Productos para riego de jardines

Comments

Transcription

Productos para riego de jardines
Productos para riego de jardines
Catálogo 2013
El uso inteligente del agua.™
Nuevos productos
www.rainbird.com/newproducts
Presentación de los nuevos productos de Rain Bird® para el 2013
Cada nuevo producto para el 2013 demuestra la capacidad de Rain Bird para brindar soluciones de riego que mejoran la productividad y
rentabilidad al mismo tiempo que refuerzan el compromiso continuo de la empresa con El uso inteligente del agua. La información detallada
de los productos y sus especificaciones se pueden encontrar en las páginas indicadas.
Cuerpos de aspersores
Boquillas aspersoras
Aspersores serie
RD1800™
Boquillas serie
R-VAN
Boquillas serie
HE-VAN (Actualmente
página 13
página 45
solo están disponibles en
algunos mercados.)
Válvulas
Programadores
Válvulas serie HV
Controlador serie
ESP-Me
Controlador serie
ESP-RZX
página 122
página 121
página 92
Nuevos
productos
para 2012
página 38
Productos de drenaje
Estaciones de bombeo
Accesorios para rejillas, cuencas y drenaje
Estaciones de
bombeo serie LC
página 221
página 206
Riego de bajo volumen
Relés de arranque
de bombas PSR,
PSRP y PSRPL
página 213
Indicador de
funcionamiento
para sistemas
de riego por
goteo
Nuevos accesorios
y kits de control de
zona
desde página 196
página 183
p
Compromiso de Rain Bird para el ahorro de agua
Rain Bird se enorgullece de sus esfuerzos para apoyar los programas y tecnologías de ahorro de agua que conducen a medios más eficientes
de suministrar agua a los jardines. Busque las etiquetas de certificación Smart Approved y Water Sense en los productos de este catálogo.
Smart Approved WaterMark™
es el programa australiano de
certificación de ahorro de agua en exteriores para aquellos
productos y servicios que ayudan a reducir el uso del agua.
La certificación del producto otorgada por Smart Approved
WaterMark es importante porque se obtiene tras evaluaciones
independientes realizadas por una organización respetada
en una región que, debido a la escasez de agua, está próxima
a adoptar tecnologías de ahorro de agua. Para obtener más
información sobre Smart Approved WaterMark, visite www.
rainbird.com/SAWM.
Rain Bird es un orgulloso socio de EPA WaterSense.
Qué significa la etiqueta WaterSense
La Agencia de Protección Ambiental de Estados Unidos desarrolló
el programa WaterSense para que sea fácil para los clientes:
· Reconocer los productos que permiten ahorrar agua a
través de una etiqueta en aquellos productos que cumplen
con los requisitos de conservación del agua.
· Obtener acceso a innovaciones de ahorro de agua.
· Comprender el valor de la eficiencia en el uso del agua.
· Reducir el desgaste de los recursos hidráulicos.
El uso inteligente del agua.™
Productos
con Smart
Approved
WaterMark
Introducción
www.rainbird.com
Introducción
Contenido
Boquillas aspersoras
22
Rotores
48
Impactos
80
Válvulas
87
111
Controladores
119
Sistemas de control centralizado
142
Xerigation®/Riego por goteo
161
Estaciones de bombeo
205
Productos de drenaje
221
Recursos
230
Referencia
233
Garantías
245
Índice
247
Rotores
Referencia
Accesorios
Impactos
8
Válvulas
Cuerpos de aspersores
Accesorios
6
Programadores
Anatomía de un sistema de riego con agua no potable
Sistemas de control
centralizado
4
Xerigation
Anatomía de un sistema comercial con
aprovechamiento eficiente de agua
Bombas
2
Drenaje
Anatomía de un sistema residencial de riego eficiente
Boquillas aspersoras
portada interior
Recursos
Nuevos productos
Cuerpos de
aspersores
Contenido
El uso inteligente del agua.™
1
Introducción
Anatomía de un sistema residencial con
aprovechamiento eficiente de agua
Introducción
Anatomía de un sistema
residencial con aprovechamiento
eficiente de agua*
Medidor de agua
CÉSPED
PENDIENTE
PORTÓN
Esta guía de diseño residencial resalta las soluciones de
productos y tecnologías de Rain Bird para lograr jardines en
buen estado con menos agua.
Aspersores
Regulación de presión en el vástago
ENTRADA
PARA
AUTOS
NO
MI
CA
Mantiene una presión de agua óptima.
Cada reducción de 5 psi (0.34 bares)
reduce el consumo de agua un 6-8%. Con
las boquillas de la serie U, VAN, HE-VAN
y MPR, si un sistema de 70 psi (4.8
bares) se reduce a los 30 psi (2 bares)
recomendados, se puede ahorrar más de
un 50% de agua.1
CÉSPED
t "TQFSTPSFT134SFHVMBSB
30 psi, 2 bares, con boquillas de las
series U, VAN, HE-VAN y MPR)
t "TQFSTPSFT4".134QTJ
PENDIENTE
t "TQFSTPSFT4".134SFHVMBSBQTJ
bares, con boquillas giratorias)
t "TQFSTPSFT3%4".134QTJ
t "TQFSTPSFT3%4".134QTJ
Boquillas de alta eficacia
%JTUSJCVZFOFMBHVBDPONÈTVOJGPSNJEBEZFWJUBO
el rociado excesivo, lo cual se puede traducir en un
ahorro de agua superior al 30%.2
t #PRVJMMBTBTQFSTPSBT4FSJF6
t #PRVJMMBT)&7"/
t #PRVJMMBTBTQFSTPSBTSPUBUJWBT
t #PRVJMMBT37"/
Dispositivos de válvula de retención Seal-AMatic™ (SAM)
Evitan que el agua se drene fuera del sistema en el
aspersor inferior y evitan la erosión, el escurrimiento
y el golpe de ariete.
t "TQFSTPSFT4".
Controladores y sensores
Controladores automáticos con
características de aprovechamiento eficiente del agua
Permiten al usuario final ajustar los ciclos de riego con
facilidad para adaptarse a diferentes terrenos
y a cambios estacionales o climatológicos.
t "TQFSTPSFT4".134QTJ
t $POUSPMBEPS&413;Y
t "TQFSTPSFT4".134QTJ
t $POUSPMBEPS&41.F
t "TQFSTPSFT3%4".
t $POUSPMBEPSFTEFMBTFSJF&41-9
t "TQFSTPSFT3%4".134QTJ
t $POUSPMBEPS4511MVT
t "TQFSTPSFT3%4".1QTJ
Tecnologías de controladores inteligentes
Aspersores para agua no potable
Indicación exclusiva de uso de agua no potable en
la cubierta.
t "TQFSTPSFT3%/1QBSBBHVBOPQPUBCMF
*Todas las afirmaciones sobre el ahorro de agua suponen criterios adecuados
de diseño, instalación y mantenimiento de los productos de riego. El ahorro
real puede variar de usuario a usuario según el clima, las condiciones del lugar
y del sistema de riego, y las prácticas de riego previas.
Ajustan el riego según las variables específicas del lugar. Los
controladores inteligentes pueden reducir el consumo de
agua hasta un 40% o más.3
Riego de bajo volum
volumen
Dispositivos para riego directo a raíz
Suministran agua de forma lenta y directa a la
raíz de las plantas, utilizan un 30-50% menos
de agua que el riego por aspersión y evitan el
rociado excesivo y el escurrimiento. 5
t %JTQPTJUJWPTEFFNJTJØOEFHPUFP
t 4JTUFNBEFDPOUSPM&414.5
t -ÓOFBEFHPUFP9'
t $POUSPMBEPSNPEVMBS&41-9DPODBSUVDIP&5.BOBHFS
t 4FSJF3JFHPBSBÓ[3PPU8BUFSJOH4FSJFT384
Dispositivos de cierre automático
Boquillas de alta eficacia
Cierre automático del controlador cuando se detecta lluvia,
lo que se traduce en un ahorro de agua del 30-35%.4
%JTUSJCVZFOFMBHVBDPONÈTVOJGPSNJEBEZ
evitan el rociado excesivo, lo cual se puede
traducir en un ahorro de agua superior al 30%.2
t 4FOTPSEFMMVWJB34%
t 4FOTPSFTJOBMÈNCSJDPTEFMMVWJBZMMVWJBIFMBEBT83
t #PRVJMMBDVBESBEB42BOUFSJPSNFOUF
denominada XPCN)
**Actualmente sólo están disponibles en algunos mercados.
El diseño del riego es sólo una representación gráfica.
1-7
Para referencia, consulte la pág. 234
2
El uso inteligente del agua.™
Introducción
www.rainbird.com
Introducción
Anatomía de un sistema residencial con
aprovechamiento eficiente de agua
GRAVILLA
CÉSPED
Rotores
Regulación de presión en el
vástago
CASA
Evita la pérdida de agua provocada
por una presión de agua desigual.
Cada reducción de 5 psi (0.34
bares) reduce el consumo de agua
un 6-8%.1 El rotor de la serie 5000
PRS ha registrado un ahorro de
agua del 15-45%.6
PATIO
t 3PUPSFTEFMBTTFSJFT
Plus con PRS
t +VOUBTBSUJDVMBEBT54+134
PARED
PENDIENTE
Boquillas de alta eficacia
La tecnología de la boquilla Rain
Curtain™ proporciona gotas
pesadas con un patrón constante
y uniforme, lo cual evita el rociado
excesivo y ahorra agua.
t -PTSPUPSFTEFMBTTFSJFTZ
5000
Dispositivos de válvula de
retención
CÉSPED
Evitan que el agua se drene fuera
del sistema en el aspersor inferior y
evitan la erosión y el escurrimiento.
t 3PUPSFTEFMBTTFSJFT4".Z
5000
Productos de drena
drenaje
El gran surtido de rejillas, cuencas y accesorios
de drenaje de Rain Bird se utilizan para para
administrar el exceso de agua que puede causar
daño estructural a la casa y destruir los jardines
que la rodean. Si lo desea, este exceso de agua
se puede controlar y recolectar para uso futuro
en riego.
El uso inteligente del agua.™
Boquillas rotativas
Válvulas
ál l
Las válvulas de Rain Bird proporcionan
características excelentes de filtración para obtener
la máxima fiabilidad en diversos entornos.
t -BTCPRVJMMBTHJSBUPSJBTEF3BJO#JSE
necesitan un 60% menos de caudal
y consiguen un ahorro de agua de hasta
un 30%.2, 7
t -BCPRVJMMB37"/EF3BJO#JSEUJFOF
un bajo índice de precipitación, reduce
los deslaves así como la posibilidad de
erosión.
3
Introducción
Anatomía de un sistema comercial con
aprovechamiento eficiente de agua
Introducción
Anatomía de un sistema
comercial con aprovechamiento
eficiente de agua*
En esta guía de diseño comercial se destacan las soluciones tecnológicas
y los productos de Rain Bird para tener un jardín saludable con menor
consumo de agua.
