
com estas os indivíduos buscavam o local da fonte, às vezes
HPLWLQGRDVPHVPDVYRFDOL]D©·HV&RQĆUPDPRVDHPLVV¥R
GHXPDYRFDOL]D©¥RUHODFLRQDGDDRSHU¯RGRGHQLGLĆFD©¥R
usada para comunicação do casal. Os dados obtidos neste
estudo revelam uma complexidade comportamental e
uma variedade de repertório inesperada para uma espécie
que supostamente apresenta canto estereotipado.
176 Functional traits of birds: an approach to understand
the effects of fragmentation in the Colombian Andes
Maria Camila Estrada-Flrez1*, Gastn Zamora Abrego2
ǢW2-='89-&!&!$-32!£&'3£31#-!
r9;'-2!$£'-;|+1!-£W$31
Fragmentation and habitat loss is a process that changes the
structure of the plant and animal communities of an ecosystem,
which affects not only the taxonomic diversity, but also the
HFRORJLFDOIXQFWLRQVWKDWVRPHVSHFLHVPD\EHIXOĆOOLQJ6WXGLHV
on Functional Diversity (FD), establish how diverse are the
functional traits (ecological and morphological attributes of a
species) of an ecosystem and which ones may be driving the
responses of a species to the environment disturbance. We
studied the andean bird assembly in vegetation fragments of
different sizes and evaluate the changes in FD as a result of
changes in vegetation cover. Moreover, we determined which
functional traits (e.g. feeding guild, foraging strategy, wing load,
ERG\VL]HQHVWLQJVLWHDUHPRUHLQćXHQWLDOLQWKHLUGLVWULEXWLRQ
{փdփTT
ID t
ABSTRACT
t
in the fragment matrix. FD is higher in larger fragments, as
opposed to smaller fragments that are expected to have lower
values of FD. However, small fragments could possibly present
higher values of taxonomic diversity, supporting our predictions
that the bird assembly responds differentially to fragmentation
process and environment disturbances. Our results could also
help us to predict which species are more vulnerable to these
processes and to identify which characteristics better explain
the observe differences in FD. Finally, it would be of great
interest to combine other diversity measures (phylogenetic
and taxonomic) in order to improve our understanding of how
the biodiversity responds to environmental constraints.
177 Capturing the Southern Lapwing (Vanellus chilensis)
Ricardo A.S. Cerboncini1*, Talita V. Braga1, Luiz H.
Varzinczak1, James J. Roper1, Fernando C. Passos1
ǢW83+8!1!&'Õ9f+8!&<!3'1$3£3+-!'329'8=!3T
2-='89-&!&'
'&'8!£&3!8!2Æ
ID t
ABSTRACT
t
Table of Contents
we placed mist-nets in their breeding territories, at least 15
m away from nests. We then walked towards the birds and
directed them towards the mist-nets while they tried to distract
us away from their nest site. Net locations were chosen to
avoid being close to other obstacles (buildings, trees) so that
ZKHQELUGVćHGWKH\GLGQRWDOVRDYRLGć\LQJWRZDUGVWKH
net. Next, when nestlings were present, we set mist nets in
a “V” formation. Then we captured nestlings by hand just
before sunset and moved within the V of the nets, where
the young birds were released. The adults, in defending the
young, returned to the young and landed in the nets. Using
this combination of procedures, we captured 78 adult birds
during the 2012 and 2013 breeding seasons in southern Brazil.
No abandonment of nest, young or territory was observed.
These capture methods allowed us to color-band individuals
and to study their behavior and ecology. Thus, with our
capture methods, lapwings (and other shorebirds) are now
possibly used in long-term population and survival studies.
r8-$!8&3$'8#32$-2-|+1!-£W$31
POSTER SESSION: FIELD TECHNIQUES & TOOLS FOR CONSERVATION
The Southern Lapwing (Vanellus chilensis, Charadriidae) is
commonly found in agricultural and urban areas in South
America, and it is interesting due to its territorial behaviors
associated with its facultative cooperative breeding. Capturing
the lapwing, however, is challenging and few studies to date
have included the capture and individual marking of birds.
+HUHZHGHVFULEHKRZZHGHYHORSHGDQHIĆFLHQWFDSWXUH
method for the lapwing during the breeding season by taking
advantage of their defensive behavior and using mist-nets at
night. First, we located nests prior to hatching and, at night,
Page 141, Posters
178 Consumo de Miconia cf. lepidota(melastomataceae)
por aves em uma área em estágio médio de
sucessão ecológica na Amazônia Central
Jos Carlos Rodrigues Soares1*, Roberta Souza de Moura1, Rbia
Pereira Ribeiro1, Juliana Soares Vieira2, Louri Klemann Junior1
ǢW2-='89-&!&'&39;!&3&31!A32!9TǣW2-='89-&!&'
'&'8!£&31!A32!9
r$!8£39*38'9;!£ǣ|+1!-£W$31
O gênero Miconia (Melastomataceae) possui um importante
papel na dieta e manutenção de diversas espécies de aves
{փdփTT
ID t
ABSTRACT
t
ID t
IUXJ¯YRUDVHPćRUHVWDVWURSLFDLVSRVVXLQGRSRWHQFLDO
para ser utilizada como poleiro natural na recuperação
de áreas degradadas. Assim, o objetivo deste trabalho foi
LGHQWLĆFDUDVHVS«FLHVGHDYHVTXHXWLOL]DUDPMiconia cf.
lepidotaFRPRLWHPDOLPHQWDUHPXPDćRUHVWDHPHVW£JLR
médio de sucessão ecológica localizada na rodovia AM010, no município de Itacoatiara (AM), contribuindo com
informações sobre o seu uso como poleiro natural. Para
isso foram utilizadas redes ornitológicas para a captura
de aves entre agosto de 2013 e julho de 2014. Todas as
DYHVFDSWXUDGDVIRUDPVDFULĆFDGDVWD[LGHUPL]DGDVH
GHSRVLWDGDVHPFROH©¥RFLHQW¯ĆFD2VFRQWH¼GRVHVWRPDFDLV
dos espécimes capturados foram retirados e as sementes
FRQVXPLGDVIRUDPWULDGDVHLGHQWLĆFDGDV'DVHVS«FLHV
de aves capturadas que utilizaram frutos em sua dieta oito
consumiram Miconia cf. lepidota. Dentre elas encontram-se
WDQWRHVS«FLHVGHDYHVćRUHVWDLVHTXHVHGHVORFDPSRXFR
como Pipra aureola, quanto espécies que utilizam ambientes
alterados e tem maior capacidade de deslocamento, como
Cacicus cela e Ramphocelus carbo. No conteúdo estomacal das
aves que consumiram Miconia cf. lepidotaIRUDPLGHQWLĆFDGDV
também, sementes de outras nove espécies vegetais. Assim,
considerando os resultados obtidos e o fato desta espécie
vegetal se desenvolver bem em áreas alteradas, o seu uso
como poleiro natural pode contribuir para a recuperação de
áreas degradadas através da atração de aves frugívoras e da
dispersão de sementes de diferentes espécies por ornitocoria.
179 $Q£OLVHFRPSDUDWLYDGDWD[DGHSUHGD©¥RGHQLQKRVDUWLĆFLDLV
Page 142, Posters
ABSTRACT
t
Table of Contents
HPXPD£UHDGHH[SORUD©¥RćRUHVWDOQD$PD]¶QLD&HQWUDO
Roberta Souza de Moura1*, Rbia Pereira Ribeiro1, Jos
Carlos Rodrigues Soares1, Louri Klemann Junior1
ǢW2-='89-&!&'&39;!&3&31!A32!9
r83#'8;!13<8!,|+1!-£W$31
A predação de ninhos naturais vem sendo sugerida como a
SULQFLSDOFDXVDGRGHFO¯QLRGHSRSXOD©·HVGHDYHVLQćXHQFLDQGR
a estrutura e o funcionamento das comunidades. Apesar de
diversos fatores terem sido estudados e relacionados com a
variação nas taxas de predação, poucos avaliaram os efeitos
GRPDQHMRćRUHVWDOVXVWHQW£YHOVREUHHVWDVWD[DV$VVLP
o presente trabalho teve como objetivo avaliar o efeito do
PDQHMRćRUHVWDOVXVWHQW£YHOVREUHDWD[DGHSUHGD©¥RGH
QLQKRVHPXPDćRUHVWDGHWHUUDĆUPHQD$PD]¶QLD&HQWUDO
3DUDLVVRIRUDPLQVWDODGRVQLQKRVDUWLĆFLDLVHPWU¬V
diferentes áreas, localizadas no município de Silves (AM), sendo
20 ninhos em uma área de preservação permanente, 20 em
XPD£UHDTXHVRIUHXPDQHMRćRUHVWDOQRDQRGHH
em uma área que ainda será manejada. Metade dos ninhos
foi instalada no solo e metade no sub-bosque, a 1.5 metros
de altura. O experimento permaneceu montado por 15 dias
e foi repetido duas vezes, entre dezembro de 2014 e abril de
1¥RKRXYHGLIHUHQ©DVLJQLĆFDWLYDHQWUHDSUHGD©¥R
dos ninhos de solo (média 3.17 ninhos predados) e de subERVTXHP«GLD+RXYHGLIHUHQ©DVLJQLĆFDWLYDHQWUH
as áreas amostradas, sendo que a área manejada, a área de
reserva e a área a ser manejada tiveram, respectivamente,
médias de 2.25, 3.00 e 4.75 ninhos predados. A menor
{փdփTT
ID t
ABSTRACT
t
taxa de predação na área manejada pode estar relacionada
FRPDDOWHUD©¥RGDHVWUXWXUDćRUHVWDOHFRQVHTXHQWH
afugentamento de predadores nestas áreas exploradas.
180 Differentiated microhabitat selection by the
Southern Bristle-Tyrant when in mixed-species
ćRFNVDQGLPSOLFDWLRQVIRULWVFRQVHUYDWLRQ
Vinicius Tonetti1*, Marco Aurlio Pizo1
ID t
ABSTRACT
t
Table of Contents
water, respectively. Results showed that P. eximius can occur
in locations with different regeneration stages and that has
ecological plasticity to use different microhabitats depending
on the association type. Preservation of bodies of water in
areas where the species occurs is an important conservation
strategy. In cases of management or possible re-introduction,
the presence and quality of these bodies should be considered.
Conservation plans should also focus on the nuclear species of
PL[HGćRFNVIROORZHGE\P. eximius, and their preferred habitats.
ǢW'6!8;!1'2;3&' 33£3+-!T-3£!83
r=8;32'ষ|+1!-£W$31
Habitat selection studies have assumed an urgency to predict
effects of natural environment changes on birds. Phylloscartes
eximiusLVDWKUHDWHQHG$WODQWLF)RUHVWHQGHPLFć\FDWFKHU
and its biology is poorly known. It can be found alone, in
SDLUVRULQPL[HGVSHFLHVćRFNV7KHDLPRIWKLVVWXG\ZDV
to analyze its microhabitat selection in the Cantareira State
Park, SE Brazil. For this, 145 circular random plots were
compared with another 54 plots centered where birds were
detected foraging. The plots had a 5-m radius within which
15 environmental variables were measured. GLM were used
to model the probability of a plot being random or used by
the species, and a stepwise procedure was performed (using
AIC) to select variables. Hierarchical partitioning analysis
ZDVSHUIRUPHGZLWKWKHYDULDEOHVVHOHFWHGLQWKHĆQDO*/0
model. Seven environmental variables were associated with
WKHRFFXUUHQFHRIELUGVLQPL[HGVSHFLHVćRFNVZKLOHĆYH
variables were selected when they were alone or in pairs. The
most important variable to determine the occurrence in and
RXWRIPL[HGVSHFLHVćRFNVZDVWKHUHOLHIDQGSUR[LPLW\WR
Page 143, Posters
181 Rede de interações entre aves frugívoras e plantas em
UHVWLQJDVQDWLYDVHUHćRUHVWDGDVQRQRUGHVWHGR%UDVLO
Arnaldo Vieira-Filho1*, Helder Araujo1, Maria Regina Barbosa1
ǢW2-='89-&!&'
'&'8!£&!!8!Ð#!
r!82!£&3,=-'-8!|+1!-£W$31
Nós comparamos redes de interação aves frugivora-plantas
HQWUHXPD£UHDGHUHVWLQJDQDWLYDHXPDUHćRUHVWDGDQR
1RUGHVWHGR%UDVLODĆPGHLGHQWLĆFDUSRVV¯YHLVHVS«FLHV
chave, tanto de aves como de plantas que possam auxiliar
QRHQULTXHFLPHQWRHPDQXWHQ©¥RGD£UHDUHćRUHVWDGD$
LGHQWLĆFD©¥RGDVHVS«FLHVFKDYHVHGHXDSDUWLUGDDQ£OLVH
de redes de interação aves frugívoras-plantas e do índice de
importância de cada espécie de planta na dieta das aves (e viceYHUVDb3DUDWDQWRIRUDPUHDOL]DGDVREVHUYD©·HVGLUHWDVGH
eventos de frugivoria e analisado amostras de fezes obtidas de
indivíduos capturados com redes de neblina entre outubro de
HVHWHPEURGH&RPRUHVXOWDGRYHULĆFDPRVTXHD
área nativa apresentou uma maior riqueza de espécies, tanto
{փdփTT
ID t
ABSTRACT
t
de aves como de plantas, e uma menor compartimentalização
GDUHGHGHLQWHUD©·HV7DPE«PYHULĆFDPRVXPDVXEVWLWXL©¥R
tanto das espécies de aves como de plantas que apresentaram
os maiores índices de importância e os maiores números de
interações quando comparamos as duas áreas estudadas.
Diante disso, sugerimos que a maior compartimentalização
GDUHGHGHLQWHUD©·HVHQFRQWUDGDSDUDRUHćRUHVWDPHQWR
pode ser explicada tanto pela diferença na composição das
espécies de aves e plantas como por uma menor riqueza
YHJHWDOHQFRQWUDGDQD£UHDUHćRUHVWDGDDVVLPQ¥RVXSRUWDQGR
espécies de aves responsáveis por manter a conectividade
da rede, como observado na restinga nativa. Com base
nesses resultados, indicamos o plantio de espécies de plantas
chave, como Myrcia bergianaDĆPGHSURSRUFLRQDUXPD
maior disponibilidade de frutos e manutenção da avifauna
frugívora observada na restinga na área restaurada.
185 Assessment of species limits in Anthus hellmayri
complex based on songs, morphological
and mitochondrial sequence data
Heraldo Norambuena1*, Pedro Victoriano1, Paul Van Els2, Victor Raimilla3
ID t
ABSTRACT
t
Table of Contents
monophyly in two subspecies (hellmayri and brasilianus) of the
A. hellmayri complex, so that new information on biological
aspects (i.e., songs, morphology) and a complete genetic
sampling (including dabbenei) could contribute to understanding
GLYHUVLĆFDWLRQLQWKHVSHFLHV:HHYDOXDWHGWKHVSHFLHVOLPLWV
in A. hellmayri complex by using songs, morphological and
mitochondrial sequence data (cytochrome b). There was
substantial cytochrome b sequence divergence (uncorrected)
EHWZHHQWD[DFXUUHQWO\WUHDWHGDVFRQVSHFLĆFhellmayri vs.
brasilianus (7.6%), dabbenei vs. brasilianus (4.4%) and dabbenei
vs. hellmayri (6.3%). The territorial songs of dabbenei differed
IURPWKHRWKHUWZRVXEVSHFLHVLQĆYHSDUDPHWHUVOHQJWKRI
song, maximum frequency, delta frequency, trill peak frequency
and trill duration), while the differences between hellmayri and
brasilianus were only in two parameters (maximum frequency
and delta frequency). Discriminant function analysis based
on songs and morphological characteristics recognized three
different clusters corresponding to the three subspecies (with
87% accuracy). This study agrees with previous results on the
paraphyly of A. hellmayri complex, and supports the idea that
these taxa are different species. Further analysis including
nuclear genes will be necessary to corroborate these results.
ǢW'6!8;!1'2;3&' 33£3+!T
!$<£;!&&'-'2$-!9!;<8!£'9@
$'!23+8)$!9T2-='89-&!&&'32$'6$-2TǣW3<-9-!2!;!;'
2-='89-;@T<9'<13(!;<8!£$-'2$'TǤW83+8!1!&'!+9;'8'2
-'2$-!9@!#38!;38-3&'$3£3+!T2-='89-&!&&'39!+39
r#<;'32-9|+1!-£W$31
Anthus hellmayri has three subspecies (hellmayri, brasilianus and
dabbenei), allopatrically distributed in grasslands of southern
South America. Molecular phylogenetic studies suggest non-
Page 144, Posters
{փdփTT
ID t
ABSTRACT
t
186 )UXJLYRU\OHYHOLQćXHQFHVLQWKHQHVWHGUDQNDQG
specialization in plant-frugivore birds network
Adriano Marcos Silva1*, Celine Melo2
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!TǣW2-='89-&!&'9;!&<!£&'!16-2!9
r!&8-!23W#-3£3+-!|@!,33W$31W#8
Several morphological, ecological and taxonomic traits
LQćXHQFHWKHUROHWKDWELUGVSHFLHVSOD\LQSODQWIUXJLYRUH
interaction networks. We tested the hypothesis that some bird
WUDLWVLQćXHQFHVSHFLHVOHYHOSURSHUWLHVLQDSODQWIUXJLYRUH
network. To build a weighted interaction matrix, we used
fecal samples of birds captured in mist nets. Each sample
with seeds was considered one interaction register. Captures
ZHUHFRQGXFWHGLQDVHPLGHFLGXDOIRUHVWLQ8EHUO¤QGLD
Brazil, a region in the Cerrado biome, during four campaigns
between June 2013 and December 2014. As bird traits
we used frugivory level (obligate, partial and opportunistic
frugivore), body mass, beak width and wing length. As specieslevel metrics we measured nested rank, specialization (d’)
and species strength. The relationship between species-level
metrics and bird traits was evaluated separately for each
variable using linear mixed effects models. We recorded 8
bird species, 16 plants and 87 interactions. Frugivory level
was related with nested and specialization, being the obligate
frugivores more generalist within the network. None of the
morphological traits were related with the other variables.
Obligate frugivorous birds consumed a large range of fruit
species due to the higher dependence on this resource, while
opportunistic species consume relatively few fruit species.
As frugivores assemblage was dominated by small-bodied
Page 145, Posters
ID t
ABSTRACT
t
Table of Contents
VSHFLHVPRUSKRORJLFDOWUDLWVZHUHVLPLODUSOD\LQJQRVLJQLĆFDQW
effect in network metrics. Support: FAPEMIG, CAPES
187 Variación estacional de la dieta de Bubo
virginianus (Strigiforme: Strigidae) en la reserva
nacional de junín, pasco-junín, Perú
Karol Natalie Lavado-Solis1*, Carlos Menacho1, Katya Balta-Obadie1
ǢW!#38!;38-3&'9;<&-39&'-3&-='89-&!&T2-='89-&!&
'8<!2!!@';!23'8'&-!T-1!f'8Ú
r0!83£W£!=!&3Wǣǡǡǥ|+1!-£W$31
La dieta de Bubo virginianus fue estudiada y analizada en
cuatro estaciones (verano, otoño, invierno y primavera) en la
zona de amortiguamiento de la Reserva Nacional de Junín,
Perú. La metodología consistió en analizar la composición de
242 egagrópilas enteras mediante el método húmedo para
disgregar luego se separó cada componente de acuerdo a,
tipo de ítem alimenticio, estructura (hueso, pelo, pluma, y
material quitinoso) y número mínimo de individuos de cada
¯WHPSRUHJDJUµSLODSDUDVXSRVWHULRULGHQWLĆFDFLµQ&RPR
resultado la dieta está compuesta por 846 presas y 33 ítems,
distribuidos en 90.9% roedores, 6.3% aves y 2.8% artrópodos.
/DFRPSRVLFLµQGLHWDU¯DSUHVHQWµVLJQLĆFDWLYDYDULDELOLGDG
HVWDFLRQDOFRQH[FHSFLµQGHOLQYLHUQR !\3 y consumo de diversas presas encontrando Cavia schudii,
Mus musculus y Phyllotis xanthopygus en verano y otoño. Los
cricétidos presentaron mayor abundancia durante el otoño,
ya que en este periodo su población tienden a incrementarse
numéricamente como producto del ingreso de individuos
jóvenes a la población y a decaer durante la primavera y el
{փdփTT
ID t
ABSTRACT
t
verano por la elevada tasa de mortalidad causada por factores
climáticos, disminución de recursos y efecto de predación.
La dominancia de Calomys spp. en la dieta se explicaría por el
grado de perturbación del área. Considerando la abundancia
y los ciclos de actividad conocidos de las especies presas
consumidas B. virginianus se comporta como depredador
generalista especializado en el consumo de roedores, de
hábitos de caza pasivo, crepuscular y nocturno en ambientes
abiertos, además puede ser considerado especie indicadora
GHFDOLGDGDPELHQWDO\GHPRJU£ĆFDGHVXVHVSHFLHVSUHVD
188 Pathogens in ticks (Acari: Ixodidae) collected
from wild birds in Costa Rica.
Maria Ogrzewalska1*, Ivan Literk2, Miroslav Capek3,
Oldrich Sychra2, Víctor Caldern4, Bernardo C. Rodríguez4,
Carlos R. Prudencio5, Thiago F. Martins
ǢW
<2&!39>!£&38<A29ধ;<;39>!£&38<A!#38!;8-3&'!2;!=-839'9
'-$0'ħ9-39'9TǣW'6!8;1'2;3(-3£3+@!2&-£&£-('-9'!9'9T
!$<£;@3(
';'8-2!8@@+-'2'!2&$3£3+@T2-='89-;@3(';'8-2!8@!2&,!81!$'<ধ$!£
$-'2$'9823TǤW29ধ;<;'3('8;'#8!;'-3£3+@T$!&'1@3($-'2$'93(;,'
A'$,'6<#£-$TǥW'8=-$-3!$-32!£&'!£<&2-1!£TǦW29ধ;<;'&3£(3<;A
r1!8-!W3+8A'>!£90!|-3$W)3$8<AW#8
The purpose of this work was to investigate the presence of
bacteria from the genus Rickettsia in ticks parasitizing wild birds
in Costa Rica. Birds were trapped at seven locations in Costa
Rica during 2004, 2009, and 2010, and then visually examined
IRUWKHSUHVHQFHRIWLFNV7LFNVZHUHLGHQWLĆHGDQGSDUWRIWKHP
were tested individually for the presence of pathogens by PCR.
A total of 1878 birds were examined, of which 163 (9%) were
Page 146, Posters
ID t
ABSTRACT
t
Table of Contents
infested with 388 ticks of the genera Amblyomma and Ixodes.
The following species were found: Amblyomma longirostre,
Amblyomma calcaratum, Amblyomma coelebs, Amblyomma
sabanerae,Amblyomma varium, Amblyomma maculatum,
and Amblyomma ovale, Ixodes minorDQGWZRXQFODVVLĆHG
species, designated here to Ixodes sp. genotype I, and Ixodes
sp. genotype II. Twelve of 24 tested A. longirostre ticks were
infected with Rickettsia amblyommii and 2 of 4 A. sabanerae were
infected with Rickettsia bellii. Eight of 10 larval Ixodes minor
were infected with an endosymbiont, a novel Rickettsia sp.
agent. We report the occurrence of I. minor in Costa Rica for
WKHĆUVWWLPHDQGDQXPEHURIQHZELUGKRVW"WLFNDVVRFLDWLRQV
Moreover, R. amblyommii and R.bellii were found in A. longirostre
and A. sabaneraeUHVSHFWLYHO\LQ&RVWD5LFDIRUWKHĆUVWWLPH
and show the importance of wild birds as host for ticks and
their possible involvement in epidemiology of rickettsioses.
190 Parasitism of wild birds by ticks (Acari:
Ixodidae) from Republic of Honduras
Marketa Novakova1*, Ivan Literk1, Luis Chavez2, Thiago F.
Martins3, Maria Ogrzewalska4, Marcelo B. Labruna3
ǢW'6!8;1'2;3(-3£3+@!2&-£&£-('-9'!9'9T
!$<£;@3(';'8-2!8@@+-'2'!2&
$3£3+@T2-='89-;@3(';'8-2!8@!2&,!81!$'<ধ$!£$-'2$'9823TǣW29ধ;<;'3(
'8;'#8!;'-3£3+@T$!&'1@3($-'2$'93(;,'A'$,'6<#£-$TǤW'6!8;!1'2;3
&''&-$-2!';'8-28-!8'='2ধ=!'!Ú&'2-1!£T
!$<£&!&'&''&-$-2!
';'8-28-!' 33;'$2-!T2-='89-&!&'&'3!<£3TǥW
<2&!39>!£&38<A
r23=!03=!1!8|=(<W$A
Ixodid or hard ticks (Acari: Ixodida: Ixodidae) are blood-feeding
ectoparasites of wild and domestic vertebrates. Ticks occur
{փdփTT
ID t
ABSTRACT
t
ID t
worldwide and are capable of transmitting a broad range of
human and animal pathogens. Wild birds play an important role
as hosts for ticks and as disseminators of potentially infected
ectoparasites among distant areas. To investigate a possible
role of wild birds as hosts for ectoparasites in the Republic of
Honduras, wild birds were trapped by ornithological mist nets
at two study locations: Jardín Botánico Lancetilla, lowland
close to the Carribean coast, and on Isla de Utila, a small island
in the Caribbean Sea. Trapped birds were examined for the
presence of ectoparasites, including ticks. Ticks were collected
during naked-eye examination using tweezers and preserved
LQHWK\ODOFRKRO7LFNVDIWHUWD[RQRPLFDOLGHQWLĆFDWLRQ
were individually tested for the presence of pathogens
from the genera Rickettsia by PCR. In total, 280 birds were
captured and, overall, 25 birds (9%) were found parasitized
by ticks. Two species of ticks were found: Amblyomma
longirostre and A. nodosum. These species are neotropical,
the adult stages feeding primarily on porcupines in the case
of A. longirostre, and on anteaters in the case of A. nodosum.
Subadult stages feed primarily on birds. Additionally, ticks were
found to be infected with Rickettsia amblyommii -organisms
of suspected pathogenicity to humans. Further studies are
crucial to verify the role of birds as hosts for ticks and their
complex role in the epidemiology of tick-borne diseases.
195 ,QćXHQFHRIFRORXUDQGGLVWXUEDQFHRQ
Page 147, Posters
ABSTRACT
t
Table of Contents
FRQVXPSWLRQUDWHRIDUWLĆFLDOIUXLW%UD]LO
Vanessa Fonseca Gonalves1*, Flávio Roque
Bernardes Camelo1, Melo Celine1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r=!2'99-2,!i(+|,3;1!-£W$31
Fruit consumption by birds may also be affected by human
GLVWXUEDQFHDQGE\WKHHGJHHIIHFW7KHXVHRIDUWLĆFLDOIUXLWV
is a useful tool to record fruit consumption by birds because
it allows some variables to be controlled, such as colour and
size, as well as the assessment of interactive effects between
variables like environment and color. The goals were to
GHWHUPLQHLIWKHFRQVXPSWLRQUDWHRIDUWLĆFLDOIUXLWLQDUHDVZLWK
high levels of human disturbance is greater than less degraded
areas and if there is a relationship between the consumption
rate and the edge-interior gradient in the study areas. Three
areas of semi-deciduous forest were selected in Brazil, which
KDGDUWLĆFLDOIUXLWRIIRXUGLIIHUHQWFRORUVSODFHGDWDVSDFHRI
1.5 to 2 meters in plants without fruit in a gradient of 0-100
meters from the edge, every 10 meters. The consumption rate
ZDVKLJKHUIRUWKHDUWLĆFLDOIUXLWVFRORUHGUHGLQWKHDUHDWKDW
was less degraded. There was a negative linear relationship
IRUWKHFRQVXPSWLRQRIDUWLĆFLDOIUXLWVLQWKHHGJHLQWHULRU
gradient, from yellow in Panga, to green in Gloria and for
the color purple in São José. The coloration and areas with
GLIIHUHQWOHYHOVRIDQWKURSRJHQLFGLVWXUEDQFHLQćXHQFHWKH
UDWHRIFRQVXPSWLRQRIDUWLĆFLDOIUXLWLQIUDJPHQWVRIVHPL
deciduous forest, showing a preference for red coloration
{փdփTT
ID t
ABSTRACT
t
and higher consumption in less degraded areas. In addition,
there was a higher rate of consumption in an outer edge
environment than in the interior of the areas studied, showing
that the edge effect can affect the consumption of fruits.
199 Vocal repertoire of the blue manakin Chiroxiphia caudata
Laura M. Schaedler1*, Lilian T. Manica1
ID t
ABSTRACT
t
Table of Contents
672 to 1728 Hz, lasting from 0.22 to 0.61 seconds. Call H was
SURGXFHGRQO\GXULQJćLJKWGLVSOD\VDQGFDOOV$%&DQG*
were produced while birds were perched at the surroundings
of the display arena. Calls D, E and F were produced in both
situations. Our study provides new detailed information on
blue manakin vocal display that should be used to elucidate
female choice for male courtship characteristics and, ultimately,
the evolutionary history of the sexual system of this species.
ǢW2-='89-&!&'
'&'8!£&3!8!2Æ
r9$,!'&£'8W£!<8!|+1!-£W$31
Many species of Pipridae have been investigated in terms
RIWKHLUDFRXVWLFDQGćLJKWGLVSOD\VKRZHYHUVWXGLHVRQWKH
blue manakin (Chiroxiphia caudata) remain scarce. In a lek
polygyny sexual system, it is possible that females assess
PDOHVèTXDOLW\WKURXJKWKHLUćLJKWDQGYRFDOFRXUWVKLSGLVSOD\V
Here, our aim was to identify and describe the variety of
song elements, based on bioacoustic parameters, and the
behavioral contexts produced by males of blue manakins at
Mananciais da Serra protected area, Piraquara, PR, Brazil.
We observed and recorded vocalizations of nine individuals,
DQGIXUWKHUDQDO\]HGVRXQGĆOHVZLWK5DYHQpVRIWZDUH:H
LGHQWLĆHGHLJKWVRQJHOHPHQWVWKDWFDQEHGLYLGHGLQWRWZR
groups of calls: those with and without frequency modulation.
In the former group, notes A, B, C, D, F, G and H varied from
weakly modulated with descendent patterns (B and C) to
strongly modulated with one or two ascension peaks (A, D,
F, G and H). Mean duration of the calls was between 0.01
and 0.35 seconds, while frequency bandwidth varied from
633 to 5455 Hz. Note E was the only note without frequency
modulation and comprised by multiple harmonics varying from
Page 148, Posters
200 Modelo de hábitat de Colibri coruscans en
la precordillera del Norte de Chile
Bojana Kuzmicic1*, Cristian C.F Estades1
ǢW2-='89-&!&&',-£'
r#3/!2!W8'(|+1!-£W$31
Desde los primeros registros–hace unas tres décadas–del
SLFDćRUD]XOColibri coruscans) en el extremo Norte de Chile,
esta especie se ha expandido a gran parte de la precordillera.
Existen evidencias que la presencia de Eucalyptus podría
representar un elemento importante en la selección del hábitat
GHOSLFDćRU\SRUORWDQWRHQVXH[SDQVLµQ'HVDUUROODPRV
un modelo de hábitat de C. coruscans para contribuir al
conocimiento del hábitat de la especie, entender su expansión
de rango y comprender las consecuencias de la introducción
de especies. Realizamos un muestreo de abundancia durante
los otoños del 2012 y 2013 en la precordillera de la región de
Arica y Parinacota. En cada uno de los puntos de muestreo
describimos la vegetación en un círculo de 200 metros de
radio, en aquellos que se registró C. coruscans, caracterizamos
{փdփTT
ID t
ABSTRACT
t
el hábitat en un radio de 50 metros. Además, realizamos
observaciones detalladas de conducta y comportamiento de
forrajeo de algunos individuos durante el 2013. Para detallar el
K£ELWDWGHOSLFDćRUFRPSDUDPRVODVPHGLDVHQWUHODVFREHUWXUDV
a 50 y 200 metros y entre las de los datos con y sin presencia
de C. coruscans. También usamos un modelo generalizado
lineal (GLM) para determinar qué variables explican de mejor
forma la abundancia de la especie. Detectamos presencia
de C. coruscans en 7 de 70 puntos (2012) y 13 de 62 puntos
(2013). El Eucalyptus resultó fundamental en todos los análisis
UHDOL]DGRVVLHQGRODYDULDEOHP£VLPSRUWDQWH\VLJQLĆFDWLYD
para explicar la presencia de la especie. Estos árboles son
utilizados para la alimentación y territorio, lo que los transforma
HQFODURVHVWUXFWXUDGRUHVGHOK£ELWDWGHOSLFDćRUD]XO
201 Censo de aves aquáticas no Parque Estadual
Do Rio Doce, Minas Gerais
Lucas Pagani-Passos1*, Miguel Rico, Karina Felipe Amaral1
ǢW
TǣW29ধ;<;3&''97<-9!!6-3$!
r£<$!9166Ǣ|@!,33W$31W#8
O Parque Estadual do Rio Doce (PERD), em Minas Gerais, é
a terceira maior região lacustre do país, sendo considerada
uma Zona Úmida de Importância Internacional, segundo
a Conferência de Ramsar. As zonas úmidas são locais
fundamentais nos ciclos de vida da fauna. Para as aves aquáticas
são de extrema importância, sendo local de concentração para
o descanso, alimentação e reprodução. O presente trabalho
tem como objetivo o censo e monitoramento de aves aquáticas
GR3(5'YHULĆFDQGRDLPSRUW¤QFLDGHVXDVODJRDVFRPRORFDO
Page 149, Posters
ID t
ABSTRACT
t
Table of Contents
de reprodução, descanso e invernada e avaliar a distribuição
HGHPRJUDĆDGDVDYHVDRORQJRGRVDQRV$W«DJRUDIRUDP
realizadas seis campanhas, entre os anos de 2012 a 2015. O
monitoramento foi através do censo direto de aves aquáticas
e de dormitórios de garças. Um total de 40 espécies de aves
aquáticas, pertencentes a 16 famílias, foram registradas em 22
lagoas do PERD e região, sendo que dez espécies não estavam
presentes no plano de manejo. Entre elas houve duas espécies
migratórias oriundas do hemisfério norte: Tringa solitária e
Sterna hirundo. De forma geral, e também por espécie, não
IRUDPREVHUYDGDVGLIHUHQ©DVVD]RQDLVVLJQLĆFDWLYDVQRXVR
GDVODJRDVSHODVDYHVDTX£WLFDV$EDL[DćXWXD©¥RQRVQ¯YHLV
da água, a estabilidade dos diferentes ambientes lacustres
do PERD, e a segurança de ser uma área protegida devem
LQćXHQFLDUVREUHHVVDHVWDELOLGDGHQDFRPXQLGDGHGHDYHV
aquáticas. O estudo ainda continua, visando conhecer as
diferenças no uso de cada ambiente pelas diferentes espécies.
202 Censo populacional em ninhal de Mycteria
americana no Rio São Francisco, Bahia, e relato
de cleptoparasitismo por Caracara plancus
Lucas Pagani-Passos1*, Thiago Filadelfo2, Jose Amorim Reis-Filho1
ǢW
TǣW
r£<$!9166Ǣ|@!,33W$31W#8
O cabeça-seca (Mycteria americana) é uma ave da família
Ciconidae que ocorre do sul da América do Norte até a
Argentina. O período reprodutivo ocorre durante a estação
seca, quando grandes grupos se concentram em ninhais.
{փdփTT
ID t
ABSTRACT
t
ID t
ABSTRACT
t
Table of Contents
Poucos relatos abordam a presença dessa espécie na região
203 Natural brood parasitism by Shiny Cowbird
nordeste do Brasil e mais escassas são as informações sobre
(Molothrus bonariensis) in Central Brazil
sua reprodução. O presente estudo objetivou descrever
Thiago Filadelfo1*, Miguel . Marini1
uma colônia reprodutiva de cabeça-seca, determinando seu
ǢW2-='89-&!&'&'8!9£-!
período reprodutivo e o tamanho populacional da colônia.
r;,-!+3i#-3<ö!|@!,33W$31W#8
Oportunisticamente relatamos interações alimentares de
carcarás (Caracara plancus) no ninhal. A colônia situa-se
Brood parasitism directly affects hosts? reproductive success,
nas lagoas marginais do Rio São Francisco no município de
by reducing clutch size, hatching success and nestling survival.
Malhadas, Bahia. Cinco expedições foram realizadas em 2011
The Shiny Cowbird (Molothrus bonariensis) is an obligate
com intuito de monitorar este ninhal, sendo conduzidos censos
LQWHUVSHFLĆFEURRGSDUDVLWHZLWKPRUHWKDQNQRZQ
mensais de adultos e juvenis. Os ninhos estavam distribuídos
host’ species. Little is known about the species suffering
em 11 árvores com média de altura de, aproximadamente,
natural brood parasitism in Brazil and even less about how
PHWURV$FRO¶QLD«PRQRHVSHF¯ĆFDHM£FRQKHFLGDSHORV
these hosts respond to parasitism. The goal of this study
moradores da região. Em concordância com a literatura, o ninhal
was to gather natural brood parasitism records in Central
se tornou ativo em maio, inicio da estação seca. Os censos
Brazil, assess M. bonariensis breeding biology data and its
DSRQWDUDPDSUHVHQ©DGHĆOKRWHVGHMXQKRDRXWXEURFRP
effects on host’ population. Fieldwork was conducted in
P£[LPRGHĆOKRWHVHPDJRVWR1 $VREVHUYD©·HVPHQVDLV
the Federal District, Central Brazil, during 2012 and 2013
indicam que a população adulta da colônia seja de cerca de
breeding seasons. A total of 424 nests from 45 species were
120 indivíduos. O comportamento de cleptoparasitismo por
found and 61 nests (14%) of 12 species were recorded being
carcará foi observado em diversas ocasiões; os mesmos foram
naturally parasitized by the Shiny Cowbird. Nests with brood
ćDJUDGRVSRXVDGRVSUµ[LPRDRVQLQKRVêURXEDQGRëSHL[HV
parasitism were only recorded from August to January, with
trazidos pelos pais que se encontravam caídos no ninho e
a peak in October. Single (only one parasite egg) and multiple
no seu entorno. Ninhais são ambientes frágeis e podem ser
(more than one parasite egg) brood parasitism events had
considerados bioindicadores de qualidade ambiental, assim
similar accounts, respectively, 29 and 32 nests; with multiple
o monitoramento contínuo dessa área deve ser realizado.
parasitism reaching up to six eggs. A total of 132 eggs of the
cowbird were found, 90 of those were lost due to predation,
egg rejection or failure in incubation. 42 eggs hatched but
only 33 nestlings left the nest successfully. The Chalk-browed
Mockingbird (Mimus saturninus, n=23) and the Pale-breasted
Thrush (Turdus leucomelas, n=11) were the most parasitized
Page 150, Posters
{փdփTT
ID t
ABSTRACT
t
species. Our data offer some insights into cowbird productivity
and its actual impact on host population in Central Brazil.
205 First description of São Francisco Sparrow
(Arremon franciscanus) females
Vitor Torga (V.T.) Lombardi1*, Marcelo Ferreira de Vasconcelos2
ǢW'6!8;!1'2;3&'-3£3+-!2-1!£T2-='89-&!&'
'&'8!£&'
-39!TǣW32ধ($-!2-='89-&!&'!;£-$!&'-2!9'8!-9
ID t
ABSTRACT
t
Table of Contents
ćDQNVDQGVLGHVRIWKHERG\JUH\WKLJKVJUH\ZDVKHGZKLWH
It appears that there are no differences in measurements and
mass between the sexes. The only exception is wing chord
that is longer in males. Females of A. franciscanus are very
similar to those of Arremon semitorquatus and it is possible that
these two species are closely related, taking into account the
overall similarities of these two species and the presence of a
black chin spot, a possible synapomorphy for both species.
r=-;38;38+!|+1!-£W$31
Arremon franciscanus is a restricted range species endemic
to the Caatinga of north-eastern Brazil. This is a recently
described species, known by only 8 specimens deposited in
3 Brazilian ornithological collections. Of them, 7 are males
DQGLVXQVH[HG,QUHFHQWĆHOGZRUNVLQ&DDWLQJDRI%DKLD
and Minas Gerais states, Brazil, we obtained 15 additional
specimens of A. franciscanus: 6 females and 9 males. Thus, the
aim of this study is to describe the plumage of females of A.
franciscanus, which remained unknown. We used these new
specimens and 2 other adult males collected in Minas Gerais
for comparing plumage features and measurements among
sexes. Plumage descriptions were based on Munsell Soil Color
Charts (1975). Measurements were taken using electronic
digital callipers and specimens were also weighed just after
collecting, using Pesolas. The overall aspect of adult females’
plumage is very similar to that of adult males. The most striking
differences are their pale yellow underparts that are white
in males. Other details that differ males include: superciliary
brighter white; pileum grey; bend of wings and underwingcoverts brighter yellow; wider and brighter pectoral band black;
Page 151, Posters
207 Bird assemblages on areas isolated by polyculture:
an alternative for conservation
Thiago Moura1*, Erica C. Nolasco2, Caio G. Machado3
ǢW2-='89-&!&'9;!&<!£&'
'-8!&'!2;!2!W83+8!1!&'Õ9f
+8!&<!3'1 33£3+-!TǣW2-='89-&!&'9;!&<!£&'
'-8!&'!2;!2!W
83+8!1!&'Õ9f+8!&<!3&'3&'£!+'1'1-Í2$-!9&!'88!'
&31#-'2;'TǤW2-='89-&!&'9;!&<!£&'
'-8!&'!2;!2!
r13<8!ħ,-!+3|+1!-£W$31
Habitat fragmentation causes changes on biological systems.
7RXQGHUVWDQGWKHVHPRGLĆFDWLRQVZHDQDO\]HWKHVWUXFWXUH
of bird assemblages in forest patches isolated by polyculture
at Bahia, northeastern Brazil. We conducted the research at
Fazendas Reunidas Vale da Juliana, covering 4.822 ha, where
the vegetation is mainly Ombrophilous Forest isolated by
polycultures of cocoa, latex and banana. We surveyed, by point
count, the bird assemblages from January to November 2014
on three landscape units: Forest, Polyculture and the Border
between the two. The bird assemblages were structured by
diversity, forest dependency, stratum of vegetation where
{փdփTT
ID t
ABSTRACT
t
the birds were observed, trophic group and abundance.
There was no variation on diversity between the landscape
units. However, we found differences on the medium and
high stratum, and the presence of forest dependents on the
Polyculture and Border. The stratum use, associated with each
species ecological plasticity, indicates structural connectivity
of the landscape units by the medium and high strata. The
presence of forest dependent species on the Border and
Polyculture reveals a larger effective area for these species,
suggesting a reduction of the edge effect. Matrixes with varied
plantation are able to sustain bird assemblages with wide
requirements, enlarging the effective area of interior forest
birds and contributing to the conservation of local community.
208 Parásitos em Nycticorax nycticoraxem Chile
Daniel Gonzlez-Acua1*, Armando Cicchino2,
Danny Fuentes2, Mike Kinsella3
ǢW2-='89-&!&&'32$'6$-2TǣW2-='89-&!&!$-32!£&'
!8&'££!;!T8+'2ধ2!WTǤW'£1'9;!#38!;38@
ID t
ABSTRACT
t
Table of Contents
al centro de rescate de la Universidad de Concepción,
Chile y aquellos que murieron se les realizó necropsia
parasitológica. Los piojos fueron aislados y almacenados
en alcohol al 70%, posteriormente fueron montados en
Bálsamo de Canadá. Los nematodos fueron aclarados con
lactofenol y los platelmintos teñidos con carmín para su
SRVWHULRULGHQWLĆFDFLµQ(QODVY¯VFHUDVIXHURQFROHFWDGRV
los helmintos Contracaecum rudolphii Hartwich, Contracaecum
microcephalum Rudolphi (Nematoda: Anisakidae), Avioserpens
sp. (Nematoda: Dracunculidae), Polymorphus brevis (Van Cleave)
(Acantocephala: Polymorphidae), Echinostoma sp. (Trematoda:
Equinostomidae). En el plumaje fueron colectados los piojos
Ciconiphilus decimfasciatus (Boisduval and Lacordaire, 1835)
(Phthiraptera: Menoponidae) y Ardeicola goisagi Uschida
(Phthiraptera: Philopteridae). No se observó la presencia de
ácaros. Todos los parásitos acá colectados corresponden a
nuevas relaciones hospedador parásito y constituyen además
nuevos resportes para la diversidad parasitológica de Chile.
(VWXGLRĆQDQFLDGRSRUHOSUR\HFWR)RQGHF\W
r&!2-+32A|<&'$W$£
Los parásitos pueden causar variados y extensos efectos
VREUHODĆVLRORJ¯DPRUIRORJ¯D\FRPSRUWDPLHQWRGHODV
aves. Pueden producir además disturbios en la habilidad
termorreguladora, reducción de la masa corporal, alteración
de procesos de selección sexual y abandono temprano del
nido. Un ave muy común en los humedales neotropicales
es el Nyctocorax nyctocorax, sin embargo el conocimiento
sobre su parasitofauna es aún poco conocido. En el presente
estudio, se analizó la parasitofauna de huairavos que llegaron
Page 152, Posters
{փdփTT
ID t
ABSTRACT
t
209 Total concentrations of mercury and selenium in feathers
of waterbirds from Babitonga Bay, south of Brazil
Daniela Fink1*, Brbara Manhes2, Natlia Beloto2, Wendel
Barbosa2, Marta J. Cremer1, Jos Lailson-Brito2
ǢW83+8!1!&'Õ9f8!&<!3'1!&'''-31#-'2;'W!#38!;8-3&'$3£3+-!&'
$399-9;'1!939;'-839T2-='89-&!&'&!'+-3&'3-2=-££'l2-=-££'mT
ǣW!#38!;8-3&'!1('8397<ধ$39'-3-2&-$!&38'9
83(!WA!#'£<8+'£lmT
!$<£&!&'&'$'!23+8!)!T
2-='89-&!&'&39;!&3&3-3&'!2'-83lm
ID t
ABSTRACT
t
Table of Contents
1 in dry weight were found in the feathers, a value which is
considered high and could bring some risk to the breeding
of waterbirds. The differences in mercury concentrations
IRXQGEHWZHHQWKHVSHFLHVFDQUHćHFWGLHWDU\KDELWV0RVW
individuals presented selenium values > 1.000 ng.g-1 in dry
weight; however, this concentration is not considered harmful
to birds. Monitoring and environmental contamination
analyses of the region due to high concentration of mercury
found in feathers of N. nycticorax are recommended.
r&!2-W)20|+1!-£W$31
Mercury is a non-essential, toxic and bioaccumulative trace
element for living beings. Selenium is a micronutrient essential
to the development of many organisms, but can become toxic
at high concentrations. Waterbirds are used as indicators
of contaminants in the environment due to their elevated
position in the food chain. The purpose of this study was to
determine mercury and selenium concentrations in feathers
of waterbirds in the Babitonga Bay. Breast, wing, and tail
feathers were collected from seven individuals from three
species of the Ardeidae family birds: Nycticorax nycticorax (2),
Nyctanassa violacea (3), and Egretta caerulea (2). These samples
were found frozen at a temperature of -16°C, within the
period of 2008-2011, in the Birds Collection of the Biological
Collection Iperoba. The feathers have undergone a cleaning
process. The total mercury determination was made in an
atomic spectroscopic with cold steam generation and selenium
in an atomic spectroscopic with electrothermal atomization.
Total mercury concentrations of N. nycticorax > 3.000 ng.g-
Page 153, Posters
210 First record breeding of Eudocimus ruber
in Babitonga Bay, south of Brazil
Daniela Fink1*, Marta J. Cremer1
ǢW83+8!1!&'Õ9f8!&<!3'1!&'''-31#-'2;'W!#38!;8-3&'$3£3+-!
&'$399-9;'1!939;'-839T2-='89-&!&'&!'+-3&'3-2=-££'l2-=-££'m
r&!2-W)20|+1!-£W$31
There are few records of Eudocimus ruber in the state of Santa
&DWDULQDVRXWKHUQ%UD]LODQGWKLVVSHFLHVLVFODVVLĆHGDV
FULWLFDOO\HQGDQJHUHGRQWKHVWDWHVRIĆFLDOOLVWRIWKUHDWHQHG
VSHFLHV7KHDLPRIWKLVVWXG\ZDVWRGHVFULEHWKHĆUVWEUHHGLQJ
event of the Eudocimus ruber in Santa Catarina. The species
bred in a mixed colony in Jarivatuba Island, a mangrove area
inside Babitonga Bay. Between August 2011 and March 2012,
fortnightly samplings were made with the aid of a motor
boat in order to collect basic information about the breeding
HYHQWRIWKLVVSHFLHV7KHĆUVWDGXOWRI(UXEHUZDVUHFRUGHG
on November 4, 2011, at the same time period in which a
group of Plegladis chihi was nesting in the area. Adults in
{փdփTT
ID t
ABSTRACT
t
incubation position in the nests were recorded on January 5,
7KHĆUVWFKLFNVZHUHREVHUYHGRQ-DQXDU\$WRWDO
RIQHVWVZHUHUHFRUGHGGLVWULEXWHGEHWZHHQĆYHEUHHGLQJ
nuclei: four in the central region and one on the coast of the
island. In March 2012 few adults remained in the colony and
DERXWMXYHQLOHVZHUHREVHUYHGć\LQJLQDJURXSDERYHWKH
colony and its surroundings. The species produced only one
breeding pulse. We believe that the individuals came from
colonies in the state of São Paulo. If this is the case, they had
traveled about 200 km in a straight line. Although there is
no human settlement on the island, the region suffers from
many anthropic disturbances. Creation of a protected area
would be a suitable long-term strategy for the conservation
of this species, as well as of the regional ecosystem.
213 Frugivoria por aves em Miconia albicans(sw.) Triana, em
área de cerrado sensu stricto do triângulo mineiro, MG
Luis Pedro Mendes Paniago1*, Adriano Marcos Silva1, Giancarlo ngelo
Ferreira1, Vitor Carneiro de Magalhes Tolentino1, Celine Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!TW
r1'2&'96!2-!+3|,3;1!-£W$31
ID t
ABSTRACT
t
Table of Contents
Estrela do Sul-MG. Foram feitas observações focais em seis
indivíduos de M. albicans (30h), para cada visita foi registrado:
espécie, tempo de permanência na planta, número de frutos
consumidos e estratégia de consumo (Engolir, Particular e
Predar). A efetividade do frugívoro como dispersor de semente
6'(IRLPHQVXUDGDDWUDY«VGRSURGXWRQ¼PHURGHYLVLWDV
KRUDGLYLGLGRSHORQ¼PHURP«GLRGHIUXWRVUHWLUDGRVYLVLWD
Foram registradas 14 espécies, sendo 69 visitas com consumo
de frutos de M. albicansIUXWRVsIUXWRVYLVLWD
Quanto à SDE, destacaram-se 3LUDQJDćDYD (1,46), Tangara
cayana (0,90) e Zonotrichia capensis (0,86). A estratégia de
consumo mais utilizada foi engolir (61%) na qual o fruto é
ingerido inteiro. Os frutos de M. albicans foram consumidos
por aves de três guildas (Frugívora, Granívora e Insetívora) o
TXHFRQWULEXLSDUDXPDGLYHUVLĆFD©¥RQDGLVSHUV¥RGHVXDV
sementes, por exemplo, quanto ao modo e sítio de deposição.
M. albicansSRVVXLIUXWRVSHTXHQRVFDVFDĆQDQXPHURVDVH
pequenas sementes, o que a torna pouco seletiva em relação
¢VVHXVGLVSHUVRUHVDXPHQWDQGRDHĆF£FLDQDSURSDJD©¥R
de sementes e recrutamento de novos indivíduos. Apoio:
FAPEMIG, CNPq, CEMIG, DURATEX S.A., PPGECO-UFU.
$GLVSHUV¥RGHVHPHQWHVLQćXHQFLDQDGHQVLGDGHGLVWULEXL©¥R
de plantas, na colonização e manutenção da diversidade
de espécies. Miconia albicans (Melastomataceae) é uma
espécie pioneira do Cerrado, cujos frutos são dispersos
SUHGRPLQDQWHPHQWHSRUDYHV2REMHWLYRGHVWHIRLGHĆQLU
a avifauna que contribui na dispersão de sementes de M.
albicans em uma área de cerrado sensu stricto do Triângulo
Mineiro. O estudo foi realizado na Faz. Nova Monte Carmelo,
Page 154, Posters
{փdփTT
ID t
ABSTRACT
t
214 Avaliação de micronúcleos em duas espécies
PLJUDWµULDVGRJ¬QHURElaenia em área de cerrado
Luis Pedro Mendes Paniago1*, Camilla Queiroz Baesse1,
Adriano Marcos Silva1, Vitor Carneiro de Magalhes
Tolentino1, Giancarlo ngelo Ferreira1, Celine Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!TW
r1'2&'96!2-!+3|,3;1!-£W$31
ID t
ABSTRACT
t
Table of Contents
isolamento e melhor conservação da área propicia menor
ação de agentes tóxicos, que resultou em menor formação de
micronúcleos nas espécies residentes, ocorrendo o contrário
em Elaenia, sugerindo que o contato com distintas áreas durante
a migração as expõe a condições que favorecem a formação
de micronúcleos. Apoio: FAPEMIG (CRA-APQ01654-12),
&13T3(/'&(0,*33*(&28)8
A análise de micronúcleos possibilita a detecção de efeitos
genotóxicos provocados por agentes físicos e químicos, como
SROXL©¥RHLQVXPRVDJU¯FRODVVHQGRXPDIHUUDPHQWDHĆFD]
para biomonitoramento. É possível que espécies migratórias
estejam mais sujeitas a estes efeitos devido à transição por
diferentes ambientes. O objetivo foi detectar a presença de
PLFURQ¼FOHRVHTXDQWLĆFDORVHPGXDVHVS«FLHVFRQJ¬QHUHV
Elaenia mesoleuca e E. parvirostris, e comparar com a média da
avifauna local, de um fragmento de mata estacional em MG.
Foram realizadas três campanhas de captura com redes de
QHEOLQDHPKUHGHV3DUDFDGDLQGLY¯GXR
capturado foram confeccionadas duas extensões sanguíneas
Ć[DGDVHP0HWDQROHFRUDGDVFRPVROX©¥RDGH*LHPVDH
WDPS¥RIRVIDWR)RUDPDQDOLVDGRVHULWUµFLWRVLQGLY¯GXR
em microscópio óptico. A quantidade de micronúcleos de cada
espécie de Elaenia foi comparada com a média da comunidade
através do Teste t para uma amostra. Foram analisadas 42
lâminas (21 indivíduos) e encontrados 69 micronúcleos. A
média de micronúcleos da comunidade (obtido através de 121
indivíduos de 30 spp. residentes) foi 0,54. Ambas espécies de
Elaenia apresentaram média de micronúcleos maior (xmeso.=
2,71, xparv.= 3,57; p<0,001) que a média da comunidade. O
Page 155, Posters
215 A Diversidade de avifauna brasileira nas
GLIHUHQWHVĆWRĆVLRQRPLDVGR&HUUDGR
Carmen Dionsio1,2*, Tlio Dornas1, Marcelo de
Oliveira Barbosa1, Renato Torres Pinheiro1
ǢWf
T2-='89-&!&'
'&'8!£&33$!2ধ29
ǣW'6!8;!1'2;3&'-3£3+-!T2-='89-&!&'&'='-83
r$!81'2£&-32-9-3|+1!-£W$31
O Cerrado é constituído por um conjunto típico de
ĆWRĆVLRQRPLDVTXHDSUHVHQWDXPPRVDLFRYDULDGRGHKDELWDWV
conferindo-lhe uma grande diversidade de espécies. No
entanto, o conhecimento sobre a avifauna deste bioma é
escasso e pouco se sabe sobre a sua composição e distribuição.