Aspersores
Regulación de presión en el vástago
Mantiene una presión de agua óptima. Cada
reducción de 5 psi (0.34 bares) reduce el
consumo de agua un 6-8%. Con las boquillas de
la serie U, VAN, HE-VAN y MPR, si un sistema de
70 psi (4.8 bares) se reduce a los 30 psi (2 bares)
recomendados, se puede ahorrar más de un 50%
de agua.1
t "TQFSTPSFT134SFHVMBSB
30 psi, 2 bares, con boquillas de las series
U, VAN, HE-VAN y MPR)
t "TQFSTPSFT4".134QTJ
t "TQFSTPSFT4".134SFHVMBSBQTJ
3.1 bares, con boquillas giratorias)
t "TQFSTPSFT3%4".134QTJ
t "TQFSTPSFT3%4".134QTJ
Boquillas de alta eficacia
%JTUSJCVZFOFMBHVBDPONÈTVOJGPSNJEBEZ
evitan el rociado excesivo, lo cual se puede
traducir en un ahorro de agua superior al 30%.2
t #PRVJMMBTBTQFSTPSBT4FSJF6
t #PRVJMMBT)&7"/
t #PRVJMMBTBTQFSTPSBTSPUBUJWBT
t #PRVJMMBT37"/
Dispositivos de válvula de retención Seal-AMatic™ (SAM)
Evitan que el agua se drene fuera del sistema
en el aspersor inferior y evitan la erosión, el
escurrimiento y el golpe de ariete.
t "TQFSTPSFT4".
t "TQFSTPSFT4".134QTJ
t "TQFSTPSFT4".134QTJ
t "TQFSTPSFT3%4".
t "TQFSTPSFT3%4".134QTJ
t "TQFSTPSFT3%4".1QTJ
Aspersores para agua no potable
Si
Sistemas
d
de control
centralizado
Programación automática basada en ET
Ajusta los tiempos de riego teniendo
en cuenta la pérdida de agua del suelo
por evaporación y la pérdida de agua
por transpiración de las plantas, lo cual
garantiza que se utiliza la cantidad
correcta de agua sin regar en exceso
ni en defecto. El ajuste automático
de los programas de riego basado en
MBFWBQPUSBOTQJSBDJØO&5
SFEVDFFM
consumo de agua en un 30-50%.8
Indicación exclusiva de uso de agua no potable
en la cubierta.
t .BYJDPN2®
t "TQFSTPSFT3%/1QBSBBHVBOPQPUBCMF
t *2W
t 4JUF$POUSPM
Gestión de caudal
**Actualmente sólo están disponibles en algunos mercados.
El diseño del riego es sólo una representación gráfica.
1-7
Para referencia, consulte la pág. 234
4
Reducen la pérdida de agua
al controlar los caudales en
tiempo real para ubicar y
aislar los caudales excesivos
provocados por tuberías rotas,
aspersores dañados o válvulas
rotas o que no funcionan.
t .BYJDPN2
Suministran agua de forma lenta y
directa a la raíz de las plantas y utilizan un
30-50% menos de agua que el riego por
aspersión.5
t *2W
Sistema Cycle + Soak™ (de
ciclo/remojo)
t .BYJDPN2
t 4JUF$POUSPM
t .BYJDPN2
t *2W
t 4JUF$POUSPM
t *2W
Riego de bajo
l
volumen
Dispositivos para riego directo a raíz
t 4JUF$POUSPM
Elimina el escurrimiento al
esparcir agua a velocidades
que el suelo puede absorber,
en terrenos como pendientes,
terrenos compactados y áreas
con mal drenaje.
Optimiza el agua disponible y los intervalos
de riego, y gestiona la demanda de caudal
total en el suministro de agua de forma
automática.
*Todas las afirmaciones sobre el ahorro de agua suponen criterios adecuados
de diseño, instalación y mantenimiento de los productos de riego. El ahorro
real puede variar de usuario a usuario según el clima, las condiciones del lugar
y del sistema de riego, y las prácticas de riego previas.
Control de caudal y detección
de fugas
t %JTQPTJUJWPTEFFNJTJØOEFHPUFP
t -ÓOFBEFHPUFP9'
t 4FSJF3JFHPBSBÓ[3PPU8BUFSJOH4FSJFT
RWS)
Boquillas de alta eficacia
%JTUSJCVZFOFMBHVBDPONÈTVOJGPSNJEBE
y evitan el rociado excesivo, lo cual se
puede traducir en un ahorro de agua
superior al 30%.2
t #PRVJMMBDVBESBEB42BOUFSJPSNFOUF
denominada XPCN)
El uso inteligente del agua.™
Introducción
Introducción
www.rainbird.com
Anatomía de un sistema comercial con
aprovechamiento eficiente de agua
Línea de goteo
subterránea
t -ÓOFBEFHPUFPTVCUFSSÈOFB4%*
QBSB
aplicaciones con césped y sin césped.
t -BUFDOPMPHÓB$PQQFS4IJFMEQSPUFHFBM
emisor frente a la invasión de raíces.
t &MSJFHP4%*QVFEFBMDBO[BSVOB
eficiencia del 90% y ahorrar hasta un
70% de agua.
Válvulas
La regulación de presión
para las válvulas mantiene
una presión constante
del agua para evitar el
desperdicio de agua
causado por vapor y neblina
en el aspersor
t .ØEVMP134%JBM
Rotores
Regulación de presión en el vástago
Controladores
l d
y sensores
Controladores automáticos con
características de aprovechamiento eficiente del agua
Estaciones de bombeo
Amplifican la presión a los niveles adecuados.
Como la presión baja puede provocar un
rendimiento bajo y desigual de las boquillas,
con frecuencia los usuarios riegan en exceso
todo el jardín para que el agua llegue a los
lugares secos. Las bombas aumentan la
presión y evitan este problema.
t &TUBDJPOFTEFCPNCFPTFSJF-$
t &TUBDJPOFTEFCPNCFP-1
t &TUBDJPOFTEFCPNCFPEFMBTTFSJFT%%1
Z%19
Permiten al usuario final ajustar con facilidad los ciclos de riego
para adaptarse a diferentes jardines y a cambios estacionales o
climatológicos.
t $POUSPMBEPSFTEFMBTFSJF&41-9.&
t $POUSPMBEPS&41.&
Tecnologías de controladores inteligentes
Ajustan el riego según las variables específicas del lugar. Los
controladores inteligentes pueden reducir el consumo de agua hasta
un 40% o más.3
t &5$-9$BSUVDIP&5.BOBHFS™
t &414.5$POUSPMNPEVMBSJOUFMJHFOUF
Dispositivos de cierre automático
t &TUBDJPOFTEFCPNCFPEFøVKPJOUFSNFEJP
Cierre automático del controlador cuando se detecta lluvia, lo que se
traduce en un ahorro de agua del 30-35%.4
t &TUBDJPOFTEFCPNCFPEFSJFHPQSJODJQBM
t 4FOTPSEFMMVWJB34%
Evita la pérdida de agua provocada por una presión
de agua desigual. Cada reducción de 5 psi (0.34 bares)
reduce el consumo de agua un 6-8%.1 El rotor de la serie
5000 PRS ha registrado un ahorro de agua del 15-45%.6
t 3PUPSFTEFMBTFSJF1MVTDPO134
t +VOUBTBSUJDVMBEBT54+134
Boquillas de alta eficacia
La tecnología de la boquilla Rain Curtain™ proporciona
gotas pesadas con un patrón constante y uniforme, lo
cual evita el rociado excesivo y ahorra agua.
t 5PEPTMPTSPUPSFTEF3BJO#JSE
Dispositivos de válvula de retención
Evitan que el agua se drene fuera del sistema en el
aspersor inferior y evitan la erosión y el escurrimiento.
t 5PEPTMPTSPUPSFTEF3BJO#JSE
Resistencia al vandalismo
Los rotores resistentes al vandalismo evitan las pérdidas
de agua causadas por daños y abusos.
t 3PUPSFTEFMBTTFSJFTZ
t 4FOTPSFTJOBMÈNCSJDPTEFMMVWJBZMMVWJBIFMBEBT83
El uso inteligente del agua.™
5
Introducción
Anatomía de un sistema de riego con agua no potable
Introducción
Anatomía de un sistema de
riego con agua no potable
En esta guía de diseño de agua no potable
se destacan las soluciones tecnológicas y los
productos de Rain Bird para tener un jardín
saludable que utilice agua no potable.
Riego de bajo volumen
t -ÓOFBEFHPUFP9'WJPMFUB
t 5BQBBTQFSTPSB1$WJPMFUB
t 5BQBEFESFOBKFWJPMFUBDPOBDDFTPSJP
Rotores
5BQBTWJPMFUBTQBSBSPUPSFT
t t 1MVT
t t 'BMDPO¥
t t ".BYJ1BX™
Válvulas
Válvulas duraderas resistentes
al cloro y accesorios para
aplicaciones de reciclaje:
t 1&4#3
t &'#$1
t (#
t "DPQMBNJFOUPSÈQJEP
t 5BQBTQBSBDBKBTEFWÈMWVMBT
Suministro de agua
no potable
Hay varias fuentes posibles de
abastecimiento de agua. Las más comunes
en instalaciones comerciales son:
t 3FDPMFDDJØOEFBHVBEFMMVWJB
t 3FDPMFDDJØOEFBHVBTQMVWJBMFT
t $POEFOTBDJØOEFTJTUFNBTEF
climatización (HVAC)
t "HVBTHSJTFTQSPDFEFOUFTEFEVDIBT
fregaderos y lavabos
t 0USBT
6
Productos de drenaje
El gran surtido de rejillas, cuencas y accesorios de drenaje de
alta resistencia de Rain Bird se utilizan para para administrar el
exceso de agua que puede causar daño a las estructuras del lugar
y destruir los jardines que lo rodean. Este exceso de agua se
puede controlar, recolectar y mezclar con el suministro de agua no
potable existente para uso futuro en riego.
El uso inteligente del agua.™
Introducción
Línea de riego
por goteo
-ÓOFBEFHPUFPTVCUFSSÈOFB4%*
QBSB
aplicaciones con césped y sin césped,
disponible en violeta sobre negro para
designar sistemas de agua no potable.
Introducción
www.rainbird.com
Anatomía de un sistema de riego con agua no potable
t -BUFDOPMPHÓB$PQQFS4IJFMEQSPUFHFBM
emisor frente a la invasión de raíces
t &MSJFHP4%*QVFEFBMDBO[BSVOB
eficiencia del 90% y ahorrar hasta un
70% de agua
Riego a
raíz RWS
Rejilla violeta
Estaciones de bombeo
Las bombas proporcionan la cantidad adecuada de
agua presurizada al sistema de riego.
t
t
t
t
t
&TUBDJPOFTEFCPNCFPTFSJF-$
&TUBDJØOEFCPNCFP-1
&TUBDJPOFTEFCPNCFPEFMBTTFSJFT%%1Z%19
&TUBDJPOFTEFCPNCFPEFøVKPJOUFSNFEJP
&TUBDJPOFTEFCPNCFPTJOSJFHP
Aspersores
t "TQFSTPSFT3%/1QBSB
agua no potable)
t 5BQBWJPMFUBQBSB
aspersores de la serie 1800®
El diseño del riego es sólo una representación gráfica.
El uso inteligente del agua.™
7
Cuerpos de aspersores
Introducción
Cuerpos de
aspersores
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
“Las boquillas y los 1800 de Rain Bird son los
mejores del mercado en calidad, confiabilidad
y precio. Nos permiten ofrecer la mejor
garantía a los clientes porque confiamos en
la marca”.
Válvulas
Luis Enrique Ruano,
Bombas y Riegos Profesionales,
Guadalajara, México
Accesorios
Productos principales
Programadores
Aplicaciones primarias
Césped
1802,
1803,
1804,
1806
1812
O
1800
PRS
1800
SAM
O
O
O
O
O
O
O
O
O
Pendientes
Sistemas de control
centralizado
Cubierta vegetal/Arbustos
O
O
O
Sistemas de alta presión
Sistemas de baja presión
O
O
Áreas de viento excesivo
O
O
O
O
1800
1800 SAM- US-200,
SAM-PRS PRS-45
US-400
O
O
O
O
O
O*
O
O
O
Xerigation®
Agua no potable
1300/
PA-80
RD-04,
1400
PA-8S
RD-06
Burbujeadores PA-8S-NP
PA-8S-PRS
RD-12
O
RD1800
SAM
RD1800
SAMPRS
RD1800
SAMPRS-F
RD1800
SAMPRS-45-F
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
Áreas dañadas/afectadas
por el vandalismo
O
Agua sucia
O
O
O
Bombas
*La válvula de retención opcional US-SAM se puede retroadaptar a todos los aspersores UNI-Sprays™.