A principal questão a ser respondida é: existe um padrão
GHELRGLYHUVLGDGHQDVĆWRĆVLRQRPLDVGR&HUUDGR"$ĆPGH
responder a esta pergunta, foi feito um levantamento de aves
QDVGLIHUHQWHVĆWRĆVLRQRPLDVFRPRIRQWHGHLQIRUPD©¥RGH
ULTXH]DHVSHF¯ĆFDHFRPSRVL©¥RHPHVS«FLHV'LIHUHQ©DVGH
SUHVHQ©DDXV¬QFLDGHHVS«FLHVHQWUHDVĆWRĆVLRQRPLDVFHUUDGR
e mata foram avaliadas a nível local. Neste trabalho foram
acrescentadas 52 novas espécies para a Fazenda Ecológica,
Palmas (TO) e reunidos dados da avifauna de vários locais
{փdփTT
ID t
ABSTRACT
t
do Brasil pertencentes ao bioma Cerrado. Foram registadas
145 espécies de aves distribuídas por 40 famílias, das quais
Thraupidae e Tyrannidae com maior número de espécies
presentes. Dentro destas o cerrado apresentou maior
percentagem de espécies comparativamente com a mata. Os
resultados na Fazenda Ecológica, revelam uma expressiva
diversidade biológica com a presença de espécies amazónicas
como Campephilus rubricollis e Melanerpes cruentatus,e de
espécies endémicas do Cerrado como Saltatricula atricollis
e Cyanocorax cristatellus. Para além disso,foram analisados
padrões de biodiversidade e similaridade dos registos através
da comparação com outros estudos, onde parece existir
a nível global um padrão de biodiversidade das famílias
UHSUHVHQWDGDVQDĆWRĆVLRQRPLDPDWD$GLFLRQDOPHQWH
percepções de correspondência entre as diferentes
regiões numa escala continental são aqui apresentadas.
ĉ Distribuição de aves de sub-bosque em zonas ripárias e não
ULS£ULDVHPXPDćRUHVWDXUEDQDQD$PD]¶QLD&HQWUDO
Urnia Cavalcante Ferreira1*, Cintia Cornelius1,
Welliton Wilson Mendona Martins1
ID t
ABSTRACT
t
Table of Contents
SUR[LPLGDGHGHLJDUDS«VFRPRREVHUYDGRHPćRUHVWDVQ¥R
perturbadas e se o efeito de borda gerado pelo processo de
urbanização afeta negativamente a distribuição da avifauna
local. Caracterizamos a avifauna de sub-bosque em uma
ćRUHVWDXUEDQDGH0DQDXV$0HPV¯WLRVULS£ULRVH
sítios não ripários, no período de julho a novembro de 2013.
Capturamos 27 espécies e um total de 118 indivíduos. O
número de indivíduos e o número de espécies não variaram
entre os sítios ripários e não ripários, bem como a composição
quantitativa da assembleia de aves não se diferenciou nos
sítios estudados. Observamos uma relação positiva entre
a biomassa de aves e a distância à borda nos sítios ripários
e um padrão inverso nos sítios não ripários. A similaridade
aumentou entre pares de sítios ripários mais próximos à
borda. Nossos resultados sugerem que o efeito de borda
gerado pelo processo de urbanização é o fator determinante
sobre a falta de diferenciação das aves de sub-bosque entre
os sítios ripários e não ripários. Além disso, apontam para a
necessidade de se considerar vários aspectos da qualidade do
habitat, principalmente a manutenção da heterogeneidade
QDWXUDOHLQWHJULGDGHGDV]RQDVULS£ULDVGHQWURGDćRUHVWD
especialmente naquelas onde o efeito de borda é mais intenso.
ǢW2-='89-&!&'
'&'8!£&31!A32!9
r<8!2-!W$(|+1!-£W$31
Efeitos negativos produzidos por perturbações antrópicas
interferem diretamente sobre a riqueza e abundância de
DYHVHPćRUHVWDV1RVVRREMHWLYRIRLFRQKHFHUVHHPXPD
ćRUHVWDFRPIRUWHLQćX¬QFLDXUEDQDDVDVVHPEOHLDVGH
espécies de aves respondem à variação ambiental gerada pela
Page 156, Posters
{փdփTT
ID t
ABSTRACT
t
218 $VVLPHWULDćXWXDQWHHPAntilophia galeata
(Passeriformes: Pipridae) e seu uso no biomonitoramento
GHIUDJPHQWRVćRUHVWDLVGRFHUUDGR
Camilla Queiroz Baesse1*, Vitor Carneiro de Magalhes
Tolentino1, Adriano Marcos da Silva1, Giancarlo ngelo
Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo2
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W83+8!1!
&'Õ9f8!&<!%È3'1$3£3+-!'329'8=!3&''$<8939!;<8!-9T
ǣW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W
r$!1-££!#!'99'|+1!-£W$31
POSTER SESSION: ECOMORPHOLOGY & PHISIOLOGY
Assimetria Flutuante (AF) é a diferença entre lados de
caracteres com simetria bilateral, sendo um sensível método
de biomonitoramento. Antilophia galeata é abundante em
ćRUHVWDVFRPGLIHUHQWHVQ¯YHLVGHSHUWXUED©¥RSRVVLELOLWDQGRD
comparação da AF entre populações. O objetivo foi determinar
HFRPSDUDUD$)WDUVRVDVDVGHA. galeata entre quatro
£UHDVGHćRUHVWDVVHPLGHFLGXDLVQR7UL¤QJXOR0LQHLURVHQGR
GXDVPDLRUHVHDIDVWDGDVGDFLGDGHJXD)ULD*DOKHLURH
GXDVPHQRUHVSUµ[LPDV¢FLGDGH*OµULD6¥R-RV«$VDYHV
foram capturas com 25 redes de neblina, totalizando 1600
KRUDVUHGHV£UHD2VLQGLY¯GXRVFDSWXUDGRVIRUDPDQLOKDGRV
&(0$9(,&0%LR7DUVRVHDVDVIRUDPPHGLGRVWU¬VYH]HV
FRPSDTX¯PHWURGLJLWDOP«GLDDULWP«WLFD3DUDYHULĆFDU
variação de AF entre áreas foram realizados testes Anova. Foi
observada AF para A. galeata (69 indivíduos). Entre as áreas,
houve diferença da AF para asa (p=0,001) e tarso (p=0,05). A.
galeataVHGHVORFDHPWRGRRHVWUDWRYHUWLFDOUHćHWLQGRHVVDV
variações na AF de acordo com o ambiente. Galheiro foi à
área com maior AF, seguida por São José, Glória e Água Fria.
Page 157, Posters
ID t
ABSTRACT
t
Table of Contents
As características do sub-bosque podem explicar a variação
da AF das aves entre as áreas, pois afeta o deslocamento
destas quando mais denso. Galheiro e São José possuem
sub-bosque denso devido ao estágio sucessional secundário
inicial. Glória e Água Fria apresentam sub-bosque limpo,
por se encontrarem em estágio sucessional avançado. A.
galeata pode ser utilizada como biomonitora de ambientes
ćRUHVWDLVSRLVDSUHVHQWRXUHOD©¥RQHJDWLYDHQWUHD$)HD
qualidade ambiental. Apoio: FAPEMIG (CRA-APQ01157-13),
&13T3(/'&(0,*33*(&28)8
219 Behind the red eyes: ontogeny of sexual
dimorphism in iris color of Dixiphia pipra (Pipridae)
DQGDSSOLFDWLRQWRĆHOGRUQLWKRORJ\
Joao V.C. Silva1*, Maira R. Rizzi2, Beatriz S. Conceicao2, Marina Anciaes2
ǢWf$3£3+-!T
TǣWTf
r/=6-'&!&'|+1!-£W$31
In Manakins, sexual dimorphism occurs mainly after plumage
color maturation. Besides the typical variation in plumage
observed in Dixiphia pipra, individuals present a range of iris
colors (brown, oranges and reds) that remain undescribed
as pure ontogenetic changes or sexual dimorphism. Here we
tested the existence of sexual dimorphism in iris color in the
species and describe its development comparing individuals at
GLIIHUHQWPROWVWDJHV:HVDPSOHLULVFRORUDQGLGHQWLĆHGWKH
SOXPDJHSKDVHRILQGLYLGXDOVLQWKHĆHOGDQGVH[HGWKHP
XVLQJVWDQGDUGPROHFXODUWHFKQLTXHV:HREVHUYHGDVLJQLĆFDQW
association between iris color, sex and molting limits. The
ontogeny of iris color also varied between sexes: brown irises
{փdփTT
ID t
ABSTRACT
t
appeared early in all offspring and switches from light and
dark orange to light and dark red, earlier in males than females.
Later development of the typical male dark red iris in female
are likely due to decreasing hormonal production in older
females, which leads to the expression of male characteristics
in birds. Because all individuals with dark red iris in formative
phase were males, irises may be used as a secondary sexual
trait expressed earlier than plumage maturation. Based on
RXUGDWDJUHHQSOXPDJHGELUGVLQWKHĆUVWIRUPDWLYHSKDVH
ZLWKPROWOLPLWVDQGOLJKWRUGDUNUHGLULVHVFDQEHLGHQWLĆHG
LQWKHĆHOGDVPDOHVZKHUHDVWKRVHZLWKRXWPROWOLPLWV
presenting light red irises will have 75% probability of being
females and about 80% of being males if irises are dark red.
220 Uso da condição corporal em aves no biomonitoramento
GHIUDJPHQWRVćRUHVWDLVGRFHUUDGR
Camilla Queiroz Baesse1*, Vitor Carneiro de Magalhes
Tolentino1, Adriano Marcos da Silva1, Giancarlo ngelo
Ferreira2, Lus Pedro Mendes Paniago1, Celine de Melo2
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W83+8!1!
&'Õ9f8!&<!%È3'1$3£3+-!'329'8=!3&''$<8939!;<8!-9T
TǣW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!T29ধ;<;3&'-3£3+-!W
r$!1-££!#!'99'|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
estacionais semideciduais do Triângulo Mineiro. Água Fria e
Galheiro: grandes e distantes de cidade, Glória e São José:
pequenas e próximas à cidade. As aves foram capturas com
UHGHVGHQHEOLQDHPGXDVFDPSDQKDV£UHDKRUDVUHGH
2VLQGLY¯GXRVFDSWXUDGRVIRUDPDQLOKDGRV&(0$9(,&0%LR
medidos (tarso direito) com paquímetro digital e pesados com
dinamômetro manual. O IMR foi obtido a partir de regressão
OLQHDU3DUDYHULĆFDUYDULD©¥RQR,05GDVDYHVHQWUHHVS«FLHV
e áreas foram realizados testes Anova. Foram analisadas
17 espécies (304 indivíduos). O IMR das aves diferiu entre
espécies (p<0,01) e áreas (p=0,05), sendo as aves do Glória
com maior IMR seguidas por, Água Fria, São José e Galheiro.
As espécies capturadas apresentam características distintas,
FRPRGLIHUHQWHVJXLOGDVK£ELWRVTXHSRGHPLQćXHQFLDUQR
IMR. Glória e Água Fria possuem estágio sucessional avançado
da vegetação, caracterizado por grande diversidade biológica,
portanto maior quantidade e diversidade de recursos. São
José e Galheiro apresentam sucessão ecológica secundária
LQLFLDOSRULQćX¬QFLDGDFRQVHUYD©¥RHKLVWµULFRGHXVRGDV
£UHDVUHćHWLQGRPHQRUGLVSRQLELOLGDGHGHUHFXUVRV2,05
das aves é afetado negativamente quando há perda de
qualidade ambiental. Apoio: FAPEMIG (CRA-APQ01654-12),
&13T3(/'&(0,*33*(&28)8
Índice de Massa Relativa (IMR) avalia condição corporal
através da estimativa das reservas nutricionais baseada na
biomassa e no comprimento de uma medida rígida. As aves são
indicadoras da qualidade ambiental por possuírem sensibilidade
às mudanças ambientais. O objetivo foi determinar se IMR
GDVDYHVYDULDHQWUHHVS«FLHVHTXDWUR£UHDVGHćRUHVWDV
Page 158, Posters
{փdփTT
ID t
ABSTRACT
t
221 Matrix role on the bird community diversity pattern
in patches of the Brazilian Atlantic Forest
Fagner D. Teixeira1*, Fernando Cesar Cascelli Azevedo2
ǢW
TǣW
r(!+2'8&!2-|,3;1!-£W$31
The Brazilian Atlantic Forest is restricted to small isolated
patches in all its extension and, as a consequence, the majority
of its fauna is declining and under extinction risk. This is
observed due mainly to the habitat loss and other negative
effects that take place on patches in a landscape, especially the
edge effect. Nevertheless, it is important to be careful while
JHQHUDOL]LQJVLQFHGLIIHUHQWPDWULFHVFDQLQćXHQFHSDWFKHVLQ
distinct levels. For example, planted forest phytophysionomies
can act as barriers to the edge effect when compared to open
areas. Therefore, we hypothesize that patches in contact with
a matrix mainly composed of eucalyptus would have more
diverse bird community. We assessed the richness (ANOVA),
abundance (Whittaker Diagram) and functional diversity
(Petchey & Gaston 2002, Ecology Letters. 5) of birds present
in the edge and inside patches of Atlantic Forest (Minas Gerais,
Brazil) surrounded by pastures (n=4) and by eucalyptus trees
(n=4). Even though all the studied patches showed low species
richness and approximate values, the eucalyptus matrix seems
to favor the bird community, that showed bigger richness
(F=70.5, p<0.05) and evenness in the border of the fragments
surrounded by eucalyptus. Furthermore the community in
contact with the eucalyptus matrix had a greater functional
diversity (average 1.2 higher), abundance of groups generally
Page 159, Posters
ID t
ABSTRACT
t
Table of Contents
sensitive to disturbances (large frugivorous) and presence
of a threatened species (Pyroderus scutatus). Regarding the
current state of the Brazilian Atlantic Forest, it is important
to give more attention to the matrix composition where the
patches are found, especially to the eucalyptus plantation.
223 Bird Functional Diversity across a forest
fragmentation gradient in Atlantic Forest
Gabriela M Bochio1*, Hugo R Medeiros2, Luiz dos Anjos1
ǢW2-='89-&!&'9;!&<!£&'32&8-2!TǣW2'96-3£!83
r+!#8-'£!#3$,-3|@!,33W$31W#8
Habitat fragmentation in tropical forests continues to cause
loss of biodiversity and its consequences on functional diversity
remains poorly understood. We investigated the patterns of
functional diversity in bird communities on a set of 14 forest
fragments across a gradient of size, connectivity and forest
cover in a forest fragmented landscape in Southern Brazil.
We evaluated three different aspects of functional diversity
(FD): functional richeness, evenness, and divergence. We also
compared the observed patterns of FD as measured by each
FD indexes with expectations for random assemblages to infer
DERXWDVVHPEO\UXOHVOLPLWLQJVLPLODULW\DQGKDELWDWĆOWHULQJ
Additionally, we examined the effects of landscape variables on
the measures of FD. We expected low values of FD compared
WRUDQGRPFRPPXQLWLHVLQGLFDWLQJWKDWKDELWDWĆOWHULQJLVWKH
dominant mechanism structuring bird communities in our
fragmented landscape. Birds were censured in each forest
fragment using point counts during four months in the spring
{փdփTT
ID t
ABSTRACT
t
and summer. Contrary to our expectations, in most cases the
REVHUYHGYDOXHVRI)'GLGQRWGLIIHUVLJQLĆFDQWO\IURPWKRVH
expected by chance. For the most isolated forest fragment in
our system, the functional evenness was higher than expected
by chance, indicating that may be the bird community is more
resilient to environmental changes. Variation in bird functional
richness was explained by area, forest cover, and connectivity.
Functional eveness showed no clear pattern and functional
divergence was explained by forest cover and connectivity.
224 Occupancy and population estimates for the cock-
of-the-rock (Rupicola rupicolaLinnaeus 1766) in
APA Maroaga, Amazonas State, Brazil
N. Sohn1*, M. Anciaes1
ǢWTf
ID t
ABSTRACT
t
Table of Contents
information on the conservation status of the species in the
target area. Habitat variables were not in the best model of
VLWHRFFXSDQF\LQVSLWHRIĆHOGREVHUYDWLRQVLQGLFDWLQJWKDW
the species occupied mainly Campinarana forests. Detection
rates were low (0 ? 20%), even when detection was favored by
weather condition and vegetation type, or within areas suitable
for breeding (detection = 5.5%). The minimum population
size estimated was 77915 individuals in a sampled area of
696.39 km2. Although possibly a methodological artifact,
these numbers may prevent the inclusion of the species in
any category of threat, but the necessity for monitoring and
management of protected areas are emphasized in order to
avoid that the species become vulnerable due to the strong
SUHVVXUHIURPDQLPDOWUDIĆFNLQJ2XUUHVXOWVSURYLGHG
population parameters that can be used to monitor the
species and establish local strategies for its conservation.
r2!;!$,!93,2|+1!-£W$32
The cock-of-the-rock (Rupicola rupicola, Cotingidae) is
endemic to the Guianan shield and associated to forests with
rock outcrops. In Amazonas state, it occurs locally around
Presidente Figueiredo. Due to its conspicuous morphological
and behavioral traits, the species suffers with animal
WUDIĆFNHUVLQFUHDVLQJXUEDQL]DWLRQDQGFRQWLQXRXVYLVLWDWLRQ
to nesting areas. Previous studies mapped suitable areas for
its occurrence in the region. However, there are no estimates
of population parameters and local habitat requirements for
the species. We estimated probabilities of site occupancy and
detection for different habitats, as well as population size and
density of the cock-of-the-rock in APA Maroaga to provide
Page 160, Posters
225 Abundance of Scarlet Ibis Eudocimus ruber in Babitonga
bay, North Coast of Santa Catarina state, Brazil
Alexandre V. Grose1*, Marta J. Cremer2, Nei Moreira1
ǢW
TǣW
r!£'W+839'|,3;1!-£W$31
Scarlet ibis (Eudocimus ruber) occurred in Santa Catarina
state, Brazil, but was considered extinct in the last 150 years.
In late 2011 the species was again observed in the estuary
of Babitonga Bay, north coast of Santa Catarina state. The
stablishment of a breeding colony indicated a good prospect
for restocking and growth. Our objective was to estimate
{փdփTT
ID t
ABSTRACT
t
population abundance by counting the number of adult
individuals. Between July 2012 and March 2015 monthly
scans with motorboat were conducted on the margins of
the estuary to count the number of individuals. We started
counts, in July (2012) with only 17 individuals. The highest
number of individuals were registered always in December,
78 individuals in 2012, 282 individuals in 2013 and 563
individuals in 2014. That represents an increase of 261% in
abundance between 2012 and 2013. In December 2014,
563 individuals were recorded in the bay, which represents
an increase of 99% between 2013 and 2014. Along this
years the highest abundance always preceded the breeding
season, occurring between October and December, and
reduced during the winter months, where we made the
lowest counts. The dispersion of youngs and adults over
a large area, searching for new feeding areas outside the
breeding season, is a characteristic of the species. Despite
the increasing trend, the data indicate probably stabilization
DQGVKRXOGEHLQćXHQFHGE\WKHVXSSRUWFRQGLWLRQVRIWKH
region. This growth brings hope for the species to become
common again in the region and in southern Brazil.
226 Song structure and organization in the
Saffron Finch (6LFDOLVćDYHRODSHO]HOQL)
Mara Juliana Benitez Saldivar1*, Viviana Massoni1
ID t
ABSTRACT
t
Table of Contents
Adult males are golden yellow colored with olive-streaked,
black upperparts and they are commonly caged as pets due
to their color and pleasant, melodious song. This species is
listed as being of “least concern”, but the pet trade seems
to be reducing their population in Buenos Aires Province in
Argentina. Even though this is a relatively common species,
a complete description and function of its song is lacking to
date. The aim of this study is to provide a characterization of
the organization and variability of the song in this species. We
present an analysis for one population of breeding males at
a nest box assemblage placed at Chascomús, Buenos Aires,
Argentina. We examined patterns of syllable and song diversity
from 1,021 songs from 48 males (N=31 in the 2014-2015
breeding season; N= 17 in the 2013-2014 breeding season),
using one recording for each male. The population syllable
repertoire represents over 90 syllables with an individual
repertoire of 13 ± 4.6 (mean ± SD) syllables and an average
number of syllables per song of 9 ± 4.1. Finally, we found that
many syllables are shared by most males, yet their placement
in each song and the frequency of use is variable. This
preliminary study of song structure shows that the population
overall repertoire is large. Moreover, this characterization
will enable assessment of potential differences between
immature and mature males’ song and, consequently, whether
acoustic communication has a relevant role in mate choice.
ǢW2-='89-&!&&'<'239-8'9
r/#'2-;'A|'+'W($'2W<#!W!8
The Saffron Finch, 6LFDOLVćDYHRODSHO]HOQL, is a South American
secondary cavity-nester with delayed plumage maturation.
Page 161, Posters
{փdփTT
ID t
ABSTRACT
t
227 (FRORJLFDOQLFKHPRGHOLQJLQSUDFWLFHćDJVKLS
species and regional conservation planning
N. Sohn1*, M. H. Fernandez2, M. Papes3, Marina Anciaes1
ǢWTfTǣWTǤW0£!,31!2-='89-;@
r2!;!$,!93,2|+1!-£W$31
Conservation of rare or endemic species is a multifaceted
matter, especially whenever knowledge gaps in species’
distribution and anthropogenic pressures converge. We
combined Geographic Information Systems and ecological
QLFKHPRGHOLQJWRROVZLWKĆHOGGDWDWRFKDUDFWHUL]HWKH
habitat types used for different behavioral activities and to
identify important areas for conservation of a charismatic
bird endemic to northeast South America, the Guianan cock
of-the-rock (Rupicola rupicola). Using species occurrences
and climatic, topographic, and remotely sensed vegetation
variables, we developed potential distribution models at
two scales: (1) broad geographic scale (northern South
America), based on georeferenced occurrences obtained
from literature and natural history museum specimens, and
ORFDOVFDOHSUHFLVH*36FRRUGLQDWHVUHFRUGHGLQWKHĆHOG
(Caverna do Maroaga Protected Area, Amazonas, Brazil).
:HLGHQWLĆHGVL[SULRULW\DUHDVIRUWKHFRQVHUYDWLRQRIWKH
species corresponding to high environmental suitability and
lowest anthropogenic pressure, measured as distance from
XUEDQDUHDVDQGKLJKZD\V3URWHFWLQJWKHDUHDVLGHQWLĆHGLQ
this study from anthropogenic threats such as hunting and
selective logging will help to preserve not only the cock-of-therock, but also the biodiversity of the whole mosaic of habitats
in the region. Our results were incorporated in a regional
Page 162, Posters
ID t
ABSTRACT
t
Table of Contents
management plan developed by state agencies and nongovernmental organizations. Modeling techniques combined
with on the ground, local surveys can be useful in species
conservation efforts, for planning new inventories, prioritizing
areas to be protected, and for creating ecological corridors.
228 When titans decide to play: playing behavior in
young individuals of Rhea americana Linnaeus
Marco Antnio P. F. Prado1*, Pedro Ubatan C. Neves1, damo
C. Barros1, Elizabeth F. G. Lima1, Carlos A. C Bianchi1
ǢW2-='89-&!&'
'&'8!£&'3-9
r1!8$368!&3#-3|+1!-£W$31
The Greater Rhea, the largest bird in South America measuring
up to 160 cm, occurs in open natural areas such as grasslands,
VDYDQQDKVDQGRSHQ&KDFREXWDOVRLQFXOWLYDWHGĆHOGV,Q%UD]LO
it is distributed all over the territory except in the Amazon.
3OD\LQJEHKDYLRULVGHĆQHGDVWKHH[SORUDWLRQRISK\VLFDO
and social environment without survival or reproduction
purposes, and it is commonly observed in young animals of
many species. Playing behavior can comprise several motor
patterns such as locomotion, jumping, laying, etc. Here we
report playing behavior for a group of young Greater Rheas
REVHUYHGDW9DOHGR7DPDQGX£IDUP$UDJRL¤QLD*2%UD]LO
during a pre-reintroduction monitoring program. We used
focal animal method in all observational sessions, tallying
approximately 100 hours of investigation. Each individual was
observed for ten minutes and had all behavioral occurrences
recorded. Five young Greater Rheas exhibited playing
behavior (pooled duration of 54 min), mostly characterized
{փdփTT
ID t
ABSTRACT
t
by locomotion. Individuals ran straight or in an irregular
course. Sometimes, this behavior started with jumps follow
by short runs. Usually, when one individual initiated this
behavior, the others tended to imitate. Playing behavior
lasted on average 10.8 minutes and happened between six
and ten in the morning and four and six in the afternoon.
Playing behavior comprises activities that help in the learning
and practice of particular skills such as motor development.
The record of this behavior is important as a contribution to
improve the knowledge of the behavioral repertoire in birds.
232 The role of environmental heterogeneity on forest
bird diversity in a Reserve in southern Brazil
Guilherme Willrich1*, Marcos Robalinho Lima1, Luiz Anjos1
ǢW2-='89-&!&'9;!&<!£&'32&8-2!
r+<-+!>-££8-$,|,3;1!-£W$31
Understanding the role of environmental factors in driving
species diversity and distribution is one of the main goals
in ecology. In this study, we evaluated if environmental
heterogeneity explained differences in bird diversity and
composition in a continuous semi-deciduous forest. The study
took place in “Parque Estadual Mata dos Godoy” (MG), a 650ha
reserve located in the north of Paraná State, southern Brazil.
We established seven trails in an upland forest (UF) - located
in a 600m a.s.l. plateau, and six trails in a riparian forest (RF),
which is located on a slope that ranges from 600 to 450m a.s.l.
bordered by the Apertados River. Three point counts with
50m radius were placed at 200m intervals on each trail, giving
a total of 39 points (3 X 13). Each point count was replicated
Page 163, Posters
ID t
ABSTRACT
t
Table of Contents
4 times from September to December 2014. We used bird
abundance to test if bird composition was different between
the two forest types. We recorded 3118 individuals of 115 bird
species, 101 species in RF (18 were exclusive) and 97 in UF
(14 were exclusive). Both Cluster Analysis and NMDS (stress
8,7) showed a clear difference in avian composition between
the two forest types. Fifty-four species were at least three
times more abundant in one of the forest types: 38 species
in RF (e.g. Psiloramphus guttatus and Philydor rufum) and 16
species in UF (e.g. Selenidera maculirostris and Dendrocincla
turdina). This result shows that environmental heterogeneity
plays a key role in the maintenance of forest bird diversity in
MG. However, the new Brazilian Forest Code has jeopardized
the preservation of riparian forests and conservation
policies should give more attention to this forest type.
235 Variações no canto de Herpsilochmus longirostris
PHO]HOQ7KDPQRSKLOLGDHHP£UHDVćRUHVWDLV
no cerrado com diferentes níveis de ruído
Vitor C. M. Tolentino1*, Camilla, Q. Baesse1, Celine Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r=-;38$!82'-83Ǣǣ|@!,33W$31W#8
Elevados níveis de ruído causados pela proximidade às
cidades é considerado um fator que afeta diretamente a
comunicação sonora das aves. Algumas espécies ajustam os
sinais sonoros em resposta aos altos níveis de ruído, alterando
a distribuição de energia da vocalização. Herpsilochmus
longirostris é insetívora e bastante abundante em ambientes
{փdփTT
ID t
ABSTRACT
t
ID t
ćRUHVWDLVFRPGLIHUHQWHVQ¯YHLVGHSHUWXUED©¥R2REMHWLYR
IRLYHULĆFDUH[LVW¬QFLDGHYDULD©¥RQRVSDU¤PHWURVDF¼VWLFRV
de Herpsilochmus longirostris entre áreas com diferentes níveis
de ruído causado principalmente por automóveis, caminhões
e aviões. As gravações foram feitas com gravador Sony ICDPX312 e microfone direcional Yoga HT-81 em três áreas
ćRUHVWDLVQR7UL¤QJXOR0LQHLURVHQGRGXDVFRPEDL[RQ¯YHOGH
ruído distantes de áreas urbanas e uma com alto nível de ruído
próxima a áreas urbanas durante o período de junho 2013 a
fevereiro 2014. Foram gravadas 1107 vocalizações e analisados
os parâmetros: frequência dominante, duração do canto e
número de notas, utilizando os programas Audacity 2.0 e Raven
Pro 1.4. O canto de Herpsilochmus longirostris possui frequência
dominante média de 2,201 kHz, duração média de 1,919 s e
21,367 notas. Os cantos dos indivíduos de áreas com alto nível
de ruído apresentaram maior frequência dominante, menor
duração e menor número de notas em relação aos cantos
de áreas com baixo nível de ruído (p < 0,05). A análise dos
parâmetros acústicos H. longirostris demonstrou que a espécie
pode ser utilizada no biomonitoramento da qualidade ambiental
na região por apresentar sensibilidade a altos níveis de ruído.
Apoio: FAPEMIG, CNPq, CAPES, CEMIG, PPGECRN-UFU.
236 $OWRVQ¯YHLVGHUX¯GROHYDPDRDXPHQWRGDIUHTX¬QFLD
Page 164, Posters
ABSTRACT
t
Table of Contents
GRPLQDQWHGRFDQWRGHDYHVHP£UHDVćRUHVWDLVGRFHUUUDGR
Vitor C. M. Tolentino1*, Camilla, Q. Baesse1, Celine Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r=-;38$!82'-83Ǣǣ|@!,33W$31W#8
O repertório vocal das aves sofre constantemente variações
causadas por diversos fatores. Fatores antrópicos, como o
ruído causado pelas cidades, são considerados os grandes
responsáveis pelas alterações na intensidade dos sinais
sonoros das aves. Uma resposta bastante comum das aves é
o aumento da frequência de seus sinais, levando a um maior
JDVWRHQHUJ«WLFR2REMHWLYRIRLYHULĆFDUTXDODLQćX¬QFLD
de altos níveis de ruído na frequência dominante do canto
de 10 espécies de aves. As gravações foram realizadas com
gravador Sony ICD-PX312 e microfone direcional Yoga HTHP£UHDVćRUHVWDLVQR7UL¤QJXOR0LQHLURGXDVFRPEDL[R
nível de ruído (Galheiro e Água Fria) e duas com alto nível de
ruído (Glória e São José) no período de junho 2013 a fevereiro
)RUDPUHDOL]DGRVê7HVWHVWëSDUDYHULĆFDUDH[LVW¬QFLD
de diferença entre elas. Foram gravadas 6220 vocalizações
das dez espécies. Nove espécies (Antilophia galeata,
Basileuterus culicivorus, Cantorchilus leucotis, Cyclarhis gujanensis,
Herpsilochmus longirostris, Leptopogon amaurocephalus,
Picumnus albosquamatus, Tolmomyias sulphurescens e Venilliornis
passerinus) apresentaram maior frequência dominante em áreas
com menores níveis de ruído (p < 0,05). Apenas Myiothlypis
ćDYHROD não apresentou diferença de frequência dominante
entre as áreas (p = 0,535). A frequência do canto das aves
geralmente é alterada na faixa que se sobrepõe à do ruído
{փdփTT
ID t
ABSTRACT
t
SDUDHYLWDUTXHRUX¯GRLQWHUĆUDQDFRPXQLFD©¥RVRQRUD
Apesar de a maioria dos estudos demonstrarem alterações
na frequência mínima da vocalização, a frequência dominante
se mostrou uma boa ferramenta para este tipo de análise.
Apoio: FAPEMIG, CNPq, CAPES, CEMIG, PPGECRN-UFU.
237 Riqueza y abundancia de aves rapaces con riesgo
potencial de electrocución y colisión con tendido
eléctrico en valles cordilleranos de Santiago, Chile
Francisco Santander1*, Sergio Alvarado1,
Cristin Estades1, Benito Gonzlez1
ID t
ABSTRACT
t
Table of Contents
1 /DDEXQGDQFLDUHODWLYDIXHDOWDHQ&µQGRULQGNP
PLHQWUDVTXHHOUHVWRGHODVHVSHFLHVQRVXSHUµORVLQG
km2. No detectamos evidencia de electrocución o colisión de
aves rapaces durante el estudio pese a que las aves utilizaron
ODLQIUDHVWUXFWXUDFRQGLVWLQWRVĆQHVUHJLVWURVGH
descansando (93,0%), alimentándose (4,2%) y apareándose
(2,7%). Sin embargo, nuestros resultados sugieren que Águila,
Carancho cordillerano, Tiuque y Aguilucho (Buteo polyosoma)
son especies con un alto potencial de sufrir accidentes
debido a su abundancia, actividad a baja altura y tamaño
corporal. Se sugiere un monitoreo constante y evaluación
de las medidas de mitigación adoptadas por la empresa.
ǢW2-='89-;@3(,-£'
r($3/9!2;!2|<W<$,-£'W$£
Los tendidos eléctricos son responsables de lesiones o muertes
por electrocución o colisión de aves rapaces en todo el mundo.
Esta situación sería crítica en ambientes montañosos donde la
topografía abrupta es un factor que aumenta la accidentabilidad
en rapaces. Entre Enero y Octubre del 2014 estudiamos la
riqueza, abundancia y riesgo de accidentes de aves rapaces
asociadas al tendido de media tensión del proyecto Alto-Maipo
en la precordillera de Santiago, Chile. Realizamos conteos
PHQVXDOHVGLXUQRVG¯DVSRUPHVHQSXQWRVGHUDGLRĆMR
km) y censos de carretera en 3 valles (Colorado, Yeso, Volcán),
abarcando 55 km. Detectamos 9 especies de rapaces en al área
de estudio: Vultur gryphus (N=206), Milvago chimango (N=31),
Geranoaetus melanoleucus (N=22), Phalcoboenus megalopterus
(N=16), Buteo polyosoma (N=12), Parabuteo unicinctus (n=12),
Falco sparverius (N=9), Falco peregrinus (N=3) y Glaucidium nanum
Page 165, Posters
238 Breeding biology of Sporophila lineola(Thraupidae) in
the municipality of Florestal, Minas Gerais, Brazil
D. F. Ferreira1*, L. E Lopes1
ǢW
f$!16<9
£38'9;!£
r&!£-£!#-3ǢǨ|+1!-£W$31
Sporophila lineola is a migratory species that inhabits a variety
of open habitats across much of South America. This study was
conducted in the Campus Florestal of the Universidade Federal
de Viçosa (19°52’51’’S, 44°24’49’’W), MG, Brazil, and aimed to
describe the breeding biology of the species. We monitored
41 active nests at intervals of 2-5 days, from December 2014
to April 2015. Nests are a shallow cup made with vegetable
ĆEHUV)HPDOHVDUHUHVSRQVLEOHIRUQHVWEXLOGLQJDQGLQFXEDWLRQ
which is asynchronous. Males are responsible for nest guarding
and territory defense, with agonistic interactions between S.
lineola and Satrapa icterophrys, Pitangus sulphuratus, Sporophila
{փdփTT
ID t
ABSTRACT
t
nigricollis and &KU\VRPXVUXĆFDSLOOXV. Clutches are of two (78.1%
of the nests) or three (21.8%) eggs, which are ovoid shapedand
cream colored, covered with brown dots and blotches.
,QFXEDWLRQSHULRGKHUHGHĆQHGDVWKHSHULRGEHWZHHQOD\LQJ
RIWKHODVWHJJDQGKDWFKLQJRIWKHĆUVWQHVWOLQJZDVRIs
GD\V1HVWOLQJSHULRGKHUHGHĆQHGDVWKHSHULRGEHWZHHQ
KDWFKLQJRIWKHĆUVWQHVWOLQJDQGćHGJHRIWKHODVWQHVWOLQJ
was of 10 ± 0.8 days. Both sexes feed the nestlings, generally
with grass seeds. The simple percentage of successful nests
was 29.3%, with 58.5% of the nests predated and 12.2%
DEDQGRQHG5HSURGXFWLYHVXFFHVVFDOFXODWHGE\WKH0D\ĆHOG
method was 29.8%, with daily survival rates of 0.934 ± 0.014
and 0.954 ± 0.018 during incubation and nestling periods,
respectively. We observed that three of the monitored males
were mated with more than one female, what is, to the best
RIRXUNQRZOHGJHWKHĆUVWUHSRUWRISRO\J\Q\IRU S. lineola.
242 Rede de interações ave-planta: um estudo sobre
frugivoria em áreas urbanas do Brasil
ID t
ABSTRACT
t
Table of Contents
destes dois grupos de plantas. Foi conduzida uma revisão
da literatura sobre frugivoria por aves em áreas urbanas do
Brasil e a partir desses dados uma meta-análise foi realizada
para criar uma rede de interações em escala nacional. Foram
incluídos 15 trabalhos na meta-análise com 70 espécies de
aves consumindo frutos de 15 espécies de plantas (6 exóticas
e 9 nativas), sendo Tangara sayaca a espécie registrada no
maior número de trabalhos (n=14) e Tyrannidae a família
mais representativa (n=18 spp.). As avifaunas consumidoras
de frutos exóticos e nativos não formaram grupos distintos
HDUHGHGHLQWHUD©·HVIRLVLJQLĆFDWLYDPHQWHDQLQKDGDFRP
um núcleo de espécies generalistas (NODF=0,30; p < 0,01)
e não modular (M= 0,36; p= 0,16) i.e sem subgrupos. Duas
plantas exóticas fazem parte do núcleo de generalistas da
rede (Ficus microcarpa e Michelia champaca). As assembleias
de consumidores de frutos nativos e exóticos não formaram
grupos diferentes. Os resultados indicam que um grupo
UHODWLYDPHQWHGLYHUVLĆFDGRGHDYHVFRQVRPHIUXWRVHP£UHDV
urbanas no Brasil de uma maneira oportunista, sem preferência
por nativos ou exóticos. Agradecimentos: FAPEMIG
Diego Oliveira1*, Alexandre Franchin1, Oswaldo Marcal-Junior1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r&-'+3#-3Ǣǡ|@!,33W$31W#8
Teoria de Redes pode ser útil nestes estudos, pois permite
avaliar simultaneamente várias espécies de aves e plantas
envolvidas em interações. Os objetivos deste trabalho foram
avaliar uma rede de interações de frugivoria por aves em
DPELHQWHXUEDQRQR%UDVLOYHULĆFDURSDSHOGHSODQWDVQDWLYDV
e exóticas na rede e comparar as assembleias de consumidores
Page 166, Posters
245 The aerobic metabolism and thermoregulation
after exhaustive activity is compromised in the
Ornate Tinamou because it’s small heart
Jordi Altimiras1*, Lina Giraldo2, Alvaro Garitano-Zavala2
ǢW-206-2+9<2-='89-;';TǣW29ধ;<;3&'$3£3+!T2-='89-&!&!@38&'!22&8Ì9
r/38&-W!£ধ1-8!9|£-<W9'
7LQDPRXVDUHDQDQFLHQWIDPLO\RIQHRWURSLFDOć\LQJELUGV
Scant data from a few species show that they have a small
{փdփTT
ID t
ABSTRACT
t
heart so our aim was to characterize relative heart size of two
species of the genus Nothoprocta and assess the physiological
limitations associated with a small heart size. Relative heart
size (0.24% for the Ornate Tinamou OT, a highland species
and 0.28% for the Chilean Tinamou CT, a lowland species)
ZDVVLJQLĆFDQWO\VPDOOHUWKDQKLJKDQGORZODQGFKLFNHQV
(0.54% and 0.42% respectively), without evidence of right
ventricular hypertrophy. Resting aerobic metabolism was
31% lower in OT than in highland chickens. When subjected
to exhaustive activity, OT had elevated glucose and lactate
levels suggesting a severe oxygen debt when exhausted. This
ZDVIXUWKHUVKRZQDVDVLJQLĆFDQWGURSLQERG\WHPSHUDWXUH
after an exhaustive bout. Finally heart rate while running on
a treadmill at 3 km h-1 was 5% lower in OT, indicating that
tinamous cannot compensate for the reduction in heart size
with a faster heart rate. Altogether, we provide evidence
that heart size is a phylogenetically conserved trait among
tinamous and that the Ornate Tinamou cannot compensate
aerobically for its small heart. Instead, it relies on anaerobic
metabolism incurring in a large oxygen debt while exhausted.
247 Dinâmica da comunidade de aves ao longo de
GXDVYDUL£YHLVWRSRJU£ĆFDVGHDOWLWXGHQD(VWD©¥R
Ecológica de Caetetus (EECa), São Paulo
Andreli Dalbeto1*, Guilherme Sementili
Cardoso1, Reginaldo Jos Donatelli2
ǢWÕ9f8!&<!%È3'1-Í2$-!9-3£+-$!9l 33£3£+-!mTǣW!#38!;8-3&'82-;3£3+-!
ID t
ABSTRACT
t
Table of Contents
o isolamento de populações e até extinção de espécies,
reduzindo a biodiversidade local em função, principalmente, da
perda de habitats e de uma maior incidência de raios solares
entre os fragmentos. Ambientes espacialmente heterogêneos
proporcionam uma grande variedade de microhabitats,
aumentando o espectro de recursos que permitem a ocorrência
de várias espécies Este estudo teve como objetivo analisar
DVFRPXQLGDGHVGHDYHVHPGXDVYDUL£YHLVWRSRJU£ĆFDVGH
altitude Porção Norte (PN - 480m) e Porção Sul (PS - 520m)
QD(VWD©¥R(FROµJLFDVGRV&DHWHWXVEXVFDQGRYHULĆFDU
suas relações ecológicas quanto a composição de espécies,
DEXQG¤QFLDHVWUXWXUDWUµĆFDHHVWUDWLĆFD©¥RGDDYLIDXQDH
também testar as possíveis diferenças na comunidade de aves
entre os períodos seco e chuvoso nessas duas porções. Nesse
estudo utilizou-se o método de Pontos de Contagem durante
12 meses, sendo de 10’ cada ponto equidistante 200m. O
levantamento quantitativo registrou 125 espécies para PN e
156 espécies para PS. O Índice Pontual de abundância variou
de 0,008 (1 contato) a 0,87 (210 contatos) na PN e de 0,004
(1 contato) a 0,91 (219 contatos) na PS. A diversidade (H’)
para PN foi de 3,76 e para PS, 2,68. A comunidade de aves
mostrou o mesmo padrão encontrado em outros fragmentos
ćRUHVWDLVGHPDWDHVWDFLRQDOVHPLGHFLGXDO*UDQGHSDUWH
das espécies exclusivas na ocorreram na PS, o que indica
DIRUWHLQćX¬QFLDGDYHJHWD©¥RQDVDYHV-£DDQ£OLVHGD
sazonalidade do regime de chuvas na EECa indica que tal
IDWRUQ¥RLQćXHQFLRXGLUHWDPHQWHDGLQ¤PLFDGDDYLIDXQD
A perda e a fragmentação de habitas são as maiores ameaças
a diversidade biológica. Essas alterações podem determinar
Page 167, Posters
{փdփTT
ID t
ABSTRACT
t
249 Taxonomic status of Turdus daguae based on
molecular and morphological analyses
ID t
ABSTRACT
t
Table of Contents
250 2HIHLWRGRSODQWLRGHGHQG¬Elaeis guineensis Jacq.)
na diversidade funcional de aves amazônicas
Jano Nez-Zapata1*, Luz Estela ZamudioBeltrn1, Adolfo G. Navarro-Sigenza1
Larissa C. Silva1*, Sara Almeida1, Mara R. Cardoso1, Pablo
Cerqueira1, Leandro Juen2, Marcos P. D. Santos3
ǢW<9'3&' 33£3+!T
!$<£;!&&'-'2$-!9
ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&'
'&'8!£&3!8Æc<9'<!8!'29'1£-33'£&-TǣW29ধ;<;3&'
-Í2$-!9-3£+-$!9T2-='89-&!&'
'&'8!£&3!8Æl
m
r/!232!;<8'|@!,33W$31
White-throated Robin (Turdus assimilis) is a widespread species
distributed from northern Mexico to northwestern Ecuador.
Morphological differentiation within the species is ample,
and has led to the subdivision of the taxon in more than 10
subspecies, based mainly on plumage color and geographical
distribution. One of its subspecies (T. a. daguae) has been
sometimes considered different at species level due to the
remarkable differences in size and plumage coloration, but
no further studies have contributed to clarify its taxonomic
situation. Based on molecular and morphological analyses,
we determined differences between this and the others
subspecies of T. assimilis. Tissue samples from throughout
the distribution range were included in the present study.
Phylogenetic analyses of mitochondrial DNA showed that
samples considered as T. assimilis are separated in two lineages,
one of them clustered all samples of T. a. daguae, and the other
lineage clustered all the remainig T. assimilis. Multivariate
analysis of morphological measurements of museum
specimens also supports differentiation of both groups, with
T. albicollis, as the sister taxon. All these evidences plus the
geographic restriction of T. a. daguae to the Chocó region,
suggest that this taxon is a separate species from T. assimilis.
Page 168, Posters
r£$!8&393#-3|+1!-£W$31
O plantio de dendê afeta a diversidade de espécies, mas o
conhecimento dos seus impactos sobre os papéis funcionais das
mesmas é limitado. Avaliamos a diversidade funcional de aves
HPSODQWLRGHGHQG¬HHPIUDJPHQWRVćRUHVWDLVDGMDFHQWHVQD
Amazônia Oriental. Amostramos a avifauna através de pontos
Ć[RVGHFHQVRVHPSDUFHODVVHQGRTXHWRGDVDSUHVHQWDYDP
matas ripárias (APP). Consideramos três tratamentos: Floresta
(198 espécies), Palma+APP (144) e Palma (88). Mensuramos
a diversidade funcional através dos índices FD (Functional
diversity), NRI (nearest relative index) e NTI (nearest taxon
index), utilizando 25 características funcionais. O FD foi maior
HPćRUHVWDGRTXHHPSDOPDSPDVQ¥RGLIHULXHQWUH
ćRUHVWDH3DOPD$33S 215,HR17,LQGLFDUDP
UHGXQG¤QFLDIXQFLRQDOQDV£UHDVGHćRUHVWDRXVHMDDVHVS«FLHV
são funcionalmente mais similares. Essa redundância confere
maior estabilidade à esse ambiente diante de perturbações
randômicas. Uma análise de ordenação (RLQ) mostrou que
traços generalistas (e.g. onivoria) estão associados às áreas
GHSODQWLRHQTXDQWRDćRUHVWDDEULJDRVPDLVHVSHFLDOL]DGRV
(e.g. frugivoria). Concluímos que a diversidade funcional de
{փdփTT
ID t
ABSTRACT
t
DYHVGLPLQXLFRPDFRQYHUV¥RGHćRUHVWDVHPSODQWLRGH
SDOPD$SHVDUGD)'Q¥RGLIHULUHQWUHćRUHVWDH3DOPD$33
esse segundo ambiente mostrou-se instável do ponto de
vista funcional e a perda aleatória de espécies resultará na
perturbação do ecossistema. Assim, faz-se necessário manter
IUDJPHQWRVćRUHVWDLVDGMDFHQWHV¢V£UHDVGHSODQWLREHPFRPR
ćRUHVWDVULS£ULDVGHQWURGRSODQWLRSDUDJDUDQWLURGHVHPSHQKR
de serviços como polinização e dispersão de sementes.
252 La educación ambiental como herramienta de
conservación de Ardenna creatopus, Isla Mocha, Chile
Verónica López1*, Valentina Colodro1, Peter
Hodum1, Cristian Cornejo2, Guillermo Reyes3
ǢW-03239$39@9;'123>£'&+'TǣW-2-9;'8-3&''&-3
1#-'2;'TǤW38638!$-Õ2!$-32!£
38'9;!£
r='832-$!|3-03239W38+
(Q,VOD0RFKDQLGLĆFDHOGHODSREODFLµQPXQGLDOGH
Ardenna creatopus, ave marina pelágica, migratoria, en peligro
de extinción. Se considera que la captura ilegal de polluelos para
consumo realizada por la comunidad, puede ser una amenaza,
estimándose el año 1998 una captura del 20% de la producción
anual? El Gobierno de Chile, a través del Ministerio de Medio
Ambiente (MMA) y la Corporación Nacional Forestal (CONAF),
en conjunto con la ONG Oikonos, comienzan el año 2011 un
trabajo de educación ambiental con los objetivos de: que los
isleños conozcan a la especie, su estado de conservación y la
ilegalidad del consumo. Lograr identidad de la comunidad con la
HVSHFLH\FRQODFRQVHUYDFLµQGHVXćRUD\ODIDXQD&DGDD³R
Page 169, Posters
ID t
ABSTRACT
t
Table of Contents
se organizan diversas actividades, algunas con la participación
hasta del 60% de la población de la isla (± 300 personas) a
través del arte y la participación comunitaria. Durante todo
el año, se trabaja con niños de la Escuela (± 16 niños). Trabajo
realizado por isleños capacitados. Se realizan también trabajos
con alumnos de la Escuela (± 70 niños): concurso de cuentos,
realización de peluches, libro para colorear, entre otras. Se
considera que los resultados han sido positivos, obteniendo
una buena respuesta de la comunidad. Encuestas muestran
un conocimiento del tema por parte de los isleños, pero sin
FXDQWLĆFDFLµQGHOFRQVXPRGHODHVSHFLH(OWUDEDMRFRQVWDQWH
con la comunidad y la capacitación de guías locales, ha
JHQHUDGRODFRQĆDQ]DGHODFRPXQLGDGEXVFDQGRORJUDUXQ
compromiso para los esfuerzos de conservación a largo plazo.
253 Are permanent preservation areas within forest plantations
functional for grassland birds in Pampa Biome?
Lucilene Jacoboski1*, Raquel Paulsen1, Sandra Hartz1
ǢW2-='89-&!&'
'&'8!£&3-38!2&'&3<£c
r£<$-£'2'W/!$3#390-|@!,33W$31W#8
The Pampa Biome hosts many endemic and threatened taxa,
though only 0.5% of the region is protected in Rio Grande do
Sul, Southern Brazil. Forestation is one of the main threats to
this biome. According to Brazilian law, cellulose companies
must maintain permanent preservation areas (PPAs) within
WKHVLOYLFXOWXUHIDUPVLQRUGHUWRHQDEOHVSHFLHVćRZDQG
landscape connectivity. Hence, the aim of this study was to
evaluate whether grassland PPAs in eucalyptus forestation
{փdփTT
ID t
ABSTRACT
t
ID t
at Pampa biome are functional for grassland birds. The study
ZDVFRQGXFWHGLQ6¥R*DEULHO56PXQLFLSDOLW\Rèèè6
DQGRèèè:%UD]LO%LUGVZHUHVDPSOHGE\WKHĆ[HG
point method at grassland PPAs and native rangelands areas
grazed by livestock, from October 2014 to January 2015. We
recorded 43 bird species, four of them in some threat category.
5LFKQHVVDQGDEXQGDQFHVKRZHGQRVLJQLĆFDQWGLIIHUHQFHV
However, the composition was different (Q= 11.75, p= 0.003),
demonstrating species turnover between areas, indicating
that the PPAs are functional for a group of species. These
results are satisfactory from a conservation perspective, yet
plant succession dynamics in the Pampa is a concern for the
conservation of birds that are restricted to well developed
grassland areas, such as PPAs. As there is no disturbance in
WKHVHDUHDVVXFKDVĆUHDQGJUD]LQJWKHZRRG\YHJHWDWLRQ
can advance in detriment of the grasslands. Therefore,
management practices could be adopted as an experiment
to avoid encroachment of woody plants within the PPAs, in
order to maintain grasslands and prevent loss of biodiversity.
254 Effects of Eucalyptus plantations on bird diversity and
Page 170, Posters
ABSTRACT
t
Table of Contents
functional nestedness: a key factor for functional trait overlap
Lucilene Jacoboski1*, Vanderlei Debastiani1,
Andr Mendona-Lima2, Sandra Hartz1
ǢW2-='89-&!&'
'&'8!£&3-38!2&'&3<£c
T
ǣW
<2&!3 333;2-$!&3-38!2&'&3<£
r£<$-£'2'W/!$3#390-|@!,33W$31W#8
Understanding ecological processes that sustain bird
functional diversity in silviculture areas is relevant because
different functional traits can show distinct responses to
this landscape alteration, and environment functioning can
be affected. Replacement of native habitats by silviculture
can be a relevant factor changing functional characteristics
of assemblages. This study aimed evaluate functional and
taxonomic differences in bird assemblages in a native forest and
eucalyptus plantations, and also to assess species functional
QHVWHGQHVV6DPSOLQJZDVFRQGXFWHGLQ%DUUDGR5LEHLUR56
municipality (30°17’29’’S and 51°18’9’’W), Brazil. We sampled
birds in eucalyptus plantations and in a native forest totalizing
Ć[HGSRLQWVEHWZHHQ2FWREHUDQG'HFHPEHURI
Species were characterised in relation to 14 traits. A total of
VSHFLHVZHUHLGHQWLĆHG5HVXOWVVKRZHGKLJKHUIXQFWLRQDO
and taxonomic diversity of birds in the native forest than
in plantations, suggesting a greater niche complementarity
in forest native. In our study the most affected species by
silviculture were those that nest in vegetation, forage in air
and nectarivores. This can also be the result of action of
DQHQYLURQPHQWDOĆOWHULPSRVHGE\VLOYLFXOWXUHVHOHFWLQJ
{փdփTT
ID t
ABSTRACT
t
species with similar traits. On the other hand, we observe
functional nestedness of traits of species from plantations
in relation to the native forest (treeNodf= 46.53, p= 0.001),
indicate trait overlap in plantations. Our results demonstrate
that some functions are affected or even lost in silviculture
area. In this sense, the occupation of the plantations is
determined by the combination of traits of each the species.
255 Current health and reproductive status of
captive Cyanopsitta spixii in Brazil
3DWULFLD3HUHLUD6HUDĆQL1*, Marcus Vincius Romero Marques2,
Ramiro das Neves Dias-Neto3, Camile Lugarini1, Ricardo Jos
Garcia Pereira4, Lorenzo Crosta5, Michael Lierz6, Ryan Watson
ǢWc-3cTǣWf
TǤW8-!&3<83TǥW'6!8;!1'2;3
&''683&<32-1!£T
fTǦW';'8-2!8-32;'='$$,-!TӐW£-2-$(38
-8&9T'68-£'9T16,-#-!29!2&
-9,T<9;<9f-'#-+f2-='89-;@-'99'2
r6!;8-$-!W9'8!)2-|-$1#-3W+3=W#8
Cyanopsitta spixii is currently one of the most threatened
animals in the world. It is considered extinct in the wild since
2000 and around 100 individuals remain in captivity. The
recovery of the species relies on the successful reintroduction
of captive-bred birds into a suitable habitat within its range. The
Spix´s Macaw Action Plan and its Captive Breeding Program
aim to manage the captive population at the highest standards.