Sugerencias para ahorrar agua
Drenaje
t El regulador PRS incorporado patentado
Recursos
mantiene una presión operativa óptima y
restringe la pérdida de agua hasta un 70%
en el caso de que se extraiga una boquilla
PRVFSFTVMUFEB×BEB5BNCJÏOUFSNJOB
con el desperdicio de agua al eliminar la
nebulización y la neblina causadas por la
alta presión.
Referencia
8
t Los aspersores de la serie 1800 que
incluyen las válvulas de retención
Seal-A-Matic™ (SAM) ahorran agua, al
evitar las fugas en los aspersores más
bajos y detienen el “golpe de ariete”
previniendo que el agua drene fuera
de la tubería después del riego.
t -BFYDMVTJWBUFDOPMPHÓB'MPX4IJFME™
proporciona una reducción de hasta
el 90% de pérdida de agua cuando se
retira una boquilla, lo cual previene
posibles escurrimientos inaceptables
y costosos.
El uso inteligente del agua.™
Cuerpos de aspersores
1800® Serie
2", 3", 4", 6", 12" (5.1 cm; 7.6 cm; 10.2 cm; 15.2 cm; 30.5 cm)
Tornillo de reducción del radio
Q El sello de limpieza integrado activado a presión se moldea dentro de la
Malla y boquilla MPR de plástico
cubierta y presenta una "jaula" plástica empotrada para proporcionar una
resistencia a la arenilla sin igual, la presión y el medio ambiente. Además,
el diseño de la junta multifunción activada por presión, asegura una junta
eficaz sin exceso de "pérdida de agua", lo que permite que se instalen más
aspersores en la misma válvula
Cuerpos de
aspersores
www.rainbird.com/sprays
Serie 1800®
Sello de limpieza integrado activado
a presión
Q El fuerte resorte de acero inoxidable proporciona una retracción confiable
Resorte retráctil fuerte de acero inoxidable
del vástago
Q El mecanismo de trinquete de dos piezas en todos los modelos permite
alinear fácilmente el patrón de la boquilla y brinda una durabilidad
prolongada
Características
t&MDBVEBMDPOUSPMBEPDPOQSFDJTJØOFOMBSFUSBDDJØOFMJNJOBMBTVDJFEBEEFMB
unidad y asegura una buena retracción del vástago en todo tipo de suelos.
&MUBQØOEFMJNQJF[BQSFJOTUBMBEP1PQ5PQ™EFDPMPSOBSBOKBFWJUB
que las partículas de suciedad más grandes que las aberturas de la malla
EFMGJMUSPEFMBCPRVJMMBFOUSFOEFTQVÏTEFMBMJNQJF[B'BDJMJUBMBJOTUBMBDJØO
de la boquilla.
Entrada lateral en modelos 1806 y 1812*
t$POTUSVJEPDPOQJF[BTEFQMÈTUJDPSFTJTUFOUFTBMQBTPEFMUJFNQPZMPTSBZPT
ultravioleta y de acero inoxidable resistentes a la corrosión,
que garantizan una larga vida útil del producto
Opción de regulador de presión en el vástago PRS
patentado
t5PEPTMPTDPNQPOFOUFTEFMBTQFSTPSTFQVFEFOEFTNPOUBSEFTEFMB
parte superior sin herramientas especiales, lo que permite realizar la limpieza
y el mantenimiento de manera fácil y rápida
Anillo de ajuste de trinquete de dos piezas
(para una fácil alineación del patrón de la boquilla
y durabilidad)
t-PTNPEFMPTZRVFOPTFBO4".
QSFTFOUBOFOUSBEBMBUFSBMF
JOGFSJPS
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
Opción de válvula de retención en el vástago SAM
Seal-A-Matic™)
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t1ÏSEJEBEFBHVBHQNBQTJCBSFT
PNÈT
de lo contrario 0.10 gpm (0.02 m3/h; 0.36 l/m)
Dimensiones y modelos
t 1⁄2&OUSBEBIFNCSBSPTDBEB/15
t.PEFMPTZBMUVSB
- 1802: 4" (10.2 cm) de altura del cuerpo; 2" de altura del vástago retráctil (5.1
cm)
- 1803: 4 7⁄ 8" (12.4 cm) de altura del cuerpo; 3" de altura del vástago retráctil
(7.6 cm)
- 1804: 6" (15.2 cm) de altura del cuerpo; 4" de altura del vástago retráctil
(10.2 cm)
- 1806: 9 3⁄ 8" (23.8 cm) de altura del cuerpo; 6" de altura del vástago retráctil
(15.2 cm)
- 1812: 16" (40.6 cm) de altura del cuerpo; 12" de altura del vástago retráctil
(30.5 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB1⁄4" (5.7 cm)
* Las unidades 1806 y 1812-SAM, SAMPRS y SAM-PRS-45 no poseen entrada lateral.
** de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de aspersores Rain Bird estándar
(series SQ, MPR, VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas giratorias Rain Bird
Serie 1800
Cómo especificar
1804
Altura del vástago retráctil
1802: 2" (5.1 cm) de altura del vástago retráctil
1803: 3" (7.6 cm) de altura del vástago retráctil
1804: 4" (10.2 cm) de altura del vástago retráctil
1806: 6" (15.2 cm) de altura del vástago retráctil
1812: 12" (30.5 cm) de altura del vástago retráctil
Modelo
Cuerpos de los aspersores 1800
El caudal controlado con precisión en la retracción elimina la suciedad de la unidad y asegura un rendimiento confiable y una buena
retracción del vástago en todo tipo de suelos.
El uso inteligente del agua.™
9
Cuerpos de aspersores
Serie 1800®
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores
Q Regulador de presión PRS incorporado en el vástago. Sin piezas que
instalar en el lugar. Ahorra tiempo y dinero
Q Mantiene la presión de salida constante en 30 psi (2.1 bares). Las boquillas
y los cuerpos de aspersores tienen mejor rendimiento a 30 psi (2.1 bares).
Asegura el rendimiento máximo de la boquilla y el cuerpo de aspersor,
incluso si varían las presiones de entrada. Mantiene la presión constante
independientemente de la boquilla que se use
Q 5 FSNJOBDPOMBOFCVMJ[BDJØOZMBOFCMJOBDBVTBEBTQPSMBBMUBQSFTJØO
%FUJFOFFMEFTQFSEJDJPEFBHVB"TFHVSBRVFTFSFBMJDFFMSJFHPOFDFTBSJP
en condiciones de alta presión o viento
Características
t3FTUSJOHFMBQÏSEJEBEFBHVBIBTUBFOVOTJMBCPRVJMMBTFTBMFPTFEB×B
Ahorra agua y dinero. Reduce la posibilidad de accidentes y
daños a la propiedad. Recomendado para zonas afectadas por el vandalismo
t%JTF×BEPQBSBVTBSDPOUPEBTMBTCPRVJMMBTQMÈTUJDBTEFBTQFSTPSFT3BJO#JSE
t5JFOFFTUBNQBEP134FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento
Índice de caudal y presión de entrada: aspersores 1800 PRS
gpm l/m
3.5 13.2
3.0 11.4
15H Nz - no PRS
2.5 9.5
Índice de flujo
Serie 1800®-PRS
15H Nz - with PRS
2.0 7.6
12H Nz - with PRS
12H Nz - no PRS
1.5 5.7
10H Nz - no PRS
10H Nz - with PRS
1.0 3.8
8H Nz - no PRS
8H Nz - with PRS
0.5 1.9
0.0 0.0
psi 15
bares 1.0
25
1.7
35
2.4
45
3.1
55
3.8
65
4.5
75
5.2
Presión de entrada
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t3FHVMBMBQSFTJØOEFMBCPRVJMMBBVOQSPNFEJPEFQTJCBSFT
DPOQSFTJPOFT
de entrada de hasta 70 psi (4.8 bares) (ver gráfico)
El regulador de presión en el
vástago patentado compensa
la presión alta o fluctuante
de agua para garantizar un
máximo rendimiento
t1ÏSEJEBEFBHVBHQNBQTJCBSFT
PNÈT
de lo contrario 0.10 gpm (0.02 m3/h; 0.36 l/m)
t*OTUBMBDJØOFOUSBEBMBUFSBMPJOGFSJPS
t&ODMJNBTDPOUFNQFSBUVSBTCBKPDFSPOPTFSFDPNJFOEBMBJOTUBMBDJØOEFMB
entrada lateral
Dimensiones
t 1⁄2" entradas hembras roscadas (15/21)
t"MUVSBEFMDVFSQP
- 1804 PRS: 6" (15.2 cm)
- 1806 PRS: 9 3⁄ 8" (23.8 cm)
- 1812 PRS: 16" (40.6 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB1⁄4" (5.7 cm)
Cómo especificar
Modelos
t134DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
1804-PRS
t134DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
Opcional
PRS: Regulación de presión en el vástago
t134DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
Altura del vástago retráctil
1804: 4" (10.2 cm) de altura del vástago retráctil
1806: 6" (15.2 cm) de altura del vástago retráctil
1812: 12" (30.5 cm) de altura del vástago
retráctil
1800-PRS
* de 2.5 a 18 pies con boquillas de aspersores Rain Bird estándares (series SQ, MPR, VAN, U);
de 13 a 24 pies con boquillas giratorias Rain Bird
Modelo
Cuerpos de los aspersores 1800
El regulador de presión patentado mantiene una presión de salida óptima para maximizar la eficiencia de la boquilla, evita el exceso de flujo
y el vaho. Cada reducción de 5 psi (0.34 bares) reduce el consumo de agua en 6-8%. Utilizar aspersores con PRS puede resultar en un 50%
de ahorro en agua comparado con los aspersores que no incluyen regulación de presión en las instalaciones en donde hay alta presión sin
considerar las fluctuaciones de las presiones de entrada.
10
El uso inteligente del agua.™
Cuerpos de aspersores
Serie 1800®
www.rainbird.com/sprays
Serie 1800®-SAM
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores
Q Válvula de retención incorporada Seal-A-Matic™ (SAM). Elimina la necesidad
de válvulas de retención situadas debajo del aspersor. Sin piezas que instalar
en el lugar.
Q Atrapa el agua en los tubos laterales en los desniveles de hasta 14 pies
(4.2 m). Reduce el desgaste de los componentes del sistema al minimizar
el golpe de ariete durante el arranque
Q Resorte retráctil aun más fuerte para adaptarse a los desniveles de hasta 14
pies (4.2 m). Uno de los resortes más fuertes de la industria.
Características
t&WJUBFMESFOBKFEFMPTBTQFSTPSFTRVFFTUÈOFOOJWFMFTNÈTCBKPT%FUJFOFFM
desperdicio de agua. Evita dañar el terreno por inundación y/o erosión
t%JTF×BEPQBSBVTBSDPOUPEBTMBTCPRVJMMBTQMÈTUJDBTEFBTQFSTPSFT3BJO#JSE
t5JFOFFTUBNQBEP4".FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
Rango operativo
1800-SAM
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
EFMBTQFSTPSBQTJCBSFT
t1ÏSEJEBEFBHVBHQNBQTJCBSFT
PNÈT
de lo contrario 0.50 gpm (0.11 m3/h; 1.80 l/m)
Dimensiones
t 1⁄2" entrada hembra roscada (15/21)
t"MUVSBEFMDVFSQP
- 1804-SAM: 6" (15.2 cm)
- 1806-SAM: 9 3⁄ 8" (23.8 cm)
- 1812-SAM: 16" (40.6 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB1⁄4" (5.7 cm)
Modelos
La válvula de retención
incorporada Seal-A-Matic
evita el drenaje de los
aspersores bajos, ideal para
usar en desniveles
t4".DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
t4".DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
t4".DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
* de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de aspersores Rain Bird estándar (series SQ,
MPR, VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas giratorias Rain Bird
Cómo especificar
1804-SAM
opcional
SAM: Válvula de retención Seal-A-Matic
Altura del vástago retráctil
1804: 4" (10.2 cm) de altura del vástago retráctil
1806: 6" (15.2 cm) de altura del vástago retráctil
1812: 12" (30.5 cm) de altura del vástago
retráctil
Modelo
Cuerpos de los aspersores 1800
La válvula de retención incorporada Seal-A-Matic™ atrapa el agua en los tubos laterales y evita el drenaje de los aspersores a niveles más bajos,
EFUFOJFOEPFMEFTQFSEJDJPEFBHVBZMPTEB×PTDBVTBEPTQPSMBJOVOEBDJØOZMBFSPTJØO5BNCJÏOSFEVDFFMEFTHBTUFEFMPTDPNQPOFOUFTEFM
sistema al minimizar el golpe de ariete durante el arranque
El uso inteligente del agua.™
11
Cuerpos de aspersores
Serie 1800®
t"MUVSBEFMDVFSQP
1804-SAM-PRS: 6" (15.2 cm)
1806-SAM-PRS: 9 3⁄8" (23.8 cm)
1812-SAM-PRS: 16" (40.6 cm)
Serie 1800®-SAM-PRS
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores
Características
t*ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMB4FSJF4".Z134
t4BUJTGBDFMBTOFDFTJEBEFTEFUPEBTMBTÈSFBTEFMPTBTQFSTPSFT
independientemente de los desniveles o cambios de presión de agua
t5JFOFFTUBNQBEP4".134FOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento
Rango operativo
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB
21⁄4" (5.7 cm)
Modelos
t4".134
4" (10.2 cm) de altura del vástago
retráctil
t4".134
6" (15.2 cm) de altura del vástago
retráctil
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t4".134
12" (30.5 cm) de altura del vástago
retráctil
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
EFMBTQFSTPS
6 psi (0.4 bares)
t1ÏSEJEBEFBHVBHQNBQTJCBSFT
PNÈT
de lo contrario 0.50 gpm (0.11 m3/h; 1.80 l/m)
Dimensiones
t 1⁄2" entrada hembra roscada (15/21)
El aspersor de primera
calidad incluye todas
las características
de la Series SAM
y PRS, y es ideal
independientemente
de la presión o la
elevación
* de 2.5 a 18 pies (75 cm a 5.5 m) con boquillas de
aspersores Rain Bird estándares (series SQ, MPR,
VAN, U) de 13 a 24 pies (4 a 7.3 m) con boquillas
giratorias Rain Bird
SAM-PRS
Dimensiones
Serie 1800®-SAM-P45
t&OUSBEBIFNCSBSPTDBEBEF›w
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
t"MUVSBEFMDVFSQP
Características
t$VCSFMBTOFDFTJEBEFTEFMBTBQMJDBDJPOFTEFMDVFSQPEFMPTBTQFSTPSFTRVF
utilizan boquillas giratorias, independientemente de los cambios en la elevación
o en la presión del agua. Incorpora la característica SAM de la serie 1800 y
regula la presión de la boquilla a 45 psi (3.1 bares)
t%JTF×Bdo para maximizar la eficiencia de la aplicación cuando se utilizan
boquillas giratorias
t.BOUJFOFMBQSFTJØOEFTBMJEBDPOTUBOUFFOQTJCBSFT
BVORVFWBSÓF
la presión de entrada. Asegura el rendimiento máximo de la boquilla y el
cuerpo de aspersor, incluso si varían las presiones de entrada. Mantiene la
presión constante independientemente de la boquilla que se use
t5JFOFFTUBNQBEPi4".134wFOMBDVCJFSUBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZ
el mantenimiento.
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
- 1804-SAM-P45: 6” (15.2 cm)
- 1806-SAM-P45: 9 3⁄8" (23.8 cm)
- 1812-SAM-P45: 16” (40.6 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB
21⁄4" (5.7 cm)
Modelos
t4".1DN
EFBMUVSB
del vástago retráctil
t4".1DN
EFBMUVSB
del vástago retráctil
Cómo especificar
t4".1DN
EFBMUVSB
del vástago retráctil
1804- SAM-P45
opcional
P45: regulador de presión en el
vástago de 45 psi (3.1 bares)
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
* de 2.5 a 18 pies (75 cm a 5.5 m) con
boquillas de aspersores Rain Bird estándares
(series SQ, MPR, VAN, U); de 13 a 24 pies (4 a
7.3 m) con boquillas giratorias Rain Bird
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
del aspersor; a 6 psi (0.4 bares)
t1ÏSEJEBEFBHVBHQNBQTJCBSFT
PNÈT
de lo contrario 0.50 gpm (0.11 m3/h; 1.8 l/m)
12
SAM-P45
opcional
SAM: Válvula de retención
Seal-A-Matic™
Altura del vástago retráctil
1804: 4" (10.2 cm) de altura del vástago retráctil
1806: 6" (15.2 cm) de altura del vástago retráctil
1812: 12" (30.5 cm) de altura del vástago
retráctil
Modelo
Cuerpos de los aspersores 1800
Nota: Especifique los cuerpos de los aspersores y las
boquillas por separado.
El uso inteligente del agua.™
Cuerpos de aspersores
www.rainbird.com/sprays
4FSJF3%™
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
NUEVO
Q %
JTF×BEPTQBSBVUJMJ[BSDPOUPEBTMBTCPRVJMMBTEFBTQFSTPSFTEFQMÈTUJDP
EF3BJO#JSECPRVJMMBTHJSBUPSJBTCPRVJMMBTTFSJF6.137"/)&7"/Z42
Q Partes resistentes a la corrosión en agua tratada y reciclada que contenga
cloro y otras sustancias químicas.
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOde 15 a 100 psi (de 1 a 6.9 bares)
Especificaciones
Q El fuerte resorte de acero inoxidable proporciona una retracción confiable
del vástago y es resistente a la corrosión.
t1ÏSEJEBEFBHVB .PEFMPT4".EFBQTJCBS
PNÈT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los demás modelos: de 0 a 10 psi (0.7 bar) o más;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Características
Dimensiones y modelos
t-BKVOUBMJNQJBEPSBQBUFOUBEBEFUSFTDVDIJMMBTJOUFHSBEBZBDUJWBEBB
presión, asegura una junta eficaz sin pérdida de agua excesiva, lo cual
permite que se instalen más aspersores en la misma válvula. La junta
limpiadora de tres cuchillas equilibra con precisión la limpieza, la pérdida
de agua y la protección contra suciedad, y optimiza el rendimiento y la
durabilidad de la elevación y la retracción. El caudal controlado con precisión
en la elevación y la retracción elimina la suciedad y garantiza la buena
retracción del vástago en todo tipo de suelos.
t-BTDBWJEBEFTQBSBBUSBQBSTVDJFEBEFOMBCBTFEFMDVFSQPEFMBTQFSTPS
previenen la recirculación de suciedad nociva durante el funcionamiento y
reducen el desgaste de la junta limpiadora y el vástago.
t&MNFDBOJTNPEFUSJORVFUFSFGPS[BEPQFSNJUFBMJOFBSFMQBUSØOEFMBCPRVJMMB
fácilmente sin herramientas, resiste las sustancias químicas del agua reciclada
y previene el desalineamiento del patrón con el tiempo.
t&MUBQØOEFMJNQJF[BQSFJOTUBMBEP1PQ5PQ™FWJUBRVFJOHSFTFTVDJFEBE
después de la limpieza y permite la instalación fácil de la boquilla.
t$POTUSVJEPDPOQJF[BTEFQMÈTUJDPSFTJTUFOUFTBMQBTPEFMUJFNQPZMPTSBZPT
ultravioleta, y piezas de acero inoxidable resistentes a la corrosión, que
garantizan una larga vida útil del producto.
t5PEPTMPTDPNQPOFOUFTEFMBTQFSTPSTFQVFEFOEFTNPOUBSEFTEFMBQBSUF
superior sin herramientas especiales, lo cual permite realizar la limpieza y el
mantenimiento del aspersor de manera fácil y rápida.
t&OUSBEBTMBUFSBMFTTØMPFOMPTNPEFMPTRVFOPTPO4FBM".BUJD™4".
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
t&OUSBEBIFNCSBSPTDBEB/15EF›wDN
t.PEFMPTZBMUVSB
Cómo especificar
RD-XX - X - Boquilla
Boquilla
Para obtener más información,
consulte las especificaciones de
las boquillas rotativas y las de las
TFSJFT6.137"/)&7"/Z42
Características opcionales
S: Válvula de retención Seal-A-Matic™
P30: regulador de presión en el vástago de 30 psi
(2.1 bares)
P45: regulador de presión en el vástago de 45 psi
(3.1 bares)
FUFDOPMPHÓB'MPX4IJFME™
NP: cubierta con indicación de uso de agua no
potable
Modelo
RD-06: 6" (15 cm) de altura del vástago retráctil
RD-12: 12" (40 cm) de altura del vástago retráctil
Notas:
La característica SAM está incluida en los modelos P45.
La tecnología Flow-Shield™ está disponible solo en los
modelos P30 y P45.
Especifique las boquillas y los cuerpos de aspersores
por separado.
Cuerpos de
aspersores
Aspersores serie RD1800™
3%3⁄8" (24 cm) de altura del cuerpo; 6" de altura del vástago retráctil
(15.2 cm)
3%DN
EFBMUVSBEFMDVFSQPDN
EFBMUVSBEFMWÈTUBHP
retráctil
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBžwDN
Modelos
Modelos de 4"
3%/1
3%4
3%4/1
3%41
3%41'
3%41'/
3%41'
3%41'/
Modelos de 6"
3%
3%/1
3%4
3%4/1
3%41
3%41'
3%41'/
3%41'
3%41'/
Modelos de 12"
3%
3%/1
3%4
3%4/1
3%41
3%41'
3%41'/
3%41'
3%41'/
Serie RD1800
-BKVOUBMJNQJBEPSBEFUSFTDVDIJMMBTZMBTDBWJEBEFTQBSBBUSBQBSTVDJFEBEFOFMBTQFSTPSEFMBTFSJF3%TFDPNCJOBOQBSBQSFWFOJSFM
desperdicio y evitar que la unidad se atore durante la elevación.
El uso inteligente del agua.™
13
Cuerpos de aspersores
4FSJF3%™
Cuerpos de
aspersores
Tecnología Flow-Shield™ exclusiva
Flujo indicador de servicio
La tecnología exclusiva
Flow-Shield™ proporciona
hasta un 90% de reducción
en desperdicio de agua si la
boquilla se pierde o es
retirada y previene los altos
.
costos en gastos de reparación por deslaves y erosión.
Si una boquilla es extraída del aspersor, la
tecnología exclusiva Flow-Shield activa un chorro
de agua en pequeña cantidad. Como resultado, el
funcionamiento se mantiene estable, se ahorra
agua y usted no tiene que esperar a que la
vegetación empiece a morir para darse cuenta
que hay un problema.
Junta limpiadora patentada de triple hoja
Regulador de presión patentado
El regulador de presión
patentado del RD1800
aumenta la eficiencia de la
boquilla hasta un 50% en
aplicaciones de alta presión.
El RD1800™ incluye un sello de tres cuchillas. El
sello superior, limpia el vástago durante la
retracción y previene que entren partículas de
suciedad externas. Durante la
operación, el sello principal
se combina con la superficie
del vástago para eliminar las
fugas de agua. La tercera
cuchilla exclusiva funciona
Tercera nueva
hoja adicional
como otra línea de defensa en
caso de que el sello principal se dañe.
Resistente al agua tratada
Mecanismo de trinquete reforzado
El mecanismo de trinquete del RD1800 fue
diseñado para facilitar el uso y la consistencia,
manteniéndose en posición a lo largo del
tiempo, soportando años de exposición al
cloro y una mayor resistencia a la suciedad.