:HSUHVHQWWKHUHVXOWVRIWKH%UD]LOLDQćRFNIXOĆOOPHQWRI
the health and reproductive management protocol over the
past year. In March 2014, 10 Spix’s in Brazil were handled
and samples surveyed. For all birds, negative diagnosis were
found considering the investigation for hemoparasites,
Page 171, Posters
ID t
ABSTRACT
t
Table of Contents
Chlamydia psittaci, Salmonella spp., Clostridium spp, Mycoplasma
spp., Mycobacterium spp., Adenovirus, Alphaherpesvirus,
Polyomavirus, Circovirus and Avian Bornavirus. Only serology
for avian Polyomavirus showed questionable results (1:2) to
three birds. Hematology and Eletrocardiograms were also
performed. Only one bird showed signs of heart disease. This
LVDQLPSRUWDQWĆQGLQJFRQVLGHULQJWKDWWKHODVWWZRGHDWKVLQ
Brazil (early 2014) were due to heart failure in two old males.
Semen analysis showed spermatozoa with morphological
abnormalities, as well as altered motility and density. On
the other hand, pairing decisions, reproductive and health
management culminated with the birth of two healthy chicks
LQ2FWREHU7KHVHZHUHWKHĆUVWELUWKVVLQFHZLWKLQ
WKH%UD]LOLDQćRFN3URSK\ODFWLFPDQDJHPHQWLVWKHEHVW
approach to safeguard the health of captive endangered birds,
once it prevents the introduction and spread of pathogens.
258 Reproducción de Sula variegata (Aves, Sulidae)
en La Quirilluca, Chile Central
Tania Hornauer1*, Juan J. Saez1, Juan C. Torres-Mura1
ǢW<9;'2;!#£'
r;,382!<'8|9<9;'2;!#£'W$£
La reproducción de las aves marinas depende de las condiciones
oceánicas y es sensible a las variaciones en los recursos
alimentarios. Sula variegata es un ave costera endémica de la
corriente de Humboldt, en categoría de conservación según la
legislación chilena, y una de las principales aves guaneras del
3DFLĆFRVXURULHQWDO6XVSULQFLSDOHVFRORQLDVGHUHSURGXFFLµQ
{փdփTT
ID t
ABSTRACT
t
ID t
se ubican en islas sin depredadores terrestres pero en la zona
central de Chile existe reproducción en un área continental
denominada Acantilados de la Quirilluca (Puchuncaví, región
de Valparaíso). Por medio de observaciones sistemáticas y
recuentos periódicos se determinó el tamaño poblacional, el
ciclo reproductivo y los patrones de actividad durante dos
años consecutivos. La reproducción es estacional, realizándose
en primavera y verano, con variaciones interanuales en la
cronología. La población de aves adultas es cercana a los
5.000 ejemplares en primavera. El número de aves que
se mantiene en reposo durante el día en la colonia varía
por la salida de aves a los sitios de alimentación en el mar,
observándose el máximo de ejemplares al amanecer y al
atardecer, reduciéndose a un 65% al mediodía. La llegada de
las aves a la colonia ocurre entre septiembre y octubre, el
cortejo ocurre entre octubre y noviembre y de noviembre a
enero se produce el periodo de incubación; la crianza de pollos
se extiende hasta Abril. En invierno desaparecen de la zona
ya que la mayoría de la población se desplaza hacia el norte.
(OQ¼PHURSURPHGLRGHSROORVSRUQLGRIXHGH$ĆQHVGH
Abril la mayoría de los individuos corresponde a volantones,
etapa en que la que se observa la mayor mortalidad.
259 Assembleia de aves aquáticas em lagos de várzea no Baixo
Page 172, Posters
ABSTRACT
t
Table of Contents
Rio Amazonas, Santarém, Pará, ao longo de um ciclo sazonal
Danilo Almeida-Santos1*, Giulianne Ferreira1, Edson Lopes1
ǢW
r&!2-£3!<+<9;39!2;39|@!,33W$31W#8
Lagos de várzea na Amazônia são inundados sazonalmente,
gerando quatro fases: enchente, cheia, vazante e seca, o que
SRGHLQćXHQFLDUHPSURFHVVRVHFROµJLFRV1µVDQDOLVDPRV
a assembleia de aves aquáticas em lagos de várzea no baixo
Rio Amazonas, ao longo de um ciclo sazonal. Amostramos
dez lagos de várzea em cada fase do ciclo sazonal utilizando
o método de transecção, percorrendo em embarcação o
perímetro de cada lago. Registramos 52 espécies ao longo de
todo o ciclo; 25 nas quatro fases, 5 em três, 10 em duas e 12
em uma fase. As famílias com maior riqueza foram Ardeidae
(11) e Scolopacidae (8), e as espécies mais abundantes foram
Ardea alba (1293), Jacana jacana (925), Bubulcus ibis (802),
Phaetusa simplex (670) e Egretta thula (638). As 10 espécies
migrantes setentrionais registradas ocorreram principalmente
nas fases vazante e seca, entre agosto e dezembro. Dentre
estas, Calidris fuscicollis e Tringa melanoleuca são novos
registros para a região. Na fase seca ocorreu a maior riqueza
(47 espécies) e o número total de registros (4009). Dentre
as 25 espécies registradas nas quatro fases, sete foram mais
abundantes na fase seca e uma na fase vazante. Na fase
cheia a riqueza foi correlacionada com o tamanho e forma
dos lagos. Fatores como a variação da composição, riqueza
e abundância ao longo do ciclo e a presença de espécies
raras, sugerem que pesquisas investigando assembleias de
{փdփTT
ID t
ABSTRACT
t
aves aquáticas em várzeas amazônicas devem considerar
todas as fases do ciclo sazonal. Isto está relacionado com
a conservação deste ecossistema, pois estudos realizados
em apenas uma fase do ciclo possivelmente não irão
incorporar todas as espécies que utilizam este ambiente.
ID t
ABSTRACT
t
Table of Contents
WKHVLWHDVDFRQWDFW]RQHZKHUHW\SLFDOELUGVIURPêWHUUDĆUPHë
forest (78%) mix with birds from second-growth forest and
open areas (22%). This study highlights the importance of this
area as a passage zone and shows that maintenance of large
urban forest fragments in this region is relevant to prevent
anthropogenic impacts and maintain population viability.
263 Bird assemblages at MUSA canopy tower in the
Botanical Garden Adolpho Ducke, Central Amazonia
Marina F. A. Maximiano1,2*, Leandro J. C. L. Moraes1,
Marcelo H. M. Barreiros, Felipe B. R. Gomes2,3
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW<9'<&!
1!AÖ2-!TǤW2-='89-&!&'
'&'8!£&3!8ÆT$!16<9£;!1-8!
r1!8-2!i1!?-1-!23|,3;1!-£W$31
Canopy towers are relevant for a complete sampling of bird
assemblages in the Amazonian tall forests, as it allows access
to low sampled strata. To characterize the bird assemblages
around a recently constructed canopy tower in Museum of
Amazonia (MUSA), located on the Botanical Garden Adolpho
Ducke, at the edge of one large forest fragment in Manaus,
Central Amazonia, we conducted systematic surveys from
June 2014 to March 2015 in the three tower platforms,
corresponding to distinct forest strata, identifying and
registering all seen or heard species. A total of 150 species
were registered, belonging to 38 families. Most of species (101)
were recorded in the second platform, located 28 m above
ground. Sensitive and migratory species were registered,
such as Harpia harpyja and Setophaga spp., respectively, as
well as several canopy species, such as Vireolanius leucotis and
Xipholena punicea. The assemblage composition characterizes
Page 173, Posters
268 Blood parasites in Monasa nigrifrons (Galbuliformes:
Bucconidae) in cerrado of Minas Gerais, Brazil
Paulo Vitor Alves Ribeiro1*, Camilla Queiroz Baese1, Vitor
Carneiro de Magalhes Tolentino1, Maria Jlia Rodrigues
da Cunha4, Adriano Marcos da Silva1, Giancarlo ngelo
Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo
ǢW29ধ;<;3&'-3£3+-!T2-='89-&!&'
'&'8!£&'#'8£Æ2&-!TǥW29ধ;<;3
&'-Í2$-!9-31Ì&-$!9T2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r6!<£3f=-;38Ǩǥ|,3;1!-£W$31
Monasa nigrifrons is an insectivorous specie that doesn’t
present sexual dimorphism, males and females have blacksooty plumage and red beak. The individuals live in small
groups in gallery forests and are distributed throughout South
America. Hemoparasites can infect several species of birds,
LQFOXGLQJWKLVFRPSURPLVLQJWKHLUĆWQHVV7KHREMHFWLYHRI
this study was to determine the occurrence and parasitemia
of hemoparasites in M. nigrifrons. Five individuals of this specie
ZHUHFDSWXUHGLQDIRUHVWLQ$UDJXDUL0*SHUIRUPLQJWZR
blood smears for each bird, stained with Giemsa and analyzed
with light microscopy. For determining parasitemia, the number
RIHU\WKURF\WHVDQGSDUDVLWHVLQPLFURVFRSLFĆHOGVZHUH
TXDQWLĆHGWRWDOLQJĆHOGVDQGHU\WKURF\WHV$OO
{փdփTT
ID t
ABSTRACT
t
the birds (100%) showed co-infection by Haemoproteus and
Plasmodium. In total, 193 erythrocytes (0.80%) were infected by
Haemoproteus and 26 (0.10%) by Plasmodium. The parasitemia
of Plasmodium ranged from three to seven (cv = 38%) parasites,
while Haemoproteus, four to 76 (cv = 80.1%) parasites, but there
wasn’t correlation of parasitemia between the both genus
(r = 0.134, df = 3, p = 0.831). The fact that all individuals are
infected can be attributed to the foraging behavior sit-and-wait
and to the habit of nesting on the ground. When the birds are
grouped, it’s estimated that there are greater release of dioxide
FDUERQDWWUDFWLQJćLHVYHFWRUVWRSHUIRUPEORRGIHHGLQJDQG
WUDQVPLWWLQJWKHSDUDVLWHV7KLVZDVWKHĆUVWVWXG\WRGRFXPHQW
occurrence, parasitemia and co-infection by Haemoproteus
and Plasmodium in M. nigrifrons. Acknowledgments: FAPEMIG
&5$$34&13T3(/'
269 Blood parasites in Antilophia galeata and Pipra fasciicauda
(Passeriformes: Pipridae) in cerrado of Minas Gerais, Brazil
Paulo Vitor Alves Ribeiro1*, Camilla Queiroz Baese1, Vitor
Carneiro de Magalhes Tolentino1, Maria Jlia Rodrigues
da Cunha2, Adriano Marcos da Silva1, Giancarlo ngelo
Ferreira1, Lus Pedro Mendes Paniago1, Celine de Melo
ǢW29ধ;<;3&'-3£3+-!T2-='89-&!&'
'&'8!£&'#'8£Æ2&-!TǣW29ধ;<;3
&'-Í2$-!9-31&-$!9T2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r6!<£3f=-;38Ǩǥ|,3;1!-£W$31
ID t
ABSTRACT
t
Table of Contents
WKHVHFRPSURPLVLQJWKHLUĆWQHVV7KHREMHFWLYHRIWKLVVWXG\
was to determine and compare the occurrence and parasitemia
of hemoparasites in both species. 30 individuals of Antilophia
galeata were captured in four forests of Triângulo Mineiro
and 34 of Pipra fasciicaudaLQDIRUHVWIURP$UDJXDUL0*
For each bird, were made two blood smears, stained with
Giemsa and analyzed by light microscopy. For determining
SDUDVLWHPLDWKHHU\WKURF\WHVDQGSDUDVLWHVZHUHTXDQWLĆHG
LQPLFURVFRSLFĆHOGVE\LQIHFWHGLQGLYLGXDO7KHUH
ZDVLQIHFWLRQLQĆYHLQGLYLGXDOVRIA. galeata, one
(3.3%) by Haemoproteus, four (13.3%) by Plasmodium, and
in four (11.8%) individuals of P. fasciicauda, one (2.95%) by
Haemoproteus and three (8.82) by Plasmodium. The parasitemia
in A. galeata were: two (0.008%) Haemoproteus and 18
(0.072%) Plasmodium in 25,000 erythrocyte analyzed, and in
P. fasciicauda, were: two (0.01%) Haemoproteus and 20 (0.10%)
Plasmodium in 20,000 erythrocytes. The low rates may be
due to the solitary and territorial behavior of both species,
because when birds are grouped, it’s estimated that there
LVJUHDWHUFDUERQGLR[LGHUHOHDVHDWWUDFWLQJćLHVYHFWRUVWR
perform blood feeding and transmitting the parasites. This
ZDVWKHĆUVWVWXG\IRFXVHGRQFRPSDULQJRFFXUUHQFHDQG
parasitemia of Plasmodium and Haemoproteus between these
two species of Pipridae. Acknowledgements: FAPEMIG
&5$$34&13T3(/'
Antilophia galeata and Pipra fasciicauda are predominantly
frugivorous birds that have sexual dimorphism, live close
to gallery forests and are distributed in South America.
Hemoparasites can affect several species of birds, including
Page 174, Posters
{փdփTT
ID t
ABSTRACT
t
276 Functional bird richness in a forest complexity
gradient in Araucaria forests
Larissa, C. Calsavara1*, Gabriela, M. Bochio1, Hugo, R.
Medeiros2, Jos, M Torezan1, Marcos, R. Lima1, Luiz Anjos1
ǢWTǣW2'96
ID t
ABSTRACT
t
Table of Contents
FRic (r = 0.39; P = 0.33) and between REA and bird richness
(r = 0.232; P = 0.57). It is possible that bird communities in AF
are resistant to fragmentation or that the forest complexity
gradient was too weak (range: 33.3-51.3). Alternatively,
RXUVDPSOHVL]HQ ZDVWRRVPDOOWRĆQGDQHIIHFW
r£!8-$389-2-|+1!-£W$31
Araucaria forests (AF) in southern Brazil have suffered strong
fragmentation resulting in fragments with varying vegetation
structure (e.g., canopy cover, number of Araucaria and dead
trees.). Studies have shown that forest structure is a good
predictor of bird composition and that heterogeneous habitats
have higher bird richness. An explanation for this pattern is
that heterogeneous habitats offer more niche spaces for the
bird community. If this is the case, then heterogeneous habitats
should harbor species with different ecological traits (body
mass, diet, substrate and foraging method). In this study, we
evaluated both taxonomic and functional bird richness in a
gradient of forest complexity in AF in southern Brazil (Paraná
State). Our prediction is that taxonomic and functional bird
richness will be positively correlated with forest complexity.
We sampled 8 sites along a forest complexity gradient, which
was measured with the use of Rapid Ecological Assessment
(REA) of forest characteristics (e.g., number of Araucaria
trees and dead trees). REA gives a number from 12 (low forest
complexity) to 60 (high forest complexity). Bird communities
were sampled in each site using 6 point counts (100m radius)
GXULQJVSULQJDQGVXPPHURI:HFDOFXODWHG
Functional Richness (FRic) using functional traits from the bird
communities. We found a lack of correlation between REA and
Page 175, Posters
281 (IHLWRLPHGLDWRGDRFRUU¬QFLDGHFKXYDVVREUH
a abundância relativa de aves na caatinga
Clarisse C. O. S. Silva1*, Pedro T. S. M. Moura1,
Thales A. D. S. Silva1, Leonardo F. F. Frana1
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
r$£!8-99'$3W9-£=!|+1!-£W$31
O deslocamento pode ser responsável por parte da variação
na abundância local de aves Neotropicais, fazendo com que
uma atividade comportamental seja responsável por vieses
na percepção de abundância das espécies. Objetivamos aqui,
avaliar variações no número de capturas em ocasiões com
e sem a ocorrência de chuvas no dia anterior. Realizamos o
HVWXGRQD(6(&6HULGµ|èH|è:£UHDVRELQćX¬QFLD
de clima semiárido. Estabelecemos uma área de 31,5 ha com
vegetação arbustiva, a qual recebeu 48 redes de neblina (18 m
x 3 m). Realizamos a coleta de dados em duas expedições, sendo
uma na estação seca e uma na chuvosa, respectivamente. Em
FDGDH[SHGL©¥RPRQLWRUDPRVD£UHDSRUVHLVGLDVFLQFRKRUDV
dia). As aves capturadas foram individualizadas com anilhas
(CEMAVE-ICMBio) e liberadas. Utilizamos o Teste t para duas
amostras independentes no programa Bioestat (versão 5.3).
Obtivemos 2.331 registros de aves durante as duas expedições,
sendo 311 indivíduos durante a primeira expedição e 2020
{փdփTT
ID t
ABSTRACT
t
QDVHJXQGD2Q¼PHURGHUHJLVWURVIRLVLJQLĆFDWLYDPHQWH
maior durante as coletas com ocorrência de chuvas no dia
anterior do que nas coletas sem ocorrência de chuva para a
seca (t8;p<0,05=4.516, p=0,001), no entanto o mesmo não
ocorreu no período chuvoso (t8;p<0,05=1,3155, p=0,11). O
aumento severo no número de registros após um dia de chuva
durante a estação seca indica que as espécies podem estar
presentes no local, sem ser detectadas ou detectadas em
abundância muito inferior a real. Portanto, faz-se necessário
cuidado ao tratar de variação sazonal na abundância relativa
das populações e presença de Aves na Caatinga, para evitar
subestimativas provocadas por vieses metodológicos.
ID t
ABSTRACT
t
Table of Contents
registered overall. It was also observed to eat eggs or shells, but
QHYHUDVWKHĆUVWQHVWYLVLWRU([FOXGLQJCoragyps atratus and
youngs Urubitinga urubitinga, other bird species normally do not
interact with nests. The second most frequent species in nests
was Crax globulosa (14%). Other studies with camera-traps not
VSHFLĆFDOO\DVVRFLDWHGWRFDLPDQQHVWVUHFRUGHGRQO\VL[VSHFLHV
of birds in the same region and period. Nests represent the
most vulnerable life-phase of crocodilians and females choose
their location based on best environmental conditions. These
habitats or protein availability can offer ideal circumstances
for others species. We have to improve our knowledge on birds
OLYLQJLQVLGHćRRGHGIRUHVWGXULQJWKHGU\VHDVRQDVCathartes
aura, which appears to be a secondary predator of caiman nests.
283 Why birds are common around caiman
nests in Central Amazonia?
Boris Marioni1*, Carolina Bertsch1, Ronis Da Silveira2
285 Efeito imediato da captura sobre a abundância
relativa de aves na caatinga
ǢW29ধ;<;3-!+!<TǣW2-='89-&!&'
'&'8!£&31!A32!9l
m
Clarisse O. Silva1*, Pedro T. S. M. Moura1, Leonardo F. F. Frana1
r#1!8-32-|1!$W$31
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
r$£!8-99'$3W9-£=!|+1!-£W$31
In Piagaçu-Purus Reserve (PP-SDR), central Amazonia,
FRQWLJXLW\EHWZHHQKLJKODQGVDQGćRRGSODLQVRIIHUYDULRXV
habitats for a vast variety of avian species. During surveys of
caiman nests predators, we evaluated if nests, an indicator
of habitat quality, work as an attractor for birds. We used 25
camera-traps installed between 11 and 54 days during two
nesting seasons (2013-2014) in 10 and 15 nests, respectively
each year. A total of 14 bird species were photographed in
27 independent occasions through 103 events. The number
of species recorded in each nest varied from none to three.
Cathartes aura was the most frequent (23%) species of bird
Page 176, Posters
Mudanças comportamentais podem alterar a percepção
sobre a abundância das aves. Entender o papel de repostas
comportamentais na abundância possibilita que sejam evitados
vieses em estudos populacionais. Objetivamos avaliar se
o número de capturas de aves com redes de neblina difere
entre o primeiro e demais dias de amostragens. Realizamos o
HVWXGRQD(6(&6HULGµ|èH|è:£UHDVRELQćX¬QFLD
de clima semiárido. Estabelecemos uma área de 63 ha, que
recebeu 96 redes de neblina (18 x 3 m). Realizamos a coleta
de dados em três expedições (exp1, exp2 e exp3), sendo duas
{փdփTT
ID t
ABSTRACT
t
durante estações secas e uma chuvosa, respectivamente.
Em cada expedição monitoramos a área por seis dias (cinco
KRUDVGLDHDVDYHVFDSWXUDGDVIRUDPLQGLYLGXDOL]DGDVFRP
anilhas e liberadas. Utilizamos o Teste t para duas amostras
independentes no programa Bioestat (versão 5.3). Obtivemos
3.577 registros de aves durante as três expedições, sendo 424
indivíduos durante a primeira expedição, 506 na segunda e
QDWHUFHLUD2Q¼PHURGHUHJLVWURVIRLVLJQLĆFDWLYDPHQWH
maior no primeiro dia de coleta do que nos demais dias
durante a seca (exp1, t22;p<0,05=5,7553, p<0,001; exp2,
WS SPDVQ¥RIRLVLJQLĆFDWLYDPHQWH
diferente o período chuvoso (t16;p<0,05=-0,1213, p=0,45).
$GLIHUHQ©DVLJQLĆFDWLYDGXUDQWHDVHVWD©·HVVHFDVIRLXP
forte indício de que existiu um comportamento das Aves
para evitar uma nova captura, o qual não ocorreu durante
RSHU¯RGRFKXYRVRSRVV¯YHOTXHHVWHSDGU¥RVHMDUHćH[R
da maior atividade das espécies no período chuvoso. Desse
modo, novas avaliações de variação na abundância de Aves da
Caatinga devem antes lidar com esta questão comportamental.
ID t
ABSTRACT
t
Table of Contents
necessárias para minimizar o tempo e os recursos gastos. O
presente trabalho teve como objetivos confeccionar uma lista
e avaliar a riqueza de espécies de aves utilizando a metodologia
das Listas de Mackinnon associada a estimadores de riqueza na
região do Rio Itaguaré, no município de Bertioga, SP. Foram
realizadas
campanhas nos três principais
ecossistemas da região: restinga, estuário e praia, totalizando
9 km de amostragem. Foram registradas 76 espécies, sendo
14 endêmicas. A estimativa de riqueza para a região foi de 123
± 6 espécies, bem acima do número de espécies encontradas.
$PHWRGRORJLDGDV/LVWDVGH0DFNLQQRQbFDUDFWHUL]RXVH
como de fácil execução para estudos rápidos áreas tropicais,
SULQFLSDOPHQWHSRUSHUPLWLUSDXVDVSDUDLGHQWLĆFD©¥RGDV
espécies em campo. Apesar disso, aconselhamos o uso desta
metodologia associada a estimadores de riqueza que permitem
inferir a necessidade ou não de mais estudos para a elaboração
de levantamentos de aves mais completos. Na região de
estudo, seria necessária a ampliação da área de amostragem
para uma melhor caracterização da riqueza de aves.
286 O uso das Listas de MackInnon em avaliações ecológicas
U£SLGDVGHDYHVXPHVWXGRGHFDVRQDćRUHVWD$WO¤QWLFD
Pedro V. R. Martins1*, Francisco S C Buchmann2, Cesar Cestari3
ǢWTǣWfTǤWf-3£!83
r6'&83=8-1!|+1!-£W$31
Apesar da alta biodiversidade e taxa de endemismo de aves, a
ćRUHVWD$WO¤QWLFDWHPVLGRFRQWLQXDPHQWHGHVPDWDGD'HVWD
IRUPDDYDOLD©·HVHFROµJLFDVTXHVHMDPU£SLGDVHHĆFLHQWHVV¥R
Page 177, Posters
{փdփTT
ID t
ABSTRACT
t
289 3DOHRGLVWULEXL©¥RHHVWLPDWLYDGHGLYHUJ¬QFLDGH
populações de Pipridae apontam conexões espaçoWHPSRUDLVHQWUHćRUHVWD$WO¤QWLFDH$PD]¶QLFD
Helder Araujo1*, Nayla Nascimento1, Bruno
Xavier1, Carlos Agne4, Erich Mariano5
ǢW2-='89-&!&'
'&'8!£&!!8!Ð#!TǥW9;<&391#-'2;!-9T
ǦW2-='89-&!&'
'&'8!£&'!16-2!8!2&'
r,'£&'8|$$!W<(6#W#8
$GLYHUJ¬QFLDGHW£[RQVHQWUHDVćRUHVWDV$PD]¶QLFDH
$WO¤QWLFDVXJHUHGXDVFRQH[·HVKLVWµULFDVHQWUHHVVDVćRUHVWDV
uma no Mioceno e outra no Quaternário. É proposto, com
dados de palinofósseis, que essa última conexão ocorreu
HQWUHR3OHLVWRFHQR+RORFHQRSRUPHLRGHGXDVURWDVXPD
litorânea e outra pelo interior do nordeste brasileiro, via matas
ciliares. Pipridae possui membros com populações disjuntas
HQWUHćRUHVWD$WO¤QWLFDQRUGHVWLQDHD$PD]¶QLD&RPLVVR
integramos dados de paleomodelagens de distribuição de
Chiroxiphia pareola, Dixiphia pipra e Ceratopipra rubrocapilla,
estimativa de tempo de divergências moleculares nas duas
primeiras espécies, dados de distribuição atual de outros táxons
e palinofósseis para avaliar as propostas espaço-temporais
de conexão. A estimativa média de tempo de divergência
entre as populações disjuntas foi de 144 e 126 mia e uma
cladogênese anterior foi de 248 mia. Entre esses períodos,
fases úmidas no nordeste são suportadas por espeliotemas e
travertinos. A distribuição potencial das três espécies a 130
mia aponta uma probabilidade climática de conexão próxima
ao litoral norte da região, bem como manchas mais ao sul.
Page 178, Posters
ID t
ABSTRACT
t
Table of Contents
Embora possa ter existido probabilidade climática próximo
ao litoral norte, não suportamos essa conexão com base na
ausência atual das três espécies em ambientes potenciais na
região (Baturité) e na ocorrência de outros piprídeos nesses
ambientes. Com isso sugerimos uma conexão pleistocênica
HQWUHDVćRUHVWDVHPXPSHU¯RGRHQWUHHPLDH
por rotas de matas ciliares atualmente situadas em regiões
próximas ao rio São Francisco e Chapada Diamantina.
290 Social interactions and foraging behaviour of Cyanocorax
cyanopogon H[SRVHGWRDUWLĆFLDOSUHGDWRUV
M.C. Beiriz1*, L.R.S. Zanette1, L.A.M. Mestre2
ǢW
'&'8!£2-='89-;@3('!8ÆTǣW
'&'8!£2-='89-;@3(!8!2Æ
r$!83£-2!#'-8-A|+1!-£W$31
We describe the behaviour of White-naped jays (Cyanocorax
cyanopogonGXULQJDQH[SHULPHQWZLWKIHHGHUVDQGDQDUWLĆFLDO
predator. Our main goal was to understand how groups of
White-naped jays use habitats where the risk of predation
is high. From September 2014 to March 2015 we observed
8 groups of jays (30 individuals) in feeders set at the Nature
Reserve of Pedra dos Ventos Hotel, in Quixadá- Ceará, Brazil.
:HSODFHGHLJKWDUWLĆFLDOIHHGHUVDSODVWLFWUD\[[FP
in patches where groups of jays had been previously found.
Each feeder was covered with a 100g of seeds mixed with 1Kg
of sand. In order to observe the reaction of jays to predators
near the feeders, we set a plastic snake 5m apart from feeder
in three patches, 10 minutes after the jays arrived at the
feeder. In 62.5% of all the groups observed the sentinel left
{փdփTT
ID t
ABSTRACT
t
its position in the tree and joined the group feeding. In all the
SDWFKHVZLWKWKHDUWLĆFLDOVQDNHWKHMD\VDEDQGRQHGWKHIHHGHU
and gave an alarm call . In one of three groups with snakes the
jays never returned after the snake had been removed. We
observed direct aggressions (pecks) and harassment between
the members of a group of six individuals that visited the
feeder without the snake exposed. We also observed that
some members of a group had priority in accessing feeders,
which suggests a dominance hierarchy. We also recorded
food sharing indicating the establishment of social alliances,
as reported for other corvids. Our initial data suggest that
associations of jays may be a strategy to reduce the risk of
predation. Future work will focus on accessing habitat quality
and foraging behaviour of jays using giving-up density.
ID t
ABSTRACT
t
Table of Contents
by circumnavigating 70 lakes along 1,000km of Amazon
5LYHUćRRGSODLQV7RWHVWWKHVHK\SRWKHVHVDQRQPHWULF
multiple-dimensional scaling ordination complemented by
multiple linear models was used to determine relationships
between bird richness and assemblage composition, and
biotic and abiotic lake characteristics. At a local scale, lake
VKDSHZDWHUWUDQVSDUHQF\DQGWURSKLFVWDWXVLQćXHQFHELUG
assemblages. At a regional scale, differences among sites in
water body richness, produced by Amazon River tributaries,
and the two water types, are determinants of variation in
composition of waterbird assemblages. The results indicate
that waterbirds assemblage composition within Amazonian
ćRRGSODLQVGRHVUHVXOWIURPOLQNVLQSURFHVVHVRSHUDWLQJDW
ERWKVSDWLDOVFDOHVDVSUHGLFWHGE\QHXWUDOWKHRU\RILQćXHQFHG
by local ecological factors as predicted by niche theory.
291 Spatial distribution and composition of waterbirds in
relation to limnological conditions in the Amazon basin
Renato Cintra
8$-2;8!93!8'9|+1!-£W$31
The main hypothesis is that waterbird richness in Amazonian
lakes differs between white-and black-waters, and has
gradients in species composition relating to lake-to-lake
differences in shape, depth, water transparency, habitat
richness, and productivity. I tested a complementary
hypothesis that bird assemblages respond to variations in
lake characteristics over a regional scale, and to neighboring
aquatic components, called water body richness, including
rivers, channels, and ponds. Bird surveys were conducted
Page 179, Posters
292 The importance of inter-habitat characteristics on gap-
crossing decisions of a bird in the Atlantic Forest hotspot
Amanda Navegantes1*, Renato Crouzeilles1, Henrique
Rajo2, Rui Cerqueira1, Maria Lucia Lorini3
ǢW2-='89-&!&'
'&'8!£&3-3&'!2'-83f
TǣW32ধ($-!
2-='89-&!&'!;£-$!&3-3&'!2'-83ff-3TǤW2-='89-&!&'
'&'8!£&39;!&3&3-3&'!2'-83f
r!1!2&!i2!='+!2;'9|,3;1!-£W$31
7KHUHVSRQVHRILQGLYLGXDOVWRKDELWDWFRQĆJXUDWLRQDQG
their ability to cross inter-habitat gaps are vital to enhance
population persistence through functional connectivity.
Here, we quantify the effects of inter-habitat distance, matrix
{փdփTT
ID t
ABSTRACT
t
ID t
type and stepping stones on the gap-crossing probability for
Formicivora littoralis, an endangered species of the Atlantic
Forest. We hypothesized that gap-crossing probability i) is
negatively related to the distance between habitat patches,
ii) is positively related to the presence of stepping stones and
iii) is affected differently by the matrix type. We compared
gap-crossing movements within six different matrix conditions
(herbaceous and non-vegetated with or without stepping
stones, unpaved and paved roads). We used playback to
stimulate individuals to cross these different matrices between
153 pairs of habitat patches at Restinga de Massambaba, Rio de
Janeiro, Brazil. Inter-habitat distance, matrix type and stepping
stones strongly affected gap-crossing probability for F. littoralis.
As expected, the success in crossing gaps was negatively related
to the distance between habitat patches, positively related
to the presence of stepping stones, and differently affected
by the matrix type. Gap-crossing movements were more
frequent and wider in matrices with than without stepping
VWRQHVLQGHSHQGHQWRIWKHVSHFLĆFPDWUL[W\SH6WHSSLQJ
stones reduced the distance between habitat patches and
increased the similarity between matrix and habitat patches,
consequently increasing functional connectivity. We suggest
that stepping stones can enhance matrix permeability to gapcrossing movements of F. littoralis more than matrix type alone.
293 Population structuring analyses provide guidelines
Page 180, Posters
ABSTRACT
t
Table of Contents
for captive breeding and reintroductions of the
endangered Aburria jacutinga (Cracidae)
Mercival Francisco1*, Paulo R.R. Oliveira-Jr.1,
Mariellen C. Costa1, Luis F. Silveira2
ǢW2-='89-&!&'
'&'8!£&'3!8£39T$!16<9&'383$!#!TǣW'3
&'='9T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3
r1'8$-=!£|<(9$!8W#8
The survival of many species has relied on captive breeding
and reintroduction into the wild. As captive populations
are often small, a major concern of managers is maintaining
their genetic integrity. To tackle this problem, the maximum
genetic variability should be preserved within and between
populations during the captive stage of conservation plans.
Then, understanding the levels of population structuring
and levels of genetic variability within the different lineages
provide important guidelines for management. Because
of its conservation status, a successful captive breeding
program for the Black-fronted Piping-guan, Aburria jacutinga,
has started in the decade of 1980. Here we investigate
levels of genetic structuring between and levels of genetic
variability within the three the aviaries that compose the
original genetic repositories of captive Jacutingas: Tropicus;
&(633DUDLEXQDDQG*XDUDWXEDXVLQJQLQHPLFURVDWHOOLWH
loci. Bayesian clustering analyses revealed that that CESP
lineage diverged from Tropicus and Guaratuba, but no
inbreeding has been detected within these aviaries. Then,
we propose three main management guidelines: i) as far as
inbreeding can be avoided within these captive lineages,
{փdփTT
ID t
ABSTRACT
t
they should be managed separately to minimize adaptation
to captivity, ii) crossbreedings, however, are indicated for
pre-release generations. Then, pre-release pairs should be
formed and managed separately, and iii) reintroducing the
species in areas where it has been extinct is more prudent
than supplementing natural populations, as population
structuring in the wild is not known and supplementations
could involve risks of disrupting local adaptive complexes.
294 $YHVGHVXEERVTXHHPXPD£UHDGHćRUHVWD
RPEUµĆODGHQVDQD$PD]¶QLD&HQWUDO
importância das unidades de conservação
Renata S. Oliveira1*, Edson Lopes2
ǢW
!$<£&!&'92;'+8!&!9&3!6!/9TǣW
r8'2!;!93<A!#-3|,3;1!-£W$31
Cerca de 1300 espécies de aves ocorrem na Amazônia, boa
parte endêmica deste bioma. Contudo, ainda há enormes
ODFXQDVQRFRQKHFLPHQWRFLHQW¯ĆFRGHVWDUHJL¥RHQTXDQWR
seus ecossistemas têm sido destruídos antes de conhecermos
sua biodiversidade. Nós estimamos a riqueza de aves de
VXEERVTXHHPXPD£UHDGHćRUHVWDSULP£ULDLQDOWHUDGD
da Floresta Nacional (Flona) do Tapajós, uma Unidade de
Conservação (UC) de uso sustentável na Amazônia central.
Realizamos amostragens com redes de neblina nos meses
GH-XQKRH6HWHPEURGH&RPXPWRWDOGHKRUDV
rede, capturamos 239 indivíduos de 50 espécies, distribuídas
em 23 famílias, o que representa 36,76% das espécies de
aves de sub-bosque já registradas para a UC em estudos
Page 181, Posters
ID t
ABSTRACT
t
Table of Contents
anteriores. Thamnophilidae (n=13) e Dendrocolaptidae (n=8)
foram as famílias mais representadas e as espécies mais
abundantes foram Glyphorynchus spirurus (n=34), Lepidothrix
iris (n=19) e Willisornis poecilinotus (n=15). A riqueza estimada
pelo Jackknife 1 foi 68,7 ± 9,3 e a curva acumulativa de
espécies não apresentou tendência a estabilização, indicando
que com maior esforço de campo mais espécies seriam
registradas. Algumas das espécies registradas possuem
distribuição relativamente restrita e várias pertencem a
grupos funcionais, tais como seguidores de bando misto e
VHJXLGRUHVGHIRUPLJDVGHFRUUHL©¥RFODVVLĆFDGDVHPRXWURV
estudos como afetadas negativamente por fatores como
IUDJPHQWD©¥RćRUHVWDOHRXFRUWHVHOHWLYRGHPDGHLUDHVWD
última, uma atividade desenvolvida na UC. Os resultados
deste estudo sugerem a condição preservada da área
estudada e a importância desta UC na manutenção de
populações de aves com interesse conservacionista.
295 Reciprocal vocal interactions between two sympatric
Laterallus species in the coast of the Río de la Plata
Emiliano A. Depino1*, Juan I. Areta1
ǢWf
r&'6-23'1-£-!23|+1!-£W$31
,QWHUVSHFLĆFUHVSRQVHVWRYRFDOL]DWLRQVEHWZHHQFRH[LVWLQJ
VSHFLHVPD\UHćHFWXQGHUO\LQJHFRORJLFDOLQWHUDFWLRQV:H
examined vocal interactions between sympatric Laterallus
leucopyrrhus and L. melanophaius in the coast of the Río de
la Plata, Buenos Aires, Argentina. These species occur in
{փdփTT
ID t
ABSTRACT
t
ID t
different but adjacent habitats with minor overlap and their
loudsongs (trills) are very similar. Hence we asked, how do
WKH\UHVSRQGWRKRPRDQGKHWHURVSHFLĆFSOD\EDFN":H
carried out 192 playback trials over a year, 96 in typical L.
leucopyrrhus habitat (Scirpus giganteus Bulrush) and 96 in
typical L. melanophaius habitat (Coastal Scrub). Each habitat
was sampled twice per season (once with playback of each
crake) during the four seasons. We placed 12 playback points
per habitat and recorded responses inside a 25m-radius.
3OD\EDFNUHVSRQVHVWRKRPRDQGKHWHURVSHFLĆFSOD\EDFNV
were statistically the same for both crakes (P-values>.05;
:LOFR[RQ0DWFKHG3DLUV7HVWV7KHVHLQWHUVSHFLĆFLQWHUDFWLRQV
VHHPWRLQGLFDWHLQWHUVSHFLĆFWHUULWRULDOLW\GXHWRDQ
incidental effect of similarities in vocalizations, or (2) an
DGDSWDWLRQWRUHGXFHLQWHUVSHFLĆFFRPSHWLWLRQEHWZHHQ
sympatric species with similar ecological characteristics.
Future studies should test these proposals by assessing
responses to homologous vocalizations with very different
sound characteristics, such as contact or aggressive calls,
and by measuring detailed variables in playback responses.
297 3UREOHPDVFRPSOXPDJHQVYHUGHROLYDGHI¬PHDV
Page 182, Posters
ABSTRACT
t
Table of Contents
adultas de Manacus manacus Chiroxiphia pareola, a
ELRPHWULDSRGHDX[LOLDUQDLGHQWLĆFD©¥RHPFDPSR
Juan Ruiz-Esparza1*, Daniela Pinheiro Bitencurti Ruiz-Esparza1,
Caroline Silva1, Patricio Adriano Rocha1, Stephen Francis Ferrari1
ǢW2-='89-&!&'
'&'8!£&''8+-6'
r/<!2$3£38!&3ǣǢ|,3;1!-£W$31
Diferenciar fêmeas ou machos de plumagens juvenis, em
algumas espécies de aves da família Pipridea, se torna
complicado por conta da semelhança e pela coexistência
destas espécies. O objetivo deste trabalho é apresentar
diferenças entre as medidas biométricas de fêmeas adultas
de Manacus manacus e Chiroxipia pareola para auxilio na
LGHQWLĆFD©¥RHPFDPSRDVVLPFRPRHVWLPDURWDPDQKRGD
área compartilhada por ambas as espécies. Os dados deste
estudo foram coletados em duas unidades de conservação
do estado de Sergipe (Refúgio de Vida Silvestre da Mata do
Junco e a Floresta Nacional do Ibura), através de campanhas
sistemáticas de três dias, entre os anos 2011 e 2013, nas quais
as aves foram capturadas utilizando redes de neblina. Foram
usadas as medidas de comprimento de asa, comprimento total
e massa corpórea das aves capturadas para indicar diferenças
estatísticas através de uma prova t. Através de programas de
imagem foi gerado um polígono da área que estas espécies
compartilham. As medidas de 81 fêmeas de M. manacus e
21 fêmeas de C. pareola foram analisadas, apresentando
GLIHUHQ©DVLJQLĆFDWLYDQRVSDU¤PHWURVWHVWDGRV$PEDVDV
espécies compartilham uma área de 420.680.498 ha, a qual
representa mais de 80% da área de distribuição de C. pareola.
{փdփTT
ID t
ABSTRACT
t
O valor da asa não apresentou sobreposição, por tanto se
VXJHUHRXVRGHVWHSDU¤PHWURSDUDDX[LOLDUQDLGHQWLĆFD©¥R
de fêmeas adultas de M. manacus e C. pareola em campo,
visto que elas podem ser encontradas na mesma área.
299 (VWUXWXUDĆORJHQ«WLFDGDVDVVHPEOHLDVGHDYHVGDFDDWLQJD
Erivelton R. Nascimento1*, Kelly Isadora de O. Correia2,
Juan Ruiz-Esparza3, Sidney F. Gouveia4
ǢW2-='89-&!&'
'&'8!£&''8+-6'
r'8-='£;32W<(9|+1!-£W$31
(VWXGRVĆORJHQ«WLFRVDVVRFLDGRVDSDGU·HVHVSDFLDLVGD
biodiversidade podem informar como a diversidade biológica
HYROXLXHVHRUJDQL]RXQRHVSD©RJHRJU£ĆFR$TXLLQYHVWLJDPRV
RSDGU¥RGHHVWUXWXUDĆORJHQ«WLFDGHDVVHPEOHLDVGHDYHV
ao longo da Caatinga. Reunimos 83 levantamentos de aves
GD&DDWLQJDHXWLOL]DPRVXPDĆORJHQLDFRPSOHWDGHVVDV
HVS«FLHVSDUDGHVFUHYHURSDGU¥RGHHVWUXWXUDĆORJHQ«WLFD
dessas assembleias. Usamos a métrica padronizada de
GLVW¤QFLDVĆORJHQ«WLFDVP«GLDVHQWUHSDUHVGHHVS«FLHVQDV
assembleias, NRI (Net Relatedness Index). Valores positivos
ou negativos apontam comunidades formadas por táxons
ĆORJHQHWLFDPHQWHSUµ[LPRVRXGLVWDQWHVUHVSHFWLYDPHQWH
Registramos 464 espécies nas assembleias, sendo seis
GHODVFRPGLVSHUV¥RĆORJHQ«WLFDVLJQLĆFDWLYDGLVWULEX¯GDV
próximas à zona de transição com a Amazônia. Apenas uma
DVVHPEOHLDWHYHHVWUXWXUDĆORJHQ«WLFDVLJQLĆFDWLYDPHQWH
agrupada. As demais assembleias não apresentaram estrutura
VLJQLĆFDWLYDDSUHVHQWDQGRSRUWDQWRSDGU¥RDOHDWµULR$
Page 183, Posters
ID t
ABSTRACT
t
Table of Contents
organização das assembleias de aves da Caatinga parece
responder predominantemente a processos estocásticos, mas
WDPE«PK£LQćX¬QFLDGHFRPSHWL©¥RQRSDVVDGRLPSHGLQGRD
coexistência de espécies intimamente relacionadas por meio
da exclusão competitiva e, em menor proporção, do efeito de
ĆOWURVDPELHQWDLVVREUHRVFODGRVGLVWULEX¯GRVUHJLRQDOPHQWH
As assembleias de aves da Caatinga parecem resultar de uma
interação complexa de diferentes processos ecológicos ao
longo da história do bioma. Essas informações podem subsidiar
a conservação da diferentes aspectos da biodiversidade, bem
como o entendimento da história evolutiva do grupo na região.
300 3ROLPRUĆVPRGHSOXPDJHPHPCnemotriccus fuscatus
(Wied, 1831) não está associado com mutações
do receptor de melanocortina-1 (MC1R)
Sandriellem N. Vieira1*, Juliana Araripe1, Alexandre Aleixo2, Pricles Rgo1
ǢW2-='89-&!&'
'&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r9!2&8-'££'1W=-'-8!|+1!-£W$31
O passeriforme Cnemotriccus fuscatus é uma ave neotropical
considerado politípica, possuindo atualmente sete subespécies,
caracterizadas por colorações diferentes de plumagem,
variando entre tons de branco, amarelo, cinza e amarronzado.
Apesar de estudos comprovarem a ligação da genética com
a variação da coloração, seu entendimento em espécies
selvagens ainda é escasso. Dentre os marcadores genéticos
utilizados para entender o processo de mudanças de coloração
em aves, destaca-se o gene receptor de melanocortina-1
(MC1R), o qual tem demonstrado casos de associação à
{փdփTT
ID t
ABSTRACT
t
YDULD©¥RGHFRORUD©¥RLQWHUHLQWUDHVSHF¯ĆFDFRPPXWD©·HV
não-sinônimas. Objetivando saber se este gene está associado
à variação de coloração da plumagem em C. fuscatus, esta
pesquisa foi realizada com três subespécies de C. fuscatus: C.
f. duidae (ventre amarelo e garganta amarelo-alaranjado); C. f.
bimaculatus (ventre branco e peito cinza acastanhado); e C. f.
fumosus (ventre amarelo claro e peito com tom amarronzado).
Foi sequenciado um fragmento do MC1R de 695 pares de bases
para cada indivíduo, o qual inclui todos os sítios conhecidos por
atuar na mudança de pigmentação em outros grupos de aves.
Foram encontrados sete sítios heterozigotos nos indivíduos, dos
TXDLVDSHQDVXPUHVXOWRXHPYDULD©¥RSDUDFRGLĆFD©¥RQ¥R
sinônima. No entanto, nenhuma variação mostrou associação
com os padrões de coloração das subespécies estudadas.
Assim, observa-se que mudanças na sequência de nucleotídeos
GHVWHJHQHQ¥RDOWHUDPRSROLPRUĆVPRGDSOXPDJHP
encontrado em C. fuscatus, sendo necessária a investigação
de outros genes ou fatores regulatórios que possam explicar
os padrões de pigmentação nesta espécie de ave.
301 Incidence of progressive greying in the
3ODLQćDQNHG5DLORallus wetmorei)
Adriana Rodrguez-Ferraro1*, Adriana Rojas2, Miguel Lentino3
ǢW2-='89-&!&-1Õ23£Ð=!8TǣW2-='89-&!&'2;8!£&'
'2'A<'£!TǤW
<2&!$-2-££-!1,'£69
ID t
ABSTRACT
t
Table of Contents
with progressive greying exhibit only a few white feathers on
early stages, but the amount of white feathers increases after
every moult cycle, retaining the color in the eyes, bill, and legs.
The objective of this study was to describe the incidence of
SURJUHVVLYHJUH\LQJLQWKH3ODLQćDQNHG5DLORallus wetmorei),
an endemic and threatened species restricted to northwestern
Venezuela, which exhibit two color morphs: dark and pale.
We conducted observations and captured rails at 5 localities
and examined 18 museum specimens, recording the part of
the body with white feathers and the extent of progressive
greying. We recorded progressive greying only in dark morph
individuals: 4 captured and 5 observed. The amount of white
feathers varied considerably among individuals, ranging
from a few small feathers to extensive progressive greying.
Wild individuals with progressive graying were recorded at
ĆYHORFDOLWLHVEXWRQO\RQHPXVHXPVSHFLPHQDSDOHPRUSK
has white feathers. This individual was collected in a sixth
locality, where the species is locally extinct because of habitat
destruction. Our results indicate that progressive greying
RFFXUVDWVL[ORFDOLWLHVZKHUHWKH3ODLQćDQNHG5DLOKDVEHHQ
reported, and affects both morphs, although currently seems
more common on dark morph individuals. We did not observe
DJJUHVVLRQIURPFRQVSHFLĆFVWRZDUGFRORUDEHUUDQWUDLOVDQG
all individuals showing progressive graying paired with normal
plumage rails, and for two of them we had evidence of breeding.
r83&8-+<'A!|<9#W='
Progressive greying is a recently described color aberration,
which consists in the progressive loss of pigment with age. Birds
Page 184, Posters
{փdփTT
ID t
ABSTRACT
t
302 (VWXGRĆORJHRJU£ĆFRGHLepidothrix nattereri (Aves:
Passeriformes) baseado em dados moleculares
Keila Lima1*, Cleyssian Dias1, Juliana Araripe1,
Alexandre Aleixo2, Pricles Rgo1
ǢW2-='89-&!&'
'&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r0'-£!£-1!Ǩǡ|+1!-£W$31
A espécie Lepidothrix nattereri é um passeriforme neotropical
pertencente à família Pipridae, distribuído em parte do bioma
Amazônico. Atualmente são descritas duas subespécies (L.
n. nattereri e L. n. gracillis) distintas com base em caracteres
morfológicos e por área de ocorrência. A possibilidade de
estes táxons serem espécies válidas motivou a realização deste
trabalho que visa aplicar análises moleculares baseadas em
sequenciamento de genes mitocondriais numa abordagem
ĆORJHRJU£ĆFD)RUDPDQDOLVDGRVH[HPSODUHVGDHVS«FLH
distribuídos em 25 pontos de coleta de quatro Estados da
Amazônia brasileira, abrangendo a área descrita para as duas
subespécies, sendo 30 exemplares para L. n. nattereri e 23 para
L. n. gracillis$Q£OLVHVĆORJHQ«WLFDVPRVWUDUDPRPRQRĆOHWLVPR
da espécie e a presença de dois grupos ligeiramente distintos,
também evidenciados pelas redes de haplótipos. Os resultados
obtidos não apoiam a divisão das duas subespécies como
sugerido na literatura, visto que os exemplares dos dois
grupos encontrados não coincidem com a distribuição para as
subespécies. Os dois grupos apresentam uma área de simpatria
próxima à região do Rio Madeira. Algumas hipóteses podem
ser levantadas para explicar este padrão: contato secundário
entre populações anteriormente separadas (áreas de refúgios);
Page 185, Posters
ID t
ABSTRACT
t
Table of Contents
eventos de hibridização e introgressão com outra espécie
do gênero Lepidothrix ( L. coronata – grupo exquisita pelo Rio
Madeira e L. iris eucephala pelo estreito do Rio Tapajós).
306 $Q£OLVHĆORJHRJU£ĆFDGRFRPSOH[RLepidothrix iris/
nattereri/vilasboasi (Aves, Passeriformes), ressalta
a necessidade de revisão taxonômica
Cleyssian N. P. Dias1*, Keila A. Lima1, Juliana
Araripe1, Alexandre Aleixo2, Pricles S. Rgo1
ǢW2-='89-&!&'
'&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&-
Após ter sido considerada como extinta por mais de 50
anos, Lepidothrix vilasboasiWHYHVXDYDOLGDGHFRQĆUPDGD
por caracteres morfológicos, apesar das suspeitas de que
este táxon poderia ser resultado de hibridização entre duas
espécies do mesmo gênero (L. iris e L. nattereri). Desde então,
nenhum estudo envolvendo estes táxons foi publicado
EXVFDQGRFRQĆUPDURVGDGRVPRUIROµJLFRV1HVWHFRQWH[WR
a genética molecular tem se mostrado uma ferramenta
HĆFLHQWHSDUDDUHVROX©¥RWD[RQ¶PLFDGHHVS«FLHVVRE
suspeita de hibridização. O presente estudo teve como
REMHWLYRFRQĆUPDURPRQRĆOHWLVPRHHVWDEHOHFHUDVUHOD©·HV
ĆORJHQ«WLFDVHQWUHDVWU¬VHVS«FLHVGHLepidothrix, fazendo
uso de sequenciamento dos marcadores moleculares ND2,
COI (mitocondriais) e Mioglobina (nuclear). Os resultados
preliminares indicam que L. vilasboasi compartilha vários
haplótipos (mitocondriais e nucleares) com indivíduos de
L. iris pertencentes a subespécie eucephala. Os marcadores
mitocondriais indicam uma separação clara entre os indivíduos
{փdփTT
ID t
ABSTRACT
t
das subespécies L. iris eucephala e L. iris iris, sendo a última
mais proximamente relacionada com a espécie L. nattereri,
mas como grupos independentes. Os marcadores nucleares
mostraram-se conservados dentro do gênero, não sendo
possível encontrar sítios que diferenciassem os táxons
abordados, nem evidências de processos de hibridização ou
introgressão envolvendo L. vilasboasi. Os dados obtidos até o
momento ressaltam a necessidade de revisão taxonômica para
L. iris, uma vez que as duas subespécies não formam um grupo
PRQRĆO«WLFRDO«PGHPRVWUDUDQHFHVVLGDGHGHPDLVHVWXGRV
para compreender a história evolutiva que envolve L. vilasboasi.
308 Análisis comparativo de imágenes obtenidas
por micro tomógrafo y diafanización para la
descripción morfológica de siringes
Natlia S. Porzio1*, Adolpho H. Augustin1, Carla S. Fontana1
ǢW32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£
ID t
ABSTRACT
t
Table of Contents
descripciones anatómicas. Como parte del diseño experimental
de uno proyecto que involucra el análisis morfológico de la
siringe y pico, correlacionando estos aspectos con la estructura
del canto de tres especies simpátricas de Sporophila (S.
hypoxantha, S. beltoni y S. caerulescens) empezamos a comparar
los resultados de obtención de imágenes utilizando las dos
técnicas: diafanizacíon y microtomógrafía. En la diafanización,
XWLOL]DPRVHOSURFHVRTXHGH7D\ORU\9DQ'\NHPRGLĆFDGR
Las siringes utilizadas están en la colección ornitológica del
Museo de Ciencias e Tecnología da PUCRS. Hasta ahora, las
imágenes generadas por Skyscan (3D) permiten la visualización
de estructuras más exactas para el análisis de datos. Además,
esta técnica posibilita el uso de contrastes para indicar
estructuras óseas o tejido blando permitiendo una descripción
morfológica más precisa. A pesar del alto costo para compra y
mantenimiento del equipo, consideramos que el Skyscan es una
herramienta importante para el estudio morfológico descrito.
r2!ধ638A-3|,3;1!-£W$31
La diversidad morfológica de las siringes es utilizada tanto
para el reconocimiento de grandes grupos de aves, como
SDUDODFODVLĆFDFLµQGHORVWD[D/DGHVFULSFLµQPRUIROµJLFD
GHODVLULQJHHVUHOHYDQWHSDUDHVWXGLRVĆORJHQ«WLFRV\HFR
morfológicos. En general se utiliza el método de diafanizacíon
y observación en lupa para el análisis descriptivo de la siringe.
Durante el preparo del material, estructuras pequeñas
pueden ser dañadas; además, la percepción de las mismas
depende de la capacidad del observador. Recientemente la
utilización do microtomógrafo de rayos x (Skyscan) posibilita
el procesamiento de imágenes de mejor calidad para efectuar
Page 186, Posters
309 Avifauna de um Remanescente Florestal de
Ecótono entre Cerrado e Mata Atlântica na
Região Metropolitana de Belo Horizonte
Tulaci B. F. Duarte1*, Joo C C Pena2, Marcos Rodrigues2
ǢW2-='89-&!&'
'&'8!£&'<838';3TǣW2-='89-&!&'
'&'8!£&'-2!9'8!-9
r;<£!$-#,!0ধ|@!,33W$31W#8
A fragmentação de habitat é um dos maiores responsáveis pela
redução de espécies no mundo. Com o intuito de se conhecer a
riqueza de aves, já que são consideradas como bons indicadores
ecológicos, realizou-se um levantamento da avifauna na Mata
{փdփTT
ID t
ABSTRACT
t
do Isidoro. A mata, também conhecida como Granja Werneck,
localizada na região norte de Belo Horizonte, capital de
Minas Gerais, representa um ecótono entre cerrado e mata
Atlântica e é um dos últimos grandes fragmentos de vegetação
relativamente preservados do município. Foram encontradas
106 espécies de aves, distribuídas em 35 famílias, incluindo o
cuitelão Jacamaralcyon tridactyla (Vieillot, 1817) espécie que
consta na lista de aves ameaçadas pela União Internacional
para a Conservação da Natureza, além de representantes
endêmicos de ambos os biomas, como os da família Pipridae:
soldadinho Antilophia galeata (Lichtenstein, 1823) e o
tangarazinho Ilicura militaris6KDZ1RGGHU9HULĆFRX
se que a região ainda precisa de estudos mais aprofundados
para melhor direcionar as futuras intervenções antrópicas.
312 $YHVGHćRUHVWDVVHFDVQRQRUGHVWH
brasileiro: revisando suas origens
Helder Araujo1*, Erich Mariano2
ǢW2-='89-&!&'
'&'8!£&!!8!Ð#!TǣW2-='89-&!&'
'&'8!£&'!16-2!8!2&'
ID t
ABSTRACT
t
Table of Contents
HĆORJHQLDVPROHFXODUHVGHHVS«FLHVHQG¬PLFDVHW¯SLFDV
dos ambientes deciduais, bem como integramos com dados
de palinofósseis, fósseis de mamíferos, paleomodelagens e
dados de travertinos e espeliotemas. Com isso, sugerimos que
GLYHUVLĆFD©¥RGHW£[RQVGHDYHVQD&DDWLQJDRFRUUHXGHVGHR
Mioceno Inferior ao Pleistoceno Superior. Modelos alopátricos,
parapátricos ou dispersão com posterior especiação podem
VHUH[HPSOLĆFDGRVHPGLIHUHQWHVW£[RQVHGLVWLQWRVPRPHQWRV
dessa história. Desse modo, podem ser falseadas hipóteses
clássicas sobre a origem recente da fauna que ocorre na
Caatinga. Ainda, existem endemismos na região associados
WDQWRD£UHDVDEHUWDVHRXDUEXVWLYDVFRPRDćRUHVWDVVHFDV
propriamente ditas. Portanto, sugerimos que o mosaico de
£UHDVDEHUWDVHćRUHVWDLV«DQWLJRQDUHJL¥RHDSRQWDPRV
DLQGDTXHDVKLVWµULDVGRVW£[RQVDVVRFLDGRVDVćRUHVWDVVHFDV
estão relacionadas com linhagens amazônicas (eg. Hylopezus e
Xiphocolaptes). Já táxons associados à vegetação aberta estão
relacionados com linhagens da “Diagonal Seca” e, quando
ocorrem na Amazônia, habitam vegetação aberta, ribeirinha,
bordas de mata ou clareira (eg. Myrmorchilus e Stigmatura).
r,'£&'8|$$!W<(6#W#8
$&DDWLQJD«DSRQWDGDFRPRXPQ¼FOHRGHćRUHVWDVVHFDV
da América do Sul, disjunto de outras áreas na Argentina,
Bolívia, Peru, Equador, Colômbia e Venezuela. A região já
foi reconhecida como uma importante área de endemismo
de aves, no entanto, foram realizados poucos estudos sobre
HYROX©¥RGLYHUVLĆFD©¥RHGLVWULEXL©¥RGDVHVS«FLHVDVVRFLDGDV
&RPRREMHWLYRGHFRQVWUXLUKLSµWHVHVGHGLYHUVLĆFD©¥RGD
avifauna na Caatinga, nós revisamos padrões de distribuição
Page 187, Posters
317 )DWRUHVTXHLQćXHQFLDPQDHVFROKDGHFDYLGDGHVQLQKR
pela Pyrrhura HQG¬PLFDGRQRUGHVWHEUDVLOHLUR
Ceclia Luna1*, Fbio Nunes1, Lorenzo Zanette1, Luiz Mestre2
ǢW2-='89-&!&'
'&'8!£&3'!8ÆTǣW2-='89-&!&'
'&'8!£&3!8!2Æ
r£-$!8-!3$£#£|+1!-£W$31
Pyrrhura griseipectus, RSHULTXLWRFDUDVXMD«FODVVLĆFDGR
pela IUCN como em perigo crítico de extinção. É endêmico
do Ceará, Brasil, de biologia ainda pouco conhecida com
{փdփTT
ID t
ABSTRACT
t
ID t
sua maior população residente no Maciço de Baturité. O
objetivo deste trabalho foi determinar quais características
bióticas e abióticas podem interferir na escolha de cavidades
para reprodução. Por meio de busca ativa e entrevistas
locais foram encontradas 67 cavidades e selecionadas 36
VHQGRFODVVLĆFDGDVHPFRPRUHSURGXWLYDVQ TXDQGR
comprovado que ali houve eclosão de ovos e não reprodutivas
(n=21). P. griseipectus se apropria de cavidades pré-formadas
principalmente nas espécies de árvore Inga ingoides (33,3%)
e Albizia polycephala (20%). Foram analisadas as seguintes
variáveis das cavidades: a) altura, b) DAP, c) temperatura
externa, d) temperatura interna, e) umidade externa, f) umidade
interna, g) profundidade, h) diâmetro da entrada, i) entrada
do oco em formato circular, j) entrada do oco em formato de
ĆVVXUDOSUHVHQ©DGHGRVVHOHPD]LPXWH$VYDUL£YHLVTXH
DSUHVHQWDUDPGLIHUHQ©DVVLJQLĆFDWLYDVIRUDP(QWUDGDGR
oco de formato circular (GLM, D.D.=5.201, p=0.022, n=19) e
umidade interna (GLM, D.D.=5.544, p=0.018, n=25), sendo
as reprodutivas mais úmidas do que as não reprodutivas.
Tais resultados sugerem que as variáveis microclimáticas
podem ser importantes na escolha da cavidade a ser ocupada,
sendo necessárias condições ideais para a eclosão dos
ovos e manutenção da ninhada. A seleção de hábitat para
QLGLĆFD©¥RLQćXHQFLDGLUHWDPHQWHQRVXFHVVRUHSURGXWLYR
dos indivíduos, sendo o conhecimento destas variáveis um
fator chave na preservação de espécies ameaçadas.
318 3HUĆOSDUDVLW£ULRGHRupornis magnirostris apreendido
Page 188, Posters
ABSTRACT
t
Table of Contents
e recolhido pelo cetas/ibama no estado do Piauí
Renata Sousa Silva1*, Rodrigo Moraes1, Emille Sousa1, Amanda
Navegantes2, Simone Freire1, Shirliane Araujo Sousa3
ǢW2-='89-&!&'9;!&<!£&3-!<ÐfTǣW2-='89-&!&'
'&'8!£&3
-3&'!2'-83f
TǤW2-='89-&!&'
'&'8!£&3-!<Ðf
r8'£!@$!=-'-8!|#3£W$31W#8
As endoparasitoses que acometem a avifauna são de grande
LPSRUW¤QFLDSDUDDVD¼GHS¼EOLFDSRLVSRGHPVLJQLĆFDUR
agravamento de problemas econômicos, sociais, médicos
e ambientais, sobretudo nos países em desenvolvimento.
$JUDQGHGLYHUVLGDGHGHHVS«FLHVHQYROYLGDVQRWU£ĆFRGH
animais silvestres no Piauí é fator de risco para a disseminação
de inúmeros agentes zoonóticos no estado. Diante disso, este
WUDEDOKRWHYHFRPRREMHWLYRHVWDEHOHFHURSHUĆOSDUDVLW£ULR
de Rupornis magnirostris apreendido e recolhido pelo CETAS
do IBAMA-PI. No período de dezembro de 2014 a janeiro de
2015, foram necropsiados dois indivíduos Rupornis magnirostris,
e destes, um apresentou estruturas parasitárias. A necrópsia
foi realizada no Laboratório de Zoologia e Biologia Parasitária
(ZOOBP) na Universidade Estadual do Piauí (UESPI), os
órgãos foram separados individualmente em placas de Petri
contendo solução salina 0,85% de NaCl e examinados em
microscópio estereoscópico e os nematódeos encontrados
IRUDPĆ[DGRVHP£OFRROTXHQWH1DDYHHPTXHVW¥R
foram encontrados sete indivíduos, os quais, cinco são machos
e dois são fêmeas, oriundas do esôfago e do estômago, os
quais pertencem ao gênero Contracaecum, pertencente à
superfamília Ascarididae e a família Anisakidae. Conclui-se que
{փdփTT
ID t
ABSTRACT
t
o presente estudo corrobora a hipótese de que os inquéritos
parasitológicos podem ser utilizados no entendimento das
relações aves-parasitos, trazendo informações sobre a
transmissão de doenças para as aves e para o homem.
321 Análises moleculares preliminares revelam separação
entre populações de Pipra fasciicauda scarlatina
(Hellmayr, 1915) do Nordeste e da Amazônia
Dnilson O. Ferraz1*, Larissa Sampaio de Souza1, Pablo Vieira
Cerqueira2, Juliana Araripe1, Alexandre Aleixo2, Pricles Sena do Rgo1
ǢW2-='89-&!&'
'&'8!£&3!8ÆTǣW<9'<!8!'29'1£-33'£&r#-3i('88!A|,3;1!-£W$31
A espécie Pipra fasciicauda ocorre na Amazônia Meridional
desde os Andes, Brasil Central, e isoladamente no nordeste
EUDVLOHLUR+DELWDPDWDVVHFDVPDWDVGHWHUUDĆUPHPDWDVGH
WUDQVL©¥RPDWDVGHJDOHULDHćRUHVWDVULEHLULQKDV$WXDOPHQWH
são reconhecidas cinco subespécies baseadas em caracteres
morfológicos. A compreensão da história evolutiva de
SRSXOD©·HVLVRODGDVSRGHFRQWULEXLUSDUDLGHQWLĆFD©¥RGH
SURFHVVRVGHHVSHFLD©¥RHPUHI¼JLRVćRUHVWDLV2SUHVHQWH
HVWXGRWHPFRPRREMHWLYRYHULĆFDURQ¯YHOGHGLYHUJ¬QFLDHQWUH
a população da Caatinga e populações que ocorrem no Bioma
Amazônico, por meio de marcadores moleculares. Foram
analisados um fragmento mitocondrial (ND2) e um nuclear
(G3PDH). Foram amostrados 12 exemplares da população
do Nordeste e 12 do bioma amazônico. Por meio da rede de
haplótipos, o marcador mitocondrial ressaltou a separação
entre as populações, o que não foi possível ser evidenciado
Page 189, Posters
ID t
ABSTRACT
t
Table of Contents
para o marcador nuclear, provavelmente por conta de sua taxa
evolutiva mais lenta. A divergência genética para o marcador
mitocondrial dentro das populações não ultrapassou 0.2% e
entre as populações foi de 0.9%. As análises até o presente
momento sugerem que as populações em questão estão em
processo de isolamento, uma vez que já é possível observar a
presença de haplótipos exclusivos no marcador mitocondrial.
Nesse sentido, os resultados apontam para a ocorrência de
uma subespécie independente no bioma Caatinga. Caso ocorra
DFRQĆUPD©¥RGRVGDGRVSUHOLPLQDUHVDSµVDLQVHU©¥RGH
novos marcadores, programas de conservação deverão ser
estimulados vistos o isolamento da população do Nordeste
e também devido à intensa degradação do seu habitat.
323 Experience-based nest-box and mate choice in the
white-rumped swallow Tachycineta leucorrhoa
Viviana Massoni1*, Carolina I. Mio2, Florencia Bulit
ǢW
@f2-='89-&!&&'<'239-8'9TǣW29ধ;<;3&'
-3£3+!<#;836-$!£Tf
r1!9932-|'+'W($'2W<#!W!8
1HVWVLWHDQGPDWHFKRLFHFDQSURIRXQGO\LQćXHQFHDQ
RUJDQLVPèVĆWQHVVDQGLQGLYLGXDOVRIVRPHQRUWKHUQ
hemisphere species use both self- and social information
to select nests and mates. To expand the knowledge on
southern hemisphere birds we explored the variables
associated to nest-box and mate choice in the White-rumped
Swallow Tachicyneta leucorrhoa using a nine years? dataset
on returning breeders at a colony located in Chascomús
(Buenos Aires, Argentina). Breeders presented moderate
{փdփTT
ID t
ABSTRACT
t
return rates (38.1%) and low local recruitment rates (4.1%).
Generalized linear mixed models revealed that, out of eight
variables examined, previous breeding performance and mate
UHWHQWLRQVLJQLĆFDQWO\H[SODLQHGYDULDWLRQLQQHVWER[DQG
mate-choice, although differently for sexes. Female’s reuse
RIDSDUWLFXODUER[ZDVVLJQLĆFDQWO\H[SODLQHGE\DVXFFHVVIXO
previous breeding experience, while this variable did not
affect male’s choice. Nest-box retention alone was a good
predictor of mate choice variation in males, while females
would choose a mate already settled in a box, regardless
of their individual increase in breeding performance. We
suggest that box retention by females would be related to
maintaining social partners with good abilities as caregivers,
indirectly assessed through their box claiming competence.
325 Can exotic tree plantations preserve bird diversity
of native woodlands in Buenos Aires, Argentina?
Mariela Vernica Lacoretz1*, Sebastin Andrs
Torrella2, Gustavo Javier Fernndez1
ID t
ABSTRACT
t
Table of Contents
and they are the major native woodlands of the Buenos
Aires province; however, only a few remain. Even though the
talares face continuous deforestation, little is known about
the consequences of their replacement by exotic woodlands
on bird biodiversity. We conducted bird census at 52 points
in native and exotic woodlands (Pinus spp. and Eucalyptus
spp.). At each point where a bird census was made, we also
determined structure and composition of vegetation. Exotic
tree plantations showed a reduction in bird species richness of
at least 50%. Moreover, bird abundance and diversity in talares
was higher than in plantations. Community structure differed
mainly in the identity of the dominant species. Furthermore,
vegetation structure varies between types of woodland, being
exotic tree plantations taller and with different composition
of strata. This study shows that exotic tree plantations are
unsuitable to preserve bird diversity not only because these
woodlands differ in woody species composition but also in
structure. The results indicate that a high proportion of bird
species, formerly present in the region, are unable to adapt to
the exotic woodland resulting in large losses of bird species.
ǢW8<63&'$3£3+!@31638;!1-'2;3&'='9TfT2-='89-&!&
&'<'239-8'9fTǣW8<63&'9;<&-39&'-9;'1!9$3£+-$!9'2
1#-'2;'9+8$3£!9lmTT
T2-='89-&!&&'<'239-8'9
r1£!$38';A|'+'W($'2W<#!W!8
Argentina has become one of the countries with the highest
deforestation rate in recent years. Over the last century the
country has lost 70 percent of its native forests, leading to
large losses of biodiversity. The talares woodlands (Celtis
ehrenbergiana) belongs to Espinal ecoregion of Argentina
Page 190, Posters
{փdփTT
ID t
ABSTRACT
t
326 (VWUDW«JLDVGHIRUUDJHDPHQWRGHEHLMDćRUHV$YHV
Trochilidae) em relação à diversidade de recursos
ćRUDLVGHPalicourea rigida Kunth (Rubiaceae).
Carlos Henrique Nunes1*, Liliane Martins-Oliveira1, Renata
Leal-Marques1, Paulo Eugnio Alves Macedo Oliveira1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
ID t
ABSTRACT
t
Table of Contents
agonísticos. E. macroura foi a espécie mais agressiva e a resposta
“fuga” foi a mais frequente. Nos pontos com menos recursos,
$PD]LOLDĆPEULDWD foi a espécie mais agressiva. A distribuição
HVSDFLDOGHUHFXUVRVćRUDLVLQćXHQFLRXDGLYHUVLGDGHGH
EHLMDćRUHVTXHXWLOL]DUDPP. rigida, e o comportamento de
forrageamento e defesa. Agradecimento: FAPEMIG.
r,'28-7<'#-3<(<|@!,33W$31W#8
%HLMDćRUHVV¥RDYHVUHVWULWDV¢V$P«ULFDVVHQGRDVSULQFLSDLVD
H[SORUDUQ«FWDUćRUDO1RVVDKLSµWHVH«TXHRFRPSRUWDPHQWR
GRVEHLMDćRUHVVHU£LQćXHQFLDGRSHODGLVWULEXL©¥RHVSDFLDOGH
Palicourea rigida. O objetivo foi determinar como a distribuição
de P. rigidaLQćXHQFLDRFRPSRUWDPHQWRGHEHLMDćRUHV2
trabalho foi realizado em uma RPPN de Uberlândia, MG de
QRYHPEURDMDQHLUR)RUDPHVWDEHOHFLGRVWU¬V
transectos com três pontos de amostragem abrangendo a
distribuição espacial de P. rigida. Foram registrados: espécie
YLVLWDQWHQ¼PHURGHćRUHVHLQćRUHVF¬QFLDVYLVLWDGDVWHPSRGH
forrageamento e ações agonísticas. Foram feitos 307 registros
GHRLWRHVS«FLHVGHEHLMDćRUHVEupetomena macroura foi a
mais frequente. Phaethornis pretrei exibiu as maiores médias
GRQ¼PHURGHćRUHVHLQćRUHVF¬QFLDVYLVLWDGDVUHJLVWUR2
tempo médio de defesa foi maior para E. macroura. Houve
correlação positiva entre o número de indivíduos de P. rigida,
YDORUFDOµULFRGLVSRQ¯YHOQ¼PHURGHćRUHVHPDQWHVHWHPSR
total de visitas, número de registros de visitantes e o tempo de
GHIHVD7DQWRRQ¼PHURGHćRUHVYLVLWDGDVTXDQWRRQ¼PHUR
de registros foram maior onde havia maior disponibilidade de
recursos. O número de encontros agonísticos foi maior nos
pontos com maior abundância de P. rígida, sendo 136 encontros
Page 191, Posters
328 $LQćX¬QFLDGDSURIXQGLGDGHGHODJRVQDDEXQG¤QFLDGHDYHV
piscívoras no Arquipélago de Anavilhanas, Amazônia Central
Renata Xavier1*, Renato Cintra1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f
r8'2!;!&!9-£=!?!=-'8|@!,33W$31W#8
A abundância de aves aquáticas depende das características
do habitat em uma escala local. Este é o primeiro estudo na
Amazônia brasileira que investigou como os atributos de
ODJRVGH£JXDSUHWDLQćXHQFLDPDYHVSLVF¯YRUDVHPQ¯YHO
SRSXODFLRQDO2REMHWLYRGHVWHWUDEDOKRIRLYHULĆFDURV
efeitos da profundidade de lagos sobre a abundância de aves
piscívoras. O estudo foi realizado em novembro-dezembro de
2007, em 45 lagos do Arquipélago de Anavilhanas, Rio Negro,
Amazônia Central. Foi utilizado um barco para percorrer cada
lago e fazer o levantamento das aves, bem como para coletar
os dados das profundidades dos lagos. As espécies Ardea cocoi,
Megaceryle torquata e Pandion haliaetus foram positivamente
correlacionadas com a profundidade, enquanto Egretta thula
esteve negativamente correlacionada. Ardea cocoi é maior
que Egretta thulaHVHEHQHĆFLDGHODJRVPDLVSURIXQGRV
porque consegue forragear em áreas mais profundas.
{փdփTT
ID t
ABSTRACT
t
Parece existir um limite de profundidade para espécies
SHUQDOWDVFRPRDVJDU©DVLQćXHQFLDGRSHORFRPSULPHQWR
das pernas. Pandion haliaetusVHEHQHĆFLDGHODJRVPDLRUHV
e mais profundos pois tende a concentrar a pesca em águas
abertas e no centro de lagos, onde a profundidade é maior.
Megaceryle torquata costuma pescar a partir de poleiros altos
e seleciona os lagos mais profundos porque requerem um
mínimo de água para pescar e não colidirem com o fundo.
Os resultados mostram claramente que as populações de
GLIHUHQWHVHVS«FLHVGHDYHVDTX£WLFDVV¥RLQćXHQFLDGDV
pela profundidade de lagos de água preta na Amazônia.
329 A meta-analysis of New World nest predators
Joo C. T. de Menezes1*, Miguel ngelo Marini2
ǢW'2;83&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&'8'9#-;'8-!2!
!$0'2A-'TǣW'6!8;!1'2;3&' 33£3+-!T2-='89-&!&'&'8!9£-!TǤW
r/3$!;'1'|+1!-£W$31
Predation is the primary cause of nest mortality and a powerful
selective agent in most New World bird species. Numerous
VWXGLHVKDYHWULHGWRĆQGIDFWRUVUHODWHGWRWKHSUH\èVQHVWLQJ
ELRORJ\WKDWFRXOGLQćXHQFHSUHGDWLRQUDWHVEXWIDLOHGWRUHDFK
a universally applicable consensus. It is increasingly suggested
that the approach should instead begin with the study of nest
predators. This study aims to compile a comprehensive list of
FRQĆUPHGQHVWSUHGDWRUVLQWKH1HZ:RUOG/LWHUDWXUHZDV
searched for records of nest predation detected by direct
observation or remote monitoring. A total of 248 species
belonging to 62 families were recorded depredating nests of
342 bird species in 19 countries. 51% of the predators were
Page 192, Posters
ID t
ABSTRACT
t
Table of Contents
birds, 30% mammals, 14% reptiles and 4% arthropods, notably
ants and crabs. 60% of all references mention events that took
place in the United States, causing this country’s predator
list to be the most numerous. Corvidae, Accipitridae, Laridae
and Ramphastidae accounted for most species of predators
among birds, Sciuridae and Cebidae among mammals, and
Colubridae among reptiles. Genera that depredated the nests
of most species (20 each) were Corvus, Larus, Molothrus,
Cyanocitta and Accipiter (birds), Cebus and Procyon (mammals),
and Pantherophis, Pituophis and Coluber (reptiles). Nutrition and
competition seem to be the major motivating factors behind
nest predation. This work will hopefully provide a valuable
basis for future studies and management plans, but it also
shows the need of further investigation on the identity of
nest predators, especially those in the Neotropical region.
330 Efeito da riqueza de habitats marginais de
lagos sobre a abundância de aves piscívoras no
Arquipélago de Anavilhanas, Amazônia Central
Renata Xavier1*, Renato Cintra2
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!f
r8'2!;!&!9-£=!?!=-'8|@!,33W$31W#8
3HODSULPHLUDYH]SDUDD$PD]¶QLDYHULĆFDPRVDQ¯YHO
populacional, se a abundância de aves piscívoras depende
das características do habitat em uma escala local. O objetivo
IRLYHULĆFDURVHIHLWRVGDULTXH]DGHKDELWDWVPDUJLQDLVGH
lagos sobre a abundância de aves piscívoras. O estudo foi
realizado em novembro-dezembro de 2007, em 45 lagos do
{փdփTT
ID t
ABSTRACT
t
ID t
Arquipélago de Anavilhanas, Amazônia Central. Foi utilizado
um barco para percorrer cada lago para registrar as aves e a
ULTXH]DGHKDELWDWVĆVLRQRPLDGDYHJHWD©¥RQDVPDUJHQV
dos lagos. As espécies Anhinga anhinga, Ardea alba, Ardea cocoi,
Megaceryle torquata, Pandion haliaetus e Phalacrocorax brasilianus
estiveram positivamente correlacionadas com a riqueza de
habitats. Estas espécies dependem da disponibilidade de
poleiros para caçar, descansar ou secar as penas, portanto
lagos com maior riqueza de habitats favorecem o aumento na
abundância destas espécies. As garças Ardea alba e Ardea cocoi,
assim como outras espécies da família Ardeidae, descansam
GXUDQWHRGLDHRXIRUPDPFRO¶QLDVQDYHJHWD©¥RPDUJLQDOGH
corpos d’água, sendo a vegetação arbórea muito importante
para estas aves. Phalacrocorax brasilianus e Anhinga anhinga
descansam por longos períodos na vegetação na margem
d’água, secam e fazem a manutenção de suas penas após
mergulhos, além de usarem a vegetação para reprodução.
Megaceryle torquata pesca a partir de poleiros altos na beira
d’água e Pandion haliaetus costuma empoleirar-se antes de
pescar e para comer a presa após a captura. A riqueza de
habitats marginais é um fator determinante na variação
na abundância local de aves piscívoras na Amazônia.
332 Morfologia comparada da asa da tesourinha
Page 193, Posters
ABSTRACT
t
Table of Contents
(Tyrannus savana) na América do Sul
Ivan Celso Carvalho I.C.C. Provinciato1*, Alejandro Edward A.E. Jahn2
ǢW2-='89-&!&'9;!&<!£!<£-9;!f-3£!83
r-=!2i$'£93|+£3#3W$31
Pesquisas realizadas no hemisfério norte mostraram que aves
que migram por longas distâncias tendem a ter asas com uma
morfologia mais pontuda em relação às aves que migram por
pequenas distâncias. Possivelmente isso ocorre porque asas
PDLVSRQWXGDVDXPHQWDPDHĆFL¬QFLDHUDSLGH]SDUDY¶RV
de longa distância. Essa relação também será verdadeira
para aves que migram entre os trópicos e o hemisfério sul?
Nós comparamos a morfologia da asa de Tesourinhas não
migratórias (Tyrannus savana monachusTXHQLGLĆFDPDRQRUWH
da América do Sul e de migratórias (Tyrannus savana savana),
que invernam em áreas em comum com os residentes mas
QLGLĆFDPDRVXOGD$P«ULFDGR6XO$O«PGLVVRQµVWDPE«P
FRPSDUDPRVDPRUIRORJLDGDDVDGDTXHOHVTXHQLGLĆFDPQD
$UJHQWLQDHGDTXHOHVTXHQLGLĆFDPQR%UDVLOYLVWRTXHRVTXH
QLGLĆFDPQR%UDVLOY¥RPLJUDUPHWDGHGDGLVW¤QFLDHPUHOD©¥R
àqueles que migram para a Argentina. Utilizando diferentes
medidas da asa bem como o peso da ave nos permitiu obter
valores de wing loading, aspect ratio e kipp’s distance. Utilizando
esses valores, nós encontramos diferenças entre populações
migratórias e populações não migratórias e também entre as
populações que migram distâncias maiores (Argentina) em
relação àquelas que migram distâncias menores (Brasil). Estes
valores obtidos sugerem que a morfologia da asa da Tesourinha
sofre uma pressão seletiva da migração, mas indicam também
{փdփTT
ID t
ABSTRACT
t
que a morfologia da asa pode ser afetada por estratégias
de forrageamento, idade e principalmente pelo sexo, onde
machos tendem a possuir asas mais pontudas que as fêmeas.
334 Comportamento alimentar de psitacídeos em
0DXULWLDćH[XRVDem Uberlândia – MG
Camila P. Teixeira1*, Renata Leal-Marques1, Carlos
Henrique Nunes1, Liliane Martins-Oliveira1
ǢW2-='89-&!&'
'&'8!£&'#'8£Ç2&-!
r;'-?'-8!6W$!1-£!|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
41.5 horas de observação em 0ćH[XRVD, sendo efetuados
70 registros de indivíduos de Brotogeris chiriri em 0ćH[XRVD,
dos quais em 21 foi observado consumo de fruto. O tempo
médio de consumo de frutos foi de 153,6 ± 119,7 s. O número
de indivíduos de B. chiriri e a duração do consumo de frutos
de 0ćH[XRVDaumentaram quanto menor o número de frutos
fechados (r=-0,71; p<0,05; r=-0,74; p<0,05). Frutos abertos de
0ćH[XRVDpor sua coloração chamativa podem atuar como um
atrativo para B. chiriri consumir os frutos da espécie vegetal,
independente da quantidade.
Agradecimento: Fapemig
Muitos frugívoros, tem na polpa de frutos a fonte de
recursos alimentares. Os Psittacidae tem sua dieta composta
principalmente de frutos, sementes e bagas. O trabalho teve
por objetivo determinar e comparar o comportamento de
forrageamento de aves da família Psittacidae em Mauritia
ćH[XRVD e determinar a relação entre o número de frutos da
planta e os comportamentos das aves. Nossa hipótese é que
as espécies de psitacídeos apresentariam comportamentos
de forrageamento diferentes entre si ao se alimentarem de
frutos de 0ćH[XRVD e a disponibilidade de frutos iria interferir
nos comportamentos das aves. O estudo foi realizado em
veredas da cidade de Uberlândia - MG. As observações
foram realizadas de Novembro de 2014 a Janeiro de 2015 no
período da manhã (07:00 - 12:30h) e tarde (14:00 - 18:30h).
O método de observação utilizado foi animal focal. As
estratégias de forrageamento foram divididas em 3 categorias:
tática de forrageamento, tática de manipulação (consumo) e
FRPSRUWDPHQWRDSµVDYLVLWD)RLTXDQWLĆFDGRRQ¼PHURGH
frutos disponíveis no ponto de observação. Foram realizadas
Page 194, Posters
338 Bird survey gaps in the Brazilian Pampas:
conservation implications
Thaiane W. da Silva1*, Graziela Dotta1
ǢW32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£
r;,!-!2'>9|+1!-£W$31
The Pampas biome occupies 63% of Rio Grande do Sul state
in Brazil. Besides the huge biodiversity of its grasslands,
conversion to agriculture is currently the main threat for the
region. More than 380 species of birds occur in the Pampas
(12,5% under threat). Here we compiled information about
locality records of bird studies in the Pampas aiming to
identify gaps of study. We carried out a literature review
(Scopus and Web of Knowledge) looking for studies in the last
20 years, and we got species’ presence data from museum
collections. Next we organized a list of localities and the
number of studies carried out at each place, and plotted
them on a map of the biome. We added a 25x25 km grid to
{փdփTT
ID t
ABSTRACT
t
LGHQWLI\JDSDUHDVGHĆQHGDVVTXDUHVRQWKHJULGZLWKRXW
VWXGLHVWKHQZHYHULĆHGKRZVWXGLHVZHUHGLVWULEXWHGLQDUHDV
important for grassland conservation: Valuable Grassland
Areas (VGAs), Brazilian Ministry of Environment Priority
Areas for Conservation (MMA), Important Areas for Birds
(IBAs), and Protected Areas (PAs). Only 34% of the Pampas
had at least one study, highlighting the need of more effort
across great part of the region to improve knowledge of
birds’ occurrence and distribution. The percentage of area
surveyed was similar for VGAs (20%), MMA (14%), and IBAs
(21%), emphasising the poor knowledge on birds’ distribution
in areas important for conservation. Turning to PAs, more
than a half of them do not have any information about
the occurrence of bird species. The uneven distribution of
research among Brazilian biomes, with the Pampas among
the less known, emphasises the importance of studies like
ours that helps to guide where to focus future research.
339 3URWRFRORQXWULFLRQDOGHUHDELOLWD©¥RSDUDĆOKRWHV
de andorinhão-do-temporal (Chaetura meridionalis)
realizado na divisão de medicina veterinária e m
Lais P. Caccia
2-='89-&!&'8'9#-;'8-!2!!$0'2A-'
ID t
ABSTRACT
t
Table of Contents
humana na cidade. Uma espécie com adaptação interessante
é o andorinhão-do-temporal (Chaetura meridionalis) que
substituiu o oco das árvores pelo interior das chaminés
SDUDQLGLĆFDUQRYHU¥R3HODDQDWRPLDGRQLQKRDTXHGD
GRVĆOKRWHVGHDQGRULQK¥RQDVFKDPLQ«V«UHFRUUHQWHQHVVD
época, causando um aumento no número de recebimentos
desses animais na Divisão Técnica de Medicina Veterinária
e Manejo da Fauna Silvestre (DEPAVE-3), da Secretaria
Municipal do Verde e do Meio Ambiente - PMSP, que ao
longo dos anos vem apresentando baixas taxas de sucesso na
reabilitação dos mesmos. Portanto, foi testado o protocolo
nutricional de Kyle & Kyle (2004) que é realizado com
sucesso em Chaetura pelagica, visando aumentar as taxas
de reabilitação em Chaetura meridionalis. O trabalho foi
realizado com 30 animais, apresentando sucesso de 46% na
reabilitação, o maior dos últimos 4 anos. Durante o mês do
tratamento os andorinhões apresentaram comportamentos
de estampagem por agrupamento e altruísmo entre parentes.
A soltura foi realizada em chaminé de residência já habitada
por outros indivíduos da espécie e foi monitorada pelo
munícipe todos os dias até a migração dos mesmos. Os
ĆOKRWHVPXLWRLPDWXURVQ¥RUHVLVWLUDPHSRUWDQWRIRUDP
propostas para estes metodologias diferentes para seu
tratamento inicial, antes que chegue ao DEPAVE-3.
£!-9Ǣǧ|,3;1!-£W$31
A pressão antrópica ao longo dos anos provocou grandes
PRGLĆFD©·HVQRVHFRVVLVWHPDVHKDELWDWVGRVDQLPDLV
silvestres. As aves, por exemplo, conseguiram se adaptar
bem a essas mudanças, passando a conviver com a população
Page 195, Posters
{փdփTT
ID t
ABSTRACT
t
342 Densidad, uso de hábitat y patrón de actividad
de Strigiformes en un bosque seco andino
Juan F. Freile
31-;$<!;38-!23&''+-9;83982-;3£+-$39
/(8'-£'3|@!,33W$31
Existen muy pocos estudios sobre las aves nocturnas andinas.
La composición y ecología de las comunidades no ha sido
estudiada en los Andes del norte. Por ello, investigamos la
densidad poblacional, distribución espacial y uso de hábitat de
búhos (Strigiformes) en un bosque seco andino en Jerusalem,
provincia de Pichincha, Ecuador (2300 m de altitud), entre
abril 2011 y marzo 2012. Adaptamos un protocolo de
mapeo de transectos con bandas de distancia paralelas a la
línea media. Estimamos la posición de cada búho registrado
(primer contacto visual o auditivo) tomando el ángulo de
ubicación y banda de distancia. Con la acumulación de puntos
de registro en el mapa, modelamos la distribución espacial
de territorios y estimamos su densidad poblacional. De seis
especies registradas, Tyto alba y Athene cunicularia mostraron
alta densidad en distintos hábitats, mientras que Ciccaba
albitarsis y Aegolius harrisii se encontraron en baja densidad
en matorral seco montano maduro y zonas más húmedas.
Asio stygius y Bubo virginianus se encontraron en hábitats
DOWHUDGRVDXQTXHP£VHVSHF¯ĆFRVTXHT. alba y A. cunicularia.
Existe superposición de territorios entre T. alba, A. cunicularia
y A. stygius, mientras C. albitarsis y A. harrisii ocuparon
espacios más restringidos y parcialmente superpuestos con
las especies más abundantes. Adicionalmente, analizamos
variables climáticas y de luminosidad que sugieren que
Page 196, Posters
ID t
ABSTRACT
t
Table of Contents
los búhos vocalizan más en las primeras horas de noches
oscuras y sin viento. Recomendamos estudiar comunidades
nocturnas con similar composición de especies en ecosistemas
húmedos para determinar si mantienen los patrones de
abundancia y uso de hábitat encontrados en Jerusalem.
344 Birds of southern Brazilian grasslands
Eduardo Chiarani1*, Christian B. Andretti1, Carla S. Fontana1
ǢW
r'$,-!8!2-|@!,33W$31W#8
The southern grasslands of South America, located in two
Brazilian biomes (Pampa - PA and Mata Atlântica - MA) and
part of Uruguay, Argentina, and Paraguay, have been suffering
large changes in land use, with severe consequences in loss
of biodiversity. From September 2014 to January 2015
we surveyed birds in 13 sites spread across the Brazilian
southern grasslands (nine in PA and four in MA biome), aiming
to compare their bird communities. Birds were recorded by
point counts (24) and transects (12), distributed in areas of
grassland as well as adjacent riparian forests, in each of the
study sites. We recorded 299 bird species (280 in PA grasslands
and 188 in MA grasslands), with 19 threatened species (at
regional, national or global level). The similarity between bird
communities of the two biomes was 0.56 (Jaccard’s index).
The 13 sites showed similar values of species richness, with
a mean of 136.9 ± 13.4 species by area (ranging from 114
to 157). The PA biome had 111 exclusive species and 13
threatened, while only 19 species were found exclusively
{փdփTT
ID t
ABSTRACT
t
on MA grasslands (10 threatened species). The species
richness we recorded corresponds to approximately 63% of
the total species known to occur in the Brazilian southern
JUDVVODQGV0RVWRIWKHVSHFLHVZHGLGQRWĆQGDUHIRUHVW
related taxa. Differences between the bird communities of
the two biomes might be related to elevation and isolation
of the MA grasslands compared to PA grasslands. More
surveys would help clarify whether these differences occurred
due to sample effects or might be explained by the greater
heterogeneity of grassland typologies in the Pampa biome.
345 Breeding success of the Brazilian
population of Gubernatrix cristata
Christian Beier1*, Mrcio Repenning1, Mauricio S.
Pereira1, Andr Pereira1, Carla S. Fontana1
ǢW32ধऄ$-!2-='89-&!&'!;Õ£-$!&3-38!2&'<£
ID t
ABSTRACT
t
Table of Contents
IRUGD\VDQGWKHQHVWOLQJVćHGJHDWGD\V0D\ĆHOGèV
QHVWLQJVXFFHVVZDV7KHPHDQQXPEHURIćHGJOLQJV
from successful nests was 1.6 (1-3) chicks. Eggs of Molothrus
bonariensis were found in 60% of the nests with a mean of
1.5 egg per parasitized nest (n=14). Predation was the main
cause of nest loss (82%), followed by abandonment after
puncture of eggs by female M. bonariensis (14%). We recorded
helpers at nests in two territories on each breeding season,
where we observed re-nesting after successful attempts.
6XUYLYDOUDWHRIĆUVWPRQWKćHGJOLQJVZDV:HUHFRUGHG
inbreeding between a male and its offspring. The low nesting
success raises some concerns about the maintenance of the
Brazilian population of G. cristata, which is target of a captive
breeding program. Understanding the autoecology of G.
cristata is fundamental to provide the base to next government
strategies to manage and conserve the Brazilian population.
r#'-'8W382-;3|+1!-£W$31
The globally endangered passerine Gubernatrix cristata occurs
in Argentina, Uruguay and Brazil. Bird trapping and habitat
loss are the main causes for its fast population decline in the
last decades. The only known wild population of G. cristata
in Brazil is located in the municipality of Barra do Quaraí,
state of Rio Grande do Sul, and it is estimated to be less than
100 individuals. We investigated the breeding biology of this
population in two breeding seasons from 2013-2015. Breeding
begins in October, with a peak of nesting attempts in late
November, and lasts until February. We found 30 nests (14
and 16 nests on each season, respectively). The modal clutch
size was three eggs (2-4 eggs). The incubation period lasts
Page 197, Posters
348 Antecedentes reproductivos y cuidado parental de
Cóndor Andino (Vultur gryphus) en Chile Central
Víctor Escobar-Gimpel1*, Sergio Alvarado2, Anir Muñoz1
ǢW38638!$-Õ21-+39&'£Õ2&38TǣW83+8!1!&'!£<&1#-'2;!£T29ধ;<;3
&'!£<&3#£!$-32!£T
!$<£;!&&''&-$-2!T2-='89-&!&&',-£'
r='+-16'£|+1!-£W$31
Los antecedentes sobre la reproducción en vida silvestre de
Cóndor Andino (Vultur gryphus), especie típicamente carroñera,
son escasos a lo largo de todo su rango de distribución,
extendiéndose desde Venezuela hasta Cabo de Hornos,
principalmente a lo largo de la cordillera de Los Andes. El
objetivo del siguiente trabajo es contribuir al conocimiento
{փdփTT
ID t
ABSTRACT
t
ID t
sobre la biología reproductiva de la especie, entregando
DQWHFHGHQWHVVREUHQLGLĆFDFLµQHQOD]RQDFHQWUDOGH&KLOH
y el cuidado parental en dos nidos. Entre 2007 y 2009, se
UHDOL]µXQDE¼VTXHGDLQWHQVLYDGHWHUULWRULRVGHQLGLĆFDFLµQ\
el estudio de cuidado parental de dos parejas reproductivas.
6HLGHQWLĆFDURQWHUULWRULRVGHQLGLĆFDFLµQDO(VWHGHOD
ciudad de Santiago, en la cordillera de Los Andes. En los dos
territorios estudiados durante la época reproductiva, los
machos ingresaron al nido con mayor frecuencia que las
hembras (62,2% vs 26,4%; N=21) y (50% vs 37%; N=47). El
transporte de alimento al nido y la conducta de alimentación
de la cría fueron realizados con mayor frecuencia por el
macho (65% vs 35%; N=28) y (63,6% vs 36%; N=19). La
interacción padre-cría sin entrega de alimento fue realizada
más frecuentemente por la hembra en un nido (75% vs 25%;
N=4) y en igual proporción por los padres en el otro. La
vigilancia del territorio fue realizada más frecuentemente
por el macho en un nido (56% vs 40%; N=91) y por la
hembra en el otro (54,6% vs 41,2%; N=24). Contrariamente
a lo observado en otros estudios, las conductas de cuidado
parental son compartidas por los padres, las que podrían estar
determinadas por la oferta y disponibilidad de alimento.
356 Responses of urban tolerant birds to the level
Page 198, Posters
ABSTRACT
t
Table of Contents
of urbanization in a neotropical city
Rafael Amorin1*, Vincius Abilhoa2
ǢW83+8!1!&'Õ9f8!&<!%È3'1 33£3+-!T2-='89-&!&'
'&'8!£
&3!8!2ÆTǣW<9'<&'-9;Õ8-!!;<8!£&3!63&!1#<-!
r!138-2W8!(!'£|,3;1!-£W$31
This paper compares the proportion of urban tolerant birds in
the urban avian community and the amount of built-up areas,
mostly impervious surface, as indicators of urbanization on
patterns of avian species composition in a Neotropical city in
Southern Brazil. From September to December 2013 (breeding
season), bird surveys were conducted in 120 squares of 100
ha randomly select within Curitiba. All bird species seen or
KHDUGGXULQJWKHVDPSOHWLPHIUDPHPLQVTXDUHZDV
UHFRUGHG8UEDQWROHUDQWELUGVZHUHLGHQWLĆHGEDVHGRQWKHLU
tolerance and ability to exploit urbanized areas. The extent of
XUEDQPRGLĆFDWLRQDQGGLVWXUEDQFHZDVHVWLPDWHGGLUHFWO\
from urban landscape data analyses through a geographic
information system. For each sample point (square) the amount
of built-up areas (e.g. buildings, roads, industrial areas, pavedRYHUVRLOFRPSDFWHGQHDULPSHUYLRXVRSHQVSDFHVZDV
measured. Simple regressions were performed to assess the
relationship of overall species richness (log) and the percentage
of urban tolerant birds (log) against the percentage of built-up
areas as the predictor variable. We recorded 102 bird species,
including 13 urban tolerant species. As expected, urbanization
VLJQLĆFDQWO\UHGXFHGVSHFLHVULFKQHVVEXWXUEDQWROHUDQW
VSHFLHVZHUHOHVVDIIHFWHGWRFKDQJHVRQODQGPRGLĆFDWLRQV
{փdփTT
ID t
ABSTRACT
t
associated to urban growth, probably because such guild can
XVHYDULRXVW\SHVRIKDELWDWLQWKHKXPDQPRGLĆHGHFRV\VWHP
The increase of “urban-adaptable” species in intermediate and
high urbanized areas was probably favored by the availability
of nest sites and food, and also by the higher temperature
caused by the impermeabilization of the land surface.
360 Alpha taxonomy of Momotus momota
(Linnaeus, 1766) (Aves: Momotidae)
Gabriella R. Frickes1*, Marcos A. Raposo1, Dante M. Teixeira1
ID t
ABSTRACT
t
Table of Contents
Momotus lessonii and Momotus subrufescens are distinct species,
examining the nomenclatural aspects and proposing the
best possible treatment to be applied at the time. Thus, we
selected 14 plumage characters and six distinct measures,
which would be analyzed using Statistica 8. The study of
DSSUR[LPDWHO\VWXIIHGVSHFLPHQVEHORQJLQJWRĆYH
museums revealed the existence of a single diagnosable species,
Momotus momota (Linnaeus, 1766), which has wide distribution
and has great polymorphism. Future studies with different
approaches, including genetic nature, may complement the
observation of certain distribution patterns observed.
ǢW<9'<!$-32!£c2-='89-&!&'
'&'8!£&3-3&'!2'-83
r+!#8-'££!(8-$0'9|+1!-£W$31
Described by Brisson in 1760, the Momotus genus encompasses
three species currently recognized. Momotus momota (Linnaeus,
1766) can be found from Mexico to northwestern Argentina
and most of Brazil, and is characterized by the black bill, red
eyes, black pileum, blue crown, black periophthalmic mask,
“stickpin” green with cinnamon, chest with two black spots,
and the spatula formed at the tip of its long tail. The taxonomic
revisions carried out point to the existence of variations in size
and plumage of this species along the geographical range, and
such diversity resulted in 20 subspecies described, a complex
with intricate nomenclature that needs a taxonomic revision,
as the evaluation of the polytypic species without the use of
VXEVSHFLĆFOHYHOLVHVVHQWLDOIRUWKHHVWDEOLVKPHQWRIFRQVLVWHQW
species (Cracraft, 1983; Nelson & Platnick, 1981). This study
aims to test the hypothesis suggested by Snow (2001) that
Momotus momota, Momotus coeruliceps, Momotus bahamensis,
Page 199, Posters
363 Temporal coordination of duet singing in the Rufous Hornero
Pedro Diniz1*, Gianlucca S. Rech1, Pedro H.L. Ribeiro1, Regina H. Macedo1
ǢW2-='89-&!&'&'8!9-£-!
r6&!&-2-A|+1!-£W$31
Female and male Rufous Horneros (Furnarius rufus) emit sexVSHFLĆFVRQJW\SHVVLPXOWDQHRXVO\WRSHUIRUPGXHWV7KUHH
hypotheses have been proposed to explain how individuals
adjust their singing tempos to coordinate songs in duets.
,QGLYLGXDOVPD\FRPELQHĆ[HGVRQJVLQWRGXHWVWKURXJKDQ
initial and common cue (i.e., they do not make adjustments
during the course of a duet). Alternatively, an individual may
adjust its singing tempo based upon what it sang previously
in the same duet (i.e., autogenous feedback), or based upon
what its partner sang previously in a duet (i.e., heterogenous
feedback). We recorded duets from a banded and urban
population of Rufous Hornero in Central Brazil, and then
GHOLPLWHGWKHĆQHGHWDLOVRIWLPLQJIRUPDOHDQGIHPDOH
{փdփTT
ID t
ABSTRACT
t
songs in each duet. Based on preliminary analysis, we found
that duration in songs by males and females was positively
correlated, suggesting that at least one sex was adjusting its
VLQJLQJWHPSRGXULQJWKHFRXUVHRIDGXHW:HDOVRYHULĆHG
ZKHWKHUWKHWLPLQJRIQRWHW\SHFKDQJHLVPRUHLQćXHQFHG
by the timing of the individual or its partners past notetype change. Interestingly, we found that male note-type
FKDQJHZDVPRUHLQćXHQFHGE\LWVSDUWQHUVODVWQRWHW\SH
ZKHUHDVIHPDOHQRWHW\SHFKDQJHZDVPRUHLQćXHQFHGE\
its own last note-type change. Our results suggest that males
are mostly responsible for duet coordination in horneros
because they responded to females to coordinate duets
(heterogenous feedback hypothesis). In contrast, females
may contribute to duet coordination through the autoadjustment of song tempo (autogenous feedback hypothesis).
372 $VSHFWRVGHPRJU£ĆFRVGHOFKRUOLWRFRUGLOOHUDQR
(Phegornis mitchellii) en los andes de Chile Central
Andrea Minoletti1*, Fernando Daz2, Jim Johnson3,
Andrea Contreras1, Anir Muoz2
ǢW2-='89-&!&&',-£'T
!$<£;!&&'-'2$-!9
38'9;!£'9@&'£!
329'8=!$-2&'£!!;<8!£'A!W!#38!;38-3&'$3£3+!@-&!-£='9;8'WT
ǣW'&&'#9'8=!&38'9&'='9@-&!-£='9;8'&',-£'TT
ǤW
-9,!2&-£&£-(''8=-$'T£!90!W2$$,38!+'W!2!&!W
ID t
ABSTRACT
t
Table of Contents
efectos antropogénicos y climáticos. Nuestro estudio es el
SULPHUHVIXHU]RSDUDGHWHUPLQDUDVSHFWRVGHPRJU£ĆFRV
de P. mitchellii. El estudio se desarrolló en el Valle del Río
Yeso (-33,64° S, -69,93° O), Chile central, durante cuatro
temporadas reproductivas entre 2010-2014. Durante todo
el periodo marcamos individualmente 101 aves (adultos
y juveniles), y monitoreamos 66 familias distintas. Para
estimar la tasa de sobrevivencia aparente utilizamos el
método de captura-recaptura, y a través del Programa
MARK determinamos una sobrevivencia aparente de adultos
moderadamente alta (0,77), con un modelo constante (i.e.,
sin efecto del tiempo). La detección interanual de juveniles
es muy baja como resultado de una baja sobrevivencia o una
dispersión fuera de nuestra área de estudio. Para evaluar
la tasa de reproducción anual determinamos el número
total de eclosiones durante una temporada. Observamos
que las parejas reproductivas producen exitosamente > 1
nidada, de 2 huevos, durante cada temporada, resultando
HQXQWRWDOGHHFORVLRQHVSDUHMDUHSURGXFWLYDWHPSRUDGD
Nuestro estudio sugiere que la tendencia de la población
local es estable, y probablemente su tamaño esté regulado
por la limitada disponibilidad de manantiales y humedales
salobres, de los cuales la especie depende para forrajear.
r!2&8'!W1-23£'ষ|+1!-£W$31
Con una población estimada de <10.000 individuos, el
Chorlito Cordillerano (Phegornis mitchellii) es una de las aves
playeras más raras del mundo. La especie es endémica de
los humedales altoandinos, los que están amenazados por
Page 200, Posters
{փdփTT
ID t
ABSTRACT
t
373 UEcoNet: Envisioning collaboration among
cities, regions and countries
Juliana Bedoya-Durn1*, Farah Carrasco-Rueda1, Anglica GarcaVillacorta1, Flavia A. Montao-Centellas1, Mariana Villegas-Bilbao1
ǢW2-='89-;@3(
£38-&!
r1/#'&3@!|<*W'&<
+XPDQGRPLQDWHGHFRV\VWHPVRFFXUZRUOGZLGHDQGbKDYH
been increasingly the focus of ecological research. Surprisingly,
despite having some of the largest cities in the world, Latin
American research on urban ecology is still poorly developed.
Envisioning a collaboration network among researchers with
focus on urban ecology, we engaged representatives from
Tropical Andean countries to join efforts to launch UEcoNet: an
Urban Ecosystems Network . UEcoNet will serve as a platform
IRUGDWDVKDULQJRQXUEDQHFRV\VWHPVDQGbWRVWUHQJWKHQ
FROODERUDWLRQDPRQJVFLHQWLVWVDQGbWKHSXEOLFLQJHQHUDO7KH
WZRPDLQJRDOVRI8(FR1HWDUH7RFROOHFWDQGbV\QWKHVL]H
GDWDRQXUEDQELRGLYHUVLW\DQGbWRLPSOHPHQWFURVVVLWH
VWXGLHVIRUGDWDFROOHFWLRQRQGHWHUPLQHGWRSLFVHJVSHFLĆF
taxa, ecosystem services, ecological processes) following
standardized methods to allow comparisons. Our preliminary
evaluation showed that, although still limited, the information
on bird diversity in Neotropical urban ecosystems still surpases
WKHLQIRUPDWLRQIURPRWKHUWD[D7KHUHIRUHGXULQJWKHĆUVW
stage, UEcoNet will focus on synthesizing information on
XUEDQDYLIDXQDDQGbGHVLJQLQJDFURVVVLWHH[SHULPHQWWR
survey urban birds in Neotropical cities. Although initially
centered on Neotropical countries, UEcoNet is open to
Page 201, Posters
ID t
ABSTRACT
t
Table of Contents
researchers from any country. Participants from research
LQVWLWXWLRQVDQGb8QLYHUVLWLHVDUHZHOFRPHWRMRLQWKHQHWZRUNb
374 Descrição de nove ninhos de aves em um
fragmento de Mata Atlântica em Murici - AL
Hermnio A. L. S. Vilela1*, Cauay V. Gazele1,
Arthur B. de Andrade1, Mrcio A. Efe1
ǢW2-='89-&!&'
'&'8!£&'£!+3!9
r,'81-2-3=-£'£!|+1!-£W$31
Estudar a biologia reprodutiva de aves é um passo importante
para entender a sua história de vida, assim contribuir para
várias áreas de conhecimento, como ecologia, conservação e
manejo. Apesar disso, para muitas espécies não existe nenhuma
descrição de seus ninhos, ovos e parâmetros reprodutivos,
WDLVFRPRWHPSRGHLQFXED©¥RHSHUPDQ¬QFLDGHĆOKRWHV
no ninho. O objetivo desse trabalho foi analisar parâmetros
reprodutivos e caracterizar morfológica e biometricamente
ninhos de aves em um dos maiores fragmentos remanescentes
do Centro de Endemismo Pernambuco em Alagoas, bem
FRPRLGHQWLĆFDUSRWHQFLDLVSUHGDGRUHV2IUDJPHQWRHVW£
inserido na Estação Ecológica (ESEC) de Murici, onde foram
realizadas expedições mensais entre setembro de 2014 à abril
de 2015. Os ninhos foram encontrados a partir de busca ativa
por sinais de reprodução. O monitoramento das atividades
dos ninhos foi realizado virtualmente por meio de armadilhas
IRWRJU£ĆFDVHPHGLGRUHVGHWHPSHUDWXUDGDWDORJJHU2V
QLQKRVIRUDPFODVVLĆFDGRVFRPRGRWLSRFDYLGDGHVHPW¼QHOH
copo raso ou fundo com variações na forma de sustentação.
No total foram encontrados nove ninhos ativos de espécies
{փdփTT
ID t
ABSTRACT
t
diferentes. Somente um dos ninhos alcançou o sucesso
aparente, com recrutamento dos ninhegos. Todos os outros
foram considerados predados ou abandonados. As armadilhas
IRWRJU£ĆFDVUHJLVWUDUDPDSUHGD©¥RGRVQLQKRVSRUXPURHGRU
marsupial, uma serpente Sibynomorphus sp. e por quati, Nasua
nasua. Informações sobre cuidado parental em Thamnophilus
aethiops também são adicionadas. Contudo, os ninhos
monitorados apresentaram um baixo sucesso reprodutivo
coerentes com fragmentos conservados de Mata Atlântica.