Válvula de retención Seal-A-Matic™ (SAM)
Exclusiva de Rain Bird, la válvula de retención SAM
detiene hasta 14 pies de instalación y evita que el agua
drene de los aspersores más bajos, eliminando la
erosión, los escurrimientos y el golpe de ariete durante
el arranque del sistema.
14
La serie RD1800 se fabrica con EPDM y poliéster,
estos materiales son resistentes al agua tratada o
reciclada, resisten la degradación causada por el
cloro en el agua reciclada asegurando una vida
mas larga.
Bolsas recolectoras
de suciedad
Cada vez que el sistema se
activa, las únicas y exclusivas
bolsas recolectoras de
suciedad del RD1800
detienen las partículas de
tierra - retirando la suciedad
de la circulación interna para
prevenir daños a largo plazo.
El uso inteligente del agua.™
Cuerpos de aspersores
Serie RD1800™ SAM
Serie RD1800™ SAM PRS
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Q Válvula de retención incorporada Seal-A-Matic™ (SAM). Elimina la
necesidad de válvulas de retención situadas debajo del aspersor. Sin piezas
que instalar en el lugar.
Q *ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMBTTFSJFT3%4".Z134
Q Resorte retráctil más fuerte para adaptarse a los desniveles de hasta 14
pies (4.2 m). Uno de los resortes más fuertes de la industria.
Q&WJUBFMESFOBKFEFMPTBTQFSTPSFTRVFFTUÈOFOOJWFMFTNÈTCBKPT%FUJFOFFM
desperdicio de agua. Evita daños el terreno por inundación y erosión.
Características
t*ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMBTFSJF3%
t*EFBMQBSBVTBSFOÈSFBTDPOEFTOJWFMFT
t3FUJFOFFMBHVBFOMPTUVCPTMBUFSBMFTMPDVBMSFEVDFFMEFTHBTUFEFMPT
componentes del sistema porque minimiza el golpe de ariete durante el
arranque.
t5JFOFFMTFMMP4".FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento.
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
EFMBTQFSTPSBQTJCBS
t1ÏSEJEBEFBHVBEFBQTJCBS
PNÈT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
t/PUJFOFFOUSBEBMBUFSBM
Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EF›wDN
Cuerpos de
aspersores
www.rainbird.com/sprays
4FSJF3%™
Q Cubre las necesidades de todas las áreas de los aspersores,
independientemente de los desniveles o cambios de presión de agua.
Q5JFOFFMTFMMP4".134FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento.
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t1ÏSEJEBEFBHVBEFBQTJCBS
PNÈT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
t3FHVMBMBQSFTJØOEFMBCPRVJMMBBVOQSPNFEJPEFQTJCBSFT
DPO
presiones de entrada de hasta 100 psi (6.9 bares).
t/PUJFOFFOUSBEBMBUFSBM
Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EF›wDN
t.PEFMPTZBMUVSB
3%41DN
EFBMUVSBEFMDVFSQPDN
EFBMUVSBEFM
vástago retráctil
3%413/8” (23.8 cm) de altura del cuerpo; 6" de altura del vástago
retráctil (15.2 cm)
3%41DN
EFBMUVSBEFMDVFSQPDN
EFBMUVSBEFM
vástago retráctil
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBžwDN
t.PEFMPTZBMUVSB
3%4DN
EFBMUVSBEFMDVFSQPDN
EFBMUVSBEFMWÈTUBHP
retráctil
3%43/8” (23.8 cm) de altura del cuerpo; 6" de altura del vástago
retráctil (15.2 cm)
3%4DN
EFBMUVSBEFMDVFSQPDN
EFBMUVSBEFM
vástago retráctil
Índice de caudal y presión de entrada: aspersores RD1800 PRS
gpm l/m
3.5 13.2
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBžwDN
3.0 11.4
15H Nz - no PRS
Índice de flujo
2.5 9.5
15H Nz - with PRS
2.0 7.7
12H Nz - with PRS
12H Nz - no PRS
1.5 5.7
10H Nz - no PRS
10H Nz - with PRS
1.0 3.8
8H Nz - no PRS
8H Nz - with PRS
0.5 1.9
0.0 0.0
psi 15
bares 1.0
25
1.7
35
2.4
45
3.1
55
3.8
65
4.5
75
5.2
Presión de entrada
-BFYDMVTJWBUFDOPMPHÓB'MPX4IJFME™SFEVDFMBQÏSEJEBEFBHVBIBTUBFOVODVBOEPTFSFUJSBVOBCPRVJMMB
El uso inteligente del agua.™
15
Cuerpos de aspersores
4FSJF3%™
Serie RD1800™ Flow-Shield™
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Cuerpos de
aspersores
Q%JTF×BEPTQBSBBIPSSBSBHVBZQSFTFSWBSMBIJESÈVMJDBEFMTJTUFNBBGJOEF
mantener el correcto funcionamiento en toda la zona de riego. Brinda
protección contra la pérdida de material vegetal y reduce la probabilidad
de incurrir en costosas multas a causa de escurrimientos excesivos cuando
se retira una boquilla.
Q & YDMVTJWBUFDOPMPHÓB'MPX4IJFMEJODPSQPSBEBFOFMWÈTUBHP4JOQJF[BTRVF
instalar en el lugar. Ahorra agua, material vegetal, tiempo y dinero.
Q Restringe la pérdida de agua hasta en un 90% si se retira la boquilla de un
aspersor que no es PRS, y hasta en un 50% si se retira la boquilla de un
aspersor PRS.
Características
t*ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMBTTFSJFT3%4".Z134ZBEFNÈT
- Reduce la posibilidad de accidentes y daños a la propiedad. Recomendado
para áreas con alta presión y afectadas por el vandalismo.
- Proporciona chorro de agua vertical de bajo caudal visible desde una línea
visual de más de 200 pies (60 m) cuando se retira una boquilla. La altura
y el bajo caudal del chorro de agua vertical hace que el agua se disperse
mientras desciende, lo cual reduce los charcos y el escurrimiento
- El chorro de agua vertical de bajo caudal no supera los 2 gpm (0.45 m3/h;
0.13 l/s), incluso con presión de entrada variable.
- El chorro de agua vertical de bajo caudal reduce la probabilidad de pasar
por alto la extracción de una boquilla, y el reemplazo de boquilla disminuye
la posibilidad de estrés del pasto y pérdidas de material vegetal.
5JFOFFMTFMMP'FOMBUBQBQBSBGBDJMJUBSMBJEFOUJGJDBDJØOZFM
mantenimiento.
Serie para aplicaciones de agua no potable
RD1800™
4", 6", 12" (10.2 cm, 15.2 cm, 30.5 cm)
Q Indicación exclusiva de uso de agua no potable en la cubierta con junta
MJNQJBEPSBWJPMFUBEFUSFTDVDIJMMBTBEWFSUFODJBFOJOHMÏT%0/05%3*/,
y en español, "NO BEBA", y símbolo internacional de no beber.
Q No requiere el uso de tapas violetas a presión que se pueden quitar durante
un acto de vandalismo.
Q No requiere el uso de llamativas cubiertas moldeadas violetas que delatan la
ubicación de los aspersores.
Características
t-BTFSJF3%QBSBBQMJDBDJPOFTEFBHVBOPQPUBCMFPGSFDFUPEBTMBT
DBSBDUFSÓTUJDBTEFMBTTFSJFT4".4".134Z4".134'MPX4IJFME
t1SPQPSDJPOBVOBBMUFSOBUJWBBMBTUBQBTBQSFTJØOZMBTDVCJFSUBTNPMEFBEBT
violetas para identificar el uso de agua no potable.
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
EFMBTQFSTPSBQTJCBS
t1ÏSEJEBEFBHVB .PEFMPT4".EFBQTJCBS
PNÈT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los demás modelos: de 0 a 10 psi (0.7 bar) o más;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Rango operativo
Dimensiones y modelos
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t.PEFMPTZBMUVSB
Especificaciones
t$BQBDJEBEEF4".SFUJFOFIBTUBQJFTN
EFMBTQFSTPSBQTJCBS
t1ÏSEJEBEFBHVB .PEFMPT4".EFBQTJCBS
PNÈT
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
Los demás modelos: de 0 a 10 psi (0.7 bar) o más;
de lo contrario: 0.5 gpm (0.1 m3/h; 0.03 l/s)
t&OUSBEBIFNCSBSPTDBEB/15EF›wDN
3%/13%4/13%41'/3%41'/DN
EF
altura del cuerpo; 4" (10.2 cm) de altura del vástago retráctil
3%/13%4/13%41'/3%41'/wDN
de altura del cuerpo; 6" (15.2 cm) de altura del vástago retráctil
3%/13%4/13%41'/3%41'/DN
EF
altura del cuerpo; 12" (30.5 cm) de altura del vástago retráctil
%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBžwDN
Dimensiones y modelos
t&OUSBEBIFNCSBSPTDBEB/15EF›wDN
t.PEFMPTZBMUVSB
3%41'3%41'DN
EFBMUVSBEFMDVFSQP
4" (10.2 cm) de altura del vástago retráctil
3%41'3%41'3/8” (23.8 cm) de altura del cuerpo;
6" de altura del vástago retráctil (15.2 cm)
3%41'3%41'DN
EFBMUVSBEFMDVFSQP
12" (30.5 cm) de altura del vástago retráctil
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBžwDN
Cubierta estándar
16
Cubierta para agua
no potable
El uso inteligente del agua.™
Cuerpos de aspersores
www.rainbird.com/sprays
Serie UNI-Spray™
Serie UNI-Spray™
Modelos*
t64DN
EFBMUVSBEFMWÈTUBHPSFUSÈDUJM
Q La junta limpiadora activada por presión evita tanto la pérdida excesiva
como el desperdicio del agua. Evita que la suciedad ingrese con la
retracción
Q El trinquete de vástago duradero permite una fácil y rápida alineación del
patrón de la boquilla
Q La cubierta y el cuerpo resistentes brindan durabilidad en condiciones de
presión alta y sobrecarga
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
Cuerpos de
aspersores
2", 4" (5.1 cm, 10.2 cm)
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
t647"/DPOWÈTUBHPSFUSÈDUJMEFEFBMUVSBDN
DPO7"/
t7ÈMWVMBEFSFUFODJØO644".6/*4QSBZJOTUBMBEBFOFMDBNQP
* UNI-Spray admite todas las boquillas Rain Bird
Características
t-BQFRVF×BDVCJFSUBFYQVFTUBIBDFRVFMBVOJEBETFBQSÈDUJDBNFOUFJOWJTJCMF
y que el paisaje sea más atractivo
t6/*4QSBZBENJUFUPEBTMBTCPRVJMMBTZBDDFTPSJPT3BJO#JSE®,
lo que simplifica la administración del inventario
- La malla y la boquilla VAN se pueden quitar fácilmente para limpiar
t-BTQJF[BTJOUFSOBTTFQVFEFOEFTNPOUBSEFTEFMBQBSUFTVQFSJPSEFMBTQFSTPS
para repararlas fácilmente
t-BWÈMWVMBEFSFUFODJØOPQDJPOBMJOTUBMBCMFFOFMDBNQP4FBM".BUJD™ evita
el drenaje de los aspersores bajos de hasta 5 pies (1.5 m) de desnivel
t-PTNBUFSJBMFTEFQMÈTUJDPZBDFSPJOPYJEBCMFSFTJTUFOMBDPSSPTJØO
Rango operativo (correspondiente a las opciones de boquilla
preinstalada)
Tornillo de reducción del radio
Arco variable removible
boquilla y malla (VAN)
t&TQBDJBNJFOUP
- Serie 10 VAN: de 8 a 10 pies (de 2.4 a 3.0 m)
- Serie 12 VAN: de 10 a 12 pies (de 3.0 a 3.7 m)
Activada a presión,
junta limpiadora multifunción
- Serie 15 VAN: de 12 a 15 pies (de 3.7 a 4.6 m)
- Serie 18 VAN VAN: de 14 a 18 pies (de 4.3 a 5.5 m)
t1SFTJØOEFBQTJEFBCBSFT
t1SFTJØOØQUJNBQTJCBSFT
t3BOHPEFBSDPEFMBCPRVJMMBBKVTUBCMF¡¡
Tapa y cuerpo
de ABS
resistente
Especificaciones
t1ÏSEJEBEFBHVBBQTJCBSFT
PNÈT
de lo contrario 0.20 gpm (0.04 m3/h; 0.60 l/m)
Dimensiones
t 1⁄2&OUSBEBIFNCSBSPTDBEB/15
t"MUVSBEFMDVFSQP
3
- US-200: 3 ⁄4" (9.5 cm)
- US-400: 5 7⁄8" (14.9 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB1⁄4" (3.2 cm)
Resorte retráctil fuerte de
acero inoxidable
UNI-Spray™
Válvula de retención Seal-AMatic (US-SAM) opcional
Mecanismo de trinquete
de dos piezas
Cómo especificar
US - 4 - 15VAN
Serie de boquilla/patrón
Boquilla VAN con arco variable
Boquillas de arco variable
(10, 12, 15 o 18 pies)
se pueden encargar
preinstaladas
Cuerpo
2" (5.1 cm)
4" (10.2 cm)
Modelo
UNI-Spray
La junta limpiadora activada por presión reduce la pérdida de agua durante el funcionamiento.