375 Ecologia de forrageamento de Empidonomus varius
(Aves: Tyrannidae) em ambiente urbano: respostas
a variações temporais, ambientais e sazonais
Liliane Martins-Oliveira1*, Carlos Henrique Nunes1,
Renata Leal-Marques1, Oswaldo Maral Júnior1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r£-£-!2''$3<(<|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
duas vezes por estação (seca e chuvosa) por ano, no período
da manhã. Foram realizadas 180h de observação em 2009, e
KHP2P«WRGRGHREVHUYD©¥RIRLDQLPDOIRFDO
registrando os comportamentos relacionados à procura, ataque
e substrato. Foram utilizados os testes Qui-quadrado e MannWhitney para as análises. O tempo de procura por poleiro maior
no ano de 2009 nas praças pode estar associado à seletividade
ou disponibilidade de presas. E varius forrageou mais alto no
DQRGHQDVSUD©DVRQGH«PDLVLQWHQVDDDWLYLGDGH
humana. O uso preferencial de substratos vegetais destaca a
importância da arborização. Em relação aos tipos ambientais
H¢VD]RQDOLGDGHHPQ¥RIRLREVHUYDGDPXGDQ©DQRV
tempos de forrageio de E. varius. A plasticidade comportamental
pode explicar a ausência de diferenças em alguns aspectos
do comportamento em resposta às mudanças ambientais
e sazonais. Compreender esses padrões comportamentais
das aves contribui para história de vida, o planejamento e
manejo dos espaços urbanos. Agradecimento: Fapemig.
Tiranídeos se adaptaram a vários ambientes e apresentam
amplo repertório comportamental. Nossa hipótese é que
o forrageamento de uma ave terá variações em resposta a
fatores ambientais, mudanças sazonais e temporais. Este
estudo objetivou avaliar diferenças no comportamento de
forrageamento de Empidonomus varius em resposta a variações
temporais, sazonais, e tipo de ambiente urbano. O trabalho foi
UHDOL]DGRQD]RQDXUEDQDGH8EHUO¤QGLD0*%UDVLO1RVDQRV
de 2012 a 2014, foram estabelecidas 30 parcelas em parques
e 30 em praças, em 2009 foram estabelecidas 21 parcelas em
praças e 12 em parques. Todas as parcelas foram amostradas,
Page 202, Posters
376 Eroding the differences: agriculture and cattle
promotes biotic homogenization in resident bird
communities of Mexican tropical dry forest
Leopoldo D. Vzquez-Reyes1*, Maria del Coro Arizmendi1, Hctor
Octavio Godnez lvarez1, Adolfo Gerardo Navarro Sigenza1
ǢW2-='89-&!&!$-32!£<;Õ231!&'Ì?-$3
r£'363£&3W=!A7<'A|<2!1W1?
Agricultural activities promote changes in natural ecosystems
that generate homogenous ecological conditions according
{փdփTT
ID t
ABSTRACT
t
ID t
to human requirements, and facilitate biological invasions
mediated by man-made transportation at a global scale. On that
conditions, biotic homogenization can occur. This phenomenon
consists in the erosion of biological differences between
biotas of contrasting ecosystems, due to extinction of local
specialist species, and invasions of exotic generalists. However,
scenarios where differences increase (biotic differentiation) can
also occur. In this study, we assess the biotic homogenization
hypothesis in resident bird communities of a tropical dry
forest in central Mexico, a globally relevant ecosystem due to
its biodiversity and endemisms, but also endangered due to
agricultural activities. We conducted point-count surveys to
assess biotic dissimilarity between resident bird communities
in both tropical deciduous and oak forests in the upper Balsas
River basin, considering three progressive levels of anthropic
SHUWXUEDWLRQ2XUĆQGLQJVVKRZDVLJQLĆFDQWGHFUHPHQWRI
taxonomic dissimilarity due to species turnover in function
of anthropic perturbation. This results in homogenization of
bird communities in human settlements at both vegetation
types, thus breaking the natural pattern of distance-decay of
VLPLODULW\2XUĆQGLQJVVKRZIRUWKHĆUVWWLPHWKDWDJULFXOWXUH
and cattle raising promote taxonomic homogenization of
bird communities in the Neotropical dry forests, indicating
the need for developing production strategies with lesser
impacts in natural vegetational cover, in order to reduce
ELRGLYHUVLW\HURVLRQWKDWWKHPRGLĆFDWLRQVSURPRWH
378 Diferencias en ecología y biología reproductiva de especies
Page 203, Posters
ABSTRACT
t
Table of Contents
GH(PEHUL]LGDHFRPRKHUUDPLHQWDSDUDUHVROYHUĆORJHQLD
Gina J. Diaz-Rodrguez1*, Gustavo A. Londoo1
ǢW2-='89-&!&!$-32!£&'3£31#-!
+/&-!A8|<2!£W'&<W$3
Recientemente se han desarrollado estudios moleculares
basados en ADN mitocondrial en los que se proponen nuevas
ĆORJHQLDVSDUDODIDPLOLD(PEHUL]LGDHVLQHPEDUJRKDVLGRGLI¯FLO
generar un árbol que concuerde con los datos morfológicos y
moleculares, sin mencionar que dependiendo de la muestra
y las técnicas usadas los árboles resultantes pueden variar.
Por esta razón es necesario desarrollar nuevas metodologías
TXHSHUPLWDQREWHQHUĆORJHQLDVP£VUREXVWDVDXQTXH
hasta hoy los géneros tradicionales Buarremon, Arremon y
Lysurus se mantienen como Arremon. Se recolectó y analizó la
información anteriormente mencionada en la temporada más
activa de reproducción, con los picos de pluviosidad en el PNN
Tatamá-Risaralda, Colombia, para algunos representantes
de los géneros Arremon y Atlapetes. Se instalaron sensores de
temperatura en nidos, se realizaron mediciones morfológicas
y descripciones de huevos y nidos, se monitoreó el desarrollo
de polluelos. Se encontraron diferencias entre las especies
correspondientes al tamaño de nidada, el tamaño de los huevos,
el comportamiento de incubación, pero se resaltan grandes
diferencias en la forma del nido, los materiales usados en su
construcción y sus diferentes preferencias de ubicación espacial
del mismo, que son poco usuales entre miembros de un mismo
género. En este estudio se propone el uso de información
sobre la ecología y biología reproductiva, como herramienta
{փdփTT
ID t
ABSTRACT
t
DOWHUQDWLYDSDUDGLOXFLGDUUHODFLRQHVĆORJHQ«WLFDVGHQWUR
del grupo. Estos resultados podrían sustentar propuestas
de cambios dentro de la familia Emberizidae y soportar
relaciones de parentesco para las especies estudiadas.
ID t
ABSTRACT
t
Table of Contents
PD\RUFRPSHWHQFLDLQWUDRLQWHUHVSHF¯ĆFDFRPRFRQVHFXHQFLD
de la reducción en la cantidad de hábitat adecuado disponible.
381 Respostas comportamentais do forrageamento de tiranídeos
(Aves: Tyrannidae) a diferentes ambientes urbanos
380 Efectos de la pérdida de hábitat en la conducta
territorial de rapaces nocturnas (Strigiformes) de
la Reserva de la Biosfera Los Tuxtlas, Veracruz
Liliane Martins-Oliveira1*, Renata Leal-Marques1, Carlos
Henrique Nunes1, Oswaldo Maral Júnior1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
M.Isabel Herrera-Jurez1*, Patricia Escalante-Pliego1
r£-£-!2''$3<(<|+1!-£W$31
ǢW29ধ;<;3&'-3£3+!&'£!2-='89-&!&!$-32!£<;231!&'Ì?-$3lm
r#-3£W-9!#'£,'88'8!|+1!-£W$31
A rápida urbanização traz uma crescente preocupação
com a conservação biológica. Aves são excelente modelo
para entender os efeitos da urbanização na vida silvestre, e
tiranídeos é um dos grupos de aves da Região Neotropical
PDLVGLYHUVLĆFDGRHPWHUPRVGHQ¼PHURVGHHVS«FLHV$
família Tyrannidae foi utilizada como modelo para avaliar se
há variações nos comportamentos de forrageamento das
aves em resposta às diferenças ambientais da área urbana de
Uberlândia, MG. Foram considerados três tipos de hábitats:
Ruas, Praças e Áreas Alteradas Próximas a Remanescentes
de Vegetação nativa (APRs). Em cada ambiente foram
HVWDEHOHFLGDVSDUFHODVGHPtFDGD$VREVHUYD©·HV
foram realizadas de abril a dezembro de 2009. Foram realizadas
280h de observação e feitos registros do comportamento
de forrageamento dos tiranídeos. As análises usadas foram
ANOVA, Kruskal-Wallis e escalonamento multidimensional
não métrico (NM-MDS), realizadas para 15 espécies de
tiranídeos. No que se refere às respostas comportamentais
dos tiranídeos aos diferentes ambientes, foram observadas
diferenças para altura do substrato de procura, sendo menor
Una gran diversidad de variables ecológicas actúan como
determinantes del comportamiento territorial. Utilizando la
proporción de cobertura vegetal remanente en el paisaje como
un indicador de la calidad del hábitat, se evaluó el efecto de
la pérdida de cobertura vegetal en la conducta territorial de
especies de rapaces nocturnas (Strigiformes) en la Reserva
de la Biosfera Los Tuxtlas. Se estimó la latencia a la primera
respuesta y la duración del periodo de respuesta a intrusiones
simuladas mediante el uso de vocalizaciones pregrabadas
(playbacks) a lo largo de un gradiente de pérdida de cobertura
vegetal. La duración del periodo de respuesta mostró una
correlación positiva con el incremento en la proporción de
cobertura vegetal (r = 0.86, P < 0.01), no así la latencia promedio
de la primera respuesta (r = - 0.04, P = 0.87). Los resultados
indican que las especies de rapaces nocturnas responden de
forma similar a los intrusos independientemente de la calidad
del hábitat. Por otro lado, en zonas con una mayor cobertura
vegetal la defensa territorial es más intensa, esto puede indicar
Page 204, Posters
{փdփTT
ID t
ABSTRACT
t
nas APRs. Não foram observadas variações no comportamento
no que se refere ao tempo médio de procura no poleiro,
número de poleiros usados na procura e distância de ataque
(com raras exceções). Quanto aos comportamentos de ataque
YHULĆFRXVHTXHDJUXSDPHQWRVVHIRUPDUDPGHDFRUGRFRP
a espécie independente do tipo de ambiente. A amplitude de
comportamentos das espécies pode possibilitar responder
DVYDULD©·HVDPELHQWDLVVHPQHFHVVLGDGHGHPRGLĆFD©¥R
de alguns comportamentos, o que pode contribuir para a
ocupação desses espaços. Agradecimento: Fapemig.
382 5HYLV¥RELEOLRJU£ĆFDGLHWDGRV7KDPQRSKLOLGDH
ID t
ABSTRACT
t
Table of Contents
onívora. Foram encontradas 44 referências que mencionam
os itens alimentares dentro da família em 55 espécies,
sendo todas consideradas predominantemente insetívoras.
Porém para a espécie Cercomacra ferdinandi, nenhum estudo
foi encontrado. Ainda para Pygiptila stellaris e Cercomacra
melanaria foi encontrado apenas uma referência cada. Isto
evidencia a prioridade em estudos aprofundados a respeito
GDGLHWDGHVWDVWU¬V¼OWLPDVHVS«FLHVPHQFLRQDGDV3RUĆP
esta lista proporciona uma única base de consulta que será
¼WLOSDUDGHWHUPLQD©¥RU£SLGDHVHJXUDGDVLQWHUD©·HVWUµĆFDV
em Thamnophilidae em trabalhos de ecologia, conservação
e manejo dos ecossistemas do Cerrado brasileiro.
ocorrentes no cerrado
Rosiani Ramos Lopes Brinck1*, Wagner de
Freitas Pereira1, Srgio Roberto Posso1
ǢW
r839-!2-i£36'9|,3;1!-£W$31
Thamnophilidae é uma família de aves passeriformes que
compreende cerca de 220 espécies, destas 160 ocorrem no
Brasil e 56 no Cerrado. Embora os Thamnophilidae sejam
VHPSUHFODVVLĆFDGRVFRPRLQVHW¯YRURVQ¥RK£QHQKXP
estudo que teste esta assertiva. Este trabalho tem por
objetivo providenciar uma lista de consulta única para as
preferências alimentares de Thamnophilidae do Cerrado
SRUPHLRGHUHYLV¥RELEOLRJU£ĆFD$UHYLV¥RELEOLRJU£ĆFDIRL
realizada com o auxílio do Google Acadêmico. Uma espécie
foi considerada dentro de uma categoria alimentar desde
que a literatura indicasse tal categoria em pelos menos
75% das citações, caso contrário a espécie foi considerada
Page 205, Posters
383 Conociendo la biodiversidad de mi campus: Guía de Aves del
Campus de la Universidad Nacional de Colombia, Bogotá
Laura Echeverri1*, Adriana Rodriguez1, Alejandra
Chadid1, Angela Mayorga1, Cristian Mur1, Elizabeth
Abril6, German Gutierrez1, Jaime Manzano1
ǢW2-='89-&!&!$-32!£&'3£31#-!
r+3<2i!='9|+33+£'+83<69W$31
La Universidad Nacional de Colombia en Bogotá es un
FDPSXVGHKHFW£UHDVFRQ£UHDVYHUGHV\HGLĆFDFLRQHV
con cerca de 2000 profesores y 30000 estudiantes, es el
campus universitario más grande del país. Desde el 2005, El
Grupo de Ornitología de la Universidad Nacional (GOUN) ha
realizado actividades de observación y capturas de aves para
capacitar a sus integrantes en el estudio de las aves y enseñar
su importancia para dinámicas académicas, ambientales y
sociales. El GOUN en el 2014 hizo la actualización de la Guía
{փdփTT
ID t
ABSTRACT
t
ID t
de aves del campus, en este trabajo se registraron un total de
122 especies de aves, de las cuales 81 fueron seleccionadas
para salir en la guía de acuerdo a criterios de abundancia y
IUHFXHQFLDGHGHWHFFLµQ&DGDĆFKDLQFOX\HIDPLOLDHVSHFLH
QRPEUHFLHQW¯ĆFR\FRP¼QIRWRGHVFULSFLµQGHLGHQWLĆFDFLµQ
hábitos alimenticios, hábitat, estructura social y si es residente
o migratoria. Fue fundamental la participación de todo el grupo,
al repartir las especies para reunir la información y elegir las
fotografías. Gracias al apoyo de la Universidad Nacional y
el Programa de Gestión de Proyectos se imprimieron 1300
ejemplares que han sido ampliamente distribuidos y aceptados
por la comunidad universitaria. De esta forma la nueva Guía
ha permitido la capacitación de estudiantes, profesores y
administrativos, realización de jornadas de observación de
aves y actividades lúdicas, demostrando así como un trabajo de
un grupo estudiantil, vinculado a un buen apoyo institucional
puede crear una herramienta que ayuda a generar conciencia
DPELHQWDO\VHQWLGRGHSHUWHQHQFLDPHGLDQWHODLGHQWLĆFDFLµQ
conocimiento de los hábitos ecológicos y la comunidad de aves.
387 Expansión del área de cría de Hirundo rustica
Page 206, Posters
ABSTRACT
t
Table of Contents
erythrogaster en Argentina (1980-2015)
Facundo A. Gandoy1*, Juan I. Areta1, Martin Carrizo, Cristian H.
Perez2, Pablo Petracci, David W. Winkler3, Kaspar Delhey4
ǢWTǣWTǤW382'££!#3(82-;,3£3+@T'6;3($3£3+@!2&
=3£<ধ32!8@-3£3+@TǥW$,33£3(-3£3+-$!£$-'2$'9T32!9,2-='89-;@
r
!$<2&3+!2&3@|@!,33W$31W!8
La Golondrina Tijerita (Hirundo rustica erythrogaster) se
reproduce en Norteamérica y migra hacia el sur durante el
invierno boreal. Sin embargo, un pequeño grupo de individuos
FRPHQ]µDQLGLĆFDUFHUFDGHHQ6XGDP«ULFDHQOD
provincia de Buenos Aires, Argentina. Registros aislados
demuestran la expansión de su zona de cría, sin embargo no
existe ningún estudio riguroso que documente la dinámica de
este proceso. Realizamos búsquedas de nidos en Buenos Aires
y provincias adyacentes entre 1999 y 2015 y suplementamos
nuestros registros con datos publicados. Contabilizamos 1240
REVHUYDFLRQHVHQSXHQWHV\DOFDQWDULOODVUHJLVWUDQGRSUHVHQFLD
ausencia y cantidad de nidos. Separamos nuestros datos y
los de la bibliografía en cuatro periodos: p1 (1980-1993), p2
(1999-2002), p3 (2009-2011) y p4 (2013-2015). Calculamos
HO£UHDP£[LPDRFXSDGDDOĆQDOGHFDGDSHULRGR\HQEDVHD
las diferencias de áreas entre periodos calculamos el aumento
anual promedio. El área de cría aumentó progresivamente de
NPtD³RHQWUHS\SDNPtD³RHQWUHS\S
\DNPtD³RHQWUHS\S'HQWURGHO£UHDFHQWUDOGH
cría (radio de 250km a partir del centro del área del periodo
1) aumentó el tamaño promedio de las colonias desde el año
QLGRVFRORQLDDOQLGRVFRORQLD(QHO
{փdփTT
ID t
ABSTRACT
t
mismo periodo la densidad de colonias también aumentó de
51% de ocupación a 75%, porcentaje que se mantiene estable
en el área central de cría y que decrece progresivamente
hacia la región periférica (~250Km). Concluimos que la
población se encuentra en aumento progresivo en área y
densidad de individuos y con una expansión centrífuga.
388 3UHIHU¬QFLDDOLPHQWDUGHDUDUDVD]XLVAnodorhynchus
hyacinthinus) por sementes de acuri (Attalea
phalerata) com ou sem exocarpo no Pantanal
Iara Roberta Azevedo-Niero1*, Wesley R. Silva1
ǢW2-$!16
ID t
ABSTRACT
t
Table of Contents
(Z=2,75; P=0,006), possivelmente devido à redução do tempo
gasto na manipulação da semente, conforme apontam estudos
anteriores. Sementes com exocarpo demandam maior tempo,
pois as araras-azuis necessitam removê-lo para ter acesso
ao endosperma das sementes. Sementes sem exocarpo são
abundantes no solo da área de estudo, sendo disponibilizadas
às araras-azuis após o exocarpo ter sido consumido
SULQFLSDOPHQWHSHORJDGR1RVVRHVWXGRFRQĆUPDDSUHIHU¬QFLD
das araras-azuis por sementes limpas de acuri, reforçando a
hipótese de que sua associação com o gado possivelmente
se desenvolveu a partir da dependência desta ave com os
grandes mamíferos da extinta megafauna sul-americana, o
que permitiu otimizar seu forrageamento em frutos de acuri.
r-!8!2-'83|+1!-£W$31
Para que animais maximizem seu aporte energético, diversos
comportamentos contribuem para que o ganho seja maior do
que os gastos despendidos no forrageamento. Esse princípio
tem sido invocado para explicar a preferência da araraazul (Anodorhynchus hyacinthinus) da região Pantanal-SulMatogrossense pelo consumo de sementes limpas de palmeiras,
sem a presença do exocarpo, evitando assim, os gastos em
removê-lo. Testamos essa hipótese realizando experimentos
com indivíduos de vida livre no Pantanal do Miranda.
Oferecemos, simultaneamente, sementes de acuri (Attalea
phalerata) com e sem exocarpo, em 12 sessões de experimento
que duravam até 12h. Após as araras-azuis deixarem
espontaneamente o local dos experimentos, as sementes
FRPLGDVIRUDPFROHWDGDVHLQVSHFLRQDGDV&RQĆUPDPRVD
preferência alimentar das araras-azuis por frutos sem exocarpo
Page 207, Posters
394 Comportamento de defesa de Athene
cunicularia (Aves: Strigiformes) em resposta a
aproximação de predadores a sua toca
Karla L. N. Fabiano1*, Jeane Silva Miranda1, Renata LealMarques1, Carlos Henrique Nunes1, Liliane Martins-Oliveira1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r£!8-99!#-3ǣǡǢǦ|+1!-£W$31
A resposta à aproximação de predadores aos ninhos pode ser
decisiva para garantir a sobrevivência e sucesso reprodutivo
de uma ave. Nossas hipóteses são que as características
morfológicas de um predador (modelo) vão interferir no
comportamento de defesa do ninho executada por Athene
cunicularia variando entre macho e fêmea; e que em locais
de maior perturbação antrópica as corujas serão menos
agressivas à aproximação de potenciais predadores. O trabalho
{փdփTT
ID t
ABSTRACT
t
foi realizado na zona urbana de Uberlândia-MG, Brasil. O
H[SHULPHQWRIRLUHDOL]DGRHPQLQKRVWRFDVVLPXODQGRD
DSUR[LPD©¥RGRVREMHWRVFDL[DGHSDSHO¥RFDFKRUURDUWLĆFLDO
e ser humano, nessa ordem. Cada objeto foi aproximado dos
ninhos três vezes, anotando-se a distância de voo e fuga, e o
comportamento executado por cada ave. Foram realizadas
medidas de perturbação e utilizados ANOVA dois fatores,
correlação de Spearman e qui-quadrado para análises. Foi
YHULĆFDGRTXHA. cunicularia não variou seu comportamento
de defesa (distância de voo e fuga, comportamento executado)
em resposta a aproximação de diferentes objetos e do ser
humano. Não houve variação na defesa em função do gênero
da ave. Não houve relação entre as variáveis de perturbação
e de comportamento da coruja quando da aproximação do
ser humano indicando uma possível habituação. Entretanto,
observamos correlação positiva entre a distância de fuga
de A. cunicularia nos testes com cachorro e caixa em relação
a perturbação próxima ao ninho. A. cunicularia se manteve
PDLVDOHUWDDTXDOTXHUREMHWRQ¥RLGHQWLĆFDGRTXDQWR
maior a perturbação no local, realizando movimentos de
intimidação e ataque ao predador. Agradecimento: Fapemig
ID t
ABSTRACT
t
Table of Contents
considered globally as Vulnerable. In Brazil, it is rare
DQGbVSDUVHO\GLVWULEXWHGPRVWO\LQKLJKODQGVRIWKHVRXWKHUQ
DQGbVRXWKHDVWHUQUHJLRQV'HWDLOVRQWKHJHRJUDSKLF
DOWLWXGLQDODQGbFXUUHQWVWDWXVLQ%UD]LODUHUHYLHZHGKHUH
EDVHGRQRXURZQREVHUYDWLRQVDQGbRQSXEOLVKHGUHFRUGV
DQGbGLJLWDOYRXFKHUV,QWKHVWDWHVRI6¥R3DXOR0LQDV
*HUDLVDQGb5LRGH-DQHLURWKHVSHFLHVRFFXUVIURPURXJKO\
500 up to 2000 m above sea level, while in southern states
RI6DQWD&DWDULQDDQGb5LR*UDQGHGR6XOLWRFFXUVDOVRLQ
elevations up to around 1000m. The occurrence of the
species in high altitudes during the colder months indicates
that the population is year-round resident. In Campos do
Jordão, São Paulo state, the Black-capped Piprites is not
uncommon, being present in 11 of 354 Mackinnon?s lists,
with a Frequency in Lists Index of 3.11. In both regions the
species is mainly associated to Araucaria forest. Furthermore,
population estimatives throughout its range are needed to
HYDOXDWHWKHVWDWXVRIWKHVSHFLHVDQGbSURSRVHFRQVHUYDWLRQ
strategies in different regions of its distribution.
396 Natural history and distribution of the Black-capped
Piprites pileata in Brazilian Atlantic Forest
Karla V C Barbosa1*, Thiago V V Costa2, Lus F Silveira2
ǢW!#38!;8-3&'$3£3+-!'8-$!&!TǣW<9'<&' 33£3+-!&!
r#!8#39!W0!8££!|+1!-£W$31
Piprites pileata is a poorly known passerine endemic to
WKH$WODQWLF)RUHVWRI%UD]LODQGb$UJHQWLQD,WLVFXUUHQWO\
Page 208, Posters
{փdփTT
ID t
ABSTRACT
t
398 Inventário e catalogação das aves de Alagoas:
lacunas do conhecimento e conservação
L. C. S. Cavalcante1*, R. Gaban-Lima2,3
ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9
lmT';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T
2-='89-&!&'
'&'8!£&'£!+3!9T!$'-TT8!9-£WTǣW!#38!;8-3&'38(3£3+-!T
-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmTǤW2-='89-&!&'
'&'8!£
&'£!+3!9<9'<&'-9;8-!!;<8!£&!2-='89-&!&'
'&'8!£&'£!+3!9
r$!=!£$!2;'£!<8'2'|+1!-£W$31
Alagoas abriga dois notáveis biomas brasileiros, a Caatinga
e a Mata Atlântica, havendo uma nítida faixa de transição
ecológica entre eles, conhecida como Agreste. Apesar dessa
YDULHGDGHGHDPELHQWHVHGDVXDFRPSOH[LGDGHELRJHRJU£ĆFD
ainda não está disponível uma compilação criteriosa das
aves do estado. Esse estudo tem como objetivos realizar
OHYDQWDPHQWRELEOLRJU£ĆFRGLJLWDOHHPFROH©·HVRUQLWROµJLFDV
visando a confecção do “Catálogo das Aves de Alagoas” (em
elaboração pelo LSEA), onde se mapeará a distribuição das
diferentes espécies, gerando informações que norteiem
políticas públicas de conservação, demais estudos ornitológicos
HTXHLQGLTXHPDVUHJL·HVGHĆFLHQWHPHQWHLQYHVWLJDGDV3DUD
cada registro compilado todas as informações disponíveis
estão sendo reunidas (e, g,: procedência, tipo de registro,
sinonímias, autoria, etc.). Até a conclusão desse resumo foram
levantadas 82 localidades (bem delimitadas) com algum
relato de Aves para Alagoas. Por meio desse levantamento
ĆFDHYLGHQWHTXHDVLQYHVWLJD©·HVRUQLWROµJLFDVV¥REDVWDQWH
mal distribuídas, e que as porções mais interioranas, e
Page 209, Posters
ID t
ABSTRACT
t
Table of Contents
DTXHODVPDLVFRVWHLUDVV¥RGHĆFLHQWHPHQWHDPRVWUDGDV
Até o momento foi detectada a ocorrência de 515 táxons,
HVSHF¯ĆFRVRXVXEHVSHF¯ĆFRVHGHVVHVV¥RRĆFLDOPHQWH
considerados ameaçados de extinção (nas diferentes
categorias), sendo três deles já extintos. Desses táxons até
agora compilados, 54 são endêmicos da Mata Atlântica e
10 da Caatinga, evidenciando que as áreas de Caatinga são
GHĆFLHQWHPHQWHLQYHQWDULDGDV$LQGD«HYLGHQWHRJUDQGH
número de espécies politípicas, reforçando a necessidade
de serem realizados mais estudos de taxonomia alfa.
399 Efecto del pastoreo en la formación de bandadas invernales de
las aves granívoras del desierto del Monte central, Argentina
Agustn Zarco1*, Victor Rodolfo Cueto2
ǢWl8<63&'2='9ধ+!$-Õ2'2$3£3+!&'31<2-&!&'9&''9-'8;3mf
!&-A!Tf'2&3A!TǣW8<63&'2='9ধ+!$-Õ2'2$3£3+!&'
31<2-&!&'9&''9-'8;3l$3&'9mT'2;83&'2='9ধ+!$-Õ297<'£&'
32;!Ó!@9;'6!!;!+2-$!9lmT329'/3!$-32!£&'2='9ধ+!$-32'9
-'2঩)$!9@Ì$2-$!9lm@2-='89-&!&!$-32!£&'£!!;!+32
r!+<9ধ2A!8|+1!-£W$31
Se ha propuesto que la formación de bandadas mixtas
durante la temporada no reproductiva (época invernal) es un
FRPSRUWDPLHQWRTXHDXPHQWDODHĆFLHQFLDHQODE¼VTXHGDGH
alimento. Este agrupamiento sería especialmente importante
para las aves granívoras en ambientes desérticos, donde las
semillas no se encuentran distribuidas homogéneamente y
pueden llegar a ser escasas. Los cambios en la abundancia
de las semillas podrían entonces afectar el comportamiento
{փdփTT
ID t
ABSTRACT
t
ID t
de agregación en bandadas. En los bosques de Prosopis
ćH[XRVD del desierto del Monte central, el pastoreo reduce
notoriamente la abundancia de semillas de gramíneas, principal
alimento de las aves granívoras y concomitantemente las
aves son menos abundantes en esos ambientes. Para analizar
si el pastoreo afecta al agrupamiento de aves granívoras,
comparamos por medio de conteos en transectas durante
dos inviernos consecutivos la proporción de individuos
que se encuentran en bandadas o solitarios en bosques de
3URVRSLVćH[XRVD con y sin pastoreo. Además, comparamos el
número y el tamaño de las bandadas en ambas situaciones.
Observamos que en bosques pastoreados, la proporción de
LQGLYLGXRVTXHVHHQFXHQWUDQDJUXSDGRVHVVLJQLĆFDWLYDPHQWH
menor que en las zonas no pastoreadas (test dif. de prop
p<0.01 para todas las especies). Pero, aunque las bandadas
fueron más pequeñas, el número de bandadas per capita
fue mayor en los bosques pastoreados. Concluimos que la
reducción en el número de semillas de gramíneas incrementa
la formación de bandadas, pero debido a la baja densidad
de las aves en los bosques pastoreados, el tamaño de las
bandadas es menor que en los bosques sin pastoreo.
400 Preliminary avifauna census of the Parque Natural
Page 210, Posters
ABSTRACT
t
Table of Contents
Municipal do Curió de Paracambi (RJ, Brazil) as
support for evaluation of environmental quality
Ramiro Drio Melinski1*, Ana Carolina Maciel2, Renan Dias2,
Mariana Vabo2, Ildemar Ferreira2, Fálvia Rocha2
ǢWTǣW
r8!1-831'£-290-|,3;1!-£WW$31
The Parque Natural Municipal do Curió de Parcambi (PNMCP)
has great ecological importance in protecting a remnant of
Atlantic Forest in one of the priority conservation areas of
this ecosystem, the Tinguá-Bocaina Biodiversity Corridor.
It is possible to evaluate forest landscapes conservation
status by describing their animal community, as some species
are sensitive to changes in forest structure, factors such
as vegetation composition and size of forest fragments
can determine the presence or absence of such species.
A census of the avifauna is necessary for biodiversity
conservation planning actions because birds are one of the
most distinct and well-described zoological groups, and can
be used as bio-indicators of environmental change. The main
methodology used for data collection was Fixed Sampling
Point, applied monthly in three transects. So far, 90 species
have been recorded, from 37 families, of which Tyrannidae
(n=8; 8.89%) is the most representative. Three species in
“Near Threatened” status (Primolius maracana, Dysithamnus
stictothorax and Ramphodon naevius) were recorded; and one
species of “Vulnerable” status (Procnias nudicollis). There are
also 17 species endemic to the Atlantic Forest, with restricted
GLVWULEXWLRQRUWKUHDWHQHGE\KXQWLQJRUWUDIĆF$OWKRXJKWKHVH
{փdփTT
ID t
ABSTRACT
t
data are preliminary and might not represent all the species
in PNMCP, the presence of Threatened and Near-Threatened
and endemic species, along with the perspective of records of
new species can provide support for greater efforts to protect
this area, historically hit by deforestation and poaching.
401 Systematic sampling in the Pampas biome shows
geographic expansion of forest birds in areas
with grassland matrix in southern Brazil
Christian Borges Andretti1*, Eduardo Chiarani1,
Carla Suertegaray Fontana1
ǢW!#38!;8-3&'82-;3£3+-!W<9'<&'-Í2$-!9''$23£3+-!&!
32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£T
r!2&8'ষW;$,'|+1!-£W$31
Grasslands of southeastern South America are one of
the most extensive open ecosystems in the Neotropical
region. Extensive riparian forests occur in association to
the grassland matrix, extending the occurrence of many
forest species. From September 2014 to January 2015
we surveyed birds in 13 sites spread across the Brazilian
southern grasslands, through expeditions lasting 4-6 days
at each site. We recorded both grassland and forest species,
that occur in forest formations associated to these open
areas (e. g. riparian forests, forest patches, etc.). We recorded
12 species of forest birds in areas of the Pampas biome
(Crypturellus obsoletus, Glaucidium brasilianum, Stephanoxis
lalandi, Conopophaga lineata, Chamaeza campanisona, Leptopogon
amaurocephalus, Tolmomyias sulphurescens, Euscarthmus
Page 211, Posters
ID t
ABSTRACT
t
Table of Contents
meloryphus, Cnemotriccus fuscatus bimaculatus, Megarynchus
pitangua, Dendrocolaptes platyrostris, Tersina viridis), increasing
their geographic distributions. Most species were recorded in
forested areas along streams in predominantly open habitats.
These species are characteristic of Atlantic Forest and their
expansion occur through forest corridors, mainly riparian
forests. The lack of a larger sample in forest formations
inserted in the Pampas biome is certainly one of the main
UHDVRQVIRUWKLVIRUWKLVQHZUHFRUGVKLJKOLJKWLQJWKHGHĆFLHQW
sampling effort on these habitats in the most southern
portion of the species distribution. Therefore, we emphasize
the importance of these corridors for the occurrence and
dispersion of forest bird species in areas of grassland matrix.
402 Distintos refúgios climaticamente estáveis do
4XDWHUQ£ULRQ¥RLQćXHQFLDPDYDULD©¥RPROHFXODUH
acústica de0\LRWKO\SLVćDYHROD(Aves: Parulidae)
Caio Brito1*, Erich Mariano2, Helder Araujo2
ǢW2-='89-&!&'
'&'8!£&!!8!Ð#!TǣW2-='89-&!&'
'&'8!£&'!16-2!8!2&'
r$!-3#1#8-;3|+1!-£W$31
A distribuição de 0\LRWKO\SLVćDYHROD, bem como vários habitats
em que ocorre, é similar à distribuição de áreas estáveis de
)ORUHVWDV(VWDFLRQDLV'HFLGXDLV)('VDRORQJRGDVćXWXD©·HV
climáticas do Quaternário Superior. Embora a distribuição
de 0ćDYHROD pareça estar relacionada com a distribuição
GHćRUHVWDVVHFDVQRQRUGHVWHEUDVLOHLURDHVS«FLHWDPE«P
RFRUUHHP£UHDVćRUHVWDLVQD)ORUHVWD$WO¤QWLFD)$$VVLP
como áreas de FEDs demonstraram-se estáveis durante
ćXWXD©·HVFOLP£WLFDVQRV¼OWLPRVDQRVDGLVWULEXL©¥R
{փdփTT
ID t
ABSTRACT
t
da FA na região nordeste no Brasil também demonstrou forte
HVWDELOLGDGHGXUDQWHDVPHVPDVćXWXD©·HVFOLP£WLFDV2
objetivo foi testar as hipóteses de estruturação genética e vocal
de populações de 0ćDYHROD, entre habitats de FEDs e FA no
nordeste brasileiro utilizando um marcador molecular (cytb) e o
canto espontâneo da espécie. Foram utilizadas as metodologias
cabíveis para coleta de amostras, extração de DNA e posterior
DPSOLĆFD©¥RHVHTXHQFLDPHQWR$VJUDYD©·HVIRUDPREWLGDV
pessoalmente ou em museus e bancos de dados públicos. Os
resultados obtidos sugerem que 0ćDYHROD é uma espécie
UHODFLRQDGDDDPELHQWHVćRUHVWDLVDVVRFLDGRVDê'LDJRQDOGH
formações abertas” da América do Sul e que possui uma baixa
taxa de variabilidade genética, como táxons de ambientes
DEHUWRVHGLIHUHQWHVGHW£[RQVGHćRUHVWD¼PLGD$VYDULD©·HV
moleculares e acústicas não apresentaram estruturação nas
populações amostradas no nordeste brasileiro, ou seja, partindo
do pressuposto que a espécie é associada às FEDs e que a
colonização das populações na FA do nordeste remonta uma
história mais recente, não seria esperado estruturação genética.
403 Male only parental care compensates loss of the female
in the biparental Rufous Hornero (Furnarius rufus)
Talita V. Braga1*, James J. Roper2
ǢW2-='89-&!&'
'&'8!£&3!8!2ÆTǣW2-='89-&!&'-£!'£,!T
ID t
ABSTRACT
t
Table of Contents
When one sex reduces parental effort, the other may maintain,
increase, also reduce its parental effort, or may even abandon
WKHQHVW7KLVVH[XDOFRQćLFWFDQEHEHWWHUXQGHUVWRRGZKHQ
one member of a pair can be removed or is handicapped
in some way that reduces its effort. Most of experimental
studies assessed female response to reduced effort by males
and found that they compensated for the loss by increasing
care. However, the effort by the female tends to be less than
that of the total care when males also contribute, and this
UHGXFHGFDUHVKRXOGUHVXOWLQUHGXFHGĆWQHVV,QDQDWXUDO
experiment in southern Brazil of a male Rufous Hornero
(Furnarius rufus) whose mate disappeared during the nestling
stage, we examined whether a single male compensates for
the loss of the female, and if so, to what degree. Parental care
was observed in 13 nests (12 pairs and the single male) during
a total of 39 hours. This single male fed nestlings much more
often than paired males and at a similar rate to that of pairs. He
also removed feces more often than other males or pairs. We
show that males can completely compensate the loss of the
female while caring for growing nestlings. Thus, both males,
and females, in pairs of Rufous Horneros, perform at a slower
rate than their ability should allow, thereby supporting the
LGHDRIVH[XDOFRQćLFWLQELSDUHQWDOFDUHVSHFLHV)XWXUHVWXGLHV
PD\H[DPLQHKRZWKLVLQFUHDVHLQSDUHQWDOFDUHLQćXHQFHV
survival of the individual adult as well as of the young.
r;!£-;!=#8|+1!-£W$31
3DUHQWDOFDUHLQELSDUHQWDOVSHFLHVFDQJHQHUDWHFRQćLFW
between the sexes, in which one sex may attempt to reduce
its effort, thereby coercing the other sex to increase effort.
Page 212, Posters
{փdփTT
ID t
ABSTRACT
t
406 Paleodistribuição potencial e variação acústica
não suportam o status de subespécie em
0\LRWKO\SLVćDYHROD (Aves, Parulidae)
Caio Brito
'XUDQWHSHU¯RGRVJHROµJLFRVSUHW«ULWRVDVćRUHVWDV¼PLGDV
HćRUHVWDVVHFDVSDVVDUDPSRUH[SDQV·HVHUHWUD©·HVGHYLGR
ao aquecimento e resfriamento do planeta. Alguns autores
propuseram que as áreas atualmente disjuntas das FEDs
poderiam ter se conectado durante o Quaternário, como
por exemplo, na hipótese do arco pleistocênico. Outros
autores sugerem que houve um longo período sem conexões
HQWUHDVćRUHVWDVVHFDVDRVXOHDRQRUWHGD$PD]¶QLD
desde, pelo menos, o Quaternário Superior. Desse modo,
alterações climáticas do Quaternário Superior poderiam ter
possibilitado conexão das populações atualmente disjuntas
GH0\LRWKO\SLVćDYHROD0IćDYHRODH0ISDOOLGLURVWULV), assim
FRPRDOJXPDVSURSRVWDVGDV)('V2REMHWLYRIRLYHULĆFDU
DLQćXHQFLDGHIDWRUHVSDOHRFOLP£WLFRVQDGLVWULEXL©¥RGH
0ćDYHRODHDVVRFLDUHVVHVUHVXOWDGRV¢YDULD©¥RYRFDO
entre as populações das duas subespécies reconhecidas,
utilizando o canto espontâneo da espécie. Através de nossas
modelagens de nicho ecológico (ENM) obtivemos quatro
modelos referentes aos quatro períodos que abordamos neste
estudo (Presente, Holoceno, LGM e LIG). Não encontramos
HVWUXWXUD©¥RJHRJU£ĆFDHQWUHPHGLGDVGDVJUDYD©·HVGHM. f.
pallidirostris (populações ao norte da Amazônia) e 0IćDYHROD
(populações ao sul e sudeste da Amazônia). As populações
de 0IćDYHROD e M. f. pallidirostris não apresentaram
GLIHUHQ©DVVLJQLĆFDWLYDVHPVHXVFDQWRVHVSRQW¤QHRVDO«P
Page 213, Posters
ID t
ABSTRACT
t
Table of Contents
das ENMs terem mostrado uma conexão recente (LGM e
LIG) entre as duas populações, hoje isoladas. Mais pesquisas,
com amostragens genéticas, observação de campo e mais
gravações, são necessárias para complementar nossos dados.
407 Analysis of biometric data and chest
circumference of Amazona vinaceae
Vanessa Tavares Kanaan1*, Rafael Meurer23DWULFLD3HUHLUD6HUDĆQL3
ǢW29ধ;<;396!3-£='9;8'TǣW2-='89-&!&'
'&'8!£&'!2;!!;!8-2!T
ǤW'2;83!$-32!£&''97<-9!'329'8=!3&'='9-£='9;8'9
r=!2'99!0!2!!2|+1!-£W$31
A common pattern among closely related animal taxa is that
species vary little in terms of overall size. This implies that
the evolutionary process creating this pattern involves an
element of internal constraints. In order to maintain a record
of natural variations between individuals, we analyzed the
biometrics of 96 Amazona vinacea: 90 birds were illegal wildlife
trade victims and six were offspring of apprehended birds
born at the Curitiba Zoo. All subjects were release candidates
of the “Reintroduction of the A. vinacea at the Araucárias
National Park, Santa Catarina, Brazil” project. In this study we
tested the hypothesis that morphometrics would be similar
within the group. Using a caliper and scales, the following
parameters were measured and the average was calculated:
the total length (351,87mm, n=31), tarsus diameter (7,94mm,
n=74), beak length or culmen (26,68mm, n =71), beak width
(18,62mm, n= 79), tarsal length (23,55mm, n= 64), wing length
(217,81mm, n= 81), tail length (11,87, n= 96), total length of
the head (61,41, n=51), body weight (373, 71g, n=91). The
{փdփTT
ID t
ABSTRACT
t
chest circumference (27,3cm, n=42) was calculated with a
tape measure. Statistical analysis using a t-test showed no
VLJQLĆFDQWGLIIHUHQFHVEHWZHHQWKHVHWRILQGLYLGXDOVIURPWKH
apprehension and the zoo (P >0.05 for all parameters) showing
homogeneity of the group of individuals sampled. The study
of biometrics provides important information of basic biology
and natural variation between individuals of Amazona vinacea.
409 Avifauna do Campus A.C. Simões - UFAL: composição,
HVWUXWXUDWUµĆFDHTXDOLGDGHDPELHQWDO
T. K. Guedes1*, C.F.M. Ferreira1, W.O. Silva1, R. Gaban-Lima1
ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmT
';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&'
'&'8!£&'£!+3!9<9'<&'-9;8-!!;<8!£&!2-='89-&!&'
'&'8!£&'£!+3!9
r;!-2!0!83£-2'+<'&'9|@!,33W$31W#8
As alterações na avifauna geradas pela expansão urbana
são mal compreendidas em virtude das diferenças nos
contextos regionais e dos tipos de ordenamento urbano,
de gerenciamento e de manejo da paisagem. No município
de Maceió, o Campus A. C Simões possui um mosaico de
ambientes urbanizados, cuja comunidade de aves ainda é
pouco investigada. Este estudo tem como objetivos (1) realizar
inventários qualitativo e quantitativo (Pontos de contagem
GHCGDVDYHVQR&DPSXVDYDOLDUDHVWUXWXUDWUµĆFD
dessa comunidade e (3) investigar parâmetros relacionados à
qualidade ambiental que possam funcionar para análises de
bioindicação; visando contribuir para aumentar o conhecimento
acerca da comunidade de Aves urbanas do Nordeste do Brasil,
HJHUDULQIRUPD©·HVTXHSRVVDPDX[LOLDUDGHĆQL©¥RGHPHGLGDV
Page 214, Posters
ID t
ABSTRACT
t
Table of Contents
para o ordenamento, gerenciamento e manejo do campus e
do entorno. As amostragens foram realizadas de setembro de
2014 até abril de 2015 (11 pontos e 20 horas de observação por
mês). No total foram registradas 61 espécies, sendo a maioria
(90%) pouco sensível às perturbações ambientais. A guilda com
maior riqueza foi a dos onívoros (21), seguida dos insetívoros
(14) e dos granívoros (9), entretanto, a guilda mais abundante
foi a dos detritívoros (39,1% da comunidade), seguido pelos
onívoros (35,3%) e pelos insetívoros (16,2%). A elevada
abundância de detritívoros (representados apenas por 3
HVS«FLHVGH&DWKDUWLGDHHYLGHQFLDDJUDYHGHĆFL¬QFLDVDQLW£ULD
local. A ausência de aves altamente sensíveis, acompanhadas
da elevada proporção de espécies pouco sensíveis, evidenciam
claramente a degradação ambiental do campus e entorno.
411 Historical biogeography of Campylopterus largipennis
complex (Trochilidae) in Amazonian, seasonally
dry tropical Forests and campos rupestres
Anderson Chaves
The hummingbird Campylopterus largipennis is the
most widespread species in its genus, ranging from
ORZODQGb$PD]RQLDQUDLQIRUHVWVWRKLJKDOWLWXGHURFN\
grasslands in southeastern Brazilian mountaintops. The
current taxonomic treatment deemed C. largipennis as a
SRO\WLSLFVSHFLHVUHSUHVHQWHGE\IRXUVXEVSHFLHVLQbDbFRPSOH[
(largipennis, obscurus, aequatorialisDQGbdiamantinensis). In
this present study we evaluated the taxonomic status of the
subspecies described by Bayesian phylogenetic reconstructions
{փdփTT
ID t
ABSTRACT
t
ZLWKPLWRFKRQGULDODQGbQXFOHDUPROHFXODUPDUNHUV6HTXHQFHV
were obtained from 1035bp for ND2 gene, 1023bp for BF7
DQGbESIRU*3'+DWRWDORILQGLYLGXDOVDQDO\]HGIURP
ORFDWLRQV%D\HVLDQLQIHUHQFHQHWZRUNVDQGbWUHHVLQGLFDWH
an ancient separation of the corresponding clades Amazonian
VXEVSHFLHVRIFODGHVRIFHQWUDODQGbHDVWHUQ%UD]LO&RQVLGHULQJ
the current nomenclature for the Amazonian subspecies of C.
largipennis there was the formation of monophyletic groups
to C. l. obscurusDQGbC l. aequatorialisDQGbWKHVHVXEVSHFLHV
DUHGLYLGHGLQWRĆYHFODGHV2QO\C. l. largipennis formed
a monophyletic clade. In addition, we observed clades
corresponding to the areas of bird endemism in the Amazon,
ZKLFKDUHODUJHO\GHĆQHGE\ZDWHUVKHGV+RZHYHUWKHGDWD
LQGLFDWHSUREDEOHJHQHćRZEHWZHHQWKHKHDGZDWHUVRIPDMRU
southern tributaries of the Amazon River. Our results agree
ZLWKUHFHQWPRUSKRORJLFDODQDO\VHVRIWKLVFRPSOH[DQGbDUH
also consistent with the separation of Campylopterus sp. nov.
from the dry forest, as an independent taxonomic unit of C. l.
diamantinensis, so that both could be elevated to species status.
413 Primeiros registros de reprodução de Tyrannus savana
(Aves, Tyrannidae) na Amazônia Brasileira: Amazônia
Ocidental como nova fronteira reprodutiva?
Glauko Correa da Silva
ID t
ABSTRACT
t
Table of Contents
savana (raça meridional), que realiza migração até Equador,
Colômbia, Guiana, Curaçao, Trinidad e Texas. Ocorre na
Amazônia entre fevereiro a julho, sendo sua área de invernada
os campos e adjacências dessa região. Para o Planalto Central
do Brasil migra de julho a agosto, se reproduzindo de setembro
a dezembro. A partir de setembro, passa o seu segundo
pico migratório, provavelmente de aves que se reproduzem
no Sul do Brasil, Argentina e Uruguai. Após a reprodução
no Planalto Central, se deslocam para o Norte de janeiro a
fevereiro. Durante buscas de ninhos ativos de aves, nas áreas
GHLQćX¬QFLDGLUHWDGRUHVHUYDWµULRGD$+(-LUDX5RQG¶QLD
foram registrados ninhos ativos de T. savana (N=7), na
localidade dos Igarapés: Jirau, Raul e Mutum, tributários do Rio
Madeira, entre os meses de outubro a dezembro de 2014. Em
MDQHLURGHHMDQHLURIHYHUHLURGHIRUDPUHJLVWUDGRV
jovens e adultos nas localidades supracitadas, diferentemente
do esperado em literatura no qual os indivíduos retornam e
se reproduzem no Planalto Central. As aves da população do
Sul do Brasil se reproduzem um pouco mais tarde que as do
3ODQDOWR&HQWUDOVHQGRHQFRQWUDGRVĆOKRWHVQRVQLQKRVHP
janeiro, deixam o Rio Grande do Sul em fevereiro e março,
voltando a este Estado em setembro. Portanto comportamento
semelhante pode estar acontecendo concomitantemente
HP5RQG¶QLD(VWH«RSULPHLURUHODWRQDOLWHUDWXUDFLHQW¯ĆFD
de registro reprodutivo na Amazônia de T. savana.
3+39WW
+£!<0388'!|@!,33W$31W#8
A espécie migratória Tyrannus savana de ampla distribuição no
Brasil, apresenta-se em sub-espécies, com destaque T. savana
Page 215, Posters
{փdփTT
ID t
ABSTRACT
t
414 Fungal characterization in occupied nests
by free-living Amazona brasiliensis
Rafael Meurer1*, Cristiane Kiyomi Miyaji Kolesnikovas2, Elenise Angelotti
Bastos Sipinski3, Frederico Fontanelli Vaz43DWULFLD3HUHLUD6HUDĆQL5
ǢW2-='89-&!&'
'&'8!£&'!2;!!;!8-2!TǣW993$-!3Ǥ2-1!£TǤW3$-'&!&'
&''97<-9!'1-&!'£=!+'1'&<$!31#-'2;!£TǥW2-='89-&!&'
'&'8!£
&3!8!2ÆTǦW'2;83!$-32!£&''97<-9!'329'8=!3&'='9-£='9;8'9
r8(!W1'<8'8i|,3;1!-£W$31
Amazona brasiliensis is a Psittacidae rated in the Brazilian list
as near threatened with extinction, but highly dependent on
management. It is endemic to the Atlantic Forest and has a
restricted range on the south coast of Brazil. Currently, the
total population is estimated at 6.650 individuals, 5.000 only
for the state of Paraná. Among the actions outlined in the
National Action Plan for the Conservation of Parrots of the
Atlantic Forest, published in 2011, is the characterization of
WKHKHDOWKSURĆOHRISRSXODWLRQVRIA. brasiliensis, A. pretrei,
A. rhodocorytha and A. vinaceae in the wild. The objective of
this study was to identify fungi present in the substrate of the
DUWLĆFLDOZRRGRU39&QHVWVRFFXSLHGE\A. brasiliensis sampled
and determine the natural patterns of fungi occurring during
the reproductive period. The collections of the samples took
place between December 2014 and January 2015, at Rasa
Island (PR), using sterile plastic swabs and transport media. The
nests surveyed (n=21) contained nestlings with age between
30 and 55 days. The microbiological and morphological analysis
was performed following standard methodology (WINN et
DOFRORQLHVZHUHLVRODWHGIURPĆODPHQWRXVIXQJL
being 70.9% (n = 17) Aspergillus sp., 12.6% (n = 3) Trycophyton
Page 216, Posters
ID t
ABSTRACT
t
Table of Contents
sp., 4.1% (n = 1) Microsporum gypseum, 4.1 % (n = 1) Fusarium
sp., 4.1% (n = 1) Mucor sp., 4.1% (n = 1) Syncephalastrum sp.
The results constitute unprecedented characterization
of fungal microbiota of the nests of this species and are
important for monitoring the health of the population and
an essential tool to management and conservation efforts.
415 Padrões de distribuição, riqueza e conservação de
psitacídeos (Aves:Psittacidae) da Caatinga
Marcos Silva1*, Flvia Pinto2, Luciano Naka1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3TǣW
r1!8$39=-2-$-39i/(|@!,33W$31W#8
A compreensão dos padrões macro-ecológicos de distribuição
de espécies é um tema de grande relevância para a biologia,
principalmente quando se trata da conservação de espécies
ameaçadas de extinção. A Caatinga possui 14 espécies de
psitacídeos ocorrendo na região, com 5 espécies enquadradas
em alguma categoria de ameaça. Nós obtivemos pontos
georreferenciados de ocorrência e criamos a representação
GDGLVWULEXL©¥RJHRJU£ĆFDGDVHVS«FLHVGHSVLWDF¯GHRV
através de polígonos de distribuição gerados por especialistas,
mínimos polígonos convexos e modelagens de nicho ecológico,
resultando em mapas de distribuição que foram comparados
entre si, indicando qual método mais se aproxima da
distribuição baseado nas localidades de ocorrência. Criamos
mapas de riqueza de espécies e relacionamos estes mapas,
indicando qual melhor representa a riqueza de psitacídeos
na Caatinga. Ainda sobrepomos o mapa de unidades de
{փdփTT
ID t
ABSTRACT
t
conservação da Caatinga sobre o mapa de riqueza, para avaliar
o quanto das áreas mais ricas está protegido. Os mapas de
GLVWULEXL©¥RJHRJU£ĆFDGLIHULUDPVLJQLĆFDWLYDPHQWHTXDQWR
ao método utilizado, onde sugerimos cautela ao lidar com
cada um desses métodos. Devido a não uniformidade dos
mapas, a comparação entre métodos determina a melhor
escolha do mapa de distribuição. Os mapas produzidos por
polígonos de especialistas, por exemplo, podem incluir áreas
onde não há registros documentados e excluir áreas com
registros recentes para as espécies. O sul do Piauí, sudoeste
da Bahia, e litoral do Ceará são as áreas mais ricas em
espécies de psitacídeos na Caatinga, as quais estão pouco
representadas nas unidades de conservação da região.
416 Sucesso reprodutivo de Formicivora acutirostris em
estuário sujeito à variação diária das marés
Bianca Luiza Reinert1*, Claudia Golec, Marco
Aurlio Pizo2, Marcos Ricardo Bornschein3
ǢW!;'8!;<8!29ধ;<;3&'9;<&391#-'2;!-9TǣW2-='89-&!&'
9;!&<!£!<£-9;!fTǤW83+8!1!&'Õ9f8!&<!%È3'1
$3£3+-!T329'8=!3'!2'/3&!-&!-£='9;8'T29ধ;<;3&'
-Í2$-!9-3£+-$!9T2-='89-&!&'
'&'8!£&'-2!9'8!-9
r#-!2$!8'-2'8;|@!,33W$31W#8
ID t
ABSTRACT
t
Table of Contents
compartilham as atividades de reprodução. Estudamos a sua
reprodução de 2006 a 2015 na baía de Guaratuba, Paraná,
com busca por ninhos nos territórios e monitoramento de
QLQKRVHĆOKRWHVIRUDGRVQLQKRV(QFRQWUDPRVQLQKRV
dos quais 382 chegaram a ter ovos e, dentre eles, 119 tiveram
sucesso (31%). As causas de insucesso mais recorrentes foram
predação (38%), alagamento por maré (27%) e queda do ninho
(11%). Causas de insucesso relacionadas com água, vento e
calor superaram predação, com 43%. Alagamento e predação
não são constantes ao longo da estação reprodutiva, tendo
picos em momentos opostos: alagamento percentualmente
maior em setembro e outubro e predação em novembro
e dezembro. O alagamento de ninhos é maior quando são
PDLVDOWDVDVPDU«V$PDLRULDGRVĆOKRWHVTXHVDLXGRQLQKR
VREUHYLYHXDW«VHWRUQDULQGHSHQGHQWHGHĆOKRWHV
Dos que saíram e morreram, pelo menos 28% morreram no
dia da saída do ninho, alguns afogados. Grande parte dos
ĆOKRWHVTXHFKHJDUDP¢LQGHSHQG¬QFLDVDLXGRQLQKRHP
outubro (47%). O sucesso reprodutivo da espécie é afetado
SRUDVSHFWRVVXMHLWRV¢PXGDQ©DFOLP£WLFD&RQĆUPDQGRVH
as previsões de aumento do nível do mar e da incidência de
eventos climáticos extremos, como vendavais, a espécie poderá
sofrer desequilíbrios populacionais, além de redução de hábitat.
Aves estuarinas são vulneráveis à mudança climática, podendo
sofrer perda de habitat e redução do sucesso reprodutivo
pelo aumento do nível do mar, entre outras causas. Formicivora
acutirostris é uma espécie ameaçada que ocorre em menos
de 6 mil hectares distribuídos em parte do litoral sul do
Brasil, principalmente em estuários. Ela vive em casais que
Page 217, Posters
{փdփTT
ID t
ABSTRACT
t
417 Systematics of the ‘chordeiline’ nighthawks (Caprimulgidae)
and revalidation of Nannochordeiles Hartert, 1896
ID t
ABSTRACT
t
Table of Contents
418 On the holotype and type locality of the mysterious
Cayenne Nightjar Setopagis maculosa (Caprimulgidae)
Thiago V V Costa1*, Bret M Whitney2, Lus F Silveira1
Thiago V V Costa1*, Johan Ingels2, Vagner Cavarzere1, Lus F Silveira1
ǢW<9'<&' 33£3+-!&!TǣW
-'£&<-&'92$W
!2&<9'<13(!;<8!£$-'2$'
ǢW<9'<&' 33£3+-!&!TǣW!£+'2#'8+£!!2ǨTfǨǡǧǡ'9;'£#'8+'2T'£+-<1
r;==$39;!|+1!-£W$31
The Cayenne Nightjar (Setopagis maculosa) was described
based on a single male specimen collected by Samuel Klages
in French Guiana, northeastern South America. Since then, no
new specimens or reliable records have been made and the
validity of the species has been questioned. A detailed analysis
of the holotype reveals that it has unique and distinctive
morphological traits that support the validity and taxonomic
status of the species, being provisionally placed in Setopagis
until additional data are available. Some features of its plumage
ZKLFKDUHLPSRUWDQWIRUĆHOGLGHQWLĆFDWLRQKDYHEHHQODUJHO\
overlooked. These especially include the overall brownish
XSSHUSDUWVWKHJUD\FURZQĆQHO\VWUHDNHGLQEODFNDQGWKH
rufous sides of the head. New information on the type locality
at the time of collection of the holotype contained in Klages’s
diaries also sheds some light on the habitat where this species
ZDVFROOHFWHGZKLFKPD\KDYHEHHQWHUUDĆUPHIRUHVW
The subfamily Chordeilinae had long been considered a
well-characterized group and including the genera Podager,
Lurocalis, Nyctiprogne and Chordeiles. However, recent molecular
studies revealed that Chordelinae is not monophyletic, as
Lurocalis and Nyctiprogne are more close related to other
groups than to Chordeiles and Podager. Those studies showed
also that Chordeiles is not monophyletic, as C. pusillus and
P. nacunda are sister taxa. For this reason, P. nacunda was
included in Chordeiles, or alternatively C. pusillus was included
within Podager. Here we present a systematic review of the
group based on external, morphological characters and a
phylogenetic analysis of the group based on 40 osteological
characters. The analysis showed a strong support for the
group composed by Chordeiles spp (including C. nacunda),
with absence of Lurocalis and Nyctiprogne. Also, the results
showed Chordeiles nacunda and C. pusillus in the base of the
clade, as successive sister taxa of the remaining Chordeiles,
partially in agreement to the previous studies. This pattern
of relationship, and the morphological variation observed
between C. nacunda and C. pusillus compared to the remaining
species, indicates the need of reinclusion of C. nacunda in the
genus Podager and revalidation of Nannochordeiles for C. pusillus.
Page 218, Posters
r;==$39;!|+1!-£W$31
{փdփTT
ID t
ABSTRACT
t
419 (IIHFWVRIPL[HGVSHFLHVćRFNLQJDQGIRUHVWIUDJPHQWDWLRQLQ
IHHGLQJHIĆFLHQF\RIELUGVLQWKH<XQJDVIRRWKLOO$UJHQWLQD
Giselle Mangini1*, Facundo Ariel Gandoy1, Juan Ignacio Areta1
ǢW#-+'3
r9£-60230-;!|+1!-£W$31
3DUWLFLSDWLRQLQPL[HGVSHFLHVćRFNVPD\KHOSLQFUHDVHIHHGLQJ
HIĆFLHQF\QXPEHURIDWWDFNVWLPHRIELUGVE\ĆQGLQJPRUH
SODFHVWRIHHGNQRZLQJUHFHQWO\GHSOHWHGDUHDVEHQHĆWLQJIURP
ćXVKLQJLQVHFWVDQGLQFUHDVLQJSUHGDWLRQDYRLGDQFH%LUGVLQ
yungas foothill live in a fragmented landscape. Forest fragments
could contain limited food in comparison to continuous forest.
:HFRPSDUHGIHHGLQJHIĆFLHQF\DQGVHDUFKUDWHQXPEHU
RIVHDUFKEHKDYLRUVWLPHRIWKUHHVSHFLHVLQIRRWKLOOIRUHVW
Salta, Argentina: Parula pitiayumi, Thraupis sayaca and Arremon
ćDYLURVWULV. Five surveys were conducted through 7 months
recording foraging behavior. Ratios of search and attack trough
WLPHZHUHFRPSDUHGLQWZRVRFLDOVLWXDWLRQVLQVLGHRXWVLGH
PL[HGVSHFLHVćRFNVDQGDWWZRODQGVFDSHFRQĆJXUDWLRQV
IRUHVWIUDJPHQWFRQWLQXRXVIRUHVWParula pitiayumi and
Thraupis sayacaLQFUHDVHGWKHLUIHHGLQJHIĆFLHQF\ZKHQ
SDUWLFLSDWLQJLQPL[HGćRFNVLQVLGHIRUHVWIUDJPHQWV.UXVNDO
Wallis; P-values<.05, n=71 and n=28 respectively), while
$UUHPRQćDYLURVWULV did not show differences (P=0.32, n=41).
Thraupis sayaca increased its search rate (p=0.0484) outside
ćRFNVLQFRQWLQXRXVIRUHVWZKLOHQRGLIIHUHQFHVZHUHGHWHFWHG
in P. pitiayumi and $ćDYLURVWULV. These results suggest that
ćRFNLQJPLJKWUHSRUWPRUHEHQHĆWVLQIRUHVWIUDJPHQWVWKDQLQ
continuous forests in our study sites. Surveys measuring food
Page 219, Posters
ID t
ABSTRACT
t
Table of Contents
availability and predator abundance are being conducted and
should provide critical data to explain the observed patterns.
420 Breeding biology of Geositta poeciloptera
(Aves, Scleruridae) in the upper Rio Grande
grasslands, Southern Minas Gerais, Brazil
Tamara L. Silva1*, Vitor Lombardi2, Leonardo Lopes2
ǢW2-='89-&!&'
'&'8!£&'-39!f
f
£38'9;!£WT
ǣW2-='89-&!&'
'&'8!£&'-39!
r;!1!8!6!99!839|+1!-£W$31W#8
Geositta poeciloptera is a globally Vulnerable grassland specialist
passerine that is thought to be undergoing a rapid population
decline. Almost nothing is known about the breeding biology
of the species, what lead us to conduct this study. From July
2014 to February 2015, we studied the breeding biology of
a population of G. poeciloptera found in the municipality of
São João del Rey, MG, Brazil. We captured adult birds with
mist nets and marked them with colored bands. We searched
for nests by following the adult birds, what resulted in the
discovery of 36 nests that we monitored with a boroscope.
1HVWW\SHLVFDYLW\ZLWKWXQQHOVLPSOHSODWIRUPDQGZHUH
excavated in the banks along dirty roads (n=33), in armadillos
burrows excavated in “murundus” (n=2) and on a small vertical
pit on the ground (n=1). The nest chamber was layered with
leaves of grass, small fragments of charcoal and mammal
hairs and feces. Breeding season spanned through 135 days
(from September to December), with a peak on numbers of
nests in September. Mean clutch size is of three eggs (93%),
with some few nests presenting two (3.5%) or four eggs
{փdփTT
ID t
ABSTRACT
t
(3.5%). Eggs are white and pyriform. Incubation period is of
15 days and is performed by both sexes. Nestling period is of
17 days, and both parents feed the youngs. Fledglings stay in
the parents territory for only about 15 days after leaving the
nest, dispersing after that. The results found allow to know
better the species and plan strategies for its conservation.
424 Avian inventory of the Recanto das Araras de Terra
Ronca Extractive Reserve (Goiás, Brazil)
Renata M. Rossato1*, Flor Maria Guedes F.M.G Las-Casas2, Ailton
Carneiro A.C. Oliveira1, Cristine da Silveira Figueiredo C.S.F Prates3,
Fernando de Lima F.L. Fvaro4, Joo Marcelo J. M. Holderbaum, Paulo
Ricardo P. R. Siqueira5, Rita de Cassia Surrage R. C. S. Medeiros1
ǢWc-3TǣW2-='89-&!&'
'&'8!£&''82!1#<$3T
ǤW2-='89-&!&'
'&'8!£&!!8!Ð#!TǥW!87<'!$-32!£&'£,!
8!2&'c-3TǦW2-='89-&!&'9;!&<!£&'32;'9£!839
ID t
ABSTRACT
t
Table of Contents
richness found for the Cerrado region (837). Nine of the 30
endemic Cerrado species were found in the reserve: Alipiopsitta
xanthops, Antilophia galeata, Charitospiza eucosma, Clibanornis
rectirostris, Cyanocorax cristatellus, Herpsilochmus longirostris,
Knipolegus franciscanus, Melanopareia torquata and Saltatricula
atricollis)LYHVSHFLHVZHUHFODVVLĆHGDV1HDU7KUHDWHQHGLQ
Brazil and nine are contemplated by Action Plans for Avian
Conservation. Even presenting a relatively small area when
compared to other Brazilian Federal Protected Areas, the
results demonstrate a representative species richness, with
the occurrence of endemic species, reinforcing the importance
of the RATRER for the conservation of the avifauna in the
Cerrado region. This study will provide information for the
elaboration of the RATRERs Management Plan and may also
stimulate birdwatching tourism in the region, contributing
to conservation and local community development.
r8'2!;!W8399!;3|-$1#-3W+3=W#8
The Recanto das Araras de Terra Ronca Extractive Reserve
(RATRER) is located in the Cerrado domain, in the northeastern
part of the state of Goiás, Brazil, and comprises an area of
12.349 ha. It is a Federal Protected Area administered by the
Chico Mendes Institute for Biodiversity Conservation. Besides
being considered an Important Bird Area, the Terra Ronca
region lacks local avian studies. Two expeditions to the RATRER
were conducted, one during local dry season and the other in
the rainy season, in August and November 2014, respectively.
The avian assembly was sampled using 10-species MacKinnon
lists and mist-nets. With all survey methods 216 species were
GHWHFWHGZKLFKUHSUHVHQWVURXJKO\RIWKHWRWDOVSHFLHV
Page 220, Posters
425 )UHTX¬QFLDGHPLFURQ¼FOHRVHPHULWUµFLWRVGH
aves para avaliação da qualidade ambiental
do mangue de Porto do Mangue/RN
Raphaella Paiva1*, C. Calabuig1, H. Oliveira1
ǢW
r!)2,!6!-=!i|,3;1!-£W$31
A detecção de danos no DNA causados por contaminantes
é de grande importância na conservação da diversidade
das espécies. Apesar da grande maioria dos estudos serem
realizados com peixes, as aves também são excelentes
indicadoras da qualidade ambiental funcionando como
{փdփTT
ID t
ABSTRACT
t
ID t
ABSTRACT
t
Table of Contents
detectores de mudanças na saúde e condições do ecossistema.
426 Avifauna do Parque Municipal de Maceió, um importante
O presente estudo foi realizado numa área de mangue,
fragmento urbano de Mata Atlântica do Nordeste do Brasil
às margens da cidade de Porto do Mangue (51°3’47.28’’S,
W. O. Silva1*, C. F. M. Ferreira1, T. K. Guedes1, R. Gaban-Lima1
36°46’14.29’’O). Extraiu-se o sangue da veia alar, que foi
ǢW!#38!;8-3&'38(3£3+-!T-9;'1ধ$!'$3£3+-!&'='9'3;836-$!-9lmT
diretamente colocado sobre a lâmina, foi feito o esfregaço.
';38&'-3&-='89-&!&'T29ধ;<;3&'-Í2$-!9-3£+-$!9'&!!&'T2-='89-&!&'
Em laboratório, as lâminas foram submetidas a um período de
'&'8!£&'£!+3!9c<9'<&'-9;8-!!;<8!£&!2-='89-&!&'
'&'8!£&'£!+3!9
espera “overnight”, secando a temperatura ambiente para a
r3£-='-8!9>-££-!19|+1!-£W$31
Ć[D©¥RGRPDWHULDO$SµVIRUDPVXEPHUVDVHPPHWDQRO
durante 10 minutos, depois lavadas com água destilada e
coradas com Giemsa (5%) durante 40 minutos. Posteriormente,
As áreas verdes em ambientes urbanos são importantes para
foram lavadas com água destilada e secas a temperatura
a manutenção da biodiversidade local, e a compreensão das
ambiente. Foram analisadas em microscópio óptico com
comunidades de Aves urbanas na região Nordeste é incipiente.
objetiva de resolução 100x através de teste cego, seguindo
Esse estudo visa inventariar a avifauna de um importante
o modelo “zig-zag”. Contaram-se 2500 células por lâmina,
UHPDQHVFHQWHćRUHVWDOXUEDQRR3DUTXH0XQLFLSDOGH0DFHLµ
totalizando 5000 células por indivíduo. Foram analisadas 16
LQYHVWLJDQGRDHVWUXWXUDWUµĆFDGHVVDFRPXQLGDGHHDSUHVHQ©D
espécies migratórias e 16 espécies residentes totalizando 32
de táxons relevantes para a conservação (endêmicos do Centro
amostras observadas entre Setembro de 2014 e fevereiro
GH(QGHPLVPR3HUQDPEXFRHRXDPHD©DGRVGHH[WLQ©¥R
de 2015. As aves migratórias apresentaram uma média de
As amostragens se iniciaram no mês de setembro de 2014
2,62Mn enquanto os indivíduos residentes apresentaram
e se estenderam até abril de 2015. Considerando as aves
uma média de 3,12Mn. Apesar de preliminares, este dados
registradas nesse estudo (86 espécies), e aquelas registradas
podem estar indicando uma possível contaminação do
por Leal (2010, Guia de aves do Parque Municipal de Maceió)
mangue ao ponto de causar danos a nível celular. Este local
(94 espécies), foram registrados 102 espécies (em 37 famílias
também pode estar funcionando como modelo para evidenciar
e 17 ordens). Desses, quatro táxons são considerados
possíveis diferenças nas concentrações de malformações
RĆFLDOPHQWHDPHD©DGRVMomotus momota marcgravianus,
celulares entre espécies migratórias e residentes.
Thamnophilus caerulescens pernambucensis, Tangara fastuosa
e Sporagra yarrellii, sendo os três primeiros endêmicos do
Centro Pernambuco. Dessa comunidade de Aves, três são
consideradas altamente sensíveis a distúrbios ambientais e 15
são medianamente sensíveis. As aves insetívoras predominaram
com 34 táxons (33%), seguidos pelos onívoros com 33 (32%)
Page 221, Posters
{փdփTT
ID t
ABSTRACT
t
e nectarívoros com 10 táxons (10%). É notável a baixa riqueza
de frugívoros (apenas 8% da comunidade), padrão esse
semelhante ao observado em outros trabalhos realizados no
estado. A existência de táxons endêmicos e ameaçados reforça
a inquestionável relevância dessa Unidade de Conservação, e a
presença de táxons altamente e medianamente sensíveis pode
VHULQGLFDWLYRGHTXHHVVDćRUHVWDXUEDQDWHPDFDSDFLGDGH
de manter elementos importantes para orntitofauna local.
431 Birds of a largely urbanized Neotropical city:
species composition and feeding guilds
Joo Carlos C. Pena1*, Ana Ustch1, Vanessa Monteiro1,
Marcos Rodrigues1, Robert J. Young2
ǢW2-='89-&!&'
'&'8!£&'-2!9'8!-9TǣW2-='89-;@3(!£(38&
ID t
ABSTRACT
t
Table of Contents
in at least one visit were considered. We recorded a total of
83 bird species, distributed in 26 families. Tyrannidae was
the most representative family with 23 species, followed by
Thraupidae (12 species). Seventy-three species were recorded
sitting on different substrates, as wires, trees, and sidewalks.
This value represents 20% of all species previously recorded
LQDUWLĆFLDODQGQDWXUDODUHDVLQ%HOR+RUL]RQWHVSHFLHV
All feeding guilds previously observed in the municipality
were registered in the streets: omnivorous and insectivorous
being the most abundant groups, (30.14% and 23.29%,
UHVSHFWLYHO\7KLVUHVXOWVVXJJHVWWKDWDVLJQLĆFDQWDVVHPEO\RI
the bird species are able to survive and persist with the limited
resources available through the urban landscape. Further
research should assess if this assembly may play important
ecosystem services such as pollination and seed dispersion.
r/3!3$6'2!|+1!-£W$31
The role of urban landscapes for biodiversity conservation
has been increasingly recognized. As the expansion of urban
landscapes occurs, strategies such as the conservation of
habitat fragments and street trees, are needed to reconcile
the development with the retention and maintenance of
biodiversity. The aim of this study is to describe the bird
community that are able to survive and occupy a Neotropical
urban ecosystem. We selected 60 point count locations in
streets distributed through the south region of Belo Horizonte,
Minas Gerais, Brazil. Each point was visited three times during
PLQXWHVDQGDOOVSHFLHVWKDWZHUHVLQJLQJSHUFKHGRUć\LQJ
were registered. To evaluate which species really occupy the
urban ecosystem, only those birds that were visualized perched
Page 222, Posters
433 Molecular systematics of Microcerculus bambla/
marginatus (Aves: Troglodytidae) species complex
Bernardo Prestes1*, Leonardo Miranda1, Lucas
Arajo-Silva1, Alexandre Aleixo1
ǢW<9'<!8!'29'1£-33'£&r#'82!8&368'9;'9ǡ|+1!-£W$31
This work constitutes a biogeographical analysis using
mitochondrial and nuclear DNA of individuals collected
throughout the Neotropical lowlands and analyzed using
Bayesian approaches. Species tree analysis and divergence
time inference were used to reconstruct the evolutionary
history of the Microcerculus bambla / marginatus species
{փdփTT
ID t
ABSTRACT
t
ID t
complex. Although our analyses support the monophyly of the
M. bambla / marginatus species complex, of the 10 reciprocally
monophyletic lineages recovered (including single divergent
samples from unique geographical areas) in the mtDNA
JHQHWUHHRQO\ĆYHDUHHQWLUHO\FRQVLVWHQWZLWKFXUUHQWO\
recognized subspecies limits in this group: (1) nominate M.
bambla bambla (Guiana lineage); (2) M. bambla caurensis (Imeri
lineage); (3) M. bambla albigularis (the disjunct population
IURPWKH$QGHDQIRRWKLOORQO\DPSOLĆHGIRUPW'1$
M. marginatus luscinia (Central America lineage); and (5) M.
marginatus taeniatus (trans-Andean population sister to Napo
lineage). Owing to type locality of M. marginatus marginatus
are uncertain (“Bogota skins” are usually unknown), it is not
possible to know to which lineage this taxon name apply;
LQDQ\HYHQWDWOHDVWĆYHDSSDUHQWO\XQQDPHGOLQHDJHV
currently attributed to M. marginatus marginatus can be
recognized as distinct evolutionary units (Napo, Inambari,
Rondônia, Tapajós and Xingu lineages). Thus, we notice
the need of formally describing the unnamed evolutionary
lineages mentioned above, given that they constitute, not
only genetically but vocally and morphologically distinct
lineages. And an integrative taxonomic approach is in course
WREHWWHUHVWDEOLVKLQWHUVSHFLĆFOLPLWVDPRQJWKHVHOLQHDJHV
434 Distribution and status of an increasingly rare duck, the
Page 223, Posters
ABSTRACT
t
Table of Contents
Southern Pochard (Netta erythrophthalma), in South America
Juan Freile1*, Arne J Lesterhuis2, Robert P Clay2
ǢW31-;$<!;38-!23&''+-9;83982-;3£+-$39TǣW-8&-('2;'82!ধ32!£
r/(8'-£'3|@!,33W$31
The Southern Pochard (Netta erythrophthalma) has a
widespread but rather local distribution in South America, with
EUHHGLQJSRSXODWLRQVLQWKH&DULEEHDQ$QGHDQDQG3DFLĆF
regions of Venezuela, Colombia, Ecuador, and Peru, the Andes
of Argentina, and the Atlantic coast of Brazil. Although never
numerous in comparison to the African population, the species
has been noted to decline as early as the 1970s. Its current
range appears largely reduced, with scarce records that mainly
LQYROYHVPDOOćRFNVH[FHSWLQJLQVRXWKHUQ%UD]LOZKHUHLW
likely spread in recent years. However, as African populations
are numerous and the species has a large distribution, it
has not been ranked as globally threatened. Our revision
of its distribution and populations in South America, based
primarily on an exhaustive literature revision and collection
of reliable unpublished data, suggests a remarkable decline
throughout most of its range, particularly in the Andes and
3DFLĆFORZODQGV7KHUHDUHQRUHFHQWFRQĆUPHGUHFRUGVIURP
Colombia and most Peru, whereas numbers are dramatically
reduced in Ecuador. Its status in Venezuela is unclear and
numbers in Argentina have always been low. The status of
the species in Brazil is apparently less critical, with numerous
records from Ceará south to Bahia and Goias. Still, numbers are
reportedly low and it has even been suggested that formerly
large Brazilian populations are also in decline. Habitat loss by
{փdփTT
ID t
ABSTRACT
t
siltation, dredging, and destruction of riparian vegetation, along
with hunting appear as major threats. Previous population
estimates seem to be overestimating actual numbers, making it
necessary to revise its conservation status in South America.
435 Morphometric data and banding of migratory birds on
the Panaquatira Beach, São José Bay, Maranhão
Reydson Rafael Rosa Reis1*, Ana Paula Silva de Sousa1,
Lucyellen Rodrigues de Sousa1, Leandro Schalcher
Aguiar1, Antnio Augusto Ferreira Rodrigues1
ǢW
'&'8!£2-='89-;@3(!8!2,3
r8'@&9328!(!'£|,3;1!-£W$31
The Panaquatira Beach (São José Bay, Maranhão - Brazil)
stands out as a conservation and study site used to the catching
and banding of shorebirds to obtaine data on their biology. This
kind of study has contributed to the conservation of these birds
worldwide. The objective of our study was banding shorebirds
on the Panaquatira Beach and collect the biometric data of
birds captured using mist nets during the period from April to
June 2013. A number of 142 birds representing 7 species were
captured: 25 Arenaria interpres, 6 Calidris canutus, 99 Calidris
pusilla, 2 Charadrius collaris, 8 Charadrius semipalmatus,
1 Limnodromus griseus and a Pluvialis squatarola. Among
these species C. pusilla had the most successful capture and
is considered the most abundant in the Maranhão Coast.
Two birds were recaptured, between these recaptures it is
noteworthy a recapture of a C. pusilla (band E36823) that
DFFRUGLQJWRWKH&(0$9(,&0%LR'DWDEDVHLWZDVEDQGHGLQ
0DLD¼,VODQGLQ0DUDQK¥R&RDVWRQ5HFDSWXUHV
Page 224, Posters
ID t
ABSTRACT
t
Table of Contents
are considered one of the main methods of study to understand
the complex process of migration, provide knowledge on
the stop locations, reproduction and routes. The species A.
interpres, C. canutus and C. pusilla had an average weight (g)
of 130.66, 31.45 and 28.00, respectively and an average wing
sizes (mm) of 154.16, 174.83 and 98.61, respectively. The
body mass rates and wing sizes are measures used to track the
migration process. Through these data it becomes possible
to infer whether populations of migrant birds will leave or
stay in the wintering site. Obtaining these data is crucial in
conservation and research for endangered migratory species.
439 &ROHFFLµQI¯VLFD\IRWRJU£ĆFDGHQLGRV\KXHYRVGHDYHV
del Museo de Zoología, Universidad de Costa Rica
Karla Conejo-Barboza1*, Luis Sandoval1, Gilbert Barrantes1
ǢW2-='89-&!&&'39;!-$!
r0!£-2!#!8#3A!|+1!-£W$31
El conocimiento sobre el diseño de nidos y huevos de
aves representa una herramienta útil para estudios de
comportamiento animal, evolución, monitoreo de especies y
conservación. Hasta hace poco, Costa Rica contaba sólo con
la colección del Museo Nacional. En el 2003 un estudiante
comenzó a recolectar huevos y nidos los cuales se fueron
acumulando en los estantes del Museo de Zoología de la
Universidade de Costa Rica. En el 2009 comenzamos a
FDWDORJDUGDUOHPDQWHQLPLHQWR\FRQWLQXLGDG3DUDĆQDOHVGHO
2012, propusimos realizar de manera paralela una colección
IRWRJU£ĆFDGHQLGRV\KXHYRVSDUDDSR\DUODFROHFFLµQI¯VLFD
Estas colecciones tienen como objetivos: 1) Asegurar la
{փdփTT
ID t
ABSTRACT
t
apropiada conservación, documentación y accesibilidad
GHOPDWHULDOI¯VLFR\IRWRJU£ĆFRGHODFROHFFLµQVHUYLUGH
referencia o material de apoyo a la enseñanza de cursos o
investigaciones relacionadas con la reproducción en aves, 3) ser
depositario de material testigo y 4)promover la investigación
en este campo. Actualmente la colección alberga 232 nidos
de 96 especies costarricenses y 209 nidadas de 157 especies
internacionales y costarricenses, como parte de la colección
I¯VLFD/DFROHFFLµQIRWRJU£ĆFDFXHQWDIRWRJUDI¯DVHQSURFHVR
de catalogación. La colección física de nidos brinda apoyo a
XQDWHVLVGHPDHVWU¯DVREUHODYDULDFLµQLQWUDHVSHF¯ĆFDHQ
el diseño de nidos y ha proporcionado material para tres
publicaciones. Esperamos que más fotógrafos y conocedores
del campo de la ornitología nos apoyen con su material para
continuar la realización y ampliación de estas colecciones,
además que nuestra iniciativa contribuya positivamente a
futuros estudios sobre nidos y huevos de aves neotropicales.
441 Are small parks reducing the reproductive success of
bird species in urban landscape of Santiago, Chile?
Tahia Rannou1*, Jorge Prez-Quezada1, Sebastin Abades2
ǢW2-='89-&!&&',-£'T
!$<£;!&&'-'2$-!9+8321-$!9T
ǣW'6!8;!1'2;3&'$3£3+!'29ধ;<;3&'$3£3+!@-3&-='89-&!&
ID t
ABSTRACT
t
Table of Contents
and limiting reproductive success. However studies of avian
reproductive success in urban landscapes are scarce. As in
fragmented landscapes, urban parks represent fragments of
habitat immersed in the urban matrix, hence, park size could
play an important role in reproductive success. Thus, larger
parks should represent higher quality habitat than small parks.
During spring 2014, we selected 17 parks, grouped in threesize categories: small (< 0.99 ha), medium (between 1 and
4.99 ha) and large (> 5 ha). At each park we monitored every
nest we encountered for the whole reproductive season (i.e.,
from September to December), every 4 days. A total of 112
nests of 7 native species were monitored. For each nest, we
measured height, tree species and bird species and the nest
VXFFHVV7KH0D\ĆHOGUHSURGXFWLYHLQGH[ZDVHVWLPDWHG
and used as a response variable. We used generalized linear
mixed models (GLMM), to analyze the effect of park size on
reproductive success. Bird species identity, tree origin and
nest height were assessed as random factors. In contrast
WRRXUSUHGLFWLRQVZHGLGQRWGHWHFWDVLJQLĆFDQWHIIHFWRI
park size on avian reproductive success. Thus, small parks
did not reduce reproductive success of urban birds. Turdus
falcklandii and Zenaida auriculata are common native birds in
this urban landscape and represented 85% of our monitored
nests, thus, those species may not be affected by park size.
r;!,-!8!223<|+1!-£W$31
Urbanization is considered to be one of the largest threats
to biodiversity worldwide. As often shown in urban green
areas, urbanization negatively affects bird richness and
abundance, through habitat loss by increasing predation rates
Page 225, Posters
{փdփTT
ID t
ABSTRACT
t
445 Hierarchical distance sampling to estimate density of hyper-
abundant Zenaida auriculatapopulations in central Argentina
Jaime N Bernardos1*, Jeffrey J Thompson2, Andrea P
Goijman1, Joaquin L Navarro3, Maria Elena Zaccagnini1
ID t
ABSTRACT
t
Table of Contents
GHYHORSLQJPDQDJHPHQWWRPLWLJDWHWKHFRQćLFWEHWZHHQ
Zenaida auriculata populations and agricultural production.
446 ,GHQWLĆFD©¥RHELRPHWULDGHHVS«FLHVGHDYHV
ǢWTǣW<@8!!8!+<!@TǤW2-='8-&!&!$-32!£&'38&3#!
residentes em Porto do Mangue, RN, Brasil
r/!-1'W#'82!8&39|+1!-£W$31
Raphaella R.P Paiva1*, C. Calabuig1, H. Oliveira1, Ramon E.R Menezes1
ǢW
In South America population explosions of Zenaida auriculata
KDYHRFFXUUHGLQPXOWLSOHFRXQWULHVDQGJHQHUDWHGFRQćLFW
with agricultural production. An understanding of how land
use and landscape composition drive these populations is
LPSRUWDQWWRZDUGVPLWLJDWLQJWKLVFRQćLFWKRZHYHUWKH
estimation of population parameters of these hyper-abundant
SRSXODWLRQVLVGLIĆFXOWDVWKHLUKLJKDEXQGDQFHPDNHVPDUNLQJ
DQDGHTXDWHSURSRUWLRQRIWKHSRSXODWLRQORJLVWLFDOO\GLIĆFXOW
while their abundance, mobility, and high mortality rates
hinder recaptures. To deal with these sampling issues related
to the Zenaida auriculata population in Argentina we employed
hierarchical distance sampling to 10 years of annual sampling
of 2700 points over an area of ~255,000 km sq in central
Argentina. Group density increased from 0.34 (95%CI 0.31,
ćRFNVKDGXULQJWR&,ćRFNV
KDLQ0HDQćRFNVL]HLQFUHDVHGIURPELUGVćRFNLQ
WRELUGVćRFNLQ7KHPRGHOLQJLQGLFDWHGWKDW
increasing proportional area of woodlands and row crops
has the strongest positive effect on the density of Zenaida
auriculata. Based upon our results we believe that our sampling
and modeling approach adequately address the sampling
issues related to hyper-abundant populations of Zenaida
auriculata and serves as an important contribution towards
r!)2,!6!-=!i|,3;1!-£W$31
Page 226, Posters
O conhecimento detalhado da biologia, status genéticos
e aspectos ecológicos da avifauna da costa do Rio Grande
do Norte são essenciais para que planos de proteção e
conservação sejam mais bem delineados e efetivados. O
SUHVHQWHHVWXGRSUHWHQGHLGHQWLĆFDUPHGLUHDFRPSDQKDU
espécies de aves residentes na Área de Preservação Ambiental
de Porto do Mangue ao longo do tempo já que esta área
é usada por pescadores da região como fonte de renda e,
WDPE«PVRIUHLQćX¬QFLDGLUHWDGDVDWLYLGDGHVGHFDUFLQLFXOWXUD
e da produção de sal marinho. Para este trabalho, a coleta de
dados foi realizada mensalmente durante três dias consecutivos
durante maio de 2014 e fevereiro de 2015 com o auxilio
de oito redes de neblina. Foram capturados 33 indivíduos
de 8 espécies. Todas as aves foram anilhadas com anilhas
fornecidas pelo CEMAVE. Foram capturadas as seguintes
espécies: Conirostrum bicolor; Columbina passerina; Choroceryde
americana; Aramides mangle; Egretta thula; Nycticorax violacea;
Cyclarhis gujanensis e Lepidocolaptes angustirostris. Para cada
ave foram medidas: massa corporal em g (MC) e tarso(T),
cúlmem total (CT), narina- ponta (NP), largura do bico(BL),
altura do bico(BA), asa (A) e cauda (C) em mm. Atualmente
{փdփTT
ID t
ABSTRACT
t
é necessário conhecer a biodiversidade da fauna local e se
ela apresenta variações ao longo do tempo com o intuito
de avaliar se as atividades antrópicas trazem prejuízos ao
ecossistema. O estudo da biometria desses animais auxilia
a criação de um banco de dados para melhor avaliação do
estado de conservação dos mesmos ao longo do tempo.
447 Vocal repertoire and parental care behaviors
in males of Psarocolius montezumain cloud
forest of central Veracruz, Mexico
Ronald A. Fernndez-Gmez1*, Jorge E. MoralesMvil1, Fernando Gonzlez-Garca3
ǢW!#38!;38-3-3£3+!&'£31638;!1-'2;3T29ধ;<;3&'
'<83';3£3+!T2-='89-&!&'8!$8<A!2!TǣW'&&'$3£3+!@
329'8=!$-2&''8;'#8!&39T29ধ;<;3&'$3£3+!TWW
r832!£&',-&3|+1!-£W$31
Vocal communication involves endocrine, neurobiological and
anatomical mechanisms; each repertoire provides valuable
information for understanding ecological and behavioral
aspects and its implementation in systems of protection against
predators during nesting and parental care, being important
for gregarious icterids like Psarocolius montezuma, specie
with polygyny mating system. Despite the studies about its
reproduction system, the role of vocal communication in their
social systems is unknown yet. We evaluated vocal repertoires
of P. montezuma males and behavioral patterns exhibited
during parental care over populations in cloud forest of central
Veracruz, México. We performed a focal sampling to males on
FRORQ\IRUIRXUKRXUVRIFRQWLQXRXVUHFRUGLQJ:HLGHQWLĆHG
Page 227, Posters
ID t
ABSTRACT
t
Table of Contents
six principal behaviors described as: agonistic interactions,
vigilance, feeding, grooming; territoriality and body movement
displays were prevalent. We recorded vocalizations of
P. montezuma in a behavioral context; subsequently we
described and analyzed spectrograms with Raven software.
We found two sorts of vocalizations catalogued as: calls
and songs. The song is integrated for a several sequences
of phrases that showed three main frequency changes with
modulation (raise, top maintenance and declination) and is
conformed for both fundamental and harmonics acoustic
components. The structure variation was located in the middle
and ending phrases of the song while length variation was in
the introduction and ending. This study provides important
information about the behaviors and vocalizations of P.
montezuma males in the parental care of colony period.
449 A bibliometric review of Brazilian Ornithology
publications between 1982 and 2015
Sara Cristina Batista1*, Jssica Cristina Castro1,
Luiz A. M. Mestre1, Juliana Rechetelo2
ǢW2-='89-&!&'
'&'8!£&3!8!2ÆTǣW!1'93302-='89-;@
r#9!8!$8-9ধ2!|+1!-£W$31
:HTXDQWLĆHGDQGFRPSDUHGSXEOLFDWLRQVLQWKHĆHOGRI
ornithology in Brazil, aiming to register temporal changes and
tendencies in ornithological studies. We reviewed national
and international journals. Publications were organized
E\HFRV\VWHPELRPHUHJLRQDSSURDFKSRSXODWLRQ
FRPPXQLW\IRFDOJURXSVSHFLHVIDPLO\FRQVHUYDWLRQ
VWDWXVDQGUHVHDUFKĆHOGHJIHHGLQJLQYHQWRU\EUHHGLQJ
{փdփTT
ID t
ABSTRACT
t
ID t
Publications were analyzed together and then divided by
decades (1982-1989; 1990-1999; 2000-2010; 2010-2015).
We evaluated 1571 publications (1237 national and 334
international). Most of the studies were conducted in the
Southeast (28%) and South (17%) regions; in the Atlantic
Forest biome (28%). Psittacidae (11%), Accipitridae (6%) and
Emberezidae (4%) were the most studied families. The most
frequent publications were about “feeding” and “inventory”
ERWK)RUWKHĆUVWGHFDGHSXEOLFDWLRQVZHUHPRUH
frequent in the Northern region (30%), in the Amazonian
Forest (30%), and the focus of the studies were “conservation
biology” (23%) and “breeding” (17%). In all following decades,
the predominant regions were Southeast (32%, 29% and
24%), with studies carried out in the Atlantic Forest (22%,
31% and 29%). Studies focusing on “breeding” were the most
frequent in 1990-1999 (17%), “feeding” in 2000-2009 and
“inventory” in 2010-2015. Publications with populations
were more frequent in all decades. Studies with endangered
species represent less than 15% in all decades. These results
represent an overview of the last 30 years of publication in
WKH%UD]LOLDQ2UQLWKRORJ\ĆHOGSRLQWLQJWKHPDLQWUHQGVRXW
and therefore promoting discussion for further studies.
450 Regionally threatened bird species in protected
Page 228, Posters
ABSTRACT
t
Table of Contents
areas at Rio Grande do Sul, southern Brazil
Natalia Procksch1*, Jan Karel F. Mahler Jr2, Glayson A. Bencke2
ǢW2-9-239TǣW
<2&!3 33#3;2-$!&3-38!2&'&3<£
r2!;!£-!683$09$,|+1!-£W$31
We assessed the representativeness of regionally threatened
bird species in state and federal protected areas (PAs) of Rio
*UDQGHGR6XOVRXWKHUQ%UD]LO7ZHQW\ĆYHDUHDVXQGHUVWULFW
protection (totaling 180,819 ha) and seven of sustainable use
(totaling 534,452 ha) were considered. Bird occurrence data
were compiled by ornithologists who took part in the recent
review of Rio Grande do Sul redlist of threatened species
'HFUHH&RDVWDOPDULQHDQGUHJLRQDOO\H[WLQFW
birds were not included in our analysis. Of the 77 species
evaluated, 12 are critically endangered, 23 endangered and
42 vulnerable. Sixty-eight species (88.3%) occur in at least
one PA. Despite covering a much greater territorial extension,
sustainable use PAs shelter only 14 (20.5%) threatened species,
no one exclusive. Twenty-six species (38.2%) are present in
only one PA, 23 (33.8%) in two PAs, two (2.9%) in three PAs,
LQIRXU3$VDQGVHYHQLQĆYHRUPRUH3$V
Sixty six threatened species occur in the Atlantic Forest and
26 in the Pampa. Species representativeness in PAs is similar
in both biomes (86.4% and 88.5%, respectively). The PAs with
the highest numbers of threatened species are the Parque
Estadual do Turvo (n=28), Parque Nacional Aparados da Serra
(n=14) and Parque Estadual de Itapeva (n=12). Turvo (in the
Atlantic Forest) and Espinilho (in the Pampa) state parks harbor
the highest numbers of critically endangered and exclusive
{փdփTT
ID t
ABSTRACT
t
species. Of the nine species not represented in PAs, the
critically endangered Automolus leucophthalmus, Crypturellus
noctivagus and Hemitriccus orbitatus should be considered
priority targets for the establishment of new PAs in the state.
456 Analisis de sitios de geofagia para la Psittacara
wagleriy Amazona ochrocephalaen taludes del Rio
Magdalena cercanos al bosque seco tropical
Nstor Peralta-Zapata
<2&!$-32!;<8!
ID t
ABSTRACT
t
Table of Contents
bajos de arcillas lo que puede indicar que los loros no están
consumiendo suelo para absorber las toxinas que se puedan
encontrar en los alimentos. Estos resultados nos permiten
dar hipótesis del por que en las zonas andinas hay lugares de
conglomeración con menos individuos de loros comparado
con las zonas amazónicas y nos van a servir para mejorar el
hábitat de estas dos especies dentro la zona de compensación
ambiental del Proyecto Hidroeléctrico el Quimbo.
457 Estudio de las aves asociadas a paisajes
26'8!£;!|2!;<8!W38+W$3
ganaderos de Colombia
Ronald A. Fernndez-Gmez1*, Yuri RoseroMora2, Aura Fiorela Delgado-Chaves3
Estudios que han analizado la composición física y química de
los lugares en que los loros consumen suelo, han permitido
conocer la funcionalidad de este comportamiento para la
ĆVLRORJ¯DGHORVRUJDQLVPRV6LQHPEDUJRHVWRVDQ£OLVLVVH
restringen a sitios amazónicos dejando la incertidumbre de
la funcionalidad de este comportamiento para loros que
KDELWDQRWURVHFRVLVWHPDV&RQHOĆQGHLGHQWLĆFDU\DQDOL]DU
ĆVLFRTX¯PLFDPHQWHVLWLRVGHJHRIDJLDGHODSHULFDIUHQWH
roja Psittacara wagleri y la Lora Real Amazona ochrocephala
en áreas cercanas a bosques secos tropical, se realizaron
recorridos en lancha sobre un tramo del rio magdalena y
caminatas sobre la zona de compensación ambiental del
Proyecto Hidroeléctrico el Quimbo (Huila, Colombia). En
ORVUHFRUULGRVUHDOL]DGRVVHLGHQWLĆFDURQFXDWURVLWLRVGH
geofagia. La composición de sodio varió notablemente entre
los sitios maestreados, pero siempre fue mayor a la que
reporta la literatura en lugares amazónicos. Por su parte
las muestras de suelo colectadas tuvieron porcentajes
Page 229, Posters
ǢW!#38!;38-3-3£3+!&'£31638;!1-'2;3T29ধ;<;3&''<83';3£3+!T
2-='89-&!&'8!$8<A!2!TǣW93$-!$-2TǤW!'9;8-!'2
-'2$-!9f-3£3+-!2-='89-&!&!$-32!£&'3£31#-!
r832!£&',-&3|+1!-£W$31
La ganadería ha tenido impactos negativos en los ecosistemas
(deforestación, contaminación hídrica y erosión). Herramientas
de paisaje que promueven la conservación y mejoran la
producción como los sistemas silvopastoriles son una
alternativa. El proyecto Ganadería Colombiana Sostenible,
realizó un monitoreo de aves entre 2013-2014 en 5 parches
de bosque asociado a ganadería de 3 departamentos (Meta,
$WO£QWLFR\4XLQG¯RFRQVLGHUDQGRSXQWRVĆMRVGHPXHVWUHR
(radio 50m) y 4 días de registro por parche. Quindío presento
la mayor riqueza (140 especies) seguido por Meta y Atlántico
con 125 y 122 especies. Considerando registros adicionales,
{փdփTT
ID t
ABSTRACT
t
los valores cambian (149, 168 y 156 respectivamente). Las
familias representativas fueron Tyrannidae, Trochilidae y
Thraupidae. En Atlántico sobresalen Ardeidae, Cuculidae,
Icteridae y Columbidae. La variabilidad en riqueza entre
parches indicó que la composición de aves presenta hábitos
generalistas y alta plasticidad ecológica. Aunque la abundancia
y riqueza de especies fue baja entre puntos, la alta riqueza
en áreas abiertas determina la importancia de conectividad
entre tipos de hábitat (matorrales y rastrojos) con el bosque
para establecer poblaciones que aprovechan temporalmente
oferta de recursos. Bajos valores de similitud entre parches
LQGLFDQXQDFRPSRVLFLµQHVSHF¯ĆFDFRPSDUWLHQGRSRFDV
HVSHFLHV/RVGLIHUHQWHVLPSDFWRVGHFDGDXQLGDGUHćHMDQ
las agrupaciones encontradas y su relación con aspectos
GHFREHUWXUDHVWUXFWXUD\ULTXH]DćRU¯VWLFD(QHVWH
sentido, mantener un monitoreo constante, permitirá
evaluar el estado actual y futuro de la comunidad de aves,
UHćHMDQGRODVPRGLĆFDFLRQHVJHQHUDGDVHQORVSDLVDMHV
458 Movement behavior and habitat use of
frugivorous birds in a gradient of forest loss
Danielle C T L Ramos1*, Marco A Pizo2, Milton C Ribeiro1
ID t
ABSTRACT
t
Table of Contents
little is known about those responses and their consequences
for ecosystem processes, as seed dispersal. In an ongoing
study, we aim to describe differences between the movement
behavior and the use of perches by three abundant seed
dispersers birds in a gradient of forest loss. We have completed
162 hours of direct observation of birds movements in six
600 x 600 m landscapes with different percentages of forest
cover and cattle grazing pastures in the surroundings of a
large Atlantic Forest Corridor of Southeastern Brazil. Dacnis
cayanaSHUFKIRUORQJHUSHULRGVDQGć\ODUJHUGLVWDQFHVWKDQ
Turdus sp. and Tangara sayaca. Birds perch longer in low forest
cover landscapes. Turdus sp. and T. sayacaćLJKWGLVWDQFHVDUH
larger in the most degraded and conserved landscapes and
were shorter in landscapes with intermediate forest cover. The
opposite was observed to D. cayanaZKRVHćLJKWGLVWDQFHV
were larger in landscapes with intermediate forest cover. That
can be explained by the usage of the landscape by the studied
birds. While Turdus sp. and T. sayaca have not shown differences
visiting distinct kinds of perches in different landscapes, D.
cayana perched more in fragments and corridors in low forest
cover landscapes and more in remnant trees in areas with
high forest cover. Those partial results suggest that birds
can play complementary roles in fragmented landscapes.
ǢW'6!8;1'2;3($3£3+@T3!<£3;!;'2-='89-;@lmT
ǣW'6!8;1'2;3( 33£3+@T3!<£3;!;'2-='89-;@lm
r&!2-'££'$;£8|+1!-£W$31
Birds behavior depends on landscape structure, and can
respond to human changes on landscape, differences in
fragmentation degree and resources availability. However,
Page 230, Posters
{փdփTT
ID t
ABSTRACT
t
459 )HDWKHUPLWHVIURPĆYHVSHFLHVRIVRQJELUGV
(Passeriformes) at Universidad Pedagogica y Tecnologica
de Colombia campus (Boyaca, Colombia)
Juliana Soto-Patio1*, Alejandra Rodrguez-Abaunza1
ǢW2-='89-&!&'&!+3+-$!@'$23£3+-$!&'3£31#-!
r/<£-!2-;!W2'!|+1!-£W$31
Colombia is among the most diversity countries for birds
with around 1879 recorded species. This great diversity
has led the development of research on ecology and
systematics of Colombian birds, in contrast with the scanty
and fragmentary publications on symbiotic astigmatan mites
$FDUL6DUFRSWLIRUPHV$VWLJPDWLQD6SHFLĆFDOO\OLWWOHLVNQRZQ
about the species richness and distribution of feather mites in
bird species. In this study we report feather mites associated
ZLWKĆYHVSHFLHVRIUHVLGHQWDQGPLJUDWRU\3DVVHULIRUPHV
(Zonotrichia capensis, Diglossa humeralis, Pheucticus aureoventris,
Vireo olivaceus and Geothlypis philadelphia). Samples were taken
by mist-nets captures at different stations located at campus
of Universidad Pedagógica y Tecnológica de Colombia in Tunja
(Boyaca, Colombia). Morphometric data were taken from each
bird, and feather mites were collected from various parts of
the body, placed in 70% alcohol. In the laboratory, feather
PLWHVPLFURSUHSDUDWLRQVZHUHSHUIRUPHGDQGLGHQWLĆHG
to the lowest taxonomic level possible. Proctophyllodidae
and Trouessartidae mites were the groups most frequently
REVHUYHG7KHVSHFLĆFLW\RIPLWHVZDVFRPPRQSHUELUG
species, the main microhabitats found were head, body and
feathers, being occuped for different stages of mites, also the
type of feather and their surface have relationship with stages
Page 231, Posters
ID t
ABSTRACT
t
Table of Contents
and position of these mites. This study provides new data about
feather mites in some species of birds sampled for Colombia.
463 Uso de hábitat urbano por 300 individuos de
diferentes especies de aves en la zona central de
San José del Guaviare (Guaviare, Colombia)
Cristian Andrs Mur-Escobar1*, Jenifer Andrea RojasLeguizamn1, Brahyan Jimenez-Pinzon2
ǢW'6!8;!1'2;3&'-3£3+!T2-='89-&!&!$-32!£&'
3£31#-!TǣW'8=-$-3!$-32!£&'68'2&-A!/'g
r$!1<8'9|<2!£W'&<W$3
En este estudio se describe la importancia de las zonas
arboladas de la ciudad, con la intención de fortalecer el
DYLWXULVPRHQODV£UHDVKLVWµULFDVGHFRQćLFWRHQ&RORPELD
que aún conservan los ecosistemas tropicales. Estas areas
YLHQHQFREUDQGRLPSRUWDQFLDHQHOPDUFRGHOSRVWFRQćLFWR
colombiano. Entre los meses de marzo de 2014 y enero
de 2015 monitoreamos la actividad de las aves mediante
HOP«WRGRGHSXQWRVĆMRVFRQMRUQDGDVGHREVHUYDFLµQGH
06:00 a 9:00h y 16:00 a 18:30h durante una semana cada
dos meses. Utilizamos binoculares Bushnell 8 X 42mm.
Encontramos que sin importar las condiciones de clima 300
individuos agrupados en 21 familias de aves se desplazan
entre el rio Guaviare y la ciudad, distanciadas por 2 km, y
utilizan la zona arbolada del parque central (con un área de
1km2) como refugio y sitio de dormida. Entre las especies
dominantes de plantas que componen el hábitat se encuentran
Ficus benjamina, Guadua weberbaueri, Elaeis guineensis y en
menor proporción Hibiscus rosa, Calliandra surinamensis y un
{փdփTT
ID t
ABSTRACT
t
individuo de Bombacopsis quinata. Los resultados de análisis
preliminar demuestran que la zona central del municipio
es un refugio importante para las aves y además un sitio de
especial atractivo para el turismo de observación de aves.
464 Bird Fauna of a reach of the Purus River,
in Lábrea, Amazonas, Brazil
Erunai P. Lima1*, Saymon Albuquerque2
ID t
ABSTRACT
t
Table of Contents
16 species, the least abundant families were Thraupidae,
Cuculidae, Cardinalidae, Turdidae, with only four species
each. We recorded species not common in open areas, such as
Ibycter americanus, Dendrocincla merula, Ramphastos tucanus.
We also found vulnerable species, Sporophila caerulescens,
Cyanoloxia cyanoides and Sporophila angolensis. The presentation
of this study is intended to serve as a stimulus for further
research in different parts of the Purus river, in the hope
that these new efforts can be made more intense portions.
ǢW'2;83&'29-233<$!9TǣW'2;83&'29-233<$!9
r'8<2!-!ǡǢ|+1!-£W$31
The Braziliam bird fauna is considered one of the richest in the
world, with approximately 1.901 species. In the Amazon the
SUHVHQFHRIODUJHULYHUVKDVDQLPSRUWDQWLQćXHQFHRQWKHELUG
richness and diversity patterns. In addition, the habitat created
by rivers, such as igapós and march forest harbor approximately
15% of the regional bird fauna. The present study presents a
list of bird species observed along a reach of the Purus River,
in Lábrea, state of Amazonas, northern Brazil. The study area
comprises 350 km of river, most of whith within the Extractive
Reserve of the Middle Purus. In several parts, we observed
RIIRUPDWLRQRIZDWHUERGLHVE\VRLOHURVLRQLQZKLFKćRDWLQJ
vegetation had accumulated, forming a suitable environment
for bird permanence and visits. The species inventory was
carried out in two boat expedition in August and October
2011, in a total of 1,400 km (return trips) and 64 h of sampling.
The methods used were direct observation with binoculars
from 6:00 to 15:00 and sound record. We photographed
the specimens whenever possible. We found 119 species of
32 families. The most abundant family was Psittacidae, with
Page 232, Posters
467 Richness and abundance of Ilha do Mel coastal birds
Mnica Famelli1*, Luciana Festti1, Juliana Rechetelo1,
Ana L. M. Gomes1, Ricardo Krul1
ǢW!#38!;38-3&'82-;3£3+-!
r132-(!1'££-|,3;1!-£W$31
This study characterized and compared coastal bird richness
and abundance in two different types of beaches in Ilha do
Mel, Parana, South of Brazil. Censuses were carried out in
two areas: Nova Brasilia (NB; exposed beach; two points: P1
and P2) and Ponta Oeste (PO, secluded beach, two points:
3DQG3GXULQJ6HSWHPEHUWR$XJXVW$UHD
NB is near a small village while PO was away from any
human occupations. We registered a total of 55 bird taxa
(22 migratory, 31 residents, one partially migratory and
one partially resident) in 460 censuses; nine out of 55 had a
frequency superior of 20%, representing 76.7% of all contacts.
Charadrius semipalmatus and Rynchops nigra were the most
abundant species and represented, together, 57.8% of all
{փdփTT
ID t
ABSTRACT
t
ID t
contacts. Although frequent, the species C. collaris, Egretta
caerulea, E. thula and Vanellus chilensis had low abundance.
Area NB was the richest, with 50 species, and area PO with
VSHFLHV%LUGULFKQHVVDQGDEXQGDQFHZHUHVLJQLĆFDQWO\
GLIIHUHQWDPRQJSRLQWV3)RUW\ĆYHVSHFLHVZHUH
registered in P2, of those, 12 were recorded only in this point.