El uso inteligente del agua.™
17
Cuerpos de aspersores
Accesorios de los aspersores
Cuerpos de
aspersores
Tapa 1800® NP
1800®-EXT
PA-80
5BQBEFBTQFSTPSQBSBBHVB
no potable
Extensión de plástico
Adaptador de plástico
Características
Características
Características
t&TUSVDUVSBUFSNPQMÈTUJDBSFTJTUFOUFBMPTSBZPT
ultravioleta y de larga duración
t"EBQUBMPTDVFSQPTEFBTQFSTPSFT
Rain Bird para utilizar los con
cualquier boquilla aspersora o
CVSCVKFBEPS'15EFDN
(15/21)
t%JTF×BEBQBSBRVFMBTUBQBTEF
los cuerpos deaspersores de la
Serie 1800 tengan una excelente
retención
t$BCFOFOUPEBTMBTCPRVJMMBTZMPTDVFSQPTEF
aspersores Rain Bird. Excepción: No se pueden utilizar
con burbujeadores
t5BQBWJPMFUBEFQMÈTUJDPQBSB
identificar fácilmente un sistema
de agua
no potable
t&TUSVDUVSBUFSNPQMÈTUJDBGVFSUF
resistente a los rayos ultravioleta
t4FJOTUBMBGÈDJMNFOUFTJOIFSSBNJFOUBT
t4FQVFEFSFJOTUBMBSTJOEB×BSMBTSPTDBTTJ
accidentalmente deja de funcionar la tubería de
elevación o el aspersor
t.BSDBEBDPOMBBEWFSUFODJB%P
/PU%SJOL`/PCFCB
FTDSJUBFO
inglés y en español.
t'ÈDJMEFJOTUBMBSTJOOFDFTJEBEEF
herramientas
Dimensiones
t$BOUJEBENÈYJNBSFDPNFOEBEBEPTFYUFOTJPOFTQPS
cuerpo de aspersores
t4FQVFEFBKVTUBSBUPEBTMBTUBQBT
de los cuerpos de aspersores de la
Serie 1800®
Modelo
t"MUVSB1⁄2" (3.8 cm); 0.8" (2.0 cm)
por encima de la cubierta 1800
t&95
Modelo
t1"
Modelo
t/1$"1
1800-EXT
PA-80
1800-NPCAP
PA-8S
PA-8S-NP
Adaptador de plástico para arbustos
Adaptador de plástico para arbustos para agua no potable
Características
Características
t"EBQUBCPRVJMMBT3BJO#JSEQBSBVUJMJ[BSDPOUVCFSÓBTEFFMFWBDJØOSPTDBEBT
.151⁄2" (15/21)
t"ENJUFNBMMBEFGJMUSPQSPUFDUPSBQSVFCBEFPCTUSVDDJPOFT4FSJFTF
envía con boquilla) y mallas de la Serie PCS
t&TUSVDUVSBEFQMÈTUJDPEVSBEFSBZOPDPSSPTJWB
Especificaciones
t"EBQUBEPSEFQMÈTUJDPWJPMFUBQBSBBSCVTUPTQBSBJEFOUJGJDBSGÈDJMNFOUFVOTJTUFNB
de agua
no potable
t
"EBQUBCPRVJMMBT3BJO#JSEQBSBVUJMJ[BSDPOUVCFSÓBTEFFMFWBDJØO
SPTDBEBT.151⁄2" (15/21)
t"ENJUFNBMMBEFGJMUSPQSPUFDUPSBQSVFCBEFPCTUSVDDJPOFT4FSJFTFFOWÓBDPO
boquilla) y mallas de la Serie PCS
t 1⁄2" entrada hembra roscada (15/21)
t&TUSVDUVSBEFQMÈTUJDPEVSBEFSBZOPDPSSPTJWB
t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE
Especificaciones
Modelo
t 1⁄2" entrada hembra roscada (15/21)
t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE
t1"4
Modelo
t1"4/1
PA-8S
18
PA-8S-NP
El uso inteligente del agua.™
Cuerpos de aspersores
PA-8S-PRS
1800 PCS
Adaptador para arbustos con regulación de presión
Mallas de compensación de presión
Características
Q $PNQFOTBMBTWBSJBDJPOFTEFQSFTJØO
t"EBQUBCPRVJMMBTQBSBVUJMJ[BSDPOUVCFSÓBTEFFMFWBDJØOSPTDBEBT.151⁄2"
(15/21)
Q Elimina la neblina y el desperdicio de agua causados por presiones altas
t3FHVMBEPSEFQSFTJØO134QBUFOUBEPJODPSQPSBEPFOFMWÈTUBHP4JOQJF[BT
que instalar en el lugar. Ahorra tiempo y dinero
Q Las boquillas se pueden combinar con determinadas mallas para lograr un
alcance corto, patrones de radio reducido o burbujeadores montados al ras
- Mantiene la presión de salida constante en 30 psi (2.1 bares). Asegura el
rendimiento máximo del aspersor y la boquilla
5FSNJOBDPOFMWBIPZMBOFCMJOBDBVTBEPTQPSMBBMUBQSFTJØO&WJUBFM
desperdicio de agua y minimiza la responsabilidad
- Restringe la pérdida de agua hasta en un 70% si la boquilla se sale o se
daña. Ahorra agua y dinero. Reduce la responsabilidad. Recomendado para
zonas afectadas por el vandalismo
t$BCFFOUPEBTMBTCPRVJMMBTEFQMÈTUJDP3BJO#JSE
t-BFTUSVDUVSBUFSNPQMÈTUJDBGVFSUFSFTJTUFMPTSBZPTVMUSBWJPMFUB
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 0.06 a 15.0 l/m)
Características
t-BNBMMBEFHQNN3/h; 1.2 l/m) permite una mayor flexibilidad para
lograr patrones de radio de 6', y 7' (1.8 m, 2.1 m)
t$PEJGJDBEBTQPSDPMPSQBSBGBDJMJUBSTVJEFOUJGJDBDJØO
tÁTFMBTDPOUPEBTMBTCPRVJMMBTEFQMÈTUJDPEFMB4FSJF.137"/4FSJF6
Strip y Burbujeadores)
t4FJOTUBMBGÈDJMNFOUFFOBQMJDBDJPOFTOVFWBTZSFUSPBEBQUBEBT4JNQMFNFOUF
cambie la malla estándar por la malla PCS
* Con un compensador de presión, la presión de salida se reducirá, pero fluctuará a medida que
cambie la presión de entrada. Un compensador de presión no puede mantener la presión de salida a
un índice constante. Un regulador de presión establece y mantiene una presión de salida constante de
30 psi (2.1 bares) siempre que la presión de entrada del aspersor sea mayor que 30 psi (2.1 bares)
Rango operativo
t$BVEBMEFBHQNEFBN3⁄h; de 36 a 3.6 l/m)
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t 1⁄2" entrada hembra roscada (15/21)
t-BTSPTDBTTVQFSJPSFTGJOBTBENJUFOUPEBTMBTCPRVJMMBT3BJO#JSE
Modelos
t1$4HQNN3/h; 0.6 l/m) - Marrón
t1$4HQNN3/h; 1.2 l/m) - Rosa
1
t"MUVSB ⁄4" (13.3 cm)
t1$4HQNN3/h; 0.6 l/m) - Plateado
Modelo
t1$4HQNN3/h; 1.8 l/m) - Anaranjado
t1"4134
t1$4HQNN3/h; 2.4 l/m) - Negro
t1$4HQNN3/h; 3.6 l/m) - Blanco
Se recomienda combinar boquilla + PCS para lograr radios
de 4', 6' y 7' *
Boquilla
PCS
pie
metro
2'-5
2'-5
)'-5
)'-5
''-5
''-5
3PTB
OFHSP
3PTB
1MBUFBEP
OFHSP
#MBODP
h
h
h
h
h
h
Nota: Los datos de reducción del radio fueron probados a 30 psi (1.5 bares). Los resultados
individuales pueden variar según las condiciones del lugar
PA-8S-PRS
Mallas 1800 PCS
El uso inteligente del agua.™
19
Cuerpos de
aspersores
www.rainbird.com/sprays
Accesorios para aspersores, mallas 1800 PCS
Cuerpos de aspersores
Mallas 1800 PCS
Rendimiento de 1800 PCS
VAN
Serie U
Cuerpos de
aspersores
Caudal (gpm)
m3/h (l/m)
Color
Distancia
62
65
U-8H
6'
62
65
U-10H
6'
62
65
U-12H
655
652
6'
62
65
U-15H
655
652
6'
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
¡
PCS-020
0.2
0.05 (60)
Marrón
pies
metros
6
4
4
(1.8)
(1.2)
(1.2)
7
5
5
(2.1)
(1.5)
(1.5)
5
4
(1.5)
(1.2)
6
4
(1.8)
(1.2)
2'
(0.6)
4
2
3'
1'
3'
La fuente negrita de color
verde indica la combinación
de boquilla y malla
recomendada para lograr el
rendimiento del catálogo en
30 psi (2.1 bares)
20
PCS-025
0.25
0.06 (72)
Rosa
pies
metros
(1.2)
(0.6)
(0.9)
(0.3)
1'
(0.3)
2'
(0.6)
(0.9)
La fuente negrita de color azul
indica una combinación de
boquilla y malla satisfactoria
PCS-030
0.3
0.07 (84)
Plateado
pies
metros
PCS-040
0.4
0.09 (108)
Anaranjado
pies
metros
1
10'
8
5
(0.3)
(3.1)
(2.4)
(1.5)
3
(0.9)
10'
6
(3.1)
(1.8)
7'
6'
3'
(2.1)
(1.8)
(0.9)
12'
8'
4'
(3.7)
(2.4)
(1.2)
6'
(1.8)
3'
11'
(0.9)
(3.4)
2'
(0.6)
3'
(0.9)
3'
2'
1'
1'
3'
2'
0.5'
0.5'
1'
0.5'
(0.9)
(0.6)
(0.3)
(0.3)
(0.9)
(0.6)
(0.2)
(0.2)
(0.3)
(0.2)
3'
(0.9)
4'
3'
2'
2'
6'
4'
1'
1'
3'
2'
0.5'
0.5'
5'
1'
1'
1'
10'
2'
1'
1'
5'
3'
(1.2)
(0.9)
(0.6)
(0.6)
(1.8)
(1.2)
(0.3)
(0.3)
(0.9)
(0.6)
(0.2)
(0.2)
(1.5)
(0.3)
(0.3)
(0.3)
(3.1)
(0.6)
(0.3)
(0.3)
(1.5)
(0.9)
2'
1'
0.5'
0.5'
(0.6)
(0.3)
(0.2)
(0.2)
0.5'
8'
1'
0.5'
(0.2)
(2.4)
(0.3)
(0.2)
2'
1'
(0.6)
(0.3)
0.5'
(0.2)
El color negro indica una combinación
de boquilla y malla que proporciona una
reducción de alcance de más del 50 %. Con
estas combinaciones de boquilla y malla no se
garantiza un patrón de rociado uniforme, lo
que puede producir un efecto de burbuja
PCS-060
0.6
0.14 (144)
negro
pies
metros
7
(2.1)
8
4
(2.4)
(1.2)
12'
7'
6'
5'
6'
15'
10'
5'
(3.7)
(2.1)
(1.8)
(1.5)
(1.8)
(4.6)
(3.1)
(1.5)
4'
(1.2)