The highest number of species per census was recorded in
P2 (6.87 ± 0.23), while P4 had the lowest (0.91 ± 0.13). Mean
number of individuals was similar in P1, P2 and P3 and it was
VLJQLĆFDQWO\OHVVLQ33(QYLURQPHQWDOGLIIHUHQFHVLQ
EHDFKKDELWDWDVWKHSUHVHQFHRIDULYHURUDPDQJURYHDUHD
DUHOLNHO\LQćXHQFLQJWKLVGLVWULEXWLRQSDWWHUQ0DQDJHPHQW
and conservation actions should consider the high richness
LQ1%DVZHOODVWKHWRXULVWLFLQćXHQFHWKHUHIRUHIXUWKHU
studies focusing tourism impact should be addressed.
469 Movement and home range of the Austral thrush
Page 233, Posters
ABSTRACT
t
Table of Contents
(Turdus falklandii) among parks in an urban landscape
Csar Muoz Varela1*, Juan Celis Diez2, Francisca
Morales3, Alexis Vasquez4, Camila Bravo5
ǢW32ধ)$-!2-='89-&!&!;Õ£-$!&',-£'T'6;3W&'$3£3+Ð!g'2;83&'
'9!883££38#!23<9;'2;!#£'lmT29ধধ;3&'$3£3+Ð!@-3&-='89-&!&
lmTǣW32ধ)$-!2-='89-&!&!;Õ£-$!&'!£6!8!93T9$<'£!&'+83231!g
'2;83&''9!883££38#!23<9;'2;!#£'TTǤW2-='89-&!&&'
,-£'T'6!8;!1'2;3&''3+8!ऄ!TǥW2-='89-&!&&',-£'T'6!8;!1'2;3
&''3+8!ऄ!TǦW'2;83&''9!883££38#!23<9;'2;!#£'T
r$'1<23A|<$W$£
Urbanization is tantamount to a near-permanent alteration
of land use, resulting in remnants vegetation fragments and
parks of different sizes immerse in an urban matrix, thus,
urbanization has resulted in a reduction of bird richness and
abundance. This urban matrix constitutes a barrier for animal
PRYHPHQWVWKXVSDUNVL]HFRXOGLQćXHQFHPRYHPHQWV
and home range of urban birds. In this context, small parks,
become lower quality habitats, and species will require a
larger area to supply their basic needs. Using radio-telemetry,
we analyzed the movement and home range of the Austral
thrush (Turdus falcklandii), a common native bird of Santiago,
Chile. We assessed movements and home range in two large
parks (> 6 ha) and three small parks (< 0.2 ha) contiguous to
one large park. For home range, we used a Kernel Density
Estimation (KDE), and also a Minimum Convex Polygon
(MCP) for the total area of use. We captured and followed
9 individuals (6 on large parks and 3 on small ones) for 7
{փdփTT
ID t
ABSTRACT
t
consecutive days. Movement between small and large parks
or vice versa wasn’t observed, despite small distance among
parks. Contrary to our predictions, we observe a trend with
large home range in large parks (mean ± SE: 16097± 3337,5
m2), compared to small parks (mean ± SE: 1874,3 ± 321,9
m2). These results suggest that, despite large differences
in park sizes, they are suitable habitats for this species.
472 Comunidade de aves do centro-oeste do Rio Grande do Sul
Lauren R. Teixeira1*, Jorge Reppold Marinho2, Chaiane Teila Iager2
ǢW2-='89-&!&''+-32!£2;'+8!&!&3£;38<+<!-'&!9-99'9lmT8'$,-1f
TǣW2-='89-&!&''+-32!£2;'+8!&!&3£;38<+<!-'&!9-99'9lm
ID t
ABSTRACT
t
Table of Contents
e Furnarius rufus com maior abundância, espécies generalistas
e comuns em ambientes abertos. Foram registradas ainda
Limnoctites rectirostris, Rhea americana e Anthus nattereri como
“quase ameaçada” e “vulneráveis” de extinção, indivíduos que
dependem diretamente de vegetação campestre. As aves
IRUDPVLWXDGDVHPVHWHFDWHJRULDVWUµĆFDVVHQGRLQVHW¯YRUDV
(36,3%) e onívoras (29,7%) as mais representativas em
relação à riqueza de espécies. Nossos resultados permitiram
conferir a importância dessas áreas para manutenção da
comunidade de aves. Por isso, devem ser ampliados os
esforços quanto aos conhecimentos ornitológicos do Pampa,
já que a pressão da agricultura e pecuária é muito intensa,
DPHD©DQGRDFRQVHUYD©¥RGDVDYHVQDĆVLRQRPLDFDPSHVWUH
r£!<8'28<16'£|@!,33W$31W#8
O Bioma Pampa no Brasil é representado unicamente
no Rio Grande do Sul, é constituído em sua maioria pela
vegetação campestre, áreas que estão entre as mais afetadas
mundialmente por atividades antrópicas. Portanto, estudos
que ampliem o conhecimento da avifauna são essenciais para
conservação da biodiversidade. Objetivo foi avaliar a estrutura
da comunidade de aves campestres do centro-oeste do RS. O
WUDEDOKRIRLUHDOL]DGRHP6¥R9LFHQWHGR6XO56HPGXDV£UHDV
de aproximadamente 120 hectares cada, com introdução de
DJURSHFX£ULDHLQćXHQFLDGDHVS«FLHH[µWLFD6XVVFURID$VDYHV
IRUDPDPRVWUDGDVQDSULPDYHUDHYHU¥R)RUDP
realizados 12 pontos de escuta em cada área de no mínimo
400m. Foi avaliada a riqueza e abundância, assim como a
respectiva dieta alimentar. Foram registrados 830 contatos de
121 espécies. Destacamos Zonotrichia capensis, Vanellus chilensis
Page 234, Posters
474 New Record of theMicrastur mintoniWhittaker, 2002
(Falconidae) in the Atlantic forest of northeastern Brazil
Toms G. Capdevile1*, Letcia B. Bissoli, Gustavo R. Magnago
ǢW
!'9!
;31!9$!6&'=-££'|,3;1!-£W$31
After its description in 2002, the cryptic forest-falcon Micrastur
mintoni was rediscovered 12 years later in southeastern Brazil
in Linhares, Espírito Santo, known to date as the only state to
keep a relictual population in the Atlantic forest. Excluded that
extinction, but in a critical situation due to the deforestation of
lowland forests (tabuleiro forests), the northeastern population
KDGQRW\HWEHHQFRQĆUPHGNQRZQE\VSHFLPHQVGHSRVLWHG
LQVFLHQWLĆFFROOHFWLRQVVLQFHIRUPHUO\M. gilvicolis).
Herein, we provide a recent documented record of Micrastur
{փdփTT
ID t
ABSTRACT
t
ID t
mintoni for the Atlantic forest of northeastern Brazil, pointing
a new locality of the species from southern Bahia. Our record
is documented by photographs from Veracel Station Private
Reserve of Natural Heritage (RPPN), municipality of Porto
Seguro, obtained on May 25th of 2014. While working inside
the reserve, after the play-back, one adult M. mintoni quietly
appeared in the middle forest stratum (about 5 m above the
JURXQGDWDERXWDP2QHPLQXWHODWHUWKHIDOFRQćHZ
EDFNLQWRWKHIRUHVWZLWKRXWYRFDOL]LQJ7KLVUHFRUGWKHĆUVW
for Porto Seguro, occurred eight decades after the collection
of the existing specimens from Itabuna and Cachoeira Grande,
corroborating the current occurrence in the Atlantic forest
of northeastern Brazil, being a new locality for M. mintoni.
The paucity of records suggests that the species is indeed
rare in the Atlantic forest, even in well preserved forests and
Information about other localities of occurrence will contribute
to a better understanding of the current distribution and
conservation strategies for this cryptic raptor of discrete habits.
477 Secretive behavior in a large active raptor nest revealed
Page 235, Posters
ABSTRACT
t
Table of Contents
by camera-traps: who is using Harpia harpyjanests
Francisca Helena Aguiar-Silva1*, Olivier Jaudoin2, Tnia M. Sanaiotti1,
Frederico Drumond Martins3, Jos Alves Costa-Filho5, Glucia Helena
Fernandes Seixas6, Samuel Duleba6, Wilson Roberto Spironello1
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǣW83+8!1!&'329'8=!3
&3!=-3f8'!£TǤW29ধ;<;3,-$3'2&'9&'329'8=!3&!-3&-='89-&!&'TǦW
2-='89-&!&'
'&'8!£<8!£&!1!AÖ2-!TӐW
<2&!%È3'3;86-$!&38!9-£
r!+<-!89-£=!Wù|+1!-£W$31
Behavioral ecology of Neotropical eagles has uncertainties
due to limited access to their territories and nesting trees.
This study was carried out in Brazilian forests and focused on
the activities on eight Harpia harpyja active nests in different
nesting cycles. We monitored from Sept 2012 to May 2015
the nests by placing one camera-trap per nest. We obtained
101,767 image records in 1,421 trap days. Seventeen species
occasionally used the nests. Twelve birds (Aburria cumanensis,
Crax fasciolata, Urubitinga urubitinga, Pseudastur albicollis,
Spizaetus ornatus, Cathartes melambrotus (scavenging), Piaya
cayana, Pteroglossus castanotis, Xiphocolaptes major, Cyanocorax
cyanomelas, Tangara palmarum, Psarocolius decumanus) used
while adults were out; Spizaetus ornatus used the nest for
FRXUWVKLSDQGFRSXOD2IWKHĆYHDUERUHDOPDPPDOVDQWHDWHU
Tamandua tetradactyla, tayra Eira barbara, monkey Sapajus
cay, kinkajou 3RWRVćDYXV, opossum Caluromys lanatus) two had
interactions with the H. harpyja adult and one was preyed. Four
of these mammal species are known as H. harpyja preys. This
evidence of multi-species usage of H. harpyja nest reinforces
the value of protecting nesting-tree and the forests surround
{փdփTT
ID t
ABSTRACT
t
them, to ensure the ecological consumer-resource interactions.
Camera-trap was a non-invasive tool for insuring continuous
PRQLWRULQJDVZHOODVSURYLGLQJHIĆFLHQWWLPHHIIRUWLQYHVWPHQW
and allows this large eagle to be studied with no alteration of
EHKDYLRU7KLVVWXG\ZDVVXSSRUWHGE\&$3(6)*%31,13$
)'%9DOH6$'HDQ$PDGRQ*UDQW55),GHD:LOG7,2)
and Cleveland Metroparks Zoo’s Scott Neotropical Fund.
478 Primeros registros de Amaurolimnas concolor(Rallidae:
Aves) en el estado de Santa Catarina, sur de Brasil
– los registros más australes de la especie
E. S. Silva1*, E. Carrano, A. V. Grose, R. V. Mhlen, C. B.
Marcon, L. Bechauser, A. Regolin, H. B. Mozerle
ǢW!-638!336'8!ধ=!6!8!329'8=!3&!!;<8'A!
'£9-1!8Ǣǧ|,3;1!-£W$31
Amaurolimnas concolor SUHVHQWDXQDGLVWULEXFLµQJHRJU£ĆFD
que empieza desde el sur de México, hacia América Central,
llegando a todo el norte de Sudamérica, hasta Bolivia y Brasil.
En territorio brasileño, está documentada para las regiones
norte, centro-oeste y este. Reportamos los registros más
australes y los primeros registros para el estado de Santa
Catarina, presentando ampliación de su distribución en el
sur del Brasil. La especie fue detectada por su vocalización
HVSRQW£QHDHQODVFLXGDGHVGH*DUXYD
,WDSR£\\6¥R)UDQFLVFRGR6XO
(Q,WDMD¯IXHHQFRQWUDGRXQLQGLYLGXR
muerto debido a un desbosque, el mismo está en la colección
del Museo de USP (MZUSP), São Paulo. Registros más
UHFLHQWHVVRQORVGH6¥R)UDQFLVFRGR6XOD
Page 236, Posters
ID t
ABSTRACT
t
Table of Contents
\DSRUF£PDUDWUDPSDD\
DSRUYRFDOL]DFLµQHVSRQW£QHD\UHVSXHVWD
DSOD\EDFN-RLQYLOOHDGRQGH
IXHHQFRQWUDGRVX£UHDGHGHVFDQVR\D
SRUUHVSXHVWDDSOD\EDFN\$UDTXDULDSRU
vocalización espontánea y respuesta a playback). La mayoria
de los registros conocidos han sido en Joinville. La totalidad
de los registros fueron en bosques atlánticos de bajada,
que presentan paisajes bastante degradados. El bosque del
registro más austral (Itajaí) fue casi totalmente suprimido
y la especie no fue detectada nuevamente. Consideramos
la pérdida de hábitat por la degradación de los bosques
atlánticos de bajada, la principal amenaza a la especie.
479 Scarlet Macaw (Ara macao) landscape use
in the Peruvian Amazon rainforest
Gabriela Vigo Trauco1*, Janice Boyd1, Donald J Brightsmith1
ǢW'?!9{2-='89-;@
r6!883;9|$=1W;!1<W'&<
Detailed knowledge of habitat use is key for successful
conservation planning. The Scarlet Macaw (Ara macao) inhabits
a broad array of tropical forest types from Mexico to Bolivia. As
a result, detailed knowledge of landscape use is needed across
its range to understand the landscape needs of the species
overall and create regionally relevant conservation plans. In
well protected landscapes in southeastern Peru, abundance
of the species varies greatly across seasons and forest
types suggesting marked but heretofore unknown habitat
preferences. Due to the highly mobile nature of this species it
{փdփTT
ID t
ABSTRACT
t
LVSDUWLFXODUO\GLIĆFXOWWRTXDQWLI\QRQEUHHGLQJKDELWDWXVH
We used GIS analysis of 730 macaw locations (Argos satellite
telemetry) from 8 birds over 6 study years in the lowlands
of southeastern Peru to describe the non-breeding season
landscape use. The birds ranged over an area of 7921 km2 in
the post-breeding season (April – July) before returning to the
breeding range. Birds remained below 380 m elevation despite
the fact that the species ascends to 850 m.a.s.l. in other parts of
WKHUDQJH/RFDWLRQVDYHUDJHGVLJQLĆFDQWO\FORVHUWRULYHUVWKDQ
H[SHFWHGEXWFRXQWHUWRRXUK\SRWKHVHVZHUHQRWVLJQLĆFDQWO\
FORVHUWRFOD\OLFNV7KHELUGVVLJQLĆFDQWO\SUHIHUUHGVZDPS
DQGćRRGSODLQKDELWDWVZKLOHDYRLGLQJDQWKURSRJHQLFDOO\
WUDQVIRUPHGDUHDV7HUUDĆUPHIRUHVWVZHUHWKHPRVW
commonly used, but were used in proportion to their availability
in the study area suggesting they were not preferred. Our
results highlight the importance of preserving high productivity
swamp environments in the face of their destruction by
extensive gold mining and urban expansion in the region.
480 'LPRUĆVPRVH[XDOHPMyiothlypis nigrocristatacon
base en análisis morfometicos
ID t
ABSTRACT
t
Table of Contents
en la cual existe la necesidad de encontrar caracteres que
permitan distinguir entre macho y hembra. Para lo anterior, se
realizó un estudio morfométrico, con 22 ejemplares adultos
(11 machos y 11 hembras) preservados en la colección de
ornitología de la Universidad Nacional de Colombia, con el
ĆQGHFRQRFHUFDUDFWHU¯VWLFDVI¯VLFDVTXHSXHGDQUHćHMDU
HOGLPRUĆVPRVH[XDOHQHVWDHVSHFLH7RPDPRVYDULDEOHV
morfométricas: culmen expuesto (C.E), culmen total (C.T),
alto pico (A.P), ancho comisura (A.C), largo ala (A), cola (C),
tarso (T) empleando un calibrador (mm), y una regla con tope
PPSDUD$\&5HDOL]DPRVDQ£OLVLV7VWXGHQWTXHUHćHMDURQ
GLIHUHQFLDVVLJQLĆFDWLYDVHQODVPHGLGDVGHFXOPHQWRWDO
(p=0.0307) y ala (p=0.0345). En éstas medidas, las hembras
tenían un valor promedio de 60.18 mm y 13.22 mm para
longitud de ala y longitud de culmen total respectivamente
y los machos tenían un valor promedio de 13.8 mm y de 63
mm para culmen total y longitud de ala respectivamente.
Los resultados demuestran que las medidas morfométicas
son una herramienta útil para diferenciación sexual de esta
especie. El presente estudio es un punto de partida para
futuros estudios de M. nigrocristata, pues actualmente no
se reportan investigaciones relacionadas con el tema.
Jenifer Andrea Rojas-Leguizamn1*, Crisrtian Andrs Mur-Escobar1
ǢW'6!8;!1'2;3&'-3£3+!T2-='89-&!&!$-32!£&'3£31#-!
r/!83/!9£|<2!£W'&<W$3
(OGLPRUĆVPRVH[XDOHVXQDFDUDFWHU¯VWLFDLPSRUWDQWHSDUDOD
LGHQWLĆFDFLµQGHOVH[RGHDOJXQDVDYHVVLHQGRGHXWLOLGDGHQ
HVWXGLRVSREODFLRQDOHVRFRQĆQHVGHFRQVHUYDFLµQMyiothlypis
nigrocristataHVXQDYHPRQRPµUĆFDGHODIDPLOLD3DUXOLGDH
Page 237, Posters
{փdփTT
ID t
ABSTRACT
t
483 $YLIDXQDGHXPIUDJPHQWRćRUHVWDOXUEDQR
Parque Estadual Sumaúma, Manaus, AM
Eglaia Rubens Freitas1*, Maiana Costa Lago1
ǢW
r'+£!-!i8<#'29|,3;1!-£W$31
2VSURFHVVRVGHXUEDQL]D©¥RPRGLĆFDPDV£UHDVGHćRUHVWD
e estão ligados diretamente à diminuição da qualidade
ambiental. A cidade de Manaus ao longo dos anos vem sofrendo
com a perda e fragmentação dos habitats naturais, a partir
GRDXPHQWRGHPRJU£ĆFRDVVLPRVIUDJPHQWRVćRUHVWDLV
da cidade foram aumentando, e com isso a necessidade de
proteção desses lugares. As unidades de conservação são
£UHDVOHJDOPHQWHSURWHJLGDVFRPDĆQDOLGDGHGHFRQVHUYDU
ćRUHVWDVXWLOL]DGDVFRPRUHI¼JLRGDVFRPXQLGDGHVELROµJLFDV
Objetivou-se nesse trabalho apresentar uma lista das espécies
de aves que utilizam o Parque Estadual Sumaúma, localizado
em área urbana da cidade de Manaus, determinando sua
riqueza, composição, abundância e distribuição ecológica.
Foram realizados levantamentos qualitativos e quantitativos,
entre os meses de dezembro de 2014 a abril de 2015. Foram
amostrados 13 pontos ao longo de cinco trilhas pré-existentes
no Parque. As coletas ocorreram no horário de 06:00 às
08:00. Resultando em 123 espécies, distribuídas em 36
famílias, incluindo registros em literatura. Destas, 63 foram
registradas durantes os censos. Onde 11% são consideradas
HVS«FLHVWLSLFDPHQWHćRUHVWDLV$IDP¯OLDPDLVDEXQGDQWH
foi Tyrannidae com 12% das espécies. Foi observado um
predomínio de espécies de ambientes de clareira e copa. Os
Page 238, Posters
ID t
ABSTRACT
t
Table of Contents
dados sugerem que o fragmento em questão apresenta formas
irregulares de ambiente, visto que foram encontradas espécies
de área preservada em ambiente alterado. Dessa maneira, os
dados gerados auxiliam na preservação dos remanescentes
ćRUHVWDLVXUEDQRVFRQWULEXLQGRFRPSODQHMDPHQWRVH
estratégias de conservação para manejo de áreas protegidas.
487 &DUDFWHUL]DFLµQGHDYHVSDUDODLGHQWLĆFDFLµQ\GHOLPLWDFLµQ
del complejo de Páramo los Picachos – Colombia
Julian Eduardo Avila-Campos
2-='89-&!&!$-32!£&'3£31#-!f
/<'!=-£!$!|<2!£W'&<W$3
En el marco del proyecto Insumos para la Delimitación de
Ecosistemas Estratégicos: Páramos y Humedales, se llevó a
cabo la caracterización de avifauna del complejo de páramos
Los Picachos que hace parte de los orobiomas andino,
altoandino y de páramo más aislado al sur de la cordillera
oriental en Colombia. Se ubica en el municipio de San Vicente
del Caguán, poseyendo alrededor de un 96% de su extensión
de ecosistemas naturales. La avifauna de alta montaña de
la serranía de los picachos se había mantenido inexplorada
SULQFLSDOPHQWHSRUGLĆFXOWDGHVGHRUGHQS¼EOLFRTXHKDF¯DQ
difícil obtener información de estas áreas y por ello cada
registro proveniente de la zona se considera muy importante.
No fue sino hasta el presente estudio que se pudo realizar un
acercamiento al área entre los 2700 y 3100 m representando
los primeros hallazgos sobre la composición de la avifauna de
alta montaña de la serranía.
{փdփTT
ID t
ABSTRACT
t
6HLGHQWLĆFDURQHVSHFLHVGHODVFXDOHVFXDWURHVW£Q
incluidas bajo alguna categoría de amenaza, Spizaetus isidori
(EN), Hapalopsittaca amazonina (VU), Andigena nigrirostris
(NT) Contopus cooperi (NT), se registraron especies como
Anisognathus lacrymosus y Metallura tyrianthina que no habían
sido reportados para el sur de la cordillera occidental y que
pueden representar nuevas subespecies. Los registros de
HVWHHVWXGLRVHUYLU£QSDUDDPSOLDU\FRQĆUPDUORVPRGHORV
de distribución de algunas aves y son el primer paso para
desmantelar el vacío de información que existe para esta región
del país. Se requieren esfuerzos adicionales para robustecer
HVWRVGDWRVHLGHQWLĆFDUSRVLEOHVQXHYDVHVSHFLHVTXHSXHGHQ
hallarse en un ecosistema tan aislado y poco conocido.
488 Avifauna presente en la Zona Reservada los
Humedales de Puerto Viejo – ZRHPV, durante las
estaciones de invierno primavera y verano
Cynthia Romero1*, Maria Zapana1
ǢW
ID t
ABSTRACT
t
Table of Contents
\DEXQGDQFLDGHODDYLIDXQDSUHVHQWHDĆQGHFRQWULEXLUDO
sustento técnico para el proceso de categorización, para ello se
realizaron censos por sectores durante el invierno, la primavera
de 2014 y el verano de 2015. Se realizaron censos por método
de transecto y búsqueda intensiva de nidos. Se registraron
en total 71 especies de aves, sobresaliendo Leucophaeus
modestus con 17.6 %, Leucophaeus pipixcan con 9.2% y Numenius
phaeopus con 6.1 % del total de individuos. Además por su
estatus migratorio tenemos 54 residentes y 17 migratorias. Se
establecieron los sectores: Gramadal, canal de agua, bosque,
laguna y playa. El sector de Playa fue el que presentó mayor
cantidad de individuos con 49.5% del total de registros, el
sector con mayor riqueza fueron las Lagunas con 50 especies,
representando el 70.4 % del total de especies registradas
en el periodo de estudio. Así mismo se han registrado zonas
de reproducción de Chroicocephalus cirrocephalus, Ardea
alba, Nycticorax nycticorax, entre otros. Este humedal sigue
albergando avifauna representativa de este ecosistema a
pesar de los impactos antrópicos a los que ha sido expuesto.
r$@2;,-!9831'83|@!,33W'9
Los humedales que son de vital importancia para las aves,
PXFKRVGHHOORVVHHQFXHQWUDQEDMRODLQćXHQFLDGHODDFWLYLGDG
humana que pone en riesgo este ecosistema, por lo cual su
registro es necesario. El área natural protegida Humedales
de Puerto Viejo, se encuentra en proceso de categorización
encontrándose en un estado transitorio denominado Zona
Reservada, según la normativa peruana. Se encuentra al sur de
Lima en la provincia de Cañete y tiene una extensión de 275,81
ha. El objetivo de este estudio fue determinar la composición
Page 239, Posters
492 Richness, abundance and functional groups of forest birds
in Araucaria Forest remnant in the Paraná State, Brazil
Eduardo Carrano1*, Fernando de Camargo Passos2
ǢWf<893&'-Í2$-!9-3£Õ+-$!9TǣW
f'6!8;!1'2;3&' 33£3+-!
'W$!88!23|6<$68W#8
This study examined the richness and abundance of species
and functional groups of forest birds considering two forest
environments (edge and interior) and seasonality. The study
{փdփTT
ID t
ABSTRACT
t
ID t
area has 52 ha and is characterized as a secondary Araucaria
Forest remnant located in the Metropolitan Region of Curitiba,
State of Paraná. Seventeen samplings were conducted
between August 2009 and April 2012 using mist nets. A total
of 570 birds were captured, belonging to 63 species and 19
IDPLOLHV6LJQLĆFDQWGLIIHUHQFHV3(50$129$LQULFKQHVVDQG
abundance of species and guilds between two environments
and also in relation to seasonality were recorded. The most
DEXQGDQWFDSWXUHGVSHFLHVZHUH7XUGXVUXĆYHQWULVDQG
Poospiza cabanisi (9.84%), both showing the highest percentage
contributions (SIMPER) for forest inside (60.9%) and edge
samples (24, 6%) into the remnant. Species were organized in
18 functional groups. Considering both environments, the most
representative guilds in relation to richness and abundance
were omnivores our frugivores of forest edge and interior, and
edge seedeaters, demonstrating the great ecological plasticity
RIWKLVJURXSRIVSHFLHVLQUHODWLRQWRWKHćH[LELOLW\RIKDELWDW
use. Differences in richness and abundance of species and
IXQFWLRQDOJURXSVGLUHFWO\UHćHFWWKHHIIHFWVRIIUDJPHQWDWLRQ
on the forest remnant, mostly in vegetation structure, with the
forest interior increasing similarity with the edge. In the future
it is probable that the remnant studied became a homogeneous
ĆWRĆVLRQRP\EHQHĆWLQJHYHQPRUHIRUHVWHGJHVSHFLHVLQ
relation to those regarded as primarily forest-dwellers.
493 The bird community of Acaraí State Park and adjacent
Page 240, Posters
ABSTRACT
t
Table of Contents
areas, São Francisco do Sul, Santa Catarina, Brazil
Eduardo Carrano1*, Alexandre Venson Grose2, Elsimar
Silveira da Silva3, Ivo Rohling Ghizoni, Jr.3
ǢWf<893&'-Í2$-!9-3£+-$!9TǣW83+8!1!&'Õ9f8!&<!%È3'1
33£3+-!f
TǤW!-638!336'8!ধ=!6!8!!329'8=!3&!!;<8'A!
r'W$!88!23|6<$68W#8
The Acaraí State Park (ASP) has an area of 6,667 ha and located
between Praia Grande and Acaraí river, north coast of Santa
Catarina state, Brazil. Covered by Lowland forests, restinga
and mangroves. The objectives were to inventory birds ind
the ASP and adjacent areas, and identify the main human
impacts. Between years 2005 and 2014 were conducted
YLVLWVLQWKHĆHOGDQGVDPSOLQJVXIĆFLHQF\RIK7KH
LGHQWLĆFDWLRQRIWKHVSHFLHVRFFXUUHGWKURXJKYLVXDODQG
vocalization, being covered trails and access during day and
night. We registered 287 species and 70 families, the most
representative is Tyrannidae (n = 27) and Thraupidae (n =
24). We emphasize occurrence of endangered species in
Brazil (Crypturellus noctivagus, Thalassarche chlororhynchos,
Procellaria aequinoctialis, Amadonastur lacernulatus, Calidris
canutus, Sterna hirundinacea, Thalasseus maximus, Carpornis
melanocephala, Hemitriccus kaempferi and Sporophila frontalis)
DQGUDUHXQFRPPRQLQ6DQWD&DWDULQD6WDWH(Eudocimus
ruber, Accipiter superciliosus, Amaurolimnas concolor,
Chloroceryle aenea, Platyrinchus leucoryphus, Conirostrum
bicolor and Sporophila angolensis). The main human impacts
are: uncontrolled growth of houses surrounding, waste
GLVSRVDOĆUHVLOOHJDOFXWWLQJRIQDWLYHVSHFLHVEuterpe edulis),
{փdփTT
ID t
ABSTRACT
t
hunting, trapping wild animals, occurrence of domestic
dogs and invasive exotic plant species. These impacts are
compounded by lack of supervision and management plan
for this area. This park has a high conservation importance,
the largest protected area and further north coast of
Santa Catarina state, in addition to housing rare species
of birds, and occurrence restricted to that region.
494 Rastreamento VHF de Harpia harpyjadevolvida
à natureza em UC na Bahia
Marcus Canuto1*, Jailson S Santos2, Alexandro D Ribeiro3,
Jos Teixeira3, Samuel C Silva3, Sivaldo S Oliveira3,
Carlos E A Carvalho4, Tania M Sanaiotti5
ǢW
!£$32-(381'9TǣW9;!3'8!$'£TǤW&3!<
8!9-£f-3TǥW83+8!1!&'Õ9f8!&<!%È3
TǦW
r1$!2<;3|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
GXUDQWHGLDVFRQW¯QXRVSRUWUDQVPLVVRU9+)VDW«OLWH
Sempre arisca à aproximação dos observadores, em oito dias
o deslocamento linear diário médio foi 900m, com percurso
linear total de 7,7 km, grande área como as duas anteriores;
saiu dos limites do parque e retornou, como ocorreu com a 1ª
Harpia reintegrada. No 4º dia não se deslocou, o que indica ter
caçado; no 14º predou preguiça-bentinho, mesma presa das
anteriores. Os remanescentes da Costa do Descobrimento
são os últimos com registros de reprodução da espécie
na Mata Atlântica, sua manutenção e ações que buscam
conectividade destes com fragmentos menores auxiliarão
na manutenção de jovens em dispersão. Financiamento:
RPPN Estação Veracel; PARNA do Pau Brasil-ICMBio;
,13$)'%9$/(6$3DUFHULDVHPUHVJDWHDWHQGLPHQWR
Veterinário, estudo genético, transferência e protocolos de
FRQWHQ©¥RUHDELOLWD©¥R&,33$&(0(9(&(7$6,%$0$
(XQ£SROLV%$8)(65DSWRU&RQWUROH$PELHQWDOH%LRFHY
O Plano de Ação Nacional para a Conservação de Aves
de Rapina- PANCAR do ICMBio, determina medidas
prioritárias para conservação da Harpia harpyja. O Programa
de Conservação do Gavião-real no Brasil (PCGR) atua em
algumas ações do PANCAR, estuda a ecologia desta espécie,
propõe e executa devolver à natureza indivíduos aptos. Na
Bahia desde 2004, através do Projeto multi-institucional
“Harpia na Mata Atlântica”, duas harpias da região foram
reabilitadas e soltas no PARNA do Pau Brasil, com 19.020ha
de mata atlântica preservada e protegida. Uma terceira,
jovem em dispersão resgatada em 2012, recebeu os mesmos
protocolos aplicados às anteriores: reabilitação na RPPN
Estação Veracel e soltura no Parque (2014), com rastreamento
Page 241, Posters
495 2HIHLWRGDLGDGHGDćRUHVWDQDGLVSRQLELOLGDGHGH
cavidades para aves não escavadoras na Amazônia central
Carine Oliveira1*, Cintia Cornelius1, Kristina Cockle2
ǢW2-='89-&!&'
'&'8!£&31!A32!9T29ধ;<;3&'-Í2$-!9-3£+-$!9TǣW3<-9-!2!
;!;'2-='89-;@T3££'+'3(+8-$<£;<8'$,33£3('2'>!#£'!;<8!£'93<8$'9
r$!8-2'#-3£3+-!|+1!-£W$31
2YDORUGDVćRUHVWDVVHFXQGDULDV«TXHVWLRQ£YHOHPUD]¥R
de serem jovens, principalmente quando comparadas à
FRPSOH[LGDGHGRKDELWDWHQFRQWUDGRHPćRUHVWDVSULP£ULDV
Cavidades em árvores é um recurso importante para muitas
{փdփTT
ID t
ABSTRACT
t
ID t
HVS«FLHVSRU«PSRGHPVHUUDUDVRXDXVHQWHVHPćRUHVWDV
secundárias. Nosso objetivo foi determinar o efeito da idade
GDćRUHVWDVREUHDIRUPD©¥RGHUHFXUVRVHVVHQFLDLVSDUDD
UHSURGX©¥RGHDYHVTXHH[LJHPFDYLGDGHVSDUDQLGLĆFD©¥R
nas Reservas do Projeto Dinâmicas Biológicas de Fragmentos
Florestais (PDBFF) próximo de Manaus(AM). Realizamos
censos de cavidades e capturas de aves em 39 sitios. Utilizamos
seleção de modelos para determinar a relação entre a idade
GDćRUHVWDHRQ¼PHURGHFDYLGDGHVHRQ¼PHURGHDYHVQ¥R
escavadora . Para avaliarmos as características das cavidades
utilizamos análise multivariada. Observamos um aumento na
GLVSRQLELOLGDGHGHFDYLGDGHVFRPD,GDGHGDćRUHVWDSRU«P
DVćRUHVWDVVHFXQG£ULDVPDLVDQWLJDVaDQRVDLQGDQ¥R
WLYHUDPRQ¼PHURGHFDYLGDGHVGDVćRUHVWDVSULP£ULDV$V
características das cavidades foram menos variáveis em
ćRUHVWDVVHFXQG£ULDVGRTXHQDVSULP£ULDV9HULĆFDPRVTXH
o número de cavidades tem um efeito positivo sobre uma
DEXQG¤QFLDGHDYHVQ¥RHVFDYDGRUDVQDVćRUHVWDVVHFXQG£ULDV
$VVLPFRQFOX¯PRVTXHDVćRUHVWDVVHFXQG£ULDVFRPSHQVDP
de forma parcial a perda de espécies. No entanto, mostramos
que a abundância das cavidades é mais importante que a
LGDGHGDćRUHVWDHPGHWHUPLQDUDDEXQG¤QFLDGHDYHVQ¥R
escavadoras. Portanto, garantindo a presença desses recursos
QDVćRUHVWDVVHFXQG£ULDVVHULDSRVV¯YHOWDPE«PJDUDQWLU
uma comunidade mais diversa de aves que utilizam oco.
498 Bullying in the caatinga: mobbing Participation against
Page 242, Posters
ABSTRACT
t
Table of Contents
Glaucidium brasilianumin the Northeastern Brazil
Hevana S. Lima1*, Luciano Naka1, Flor Las-Casas1, Jonathan Ribeiro1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3
r,'=!2!9£-1!|+1!-£W$31
Mobbing is an anti-predatory behavior where potential preys
exhibit audible and visual displays against a potential predator.
This behavior has been described in different animal groups,
including birds. Altruism, parental care and prey-predator
communication are some of the hypotheses that explains
this behavior. In the Neotropics, the Brazilian Pygmy-owl
(Glaucidium brasilianum) is known as one of the most common
mobbed predators. This study was conducted at the Chapada
do Araripe, Ceará. Our main goals were to 1) characterize
the assembly of birds that mob Glaucidium brasilianum; 2)
assess if the number of individuals and the frequency of
each species participating in the mobbing is related to their
overall abundance in the studied area; and 3) assess if there
is a phylogenetic effects behind species participation. We
conducted 5-min playback experiments simulating the presence
of G. brasilianum in 116 points, distributed through an area
of ~1670ha. Each point was sampled twice (morning and
afternoon). We recorded a total of 70 different bird species
(of 6 orders and 22 families), which represents ~48% of all
bird species recorded at this locality. The participation in
the mobbing was not related to frequency and abundance in
the area , Phaeomyias murina, Cyanoloxia brissoni and Tangara
cayana were the most commonly attracted species, but, are
not the most abundant birds species in the area. We found
{փdփTT
ID t
ABSTRACT
t
a strong phylogenetic signal in the attraction to pygmy-owl
song stimuli, as ~85% of the species recorded belong to the
Passeriformes, and 24% belong to the family Tyrannidae.
499 Impacto de linha de transmissão de energia
sobre a avifauna no sul do Brasil
Jan Karel F. Mahler Jr.1*, Carla S. Fontana2, Marcio
Repenning2, Cristiano E. Rovedder3
ǢW
<2&!3 33#3;2-$!&3-38!2&'&3<£TǣWT
ǤW'88!329<£;38-!1#-'2;!£;&!W
r/!2f1!,£'8|(A#W89W+3=W#8
No mundo, estima-se que a colisão com estruturas relacionadas
à produção, transmissão e distribuição de energia impactem
1 bilhão de aves anualmente. Entre 2006 e 2009 e 2011 e
2012, foi realizado monitoramento mensal para avaliar o
impacto de uma linha de transmissão (LT) sobre as aves e a
HĆFL¬QFLDGHVLQDOL]DGRUHVQRVFDERVGD/7QRPXQLF¯SLRGH
Osório, Rio Grande do Sul, Brasil. Foram registradas 171 aves
de 33 espécies vítimas de colisão durante o monitoramento.
Amazonetta brasiliensis, com 25 registros, Vanellus chilensis, com
23 registros, e Zenaida auriculata, com 21 registros, foram as
espécies mais afetadas. A maioria das espécies registradas é
comum na região de estudo e ocupam diferentes ambientes.
Entretanto, espécies mais raras localmente e restritas a
ambientes úmidos pontuais, como Phleocryptes melanops, foram
impactadas eventualmente. Como o número de registros de
aves obtido pode ser uma subestimativa do total efetivamente
impactado, foi calculado um fator de correção a partir da taxa
Page 243, Posters
ID t
ABSTRACT
t
Table of Contents
de aves mortas não removidas por animais carniceiros (20%)
e da taxa de aves detectadas pelo observador (70%). Com
aplicação do fator de correção, o total de aves impactadas
passa a ser de 1221,43 indivíduos. Considerando que 198,59
km foram percorridos durante o monitoramento, os valores
de aves impactadas por quilômetro foram de 0,86 (valor
bruto) e 7,14 (valor corrigido). Do total registrado, 97 aves
(56,72%) foram encontradas em trechos de LT sinalizados
e 74 (43,27%) em trechos não sinalizados, mostrando uma
EDL[DHĆFL¬QFLDGRVVLQDOL]DGRUHVQDPLWLJD©¥RGRVLPSDFWRV
500 Returning home: movement strategies of Sub-
$QGHDQELUGVLQDPRGLĆHGODQGVFDSH
Carolina Montealegre-Talero1*, Marcela SuarezRubio2, Luis Miguel Renjifo1, Swen Renner3
ǢW32ধ)$-!2-='89-&!&!='8-!2!TǣW29ধ;<;'3( 33£3+@T2-='89-;@3(!;<8!£
'93<8$'9!2&-('$-'2$'9TǤW1-;,932-!2329'8=!ধ32-3£3+@29ধ;<;'
r#-3$!83|+1!-£W$31
Forest patches in fragmented landscapes tend to be
interspersed within an open-habitat matrix. The open
KDELWDWLVW\SLFDOO\VLJQLĆFDQWO\GLIIHUHQWLQVWUXFWXUHDQG
resources availability than forest habitat and therefore could
disrupt movement. We documented movement for one
individual of a long-distant migrant (Catharus ustulatus), one
individual of Buarremon brunneinuchus and two individuals
of Thripadectes virgaticeps, both understory resident
species, in a fragmented landscape dominated by a pasture
matrix in a Sub-Andean region of central Colombia. We
{փdփTT
ID t
ABSTRACT
t
translocated the four individuals away from their captured
sites in a landscape matrix consisting of pasture for cattle
and isolated trees and tracked individuals returning to the
FDSWXUHGORFDWLRQ&XVWXODWXVKDGQRGHWHFWDEOHGLIĆFXOWLHV
traversing a pasture matrix and returning to the captured
site. Understory resident species avoided making lengthy
ćLJKWVDQGXVHGVWHSSLQJVWRQHVDQGQHDUE\FRUULGRUVWRHDVH
their movement. Implementation of stepping stones like live
fences and isolated trees and maintenance of corridors may
contribute to the conservation of bird species by enhancing
functional connectivity in regions with fragmented forests.
501 Maroon-fronted parrot (Rhynchopsitta terrisi) reproduction
ID t
ABSTRACT
t
Table of Contents
Naturales Protegidas). The aim of this study was to evaluate its
reproduction activities during 2011 and 2012. During three
FRQVHFXWLYHGD\VRIHDFKZHHNHQGRI2FWREHUDQGWKHĆUVWRI
1RYHPEHUZHHYDOXDWHGWKHQXPEHURISDLUVDQGćHGJOLQJV
production in three different nesting sites. Our results showed
38 and 26 pairs, 24 and 21 potentials nests, 8 and 6 nest, 14
DQGćHGOLQJVIRUDQGUHVSHFWLYHO\7KHUHZHUH
DQGćHGJOLQJVSHUQHVWLQDQGUHVSHFWLYHO\
all of them observed in October, but not in November. The
productivity between years was according to the reported in
the literature. The evaluated nesting sites represent a good
complement to the most important nesting site reported for
the species in the Cumbres de Monterrey National Park.
in the Cumbres de Monterrey National Park, Mexico
Mauricio Cotera Correa1*, Laura Scott Morales1,
Eduardo Estrada Castilln1, Jesus Castillo2
ǢW
!$<£;!&&'-'2$-!9
38'9;!£'9T2-='89-&!&<;231!&'<'=3'2T
ǣW31-9-32!$-32!£&'8'!9!;<8!£'983;'+-&!9T
r1!<8-$-3i$3;'8!|@!,33W$31
The Cumbres de Monterrey National Park avifauna include at
least 206 species, some with conservation problems according
to the Mexican law. One of them is the maroon-fronted parrot
(Rhynchopsitta terrisi), the most representative and charismatic
bird species of the park with no more 4,000 individuals. It is an
endemic species to the pine forest of the Sierra Madre Oriental
in northeast Mexico and is under endangered status according
to the Mexican law (NOM-059-SEMARNAT-2010). Therefore
the monitoring of its population is a priority by the National
Protected Areas Commission (Comisión Nacional de Áreas
Page 244, Posters
506 Sex-Ratio Deviation in Harpia harpyja
Aureo Banhos1*, Renan Coser2, Tania M. Sanaiotti3, Francisca
H. Aguiar-Silva4, Tomas Hrbek5, Izeni P. Farias5
ǢW'6!8;!1'2;3&'-3£3+-!T2-='89-&!&'
'&'8!£&3968-;3!2;3T83+8!1!&'
329'8=!!3&3!=-3f8'!£TǣW83+8!1!&'Õ9f8!&<!%È3'1'2ধ$!329'8=!3
'-3£3+-!=3£<ধ=!T29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!TǤW29ধ;<;3
!$-32!£&''97<-9!9&!1!AÖ2-!T338&'2!3'1-3&-='89-&!&'T83+8!1!&'
329'8=!!3&3!=-3f8'!£TǥW83+8!1!&'Õ9f8!&<!%È3'1$3£3+-!T29ধ;<;3
!$-32!£&''97<-9!9&!1!AÖ2-!T83+8!1!&'329'8=!!3&3!=-3f8'!£TǦW
!#38!;8-3&'=3£<3''2ধ$!2-1!£T2-='89-&!&'
'&'8!£&31!A32!9
r!<8'3#9|+1!-£W$31
The sex-ratio is a parameter that expresses the proportion
of male and female in a population. Deviation on these
proportions may occur due to differential parental resource
allocation towards one of the sex or to adult differential
{փdփTT
ID t
ABSTRACT
t
mortality. Harpy Eagle (Harpia harpyja) presents sexual
GLPRUSKLVPRQO\E\VL]HKRZHYHUWKLVLVGLIĆFXOWWRREVHUYH
visually in chicks and shed feathers. We tested the sex ratio
deviation from 1:1 using molecular markers for sex in three
life phases: chicks in the nest (n=31), juvenile (n=29) and
adults (n=33), using Chi square. DNA samples came from
feather, blood and tissue from wild, hunted, rescued and
collected individuals from several Brazilian forests. Chicks
DQGDGXOWVSUHVHQWHGVLJQLĆFDQWVH[UDWLRGHYLDWLRQS
with 1 male: 3.4 females and 1 male: 3.1 female, respectively.
Juvenile presented fewer males than females, but differences
ZHUHQRWVWDWLVWLFDOO\VLJQLĆFDQWS!7KHUHVXOWV
indicate that sex-ratio varies slightly among lifestages, but
keeps the same proportions among chicks and adults. This
suggests an adaptive manipulation of the sex ratio. Financial
support: CNPq, FBPN, Scott Neotropical Fund, FAPEAM,
)$3(6DQGWKHSDUWQHUVKLS,13$)'%9$/(6$
509 Phylogeography of Polioptila dumicola (Masked
gnatcatcher) and P. plumbea (Tropical gnatcatcher)
revealed paraphyly and a complex history
Carina C. de M. Moura1*, Michael Wink1, Alexandre
Aleixo2, Alexandre M. Fernandes3
ǢW'-&'£#'8+2-='89-;@TǣW<9'<!8!'29'1£-33'£&-T
ǤW2-='89-&!&'
'&'8!£<8!£&''82!1#<$3
ID t
ABSTRACT
t
Table of Contents
great similarity in species composition. It is believed that
taxonomic similarity is due to Pleistocene climatic changes,
assuming that the Amazon rainforest receded and became
fragmented, facilitating biotic interchange during glacial
periods. Here, we investigated the phylogeography of two
closely related Neotropical bird species from open forest
habitats, Polioptila dumicola and P. plumbea, to understand the
KLVWRULFDOHYHQWVWKDWPLJKWKDYHGULYHQWKHGLYHUVLĆFDWLRQ
of these species with disjunct distribution in open areas. We
sequenced 1143 bp of the mitochondrial gene cytochrome
b of 10 individuals of P. dumicola sampled in 7 localities (from
Amazonas to Minas Gerais) and 19 of P. plumbea from 12
localities along northern and northeastern of Brazil (sampled
in Piauí and Pará states). A striking result inferred from the
Bayesian analysis was the observed paraphyly of P. plumbea
populations from the caatinga dry forest with respect to
the P. plumbea populations from Amazonia. Populations of
P. plumbea from the state of Pará in the Amazonia group are
sister to P. dumicola rather than populations of P. plumbea
from the state of Piauí in the caatinga. The paraphyly of P.
plumbea might be associated with events of dispersal, with later
adaptation to a new habitat and differentiation. Additional
samples, genes, and morphological analyses are being
conducted and will provide further aspects on the evolution
of these passerines from open vegetation in the Neotropics.
r$!8-2!$!82'-83|@!,33W$31W#8
The Amazon rainforest is surrounded by two large areas
of open vegetation. Between these two regions there is
Page 245, Posters
{փdփTT
ID t
ABSTRACT
t
510 7KUHDWHQHGEXWFRPPRQVWDWXVRIćRRGHGIRUHVW
specialized birds in the Rio Branco basin, Roraima, Brazil
Thiago O. Laranjeiras1*, Alice Plaskievicz2,
Marcela F. Torres3, Luciano N. Naka4
ǢW29ধ;<;3,-$3'2&'9&'329'8=!3&!-3&-='89-&!&'TǣW
832!;T2-='89-&!&'
'&'8!£&'38!-1!TǤW29ধ;<;3!$-32!£&'
'97<-9!9&!1!AÖ2-!TǥW2-='89-&!&'
'&'8!£&''82!1#<$3
ID t
ABSTRACT
t
Table of Contents
spilogaster and Synallaxis kollari are restricted to the upper Rio
Branco-Uraricuera, where the destruction of riverine forest
already threatens their populations. We found that all those
species remain relatively common in the region, but this may
FKDQJHUDGLFDOO\LIWKHĆYHK\GURHOHFWULFGDPVSODQQHGIRU
the basin are actually built. Estimates of habitat loss related
to dams are essential for future conservation decisions.
r;,-!+3W£!8!2/'-8!9|-$1#-3W+3=W#8
Current Brazilian (ICMBio) and global (IUCN) red lists include
$PD]RQLDQćRRGHGIRUHVWVSHFLDOL]HGELUGVXQGHUGLIIHUHQW
levels of vulnerability), but data of their occupation and
population are limited. Here we report on the distribution
and status of 14 of these species, which we have found in
the Rio Branco basin (Roraima, Brazil). We conducted 420
DYLDQVXUYH\VSRLQWFRXQWVLQORFDOLWLHVSRLQWV
locality) distributed every 50 km, along the Uraricuera and
Branco rivers, covering one of Amazonian’s largest rainfall
gradients. Half the species were frequently found (>20% of
points that included preferential habitat); and only Agamia
agami, Zebrilus undulatus and Arremonops conirostris were
poorly detected (<4 points). Pauxi tomentosa and the endemic
Cercomacra carbonaria (one of the most detected, in 86
points) occurred throughout all localities. Neochen jubata
and Stigmatura napensis also occurred widely throughout the
river, in the few points (<20) that cover sandbar and sandbar
scrub. Myrmotherula klagesi (the most detected, in 108 points),
Myrmoborus lugubris, Thamnophilus nigrocinereus, Dendroplex
kienerii and Conirostrum bicolor occurred exclusively in the
lower Rio Branco, where human impacts are still few. Picumnus
Page 246, Posters
512 Assimetria bilateral em Pinguins-de-
Magalhães (Spheniscus magellanicus)
Thaís Arruda Gonçalves
2-='89-&!&'
'&'8!£&''82!1#<$3
;!;!,!88<&!!|+1!-£W$31
A assimetria hemisférica do cérebro representa uma característica fundamental na organização e comportamento dos
vertebrados, e pode ser detectada através das atividades motores. Neste trabalho buscamos analisar se existem diferenças
VLJQLĆFDWLYDVQDODWHUDOLGDGHGRV3LQJXLQVGH0DJDOK¥HVS.
magellanicus) através de observações comportamentais e
morfológicas em indivíduos adultos. Este estudo foi realizado
entre outubro de 2014 e fevereiro de 2015 em Punta Tombo,
&KXEXW$UJHQWLQD(VSHFLĆFDPHQWHHVWXGDPRVSDU¤PHWros de lateralizacão: i) uso diferencial das asas (medido através
do desgaste destas em 971 indivíduos); ii) preferência do lado
do corpo atacado em brigas (medido em 227 indivíduos ensanguentados); iii) curvatura do esterno medido a partir de 60
ossos coletados ao longo de toda colônia); e iv) preferência na
utilização dos membros posteriores para superar obstáculos
DUWLĆFLDLVPHGLGRGXUDQWHDSDVVDJHPGHDQLPDLVVREUH
{փdփTT
ID t
ABSTRACT
t
balanças colocadas na sua rota de passagem). Houve apenas
XPDGLIHUHQ©DVLJQLĆFDWLYDQRSDU¤PHWURUHODFLRQDGR¢VOXWDV
pinguins atacam preferencialmente o lado direito do corpo do
inimigo. Esse comportamento agressivo pode ocorrer por disputas por melhor qualidade de ninho, melhores territórios, por
fêmeas, entre outros. Estes resultados sugerem que embora
não haja lateralidade em relação ao deslocamento, pode existir
uma lateralidade no comportamento de S. magellanicus relacioQDGDFRPDFRPSHWL©¥RSRUI¬PHDVRXORFDLVGHQLGLĆFD©¥R
513 5HSHUWµULRYRFDOHYDULD©¥RJHRJU£ĆFDGH
Myrmorchilus strigilatus(Aves: Thamnophilidae)
Jonathas lins Souza1*, Luciano Nicolas Naka1
ID t
ABSTRACT
t
Table of Contents
(2 notas), longos (5-7 notas), e apelos (1 nota). Observações
HPFDPSRVXJHUHPDSUHVHQ©DGHGLPRUĆVPRVH[XDOYRFDO
pois apenas machos emitiram os cantos curtos e as fêmeas
os cantos longos em resposta a vocalização do macho; ambos
HPLWLUDPRDSHOR$DQ£OLVHGHYDULD©¥RJHRJU£ĆFDPRVWURX
diferença nas populações relacionadas com a freqüência: as
populações do Chaco tem freqüências mais baixas que as da
Caatinga em praticamente todos os parâmetros. Uma análise
de função discriminante apontou diferenças diagnosticáveis
nas duas populações. Apesar das diferenças diagnosticáveis,
HVWDVQ¥RVDWLVID]HPPHWRGRORJLDVUHFHQWHVSDUDGHĆQLUOLPLWHV
de espécies (Isler et al., 1998, The Auk, Vol. 115). Trabalhos
moleculares e morfológicos em andamento poderão ajudar a
entender o grau de diferenciação destas duas populações.
ǢW2-='89-&!&'
'&'8!£<8!£&''82!1#<$3
r/32!;,!9i£-29|3-W$31W#8
Populações de aves em alopatria podem desenvolver
mecanismos de isolamento reprodutivo, sendo as vocalizações
associadas ao desenvolvimento de barreiras pré-zigoticas.
Myrmorchilus strigilatus«XPDHVS«FLHHQG¬PLFDGDVćRUHVWDV
secas que apresenta duas subespécies alopátricas, uma na
Caatinga (M. s. strigilatus), e outra no Chaco (M. s. suspicax).
Neste estudo, descrevemos o repertório vocal de M. strigilatus
SDUDYHULĆFDUDH[LVW¬QFLDGHGLIHUHQ©DVYRFDLVHQWUHDV
populações. Para avaliar a existência de diferenças vocais entre
as duas populações, utilizamos 55 gravações (29 da Caatinga e
26 do Chaco) obtidas em campo e arquivos acústicos, nas quais
analisamos oito parâmetros vocais usando o Programa Raven
3UR,GHQWLĆFDPRVWU¬VWLSRVGHYRFDOL]D©·HVFDQWRVFXUWRV
Page 247, Posters
516 ,QćX¬QFLDGRPDQHMRćRUHVWDOVREUHDDVVHPEOHLDGHDYHVHP
uma área de Caatinga na Chapada do Araripe, Ceará, Brasil
Jonathan R. Ribeiro1*, Flor M. G. Las-Casas1,
Weber A. G. Silva2, Luciano N. Naka1
ǢW
TǣW7<!9-9
r/32!;,!2W8!139|<(6'W#8
2PDQHMRćRUHVWDOQD&DDWLQJDVXUJHFRPRDOWHUQDWLYDDRXVR
não-sustentável da terra na região. Porém, pouco se sabe sobre
RVLPSDFWRVGRPDQHMRQDVćRUHVWDVVHFDV2REMHWLYRGHVWH
WUDEDOKRIRLDYDOLDURHIHLWRGRPDQHMRćRUHVWDOQD)D]HQGD3DX
D’arco, localizada na APA da Chapada do Araripe, Ceará, Brasil,
sobre a composição, riqueza e abundância da avifauna. Censos
padronizados (pontos de escuta) com 5 minutos de duração
{փdփTT
ID t
ABSTRACT
t
ID t
ABSTRACT
t
Table of Contents
foram realizados em 162 pontos, localizados sistematicamente
519 Untangling the phylogenetic relationships in
a cada 250 m, cobrindo uma área de 1670 ha. Registramos
the Neotropical becards (Pachyramphus)
103 espécies de aves e 7.340 indivíduos durante os censos.