4'
4'
4'
(1.2)
(1.2)
(1.2)
6'
3'
3'
8'
4'
3'
3'
10'
5'
4'
4'
12'
5'
3'
3'
11'
6'
(1.8)
(0.9)
(0.9)
(2.4)
(1.2)
(0.9)
(0.9)
(3.1)
(1.5)
(1.2)
(1.2)
(3.7)
(1.5)
(0.9)
(0.9)
(3.4)
(1.8)
6'
3'
1'
1'
(1.8)
(0.9)
(0.3)
(0.3)
PCS-090
0.9
0.20 (216)
Blanco
pies
metros
9
9
(2.7)
(2.7)
11'
9'
8'
8'
(3.4)
(2.7)
(2.4)
(2.4)
13'
9'
(4.0)
(2.7)
6'
(1.8)
6'
6'
(1.8)
(1.8)
8'
5'
5'
(2.4)
(1.5)
(1.5)
7'
6'
6'
(2.1)
(1.8)
(1.8)
8'
6'
5'
15'
9'
6'
(2.4)
(1.8)
(1.5)
(4.6)
(2.7)
(1.8)
12'
5'
3'
3'
(3.7)
(1.5)
(0.9)
(0.9)
Nota: Las mallas se probaron a 50 psi (3.5 bares) durante 10 minutos antes de tomar
las mediciones de distancia. Las distancias pueden variar levemente con presiones más
altas y tiempos de riego más largos
Nota: Consulte las notaciones del catálogo para seleccionar la boquilla adecuada
El uso inteligente del agua.™
Cuerpos de aspersores
www.rainbird.com/sprays
Mallas 1800 PCS
Strip
Burbujeador
MPR
Caudal (gpm)
m3/h (l/m)
Color
Distancia
2
5
5H
'
2
5
8H
'
2
5
10H
'
2
5
12H
55
52
'
2
5
15H
55
52
'
2#
5H-B
'#
$45#
445
$45
445
&45
15LCS
15RCS
PCS-020
0.2
0.05 (60)
Marrón
pies
metros
PCS-025
0.25
0.06 (72)
Rosa
pies
metros
5'
(1.5)
6'
(1.8)
8'
6'
5'
(2.4)
(1.8)
(1.5)
10'
6.5'
6'
(3.1)
(2.0)
(1.8)
6'
4'
3'
(1.8)
(1.2)
(0.9)
8'
5'
4'
(2.4)
(1.5)
(1.2)
3'
2'
(0.9)
(0.6)
7'
4'
3'
(0.9)
2'
(0.6)
1'
1' x 5'
1' x 5'
La fuente negrita de color
verde indica la combinación
de boquilla y malla
recomendada para lograr el
rendimiento del catálogo en
30 psi (2.1 bares)
(0.3)
(0.3 x 1.5)
(0.3 x 1.5)
5'
(1.5)
7'
7'
2'
8'
9'
6'
(2.1)
(2.1)
(0.6)
(2.4)
(2.7)
(1.8)
(2.1)
(1.2)
8'
6'
4'
2'
2'
(2.4)
(1.8)
(1.2)
(0.6)
(0.6)
4'
2'
(1.2)
(0.6)
5'
5'
3'
1'
(1.5)
(1.5)
(0.9)
(0.3)
3
(0.9)
4'
1'
(1.2)
(0.3)
3'
(0.9)
2
1' x 7'
1' x 7'
La fuente negrita de color azul
indica una combinación de
boquilla y malla satisfactoria
El uso inteligente del agua.™
PCS-030
0.3
0.07 (84)
Plateado
pies
metros
(0.6)
(0.3 x 2.1)
(0.3 x 2.1)
3' x 12'
1' x 12'
1' x 12'
(0.9 x 3.7)
(0.3 x 3.7)
(0.3 x 3.7)
El color negro indica una combinación
de boquilla y malla que proporciona una
reducción de alcance de más del 50 %. Con
estas combinaciones de boquilla y malla no se
garantiza un patrón de rociado uniforme, lo
que puede producir un efecto de burbuja
PCS-040
0.4
0.09 (108)
Anaranjado
pies
metros
8'
8'
3'
10'
10'
8'
1'
11'
10'
6'
4'
3'
2'
9'
7'
4'
2'
(2.4)
(2.4)
(0.9)
(3.1)
(3.1)
(2.4)
(0.3)
(3.4)
(3.1)
(1.8)
(1.2)
(0.9)
(0.6)
(2.7)
(2.1)
(1.2)
(0.6)
5'
2'
1'
5'
(1.5)
(0.6)
(0.3)
(1.5)
4' x 12'
2' x 10'
4' x 15'
(1.2 x 3.7)
(0.6 x 3.1)
(1.2 x 4.6)
PCS-060
0.6
0.14 (144)
negro
pies
metros
8'
(2.4)
10'
4'
12'
11'
10'
6'
6'
5'
12'
12'
7'
4'
(3.1)
(1.2)
(3.7)
(3.4)
(3.1)
(1.8)
(1.8)
(1.5)
(3.7)
(3.7)
(2.1)
(1.2)
5'
2'
4' x 24'
3' x 20'
PCS-090
0.9
0.20 (216)
Blanco
pies
metros
8'
(2.4)
12'
12'
9'
8'
7'
15'
14'
11'
8'
6'
4'
(3.7)
(3.7)
(2.7)
(2.4)
(2.1)
(4.6)
(4.3)
(3.4)
(2.4)
(1.8)
(1.2)
(1.5)
(0.6)
3'
(0.9)
(1.2 x 7.3)
(0.9 x 6.1)
7' x 12'
4' x 30'
4' x 26'
(2.1 x 3.7)
(1.2 x 9.1)
(1.2 x 7.9)
Nota: Las mallas se probaron a 50 psi (3.5 bares) durante 10 minutos antes de tomar
las mediciones de distancia. Las distancias pueden variar levemente con presiones más
altas y tiempos de riego más largos
Nota: Consulte las notaciones del catálogo para seleccionar la boquilla adecuada
21
Cuerpos de
aspersores
Rendimiento de 1800 PCS
Boquillas aspersoras
Introducción
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
Válvulas
“La boquilla VAN es una compra estupenda.
Esta boquilla de Rain Bird se puede ajustar
completamente y se puede utilizar en
cualquier jardín con formas irregulares”.
Marco Antonio Barocio,
Equipos y sistemas de irrigación,
Guadalajara, México
Accesorios
Productos principales
Programadores
Aplicaciones primarias
Sistemas de control
centralizado
Césped
MPR
Estándar
O
Aspersores fijos de ARCO
Boquillas SQ
Serie U
Estándar
Mejor
O
O
Aspersores variables de ARCO
VAN
HE-VAN
Estándar
Lo mejor
O
O
Pendientes
Áreas angostas
O
Boquillas rotativas
Rotativa
R-VAN
Estándar
Lo mejor
O
O
O
O
O
O
Áreas pequeñas
O
O
O
Altamente eficiente
O
O
O
O
Viento excesivo
O
O
O
O
O
O
O
Canteros en paisajes
O
O
O
O
Xerigation®
Alta presión
Bombas
Sugerencias para ahorrar agua
Drenaje
t Las boquillas Serie U son boquillas de
Recursos
doble orificio que realizan una mejor y
más uniforme distribución del agua. El
agua que sale de ambos orificios se
combina para formar un caudal de agua
continuo y elimina las zonas sin regar. Así
se obtiene una cobertura más uniforme
en toda el área de riego.
Referencia
22
t Las boquillas HE-VAN son completamente
ajustables de 0 a 360 grados con una alta
uniformidad y eficiencia. Las boquillas HE-VAN
pueden reducir la cantidad de variaciones que
pueden ocurrir en casi cualquier tipo de
TJUVBDJØOPSFUPFOFMUFSSFOP%JTQPOJCMFTFO
radios de 8’ a 15’, esta boquillas son altamente
eficientes y de máxima cobertura.
t Las boquillas rotativas proporcionan
una distribución eficaz del agua a través
de caudales rotativos que suministran el
agua de manera uniforme a un bajo
índice de precipitación, lo cual reduce
significativamente el escurrimiento y la
erosión.
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Boquillas MPR
Boquillas plásticas MPR
Boquillas con rangos de precipitación igualados
Q 5 PEPTMPTNPEFMPTEFMBTTFSJFTZDPOTVTEJGFSFOUFTPQDJPOFT
de distancia y patrones de riego incluyen rangos de precipitacion igualados
(MPR) para proporcionar una distribución más uniforme y flexibilidad en el
diseño.
Boquillas aspersoras
Q Las boquillas de la Serie 5 reúnen todos los requisitos para césped o arbustos
en áreas pequeñas
Q Las boquillas de la Serie 8 ahora cuentan con un caudal de agua más bajo que
permite que haya más aspersores por zona
Características
t-BTNBMMBTEFGJMUSPCMBODBTEFMB4FSJF¥EFwYwNNY
mm), que se envían junto con las boquillas, mantienen un ajuste del radio
exacto e impiden las obstrucciones(Las boquillas de las Series 5 y 8 se envían
con filtros de malla fina azul de 0.02" x 0.02" [0.5 mm x 0.5 mm])
Boquilla y malla MPR
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t1SFTJØOØQUJNBQTJCBSFT
* Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener un rendimiento óptimo de la
boquilla en situaciones de presión más alta
Modelos
t4FSJF
t4FSJF#PRVJMMBTCVSCVKFBEPSBT
t4FSJF
t4FSJF'-5%JTF×BEBQBSBBQMJDBDJPOFTEFUSBZFDUPSJBNÈTCBKBUBMFTDPNP
áreas con viento
t4FSJF
t4FSJF
t4FSJF
t4FSJF4USJQ
Boquillas MPR de Rain Bird®, el
estándar de la industria
Paquete de boquillas de sellado reutilizable
Características
t$ØNPEBTCPMTBTEFTFMMBEPSFVUJMJ[BCMF
t4FMMPEFTFHVSJEBE
t0SJGJDJPTQBSBDPMHBSZFYIJCJSGÈDJMNFOUF
Paquete de boquillas de
sellado reutilizable
El uso inteligente del agua.™
23
Boquillas aspersoras
Boquillas MPR
Serie 5 MPR
Serie 5 MPR
Boquillas aspersoras
Trayectoria de 5° Boquilla
Presión
psi
5F
15
20
25
30
5H
15
20
25
30
5Q
15
20
25
30
Radio
pies
3
4
4
5
3
4
4
5
3
4
4
5
Caudal
gpm
0.29
0.33
0.37
0.41
0.14
0.16
0.18
0.20
0.07
0.08
0.09
0.10
Q
Precip.
pulg./h
3.10
1.99
2.23
1.58
3.00
1.93
2.17
1.54
3.00
1.93
2.17
1.54
V
Precip.