Lukas J. Musher1*, Joel Cracraft1
A riqueza de espécies e o número de indivíduos registrados
ǢW1'8-$!2<9'<13(!;<8!£-9;38@T'6!8;1'2;3(82-;,3£3+@
diferiram estatisticamente entre as áreas manejadas e não
r£1<9,'8|!12,W38+
manejadas. Menos espécies e indivíduos foram registrados,
em média, nos censos realizados em áreas manejadas. Esta
The Neotropical genus, Pachyramphus, has perplexed
diferença é ainda maior entre as espécies de aves dependentes
systematists for decades, and current evidence places
GHćRUHVWD$FRPSRVL©¥RGDDVVHPEOHLDGHDYHVWDPE«P
them within Tityridae. Traditional molecular markers have
diferiu entre a área manejada e a área controle. Analisando
been unable to resolve phylogenetic relationships within
uma crono-sequência de 10 anos de manejo, não observamos
Pachyramphus, and species limits have not been evaluated
uma tendência de recuperação da composição em relação
with phylogeographic sampling. We are sequencing two
as áreas controle. Analisando o efeito do manejo sobre a
mitochondrial genes, cytB and ND2, as well as using target
avifauna endêmica da Caatinga, vimos que este é espéciecapture and massively parallel sequencing technologies in order
HVSHF¯ĆFRHQTXDQWRDOJXPDVHVS«FLHVHQG¬PLFDVFRPR
to produce high-resolution phylogenetic hypotheses, document
Thamnophilus capistratus ou Synallaxis hellmayri aumentam
GLYHUVLW\DWDĆQHUVFDOHDQGGHWHUPLQHWKHELRJHRJUDSKLF
sua ocorrência em áreas manejadas, outras como Sclerurus
IDFWRUVWKDWFRQWULEXWHGWRGLYHUVLĆFDWLRQLQPachyramphus.
cearensis e Hylopezus ochroleucus diminuem nestas áreas.
Using preliminary data we computed a well-supported
&RQFOX¯PRVTXHDVHVS«FLHVGHSHQGHQWHVGDćRUHVWDV¥R
parsimony tree based on 34 Pachyramphus samples (including
DIHWDGDVQHJDWLYDPHQWHSHORPDQHMRćRUHVWDOHTXHXPSHU¯RGR
12 species and 19 subspecies) of cytB. We found phylogenetic
GHDQRVQ¥RSDUHFHVHUVXĆFLHQWHSDUDTXHDFRPSRVL©¥R
structure at the species level mostly matches patterns seen
da avifauna recupere sua estrutura e composição inicial.
in previous studies, and this structure is fairly concordant
with current taxonomy. However there is some potential
paraphyly within the tree. Individuals of P. validus validus, P.
polychopterus spixii and P. marginatus nanus do not cluster with
other individuals assigned to those taxa. For example, there
are two evolutionarily independent lineages of P. m. nanus from
opposite sides of the Amazon River that show high genetic
divergence and are non-monophyletic. Because two monotypic
taxa, P. minor and P. marginatus nanus, are widespread
Page 248, Posters
{փdփTT
ID t
ABSTRACT
t
within Amazonia, additional sampling may show that these
taxa actually represent multiple evolutionary lineages.
520 A taxonomic revision of Cyphorhinus thoracicusand
Cyphorhinus phaeocephalusshows the
underestimation of Cyphorhinusgenus diversity
Fernanda Bocalini1*, Lus Fbio Silveira1
ǢW'3&'='9T<9'<&' 33£3+-!&!2-='89-&!&'&'3!<£3l m
ID t
ABSTRACT
t
Table of Contents
thoracicus and C. dichrous). Vocal analysis was not informative
to C. phaeocephalus complex, although it has showed great
variability within C. thoracicus complex, the song of C. dichrous
is a short set of haunting whistles while the song of C. thoracicus
also includes trills and squeaks. These results together
with Cyphorhinus arada revision show that the diversity of
Cyphorhinus genus has always been underestimated; it has
increased from 3 species to 14 after taxonomic revisions.
r('('#3$!|+1!-£W$31
Cyphorhinus thoracicus typically inhabits humid mountains
forests discontinuously from the Colombian to the Peruvian
Andes, mostly at elevations above 1,300 m, currently it
comprises two subspecies: C. t. thoracicus and C. t. dichrous.
Cyphorhinus phaeocephalus occurs from Central America
(Honduras) to Colombia, inhabits humid lowlands forests,
always below 700 m, and comprises six subspecies: C. p.
richardsoni, C. p. infuscatus, C. p. lawrencii, C. p. propinquus, C. p.
chocoanus and C. p. phaeocephalus. In both species-complexes
no taxonomic revision has been done so far, despite the
phenotypic variability detected. Here we revise the taxonomy
of C. thoracicus and C. phaeocephalus based on morphological
and vocal characters. A total of 90 specimens and 27 voice
samples of C. phaeocephalus and 66 specimens and 40
voices samples of C. thoracicus were analyzed, including all
forms and the entire distribution of the taxa. Our results of
morphological analysis found diagnostic features that allowed
us to propose recognition of eight valid taxa and we suggest
treating them as full species (C. phaeocephalus, C. chocoanus,
C. propinquus, C. lawrencii, C. infuscatus, C. richardsoni, C.
Page 249, Posters
521 Relationship between the macrophyte cover
and the aquatic bird distribution on Parque
estadual do Rio Doce, Minas Gerais
Pedro Henrique V.B.P. Silva1*, Rayana M. Souza1
ǢW2-='89-&!&'
'&'8!£&'-2!9'8!-9
r6'&83,'28-7<'=#69-£=!|+1!-£W$31
The organization of aquatic bird communities is frequently
related to environmental variables and biological factors.
The presence of macrophytes determines a retention of
OLPQLFRUJDQLVPVFORVHWRHGJHGHĆQLQJDUHJLRQZLWKODUJH
amounts of biomass and high productivity. In lacustrine
systems, aquatic birds have an important role in ecological
processes such as nutrient cycling and other organisms’
biogeographical distribution as they transport them in many
ways, as an example in the feathers. As so, our objective
was to investigate the possible relationship between the
macrophyte cover and the aquatic bird distribution on the
Dom Helvécio lagoon, located at Parque estadual do Rio
Doce, Minas Gerais. The data collection was done through
{փdփTT
ID t
ABSTRACT
t
direct observation, with 10 minutes of observation on each
spot, over the whole extension of the lagoon during 3 days.
With a total of 40 sampling spots, in an effort of 6,7 hours of
observation. The macrophyte cover was measured through
FDWHJRUL]DWLRQE\SHUFHQWDJHRIFRYHULQĆYHFODVVHV1R
VLJQLĆFDQWUHODWLRQVKLSEHWZHHQDTXDWLFELUGGLYHUVLW\DQG
macrophyte cover was found at the studied lagoon. A total
of 16 species of aquatic birds were observed throughout the
lagoon, among these the more abundant were Crotophaga major
and Egretta thula. While the rarest species were Rostrhamus
sociabilis and Cairina moschata. In conclusion, it is necessary to
add another strategy to measure the macrophyte coverage
of the system and to add other environmental factors in the
analysis such as edges average depth and seasonality. These
measures will help to improve the analysis of this study.
523 Turdus serranus, T. fuscater y T. chihuanco, especies
clave para la diseminación de Tripodanthus
acutifoliusen Prunus serotinaen Cajamarca - Perú
Manuel Salomn Roncal Ordoez1*, Manuel Roberto Roncal Rabanal1
ǢW2-='89-&!&!$-32!£&'!/!1!8$!
r1!2<'£832$!£|<2$W'&<W6'
Prunus serotina Ehrhart ssp. capuli, es un árbol nativo y cultivado
GHODćRUDSHUXDQDSURVSHUDHQORV$QGHVHQODYHUWLHQWH
occidental entre 2 500 y 3 200 m de altitud (Calzada, 1980);
protege el suelo agrícola y sirve como barrera viva, material de
protección y confección de muebles, nutrición, además de tener
propiedades medicinales. Este árbol muestra suceptibilidad a
Tripodanthus acutifolius (Loranthaceae). Ensayos de germinación
Page 250, Posters
ID t
ABSTRACT
t
Table of Contents
de las semillas de T. acutifolius procedentes de las excretas
de tres especies de zorzales del género Turdus, tuvieron un
resultado de 100% de poder germinativo, a diferencia de
las semillas que no pasaron por el tracto digestivo de las
especies de Turdus, donde se registro el 0% de germinación
de semillas. En el presente estudio, se determinó que Turdus
serranus, T. fuscater y T. chihuanco, actúan como los principales
agentes de diseminación de Tripodanthus acutifolius en
cinco distritos de la región de Cajamarca en Perú que están
causando un 61,8% de incidencia y un 30% de severidad
patógena en 1627 plantas de Prunus serotina evaluadas.
524 Uso del hábitat rural fragmentado por el ensamble
de aves del bosque templado de Sudamérica
Silvina Ippi1*, Juan Luis Celis-Diez2, Daniel Salinas3,
Mary Willson4, Juan J. Armesto5
ǢW'2;83'+-32!£2-='89-;!8-3!8-£3$,'T2-='89-&!&!$-32!£&'£
31!,<'fT29ধ;<;3&'$3£3+-!@-3&-='89-&!&lmTǣW
9$<'£!&'+83231Ð!T32ধ)$-!2-='89-&!&!;£-$!&'!£6!8!Ð93TǤW
<2&!$-2'2&!!8>-2TǥW
<2&!$-2'2&!!8>-2TǦW6;3W&'$3£3+-!
f2-='89-&!&!;£-$!&',-£'T29ধ;<;'3($3£3+@!2&-3&-='89-;@
r9-£=-66-|@!,33W$31
Los bosques templados del sur de Sudamérica se han visto
H[SXHVWRVDXQDLQWHQVDPRGLĆFDFLµQGHOFDPELRGHXVRGHO
suelo, producto de la actividad agropecuaria y forestal. Así, el
paisaje rural actual está compuesto por fragmentos de bosques
y matorrales inmersos en una matriz de praderas, tierras de
FXOWLYR\SODQWDFLRQHVGHHXFDOLSWXV(VWDPRGLĆFDFLµQGU£VWLFD
{փdփTT
ID t
ABSTRACT
t
ID t
de la cobertura arbórea y de su continuidad ha afectado a
la comunidad de aves de bosque. En este estudio, se evaluó
cómo la composición de los distintos grupos funcionales de
aves de bosque varía en tres hábitats (bosque, hábitat ribereño
y matorral) que componen el paisaje rural del norte de la
isla de Chiloé (Chile), y qué grado de similitud existe entre
estos hábitats. Este estudio forma parte del monitoreo a
largo plazo que se lleva a cabo en la Estación Biológica Senda
Darwin (42°S) a partir del 2010. La riqueza total fue de 39
especies, incluyendo rapaces y aves acuáticas. Las especies
más abundantes fueron Elaenia albiceps y Turdus falcklandii,
ambos importantes dispersores de semillas, y Sephanoides
sephaniodes, probablemente el principal polinizador. La
ULTXH]DGHHVSHFLHVQRGLĆULµVLJQLĆFDWLYDPHQWHHQWUHORV
hábitats, pero sí la abundancia, siendo ésta máxima en el
hábitat ribereño. Los hábitats bosque y ribereño fueron más
similares entre sí en cuanto a las especies dispersoras de
semillas y polinizadores, mientras que las aves insectívoras
usaron de forma más errática los hábitats muestreados.
Nuestros resultados resaltan la importancia de los hábitats
ribereños como corredores biológicos y hábitat para
las aves en un paisaje rural dominado por praderas.
526 Record of Thrush-like Wren Campylorhynchus
Page 251, Posters
ABSTRACT
t
Table of Contents
turdinus(Aves: Troglodytidae) for the state
of Rio Grande do Sul, Southern Brazil
Dilson Vargas-Peixoto1*, Mariane Bosholn2
ǢW2-='89-&!&'
'&'8!£&'!2;!!8-!TǣW29ধ;<;3
!$-32!£&''97<-9!9&!1!AÖ2-!
r--<2-i0!2;!£|+1!-£W$31
The Thrush-like Wren Campylorhynchus turdinus (Lafresnaye,
1846) is a species of Troglodytidae with distribution in
Argentina, Bolivia, Colombia, Ecuador, Peru, Paraguay and
Brazil. The only record in the extreme south of Brazil was
held in the state of Paraná. However, after observing one
individual in the wild, on April 26th, 2015, we report the
ĆUVWUHFRUGVRIWKHCampylorhynchus turdinus unicolor for
the state of Rio Grande do Sul, in the urban area of city
of Santa Maria, southern Brazil. Therefore, we extended
the known distribution range of the species, and establish
a new southern limit for its geographic distribution.
{փdփTT
ID t
ABSTRACT
t
527 Comparação entre o comportamento reprodutivo
do tangará-dançador, entre leques principais
e secundários, ao longo dos meses
Mariane Bosholn1)UDQFKHVFR'HOODćRUD2,
Michele Brodt2, Nilton Cceres2
ǢW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!T
ǣW2-='89-&!&'
'&'8!£&'!2;!!8-!
r#39,3£2W1|+1!-£W$31
Machos do tangará-dançador Chiroxiphia caudata (Aves:
Pipridae) se agregam em leques principais e secundários.
Entretanto, não se sabe se há uma variação comportamental
por parte dos machos, e se a preferência de fêmeas é afetada
diferentemente entre leques principais e secundários. Como o
período reprodutivo do tangará-dançador é longo, é possível
que o comportamento de machos e fêmeas desta espécie
também variem ao longo dos meses. Por isso, investigamos
se a duração das exibições de treino, exibições de corte, e
duração das visitas das fêmeas variam entre leques principais e
secundários do tangará-dançador, e se estes comportamentos
sofrem variação temporal. Para tanto, observamos o
comportamento de machos e fêmeas em leques principais e
secundários, ao longo de três estações reprodutivas. Embora
as danças de treino dos machos de tangará-dançador tenham
sido mais duradouras no leque secundário, o tempo de duração
das danças de corte dos machos, assim como a duração
das visitas de fêmeas foram similares em ambos os tipos de
leque. Além disso, observamos que a duração das danças de
treino e de corte não sofreram variação temporal, embora a
duração das visitas das fêmeas tenha variado. Esses resultados
Page 252, Posters
ID t
ABSTRACT
t
Table of Contents
podem ter implicações sobre a evolução dos leques principais
e secundários, o uso de leques secundários pode ser uma
estratégia adotada por machos subordinados que tem pouca
oportunidade de copular com as fêmeas nos leques principais.
528 Presença de moluscos na dieta de aves passeriformes
em uma área de várzea Amazônica
Gisiane Rodrigues Lima1*, Luciano Nicols Naka2,
Thiago Mahlmann3, Mario Cohn-Haft3
ǢW2-='89-&!&'
'&'8!£&31!A32!9TǣW2-='89-&!&'
'&'8!£&'
'82!1#<$3TǤW29ধ;<;3!$-32!£&''97<-9!9&!1!AÖ2-!
r+-9-!2'W#-3£3+-!|+1!-£W$31
,GHQWLĆFDURVLWHQVDOLPHQWDUHVGDVDYHV«IXQGDPHQWDOSDUD
entender como são utilizados os recursos, as interações entre
as espécies e como se estruturam dentro de comunidades. O
HVWXGRGDGLHWDGHDYHVDLQGDSHUPLWHLGHQWLĆFDUHFRQKHFHU
DVUHOD©·HVHFROµJLFDVĆVLROµJLFDVHFRPSRUWDPHQWDLV3RU«P
existem lacunas sobre o conhecimento da dieta de aves
Neotropicais, inclusive de aves passeriformes de ambientes
de várzea. O objetivo do trabalho foi realizar uma análise do
conteúdo estomacal de espécies de passeriformes pertencentes
às comunidades de várzea coletadas ao longo do Rio Branco
no Estado de Roraima, Brasil. Foram analisados, até o presente
momento 123 estômagos de 81 espécies coletadas no baixo
5LR%UDQFR7RGRRFRQWH¼GRIRLWULDGRHLGHQWLĆFDGRTXDQWRDR
tipo de dieta ou, quando possível, o menor nível taxonômico do
espécime encontrado. O conteúdo estomacal de três indivíduos
de famílias diferentes surpreendeu pela presença de espécimes
GRĆOR0ROOXVFDQDGLHWD$VHVS«FLHVIRUDPMyrmotherula
{փdփTT
ID t
ABSTRACT
t
assimilis (Thamnophilidae), associada a ambientes de várzea,
apresentou três moluscos aquáticos semelhantes (Classe
%LYDOYLDLGHQWLĆFDGRVHPQ¯YHOGHJ¬QHUREupera). Cranioleuca
gutturata (Furnariidae) e Dendroplex picus (Dendrocolaptidae)
apresentaram em sua dieta espécies de moluscos terrestres,
HVWHVLGHQWLĆFDGRVDSHQDVHPQ¯YHOGHFODVVH*DVWURSRGD
Assim, a presença de moluscos na dieta das aves levanta várias
questões acerca da dieta das espécies da várzea Amazônica,
o segundo maior tipo de habitat dentro do bioma. As aves
poderiam estar em busca de cálcio ao ingerir moluscos na
dieta ou estariam sendo simplesmente oportunistas?
530 (VS«FLHVHQG¬PLFDVH£UHDVSULRULW£ULDV
para a conservação da Caatinga
Daniele Mariz1*, Flávia Pinto2, Manuella Andrade
Souza3, Helder Farias Pereira de Araujo4, Weber
Andrade de Giro e Silva5, Luciano Nicolas Naka1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3f
TǣW9$3£!!$-32!£&'3;2-$!
836-$!£fc2;W'97WU!#38!;8-3&'$3£3+-!96!$-!£'329'8=!3f
cf-3£!83TǤWc-3TǥW2-='89-&!&'
'&'8!£&!!8!Ð#!T
ǦW7<!9-9l993$-!3&''97<-9!'329'8=!3&'$39-9;'1!97<ধ$39m
r&!2-1!8-AW6'|+1!-£W$31
ID t
ABSTRACT
t
Table of Contents
GDGRVELEOLRJU£ĆFRVHSRQWRVGHRFRUU¬QFLDREWLGRVDSDUWLU
GHHVS«FLPHVJUDYD©·HVHIRWRJUDĆDVJHRUHIHUHQFLDGDV
Produzimos modelos de nicho ecológico no programa
BioEnsembles para gerar modelos de consenso de vários
algoritmos, utilizando variáveis bioclimáticas de Wordclim, e
GHWRSRJUDĆD$£UHDFRQVLGHUDGDQDPRGHODJHPIRLGH
NPDRUHGRUGROLPLWHRĆFLDOGD&DDWLQJDHVXDVHFRUUHJL·HV
Foram listados 56 taxa (35 espécies e 21 sub-espécies)
endêmicos, pertencentes a 7 Ordens e 22 Famílias. Segundo
a mais recente lista de espécies ameaçadas do Brasil, 6 destas
taxa estão em perigo de extinção, 5 são vulneráveis e 2
estão criticamente ameaçadas (uma delas, Cyanopsitta spixii,
provavelmente extinta na natureza). Segundo os modelos,
quatro ecorregiões da Caatinga concentram a maior quantidade
de taxa endêmicos: a Depressão Sertaneja Setentrional e o
Raso da Catarina (com 27 taxa endêmicos), e o Planalto da
Borborema e a Depressão Sertaneja Meridional (26 taxa
endêmicos). Estas áreas são importantes estrategicamente
para a conservação da avifauna da Caatinga, entretanto, vêm
sofrendo com a pressão de uso antrópico e abrangem poucas
XQLGDGHVGHFRQVHUYD©¥RFRQĆUPDQGRDQHFHVVLGDGHGHD©·HV
e políticas públicas para a preservação da biodiversidade local.
Espécies endêmicas possuem distribuições restritas e requerem
atenção especial nas estratégias de conservação. A Caatinga
apresenta um alto grau de endemismo, mas vem sofrendo um
extenso processo de degradação ambiental. O objetivo deste
trabalho é apresentar uma lista dos taxa de aves endêmicos
da Caatinga, e determinar as áreas prioritárias para a sua
conservação. Para determinar os taxa endêmicos, utilizamos
Page 253, Posters
{փdփTT
ID t
ABSTRACT
t
531 Niche divergence in two alopatric populations of a
Dry Forest avian specialist: the case of Myrmorchilus
strigilatus(Thamnophilidae) in the Caatinga
Lays V. Freitas1*, Mariana Jaramillo1, Jonathas Souza1, Luciano; Naka1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3
r£!!£'W(8'-;!9|+1!-£W$31
No abstract available.
533 Uso de polígonos de distribuição para
modelagens de nicho ecológico
Lilia D. N. Santos1*, Mariana Jaramillo1
ǢW2-='89-&!&'
'&'8!£&''82!1#<$3
r£-£-!2<2'9ǡǡǣ|,3;1!-£W$31
A modelagem de nicho ecológico (MNE) é uma ferramenta
utilizada para avaliar a distribuição das espécies, e os fatores
TXHLQćXHQFLDPVXDRFRUU¬QFLDQDSDLVDJHP1RHQWDQWR
01(SUHFLVDPGHSRQWRVGHRFRUU¬QFLDFRQĆUPDGRV
normalmente obtidos de coleções zoológicas, literatura, e
bancos de dados online. Dependendo da espécie em questão,
o número de localidades pode ser reduzido, e não satisfazer
os valores mínimos necessários para correr os MNE. Uma
alternativa à coleta de dados reais é o uso de polígonos de
distribuição disponíveis na literatura. Neste caso, pontos
aleatórios são obtidos a partir dos polígonos. Nosso objetivo foi
determinar se os MNE de pontos retirados aleatoriamente de
Page 254, Posters
ID t
ABSTRACT
t
Table of Contents
polígonos podem substituir MNE realizados com localidades
FRQĆUPDGDV3DUDUHVSRQGHUHVWDSHUJXQWDXWLOL]DPRVGXDV
espécies de aves Sittasomus griseicapillus e Xiphocolaptes
falcirostris (família Dendrocolaptidae), cujas distribuições
foram modeladas usando MaxEnt e variáveis climáticas na
Caatinga. Os pontos de ocorrência dessas espécies foram
obtidos a partir de bancos de dados, totalizando 574 e 91
pontos para as duas espécies, respectivamente. A partir dos
polígonos publicados por Ridgely et al. (2005), extraímos
100 pontos aleatórios para cada espécie no ArcGIS, os quais
foram utilizados para as MNE. Após as MNE, construímos
mapas binários de probabilidade de ocorrência das espécies.
Análises preliminares apontam que os MNE produzidos a
partir de localidades aleatórias são semelhantes aos obtidos
por localidades reais nas espécies testadas, sugerindo
que estes possam estimar corretamente a ocorrência das
HVS«FLHVHPORFDLVRQGHQ¥RK£UHJLVWURVFRQĆUPDGRV
535 Calidad del nectar de Hamelia patens(Rubiaceae)
\VXUHODFLRQFRQORVYLVWDQWHVćRUDOHV
Liliana Yisela Quispe Flores
2-='89-&!&!$-32!£+8!8-!!3£-2!
@-9'£!7*38'9|+1!-£W$31
/DVSODQWDVFRQćRUHVKDQGHVDUUROODGRGLYHUVDVHVWUDWHJLDV
para atraer insectos y aves como agentes polinizadores,
asegurando repetidas visitas que conduciran a la polinización.
El objetivo fue determinar la relación entre la calidad de
néctar y el número de visitas de las aves nectarívoras. Realicé
{փdփTT
ID t
ABSTRACT
t
el estudio en febrero del 2014, en la Estación Biológica La
Selva, Costa Rica, seleccionando cuatro arbustos de Hamelia
SDWHQVFXEULHQGRODVLQćRUHVFHQFLDVFRQXQDWHODGHDSHUWXUD
de maya de 0,1cm. La extracción del néctar se realizó con un
tubo capilar de 10 µl y el porcentaje de sacarosa fue medido
FRQXQUHIUDFWµPHWURHQFXDWURćRUHVSRUDUEXVWRGHVGH
las 6 hasta las 16 horas. Hamelia patens fue visitada en 30
ocasiones por tres especies de aves, Amazilia tzacatl (83,3%),
Cyanerpes lucidus (10%) y &RHUHEDćDYHROD (6,7%) un polinizador
y dos robadores de néctar. Las visitas están relacionadas con
el volumen de néctar (r=0.90, p< 0.0001) que se encuentren
HQODVćRUHV\HOSRUFHQWDMHGHVDFDURVDWDPEL«QIDYRUHFHDO
número de visitas (r=0.84, p=0.036). Todas las aves observadas
fueron más activos durante las horas pico de la producción
de néctar (6:00 ? 7:30 h) al llegar al medio día, decrece
la actividad de las aves, cuando la producción del néctar
disminuye. A diferencia de los robadores, Amazilia tzacatl fue
observado en horas de la tarde, pero en menor frecuencia
TXHHQODVPD³DQDVHQEXVFDGHćRUHVTXHQRIXHURQYLVLWDGDV
durante el día y aprovechar a consumir el néctar restante.
539 Efeitos de borda, restrições geométricas e a diversidade
GHDYHVHPUHPDQHVFHQWHVćRUHVWDLVGH0DWD$WO¤QWLFD
Eduardo Cansi1*, Marcus Vieira1
ǢW2-='89-&!&'
'&'8!£&3-3&'!2'-83l
m
r'&<!8&3W#-3£3+-!|,3;1!-£W$31
ID t
ABSTRACT
t
Table of Contents
ćRUHVWDLVFRPFRQVHT¾¬QFLDVGHOHW«ULDVSDUDDPDLRU
SDUWHGDELRWDćRUHVWDOQDWLYD$IUDJPHQWD©¥RH[S·HRV
organismos que permanecem no fragmento a condições de
um ecossistema diferente circundante, chamado de “efeito
de borda”. O presente estudo objetiva estudar os efeitos de
borda sobre padrões de riqueza e composição de aves em
IUDJPHQWRVćRUHVWDLV$KLSµWHVHSULQFLSDOGHWUDEDOKR«TXH
HVS«FLHVćRUHVWDLVVHU¥RPHQRVDEXQGDQWHVHPIUDJPHQWRV
com mais efeito de borda, somando-se que existem espécies
generalistas e de borda, que serão mais abundantes. Medidas
de temperatura e umidade serão feitas da borda para o
interior dos fragmentos para caracterizar aspectos abióticos
do efeito de borda. Serão amostrados 20 fragmentos que
YDULDPGHDKHFWDUHVORFDOL]DGRVDEDFLDKLGURJU£ĆFD
do rio Macacu, nos municípios de Guapimirim e Cachoeiras de
Macacu, no Estado do Rio de Janeiro. Para a amostragem das
DYHVVHU¥RXWLOL]DGRVP«WRGRVGHSRQWRVĆ[RVDPRVWUDJHQV
esporádicas e capturas em redes de neblina. O efeito das
restrições geométricas, o Efeito de Borda Geométrico, será
avaliado através de simulações para cada fragmento, utilizando
estimativas de área de movimento para cada espécies
baseadas na literatura ou medidas morfológicas. Os resultados
preliminares deste estudo mostram uma ocupação de 86%
GDVDYHVFRQFHQWUDGDQDSRU©¥RERUGDLQWHUWHUPHGL£ULDGR
fragmento, tendo um domínio de Manacus manacus (Linnaeus,
1766) com 48%. Inferindo que o interior dos fragmentos
GHPDWDDWO¤QWLFDQ¥RSRVVXHPHVS«FLHVćRUHVWDLV
$IUDJPHQWD©¥RćRUHVWDO«DVXEVWLWXL©¥RGHJUDQGHV£UHDV
GHćRUHVWDQDWLYDSRURXWURVHFRVVLVWHPDVGHL[DQGRPDQFKDV
Page 255, Posters
{փdփTT
ID t
ABSTRACT
t
540 Strigiformes como potenciais reservatórios de
EDFW«ULDVPXOWLUUHVLVWHQWHVGRJ¬QHUREnterococcus
Andre Freitas1*, Jeferson Pires2, Daniel Neves3, L. M. Teixeira1
ǢW2-='89-&!&'
'&'8!£&3-3&'!2'-83l
mT
ǣW2-='89-&!&'9;$-3&'TǤW
ID t
ABSTRACT
t
Table of Contents
10,8 %; cylA, 33,8%; gelE, 61,5%. A localização dos Strigiformes
na cadeia alimentar alerta para a possibilidade de atuarem
como reservatórios que propiciem a circulação ambiental
de amostras de Enterococcus apresentando características
similares àquelas encontradas no ambiente hospitalar.
r!2&8'!!8(8'-;!9|,3;1!-£W$31
Os Enterococcus pertencem a microbiota de humanos e
animais, embora alguns atuem como importantes patógenos
responsáveis por infecções graves. Foram caracterizadas 65
amostras de Enterococcus isoladas das fezes de 27 Strigiformes,
encaminhadas ao CETAS-RJ e a CRAS-UNESA. As amostras
IRUDPLGHQWLĆFDGDVIHQRWLSLFDPHQWHHVXEPHWLGDVDWHVWHV
de susceptibilidade a 18 antimicrobianos (disco- difusão). A
SHVTXLVDGHJHQHVIRLUHDOL]DGDSRU3&5)RUDPLGHQWLĆFDGDV
as espécies E. faecalis (66,1%); E. hirae (18,5%); E. faecium
(9,2%); E. gallinarum (3,1%) e E. avium (3,1%). Os percentuais de
Q¥RVXVFHSWLELOLGDGHIRUDPDPSLFLOLQDFLSURćR[DFLQD
FORUDQIHQLFROHQURćR[DFLQDHULWURPLFLQD
56,9%; estreptomicina, 10,8%; fosfomicina, 3,1%; gentamicina,
OHYRćR[DFLQDOLQH]ROLGDQLWURIXUDQWR¯QD
QRUćR[DFLQDSHQLFLOLQDTXLQXSULVWLQD
dalfopristina, 7,7%; rifampicina, 60%; tetraciclina, 23,1% e
vancomicina, 7,7%. A multirresistência (? 3 antimicrobianos) foi
observada em 27,7% das amostras. Os genes detectados entre
as amostras não suscetíveis foram: tet(M), 100%; tet(L), 33,3%;
aph(2’)-Id, 75%; aph(3’)-IIIa, 75%; ant(6?)-Ia, 71,4%; ant(9?)-Ib,
14,3%; vat(D), 40% das amostras não-E. faecalis; erm(B), 21,6%
e mef(A), 13,5%. Foram observados os genes de virulência ace,
64,6%; aggA, 41,5%; asa1, 56,9%; efaA, 66,1%; eeP, 61,5%; esp,
Page 256, Posters
544 Monitoramento populacional de espécies de
DYHVHQG¬PLFDVHDPHD©DGDVGHH[WLQ©¥RGR
cerrado no Triângulo Mineiro (MG)
G. A. Ferreira1*, L. P. M. Paniago1, E. H. M. Campos1, C. Melo1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r+-!2#-3<(<|+1!-£W$31
Conhecer os requerimentos ecológicos de uma espécie é
pré-requisito para que estratégias de conservação tenham
sucesso, especialmente nos trópicos, onde as alterações
antrópicas vêm reduzindo diversos habitats naturais e a falta
GRFRQKHFLPHQWRELROµJLFRGRVRUJDQLVPRVGLĆFXOWDPDLQGD
mais a conservação efetiva das espécies. Assim o objetivo
deste estudo foi monitorar populações de espécies de aves
endêmicas do Cerrado (Melanopareia torquata e Saltaricula
atricollis) e ameaçadas de extinção (Culicivora caudacuta,
Alectrurus tricolor e Coryphaspiza melanotis) que utilizam áreas
de cerrado sensu stricto e campestres, determinando locais
estratégicos na conservação destas, na fazenda Nova Monte
Carmelo, Triângulo Mineiro, Minas Gerais, Brasil. O estudo foi
realizado em áreas de cerrado sensu stricto e áreas campestres,
HQWUHDJRVWRHMDQHLUR)RUDPIHLWRVUHJLVWURV
de cinco espécies, sendo elas C. caudacuta (N=124), A. tricolor
(N=32) e C. melanotis (N=12), todas ameaçadas de extinção,
{փdփTT
ID t
ABSTRACT
t
FODVVLĆFDGRVFRPRYXOQHU£YHOGHDFRUGRFRPD,8&1HGXDV
endêmicas, M. torquata (N=15) e S. atricollis (N=2). Do total de
registros, 180 foram de adultos e cinco de jovens, sendo quatro
de A. tricolor, registrados em dezembro e janeiro e um de C.
melanotis, registrado em janeiro. A princípio observa-se que
as áreas de estudo podem desempenhar papel importante
na reprodução de algumas espécies de aves ameaçadas de
extinção como C. caudacuta e A. tricolor. Além disso, este
estudo torna-se fundamental no âmbito conservacionista
dessas espécies em relação à sua conservação dentro da área
de estudo. Apoio: Empresa DURATEX S.A e FAPEMIG.
548 Efeito da estrutura do habitat urbano e da
perturbação humana sobre a avifauna
Renata R. Leal-Marques1*, Liliane Martins-Oliveira1, Carlos Henrique
Nunes1, Alexandre Gabriel Franchin1, Oswaldo Maral Junior1
ǢW2-='89-&!&'
'&'8!£&'#'8£Æ2&-!
r8'2!;!#-3<(<|+1!-£W$31
Atualmente, paisagens urbanas devem ser consideradas para
a conservação da biodiversidade. Nossas hipóteses são que
praças com maior área e arborização e menor perturbação
humana apresentarão maior riqueza de aves e que as variáveis
associadas a essas características determinarão a composição
e as atividades de forrageamento e reprodução das aves.
Objetivou avaliar a relação entre a estrutura de hábitat com a
riqueza, composição e comportamento da avifauna em praças
S¼EOLFDVGH8EHUO¤QGLD0*)RUDPLQYHVWLJDGDVSUD©DVGH
março a novembro de 2009, totalizando 412h. Foi realizada
Page 257, Posters
ID t
ABSTRACT
t
Table of Contents
caminhada em zig-zag, na qual toda praça era percorrida e
inspecionada com varredura detalhada e considerados apenas
registros visuais. Foram feitas medidas de estrutura do hábitat
e utilizadas regressão linear múltipla e NM-MDS para análises.
Foram registradas 121 espécies, sendo as mais abundantes:
Zenaida auriculata, Passer domesticus e Patagioenas picazuro.
A riqueza de aves correlacionou positivamente com: número
de espécies e de indivíduos de plantas (> 6m); proporção de
cobertura arbórea no entorno; distâncias ao remanescente
de vegetação nativa e ao centro da cidade e negativamente
com o número de pedestres. As aves utilizaram as praças
especialmente para abrigo, alimentação e reprodução. A
composição da avifauna e as atividades de forrageamento
e de reprodução foram relacionadas às características da
vegetação (riqueza, abundância e altura das plantas). Concluise que o número de espécies e indivíduos de plantas e a
complexidade da vegetação em praças são fatores da estrutura
de hábitat essenciais para a riqueza, composição e manutenção
da avifauna no meio urbano. Agradecimento: Fapemig.
552 Blood parasites, ectoparasites, and stress response in birds
of ecuadorian dry forests in relation to habitat disturbance
Gustavo Tomás1*, Leonardo Ordóñez1, Carlos I. Espinosa1
ǢW2-='89-&!&Ì$2-$!!8ধ$<£!8&'3/!lm
r+;31!9|''A!W$9-$W'9
Richness of parasite community is a key indicator of
conservation status of an ecosystem. Several studies have
pointed out variations in parasite community in relation to
{փdփTT
ID t
ABSTRACT
t
ID t
habitat disturbance. In general, those ecosystems in better
conservation state can allow the existence of a more diverse
parasite community than more degraded ecosystems, though
contradictory results have been found. We are exploring the
effect of habitat disturbance on the parasite community of
birds living in dry forests of south-west Ecuador, comparing
three levels of disturbance (degraded forest, semidegraded
forest, and conserved forest). We are evaluating abundance
and prevalence of ectoparasites and blood parasites, and also
the level of physiological stress response as measured with
stress protein levels or HSPs. Moreover, we are exploring
the possible relationship between ectoparasite and blood
parasite loads and physiological stress levels in birds. We are
sampling birds with mist nets in several plots representative
of the different disturbance levels. We are collecting
ectoparasite samples, and a blood simple to determine
prevalence and intensity of infection by blood parasites by
means of both microscopy and molecular techniques. We
are also estimating stress protein levels from blood samples
of birds by means of Western-blot. We present preliminary
results describing incidence of several blood parasites and
ectoparasites in the different bird species sampled.
555 8UXEXVGRVJ¬QHURVCoragyps e Cathartes
Page 258, Posters
ABSTRACT
t
Table of Contents
PRUWRVSRUDWURSHODPHQWRHPWU¬V£UHDV
da Caatinga, Rio Grande do Norte
H. Oliveira1*, N. N. Rosa1, C. Calabuig1
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
r,<+2'-&'93<A!|,3;1!-£W$31
Por serem indivíduos necrófagos, os urubus são observados
ao longo das estradas a procura de carcaças, apesar disso,
há poucos estudos sobre atropelamentos de urubus. Este
estudo foi realizado entre setembro de 2013 e março
GHFRPRREMHWLYRGHLGHQWLĆFDUHFROHWDUPHGLGDV
morfométricas de espécimes de urubus atropelados em
estradas circundantes a três Unidades de Conservação
Federais no bioma Caatinga. Foram registrados 58 espécimes
de urubu, desses, 53 Coragyps atratus (urubu-de-cabeçaSUHWDFRPXPDWD[DGHPRUWDOLGDGHGHLQGNPGLD
e cinco do gênero CathartesFRPLQGNPGLD'HQWUR
do gênero CathartesIRLLGHQWLĆFDGRXPFRPRC. burrovianus
(urubu-de-cabeça-amarela) e um C. aura (urubu-de-cabeçavermelha). A morfometria foi realizada em 27 indivíduos de
C. atratus, com escala em milímetros e apresentaram médias
de 106,7 para o comprimento cabeça ponta do bico (CPB),
55,3 cúlmem total (CT), 42,9 narina ponta do bico (NP), 22,7
altura do bico (BA), 18,3 largura do bico (BL), 77,3 tarso
(T), 169,2 cauda (C) e 402,9 asa (A). O gênero Cathartes sp.
apresentou médias de 93,1 CPB, 48,4 CT, 34,3 NP, 30,0 BA,
18,0 BL, 65,5 T, 237 C e 453,2 A. Os gêneros são facilmente
distinguidos morfologicamente (e.g. formato e coloração da
{փdփTT
ID t
ABSTRACT
t
cabeça, primarias da asa diferentes). No presente estudo,
a maior mortalidade ocorreu em C. atratus para todas as
áreas do estudo e o gênero Cathartes foi registrado em duas
áreas. Durante os monitoramentos, a espécie mais avistada
se alimentando de animais atropelados foi C. atratus que
costuma andar em bandos ao contrário dos do gênero
Cathartes. Isso explicaria a maior mortalidade dessa espécie.
556 Estudo preliminar sobre a dieta alimentar de
Crotophaga ani (Aves: Cuculidae) oriundos de
atropelamentos em duas regiões da Caatinga, RN
H. Oliveira1*, V. Morlanes1, B. K. A. Silva1, A. G.
Lima1, M. S. Godoy1, C. Calabuig1
ǢW2-='89-&!&'
'&'8!£<8!£&3'1-f8-&3
ID t
ABSTRACT
t
Table of Contents
observado. A ordem Araneae apresentou 40%, Coleoptera
80%, Hemiptera 80%, Hetenonemiidae 20%, Hymenoptera
20%, Lepidoptera 60%, Mantodea 20%, Orthoptera 100%;
ovos de origem insecta 20% e material de origem vegetal 20%.
A dieta analisada e pertencente à região da FLONA de Assú
apresentou baixa diversidade de itens pertencentes apenas
às ordens Lepidoptera, Orthoptera, Hemiptera e Coleóptera.
As dietas da região da ESEC do Seridó apresentaram maior
diversidade com a presença de todas as ordens citadas.
Estes dados são interessantes quando comparados a outros
estudos para essa espécie já que não foram encontrados
vertebrados (e.i., anfíbios, cobras ou lagartos). Apesar de
dados preliminares, a diferença existente entre a diversidade
alimentar entre as duas áreas estudadas pode estar
relacionada com a disponibilidade de recursos alimentares.
r,<+2'-&'93<A!|,3;1!-£W$31
A dieta alimentar em aves pode variar de acordo com o
ambiente onde está inserida e a sua posição na cadeia
WUµĆFD(VWHWUDEDOKRWHYHFRPRREMHWLYRFRQKHFHUDGLHWD
alimentar do Anu-preto (Crotophaga ani) através de cinco
conteúdos estomacais coletados entre março a agosto de
2014 oriundos de atropelamentos em estradas circundantes
a duas Unidades de Conservação Federal no bioma Caatinga.
A triagem do conteúdo alimentar foi feita com lupas (x1.6)
HORJRFRQVHUYDGRHP£OFRRO$LGHQWLĆFD©¥RGRVLWHQV
alimentares ocorreu em nível de ordem e, quando possível,
de espécie, com ajuda de chaves taxonômicas. Para todos os
conteúdos foi obtido o peso úmido em balança analítica de
0.0001g de precisão. A frequência de ocorrência foi calculada
como a proporção de moelas em que determinado item foi
Page 259, Posters
566 Reprodução cooperativa e cuidado parental
de Gubernatrix cristata, no Brasil
Andr Pereira1*, Christian Beier1, Mrcio Repenning1, Carla S. Fontana1
ǢW!#38!;8-3&'82-;3£3+-!T<9'<&'-Í2$-!9''$23£3+-!&!
32ধ($-!2-='89-&!&'!;Õ£-$!&3-38!2&'&3<£
r!2&8'W6'8'-8!Wǡǡǣ|!$!&W6<$89W#8
OO cardeal-amarelo (Gubernatrix cristata) ocorre no Uruguai,
centro da Argentina e extremo sul do Brasil, e está ameaçado
em toda sua distribuição. Reprodução cooperativa não era
descrita para a espécie. Nosso objetivo é investigar o cuidado
parental e avaliar o papel de machos, fêmeas e ajudantes no
cuidado de ninhegos. Monitoramos três ninhos no Parque
Estadual do Espinilho, Barra do Quaraí, Rio Grande do Sul,
{փdփTT
ID t
ABSTRACT
t
ID t
GHDDWUDY«VGHĆOPDJHQVWRWDOL]DQGRK
GHREVHUYD©¥R&ODVVLĆFDPRVRSHU¯RGRGHQLQKHJRVHP
IDVHLQLFLDO) GLDVHĆQDO) GLDVSDUDPHGLU
a frequência de visitação (FV) em diferentes estágios de
desenvolvimento da ninhada. Para medir a contribuição de
cada indivíduo no cuidado parental utilizamos Wilcoxon
signed-rank. A FV realizada comparando F1 e F2 de machos,
I¬PHDVHDMXGDQWHVDXPHQWRXVHPGLIHUHQ©DVVLJQLĆFDWLYDV3"
0,05). Comparando a FV de machos em relação às fêmeas (z =
1,014; P = 0,155), assim como fêmeas em relação a ajudantes
(z = 1,60; P = 0,054), também não apresentaram diferença
VLJQLĆFDWLYDQD)(QWUHWDQWRKRXYHGLIHUHQ©DVLJQLĆFDWLYD
na FV de machos e ajudantes (z = 2,497; P = 0,006) na F1.
1D)KRXYHGLIHUHQ©DVVLJQLĆFDWLYDVQD)9SDUDPDFKRVH
fêmeas (z = 2,157; P = 0,014); fêmeas e ajudantes (z = 2,366;
P=0,009) e machos e ajudantes (z = 1,825; P = 0,033). Esses
resultados parciais indicam que machos, fêmeas e ajudantes
aumenta a frequência de visitação (cuidado parental) de
forma similar durante o desenvolvimento dos ninhegos.
Porém o cuidado parental de machos e femêas foi superior
em relação aos ajudantes ao longo do período de ninhegos.
567 Descrição da vocalização de Melanopareia torquata
Page 260, Posters
ABSTRACT
t
Table of Contents
bitorquata (D Orbigny & Lafresnaye, 1837) em Vila
Bela da Santíssima Trindade, Mato Grosso, Brasil
Cintia O. M. Palhares1*, Leonardo E. Lopes1
ǢW2-='89-&!&'
'&'8!£&'-39!f!16<9
£38'9;!£
r$-2ধ!W1'2'9'9|<(=W#8
A bioacústica tem se mostrado útil em estudos taxonômicos
sobre Passeriformes Suboscines. Estudos preliminares sobre
a taxonomia de Melanopareia torquata (Wied, 1830) a partir
de caracteres morfológicos externos sugeriram elevar a
subespécie M. t. bitorquata ao status de espécie independente,
com distribuição restrita aos campos do leste da Bolívia
e sudoeste do Brasil. Este estudo objetiva descrever a
estrutura de vocalização de longo alcance de M. t. bitorquata,
fornecendo subsídios para investigações taxonômicas futuras.
Os registros sonoros analisados (n = 11) foram obtidos em
dezembro de 2009 e novembro de 2014 no município de
Vila Bela da Santíssima Trindade, Mato Grosso. Para isso foi
utilizado o software Raven Pro 1.5, para mensuração das
variáveis: duração (ms), energia (dB), frequência máxima
(Hz) das notas; intervalo entre notas e entre séries (ms);
frequência do primeiro harmônico (Hz) e número de notas
por série. O canto apresentou estrutura harmônica, sendo
possível visualizar até sete harmônicos nas gravações de
melhor qualidade. O harmônico de maior energia foi o primeiro
(frequência média de 2,587 kHz ±0,128; n=304), seguido pelo
TXLQWR9HULĆFRXVHPRGXOD©¥RGHVFHQGHQWHHPDW«
Hz no primeiro harmônico de algumas notas. Houve variação
expressiva nos valores de intervalo entre séries (867,41 ms
{փdփTT
ID t
ABSTRACT
t
±1222,49; n=78; CV=104,9%) e número de notas por série
(2,81 notas ±1,76; n=68; CV=62,5%). Os resultados sugerem
que a duração e frequência das notas, bem como valores de
energia e frequência dos harmônicos, podem ser medidas de
interesse na comparação com as demais subespécies, tendo
potencial para compor um estudo taxonômico do grupo.
586 Itens alimentares de Formicariidae, Scleruridae e
Dendrocolaptidae, Donacobiidae, Polioptilidae, Turdidae,
Mimidae e Motacillidae (Aves: Passeriformes)
Leila Santos Belini1*, Thais G. Marcon1, Thaynara
C. dos S. Rocha Rocha1, Sergio R. Posso1
ǢW
r£'-£!#'£-2-|,3;1!-£W$31
O cerrado é um bioma dominado por formações vegetacionais
abertas ou campestres e possui 837 espécies de aves sendo
22 endêmicas. Entretanto não há uma base de consulta sobre
os itens alimentares consumidos pelas aves neste bioma.
7DOEDVHIRUQHFHLQIRUPD©·HVVREUHDHVWUXWXUDWUµĆFDGD
comunidade avifauna e suas interações com os demais táxons
no cerrado. O presente trabalho tem como objetivo descrever
o itens alimentares das famílias Formicariidae, Sclecuridae
e Dendrocolaptidae, Donacobiidae, Polioptilidae, Turdidae,
Mimidae, Motacillidae e do cerrado brasileiro através de
UHYLV¥RELEOLRJU£ĆFD7DOUHYLV¥RIRLUHDOL]DGDFRPDX[¯OLR
do google scolar e consideradas dentro de uma categoria
alimentar aquelas espécies cuja literatura concorda em pelo
menos 75% das citações, caso contrário foram consideradas
onívoras. Em Dendrocolaptidae 26,08% são onívoros
Page 261, Posters
ID t
ABSTRACT
t
Table of Contents
(Dendrocincla fuliginosa, Sittasomus griseicapillus, Xyphorhynchus
picus, X. guttatus, Glyphorhynchus spirurus e Campylorhamphus
trochilirostris) e 73,91% insetívoras. As espécies das famílias
Formicariidae, Scleruridae, Donacobiidae (Donacobius
atricapilla), Polioptilidae (Ramphocaenus melanurus, Polioptila
plumbea e P. dumicola) e Motacillidae (Anthus lutescens) são
consideradas insetívoras. Todas as espécies do cerrado de
Mimidae (Mimus gilvus, M. saturninus e M. triurus) e Turdidae
(n = 11) são consideradas onívoras pela literatura. Não foram
encontrados estudos dos itens alimentares de Xyphorhynchus
elegans, Dendrocincla pallescens e Anthus hellmayri, indicando
a prioridade deste tipo de estudo nestas espécies.
588 Reproductive Success and Survival of Tyrannus
melancholicus (Vieillot, 1819) (Aves: Tyrannidae)
in a Area of Restinga in Southeastern Brazil
Hermes Daros1*, Charles Duca1
ǢW2-='89-&!&'-£!'£,!lm
r&!839W,'81'9|,3;1!-£W$31
(VWLPDWHVRISRSXODWLRQSDUDPHWHUVLVWKHĆUVWVWHSWR
understand population dynamics. This study analyzed Tyrannus
melancholicus demographic attributes in a protected area of
Southeast Brazil, evaluating breeding success, causes of nest
loss, survivorship, fecundity and population growth rate.
We found twenty-four nests that were checked in intervals
of 2-3 days. Of them, 31.5% were successful, 1.9% was
abandoned and 66.7% were predated. Therefore, predation
was the main cause of nest loss. Daily survival rate (DSR)
of the nests was 0.96 d-1, with a breeding success of 30.9%
{փdփTT
ID t
ABSTRACT
t
being these values considered high when compared with
other studies of neotropical passerines. The annual survival
rate was 0.51 y-1, considered low for neotropical birds. The
fecundity was m = 0.33. With high breeding rates and low
survival, it is likely that the population of T. melancholicus
is sensitive to variations in fecundity. Four models used
to estimate population growth suggest different results:
r = -0.159 (stable), or ranging between 0.555 and 0.684
GHFOLQLQJ6KRZLQJQRYLVLEOHSRSXODWLRQGHFOLQHWKURXJKĆHOG
observations over the years, it is possible that other variables
LQćXHQFHWKLVG\QDPLF$SODXVLEOHK\SRWKHVLVLVWKDWXUEDQ
populations with high population growth are cushioning the
decline of the reserve’s population through emigration.
590 Composição e riqueza de aves sobre efeito de
borda em remanescentes de Mata Atlântica
Eduardo Cansi1*, Marcus Vieira1
ǢW2-='89-&!&'
'&'8!£&3-3&'!2'-83
r'&<!8&3W#-3£3+-!|,3;1!-£W$31
$IUDJPHQWD©¥RćRUHVWDOHXPDVXEVWLWXL©¥RGHJUDQGHV
£UHDVGHćRUHVWDQDWLYDSRURXWURVHFRVVLVWHPDVćRUHVWDLV
deixando manchas, com consequências deletérias para uma
PDLRUSDUWHGDELRWDćRUHVWDOQDWLYD$IUDJPHQWD©¥RH[S·H
os organismos que permanecem no fragmento à condições
de um ecossistema diferente circundante, chamado de “efeito
de borda”. O presente estudo objetivou estudar os efeitos
GHERUGDFDXVDGRVHPDYHVHPIUDJPHQWRVćRUHVWDLVVH
fragmentos com maior efeito de borda teriam menor riqueza
Page 262, Posters
ID t
ABSTRACT
t
Table of Contents
e equitabilidade de aves. Avaliando se as espécies de aves
ćRUHVWDLVVHOHFLRQDPRVGLIHUHQWHVHOHPHQWRVGHSDLVDJHQV
fragmentadas, de acordo com a disponibilidade ou em função
do efeito de borda existente em 15 fragmentos que variam de
50 a 225 hectares, nos municípios de Guapimirim e Cachoeiras
de Macacu, no estado do Rio de Janeiro. A hipótese principal
GHWUDEDOKRIRLTXHHVS«FLHVćRUHVWDLVV¥RPHQRVDEXQGDQWHV
em fragmentos com maior efeito de borda, somando-se que
existem espécies generalistas e de borda, que seriam mais
abundantes. Para a amostragem das aves, foram utilizados
métodos de capturas de aves através de redes de neblina,
procurando avaliar o efeito de borda geométrico. Os resultados
preliminares deste estudo mostram uma ocupação de 86%
GDVDYHVFRQFHQWUDGDQDSRUF¥RERUGDLQWHUWHUPHGL£ULDGR
fragmento, testadas através de um modelo não-paramétrico,
o teste de Kruskal-Wallis ANOVA, sendo o p <0,05. Inferindo
que o interior dos fragmentos de mata atlântica não possuem
espécies especialistas, e sim generalistas. Ou ainda, que
fragmentos de mata atlântica possuem uma borda mais atrativa.
601 Distribuição de aves frugívoras e nectarívoras em
XPDćRUHVWDXUEDQDQDFLGDGHGH0DQDXV
Welliton Martins1*, Urnia C. Ferreira1
ǢW2-='89-&!&'
'&'8!£&31!A32!9
r>'££-;321!8ধ29Ǥǣ|,3;1!-£W$31
A distribuição dos organismos no espaço está geralmente
relacionada a distribuição dos recursos alimentares. Nosso
REMHWLYRIRLYHULĆFDUDGLVWULEXL©¥RGDGLYHUVLGDGHHDEXQG¤QFLD
{փdփTT
ID t
ABSTRACT
t
ID t
ABSTRACT
t
Table of Contents
de espécies de aves pertencentes a dois grupos funcionais
(frugívoros e nectarívoros) com relação a áreas ripárias e não
ULS£ULDVHPXPDćRUHVWDXUEDQDQDFLGDGHGH0DQDXV1RVVD
hipótese foi que áreas ripárias seriam mais produtivas ao
oferecerem água e nutrientes de forma mais constante para
plantas que oferecem recursos para estas aves. Portanto
esperávamos uma maior abundância e riqueza de espécies
destes grupos funcionais nas zonas ripárias que nas não
ripárias. Para a amostragem da avifauna, utilizamos redes de
neblina dispostas em 10 transectos de 120 m cada, em zonas
ripárias, e 10 em zonas não ripárias. No total capturamos
10 espécies do interesse desse estudo, sendo seis espécies
frugívoras e quatro espécies nectarívoras. Observamos que
não houve diferença entre as zonas ripárias e não ripárias
com relação ao número de indivíduos capturados tanto
para frugívoros como nectarívoros. No entanto, quando
YHULĆFDPRVDGLYHUVLGDGHPHGLGDSHOR¯QGLFHGH6LPSVRQ
separadamente para cada grupo, encontramos diferenças
entre áreas ripárias e não ripárias. Portanto, este estudo
PRVWUDTXHQRIUDJPHQWRćRUHVWDOGD8QLYHUVLGDGH)HGHUDO
do Amazonas há diferença quanto à diversidade de aves
frugívoras e nectarívoras entre as zonas riparias e não riparias.
Page 263, Posters
{փdփTT

baixe o livro de resumos noc

Transcription

Similar documents

Introducción

common birds aves comunes

Isla del Coco

paraguay biodiversity paraguay biodiversität

Birds of Puerto Vallarta

ICSI Cheeta

PDF Preview - Orquídeas Tropicales

Guyra Paraguay © Guyra Paraguay

Barbacoas y seguridad alimentaria

Foliar micromorphology in the classification of South American