pulg./h
3.58
2.29
2.57
1.83
3.46
2.22
2.50
1.78
3.46
2.22
2.50
1.78
Serie 8 MPR
Trayectoria de 10° Boquilla
Presión
psi
8F
15
20
25
30
8H
15
20
25
30
8T
15
20
25
30
8Q
15
20
25
30
Trayectoria de 5° Boquilla
Presión
bares
5F
1.0
1.5
2.0
2.1
5H
1.0
1.5
2.0
2.1
5Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
1.1
1.3
1.5
1.5
1.1
1.3
1.5
1.5
1.1
1.3
1.5
1.5
Serie 8 MPR
Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8
Caudal
gpm
0.74
0.86
0.96
1.05
0.37
0.42
0.47
0.52
0.25
0.29
0.32
0.35
0.18
0.21
0.24
0.26
Q
Precip.
pulg./h
2.85
2.30
1.89
1.58
2.85
2.25
1.85
1.56
2.89
2.33
1.89
1.58
2.77
2.25
1.89
1.56
V
Precip.
pulg./h
3.29
2.66
2.18
1.82
3.29
2.59
2.13
1.81
3.34
2.69
2.18
1.82
3.20
2.59
2.18
1.81
Trayectoria de 10°
Boquilla
Presión
bares
8F
1.0
1.5
2.0
2.1
8H
1.0
1.5
2.0
2.1
8T
1.0
1.5
2.0
2.1
8Q
1.0
1.5
2.0
2.1
Caudal Caudal
m3⁄h l/m
0.06 1.1
0.08 1.4
0.09 1.6
0.09 1.6
0.03 0.5
0.04 0.7
0.04 0.7
0.05 0.9
0.02 0.4
0.02 0.4
0.02 0.4
0.02 0.4
Q
Precip.
mm/h
79
51
57
40
76
49
55
39
76
49
55
39
V
Precip.
mm/h
91
58
65
46
88
56
64
45
88
56
64
45
SIST. MÉTRICO
Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
Caudal Caudal
m3⁄h l/m
0.16 2.8
0.20 3.4
0.23 3.9
0.24 4.0
0.08 1.4
0.10 1.7
0.12 1.9
0.12 2.0
0.05 1.0
0.07 1.1
0.08 1.3
0.08 1.3
0.04 0.7
0.05 0.8
0.06 1.0
0.06 1.0
Q
Precip.
mm/h
72
58
48
40
72
57
47
40
73
59
48
40
70
57
48
40
V
Precip.
mm/h
84
68
55
46
84
66
54
46
85
68
55
46
81
66
55
46
Nota: Todas las boquillas MPR se probaron con vástagos retráctiles de 4" (10.2 cm)
Nota: Especifique el cuerpo del aspersor y las boquillas por separado.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
Nota: No se recomienda una reducción del radio que supere el 25% del alcance normal de la
boquilla
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
24
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie 10 MPR
Trayectoria de 15° Boquilla
Presión
psi
10F
15
20
25
30
10F
15
20
25
30
10T
15
20
25
30
10Q
15
20
25
30
Serie 10 MPR
Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10
Caudal
gpm
1.16
1.30
1.44
1.58
0.58
0.65
0.72
0.79
0.39
0.43
0.48
0.53
0.29
0.33
0.36
0.39
Q
Precip.
pulg./h
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52
2.28
1.96
1.71
1.52
V
Precip.
pulg./h
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75
2.63
2.26
1.98
1.75
Serie 12 MPR
Trayectoria de 30° Boquilla
Presión
psi
12F
15
20
25
30
12TQ
15
20
25
30
12H
15
20
25
30
12T
15
20
25
30
12Q
15
20
25
30
Trayectoria de 15°
Boquilla
Presión
bares
10F
1.0
1.5
2.0
2.1
10F
1.0
1.5
2.0
2.1
10T
1.0
1.5
2.0
2.1
10Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1
2.1
2.4
3.0
3.1
Serie 12 MPR
Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
Caudal
gpm
1.80
2.10
2.40
2.60
1.35
1.58
1.80
1.95
0.90
1.05
1.20
1.30
0.60
0.70
0.80
0.87
0.45
0.53
0.60
0.65
Q
Precip.
pulg./h
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
V
Precip.
pulg./h
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
Trayectoria de 30°
Boquilla
Presión
bares
12F
1.0
1.5
2.0
2.1
12TQ
1.0
1.5
2.0
2.1
12H
1.0
1.5
2.0
2.1
12T
1.0
1.5
2.0
2.1
12Q
1.0
1.5
2.0
2.1
Caudal Caudal
m3⁄h l/m
0.26 4.2
0.29 4.8
0.35 6.0
0.36 6.0
0.13 2.4
0.14 2.4
0.18 3.0
0.18 3.0
0.09 1.2
0.10 1.8
0.12 1.8
0.12 1.8
0.06 1.2
0.07 1.2
0.09 1.2
0.09 1.2
Q
Precip.
mm/h
58
50
39
37
58
50
39
37
58
50
39
37
58
50
39
37
V
Precip.
mm/h
67
58
45
43
67
58
45
43
67
58
45
43
67
58
45
43
SIST. MÉTRICO
Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
Caudal Caudal
m3⁄h l/m
0.40 6.8
0.48 8.3
0.59 9.7
0.60 9.8
0.30 5.1
0.36 6.3
0.45 7.3
0.45 7.4
0.20 3.4
0.24 4.2
0.30 4.9
0.30 4.9
0.13 2.3
0.16 2.8
0.20 3.2
0.20 3.3
0.10 1.7
0.12 2.1
0.15 2.4
0.15 2.5
Q
Precip.
mm/h
55
47
46
44
55
47
46
44
55
47
46
44
55
47
46
44
55
47
46
44
V
Precip.
mm/h
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
Nota: Todas las boquillas MPR se probaron con vástagos retráctiles de 4" (10.2 cm)
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
25
Boquillas aspersoras
Boquillas MPR
Boquillas aspersoras
Boquillas MPR
Serie 15 MPR
Boquillas aspersoras
Trayectoria de 30° Boquilla
Presión
psi
15F
15
20
25
30
15TQ
15
20
25
30
15H
15
20
25
30
15T
15
20
25
30
15Q
15
20
25
30
Serie 15 MPR
Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.30
1.50
1.65
1.85
0.87
1.00
1.10
1.23
0.65
0.75
0.82
0.92
Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
Trayectoria de 30°
Boquilla
Presión
bares
15F
1.0
1.5
2.0
2.1
15TQ
1.0
1.5
2.0
2.1
15H
1.0
1.5
2.0
2.1
15T
1.0
1.5
2.0
2.1
15Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
Caudal Caudal
m3⁄h l/m
0.60 9.8
0.72 11.8
0.84 13.7
0.84 14.0
0.45 7.4
0.54 8.8
0.63 10.3
0.63 10.5
0.30 4.9
0.36 5.9
0.42 6.8
0.42 7.0
0.20 3.3
0.24 3.9
0.28 4.6
0.28 4.7
0.15 2.5
0.18 2.9
0.21 3.4
0.21 3.5
Q
Precip.
mm/h
52
47
41
40
52
47
41
40
52
47
41
40
52
47
41
40
52
47
41
40
V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
Nota: Todas las boquillas MPR se probaron con vástagos retráctiles de 4" (10.2 cm)
Nota: Especifique el cuerpo del aspersor y las boquillas por separado.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
Nota: No se recomienda una reducción del radio que supere el 25% del alcance normal de la
boquilla
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Boquillas burbujeadoras MPR Serie 5
Trayectoria de 0°
Boquilla
Presión
psi
5F-B
15
20
25
30
5H-B
15
20
25
30
5Q-B
15
20
25
30
5CST-B
15
20
25
30
Radio
pies
5
5
5
5
5
5
5
5
5
5
5
5
5
5
5
5
Boquillas burbujeadoras MPR Serie 5
Caudal
gpm
1.50
1.50
1.50
1.50
1.00
1.00
1.00
1.00
0.50
0.50
0.50
0.50
0.50
0.50
0.50
0.50
Trayectoria de 0°
Boquilla
Presión
bares
5F-B
1.0
1.5
2.0
2.1
5H-B
1.0
1.5
2.0
2.1
5Q-B
1.0
1.5
2.0
2.1
5CST-B
1.0
1.5
2.0
2.1
Radio
m
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
SIST. MÉTRICO
Caudal
m3⁄h
0.35
0.35
0.35
0.35
0.23
0.23
0.23
0.23
0.12
0.12
0.12
0.12
0.12
0.12
0.12
0.12
Caudal
l/m
5.7
5.7
5.7
5.7
3.8
3.8
3.8
3.8
1.9
1.9
1.9
1.9
1.9
1.9
1.9
1.9
Nota: Indica radio ajustado a las psi mostradas
Nota: Caudal en el radio ajustado de 5 pies (1.5 m)
26
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie 15 Strip
Serie 15 Strip
Trayectoria de 30°
Boquilla
Presión
psi
15EST
15
20
25
30
15CST
15
20
25
30
15RCS
15
20
25
30
15LCS
15
20
25
30
15SST
15
20
25
30
9SST
15
20
25
30
ancho x largo
pies
4 x 13
4 x 14
4 x 14
4 x 15
4 x 26
4 x 28
4 x 28
4 x 30
3 x 11
3 x 12
4 x 14
4 x 15
3 x 11
3 x 12
4 x 14
4 x 15
4 x 26
4 x 28
4 x 28
4 x 30
9 x 15
9 x 16
9 x 18
9 x 18
A = Ancho del patrón de cobertura
L = Longitud del patrón de cobertura
Caudal
gpm
0.45
0.50
0.56
0.61
0.89
1.00
1.11
1.21
0.35
0.40
0.45
0.49
0.35
0.40
0.45
0.49
0.89
1.00
1.11
1.21
1.34
1.47
1.60
1.73
Trayectoria de 30°
Boquilla
Presión
bares
15EST
1.0
1.5
2.0
2.1
15CST
1.0
1.5
2.0
2.1
15RCS
1.0
1.5
2.0
2.1
15LCS
1.0
1.5
2.0
2.1
15SST
1.0
1.5
2.0
2.1
9SST
1.0
1.5
2.0
2.1
SIST. MÉTRICO
ancho x largo
m
1.2 x 4.0
1.2 x 4.3
1.2 x 4.3
1.2 x 4.6
1.2 x 7.9
1.2 x 8.5
1.2 x 8.5
1.2 x 9.2
0.8 x 3.2
1.0 x 3.9
1.2 x 4.5
1.2 x 4.6
0.8 x 3.2
1.0 x 3.9
1.2 x 4.5
1.2 x 4.6
1.2 x 7.9
1.2 x 8.5
1.2 x 8.5
1.2 x 9.2
2.7 x 4.6
2.7 x 4.9
2.7 x 5.5
2.7 x 5.5
Caudal
m3⁄h
0.10
0.11
0.13
0.14
0.20
0.23
0.25
0.27
0.08
0.09
0.11
0.11
0.08
0.09
0.11
0.11
0.20
0.23
0.25
0.27
0.30
0.33
0.36
0.39
Caudal
l/m
1.7
2.0
2.3
2.3
3.4
4.0
4.5
4.6
1.3
1.6
1.8
1.9
1.3
1.6
1.8
1.9
3.4
4.0
4.5
4.6
5.1
5.8
6.5
6.5
Boquillas aspersoras
Boquillas MPR
Los datos de rendimiento se tomaron en condiciones de cero viento.
Nota: Especifique el cuerpo del aspersor y las boquillas por separado.
Nota: No se recomienda una reducción del radio que supere el 25% del alcance normal
de la boquilla
Serie 8 FLT MPR
Trayectoria de 5° Boquilla
Presión
psi
8H-FLT
15
20
25
30
8Q-FLT
15
20
25
30
Serie 8 FLT MPR
Radio
pies
6
7
7
8
6
7
7
8
Caudal
gpm
0.56
0.65
0.72
0.79
0.28
0.32
0.36
0.39
Q
Precip.
pulg./h
3.36
2.91
2.60
2.38
3.32
2.87
2.57
2.35
V
Precip.
pulg./h
3.88
3.36
3.01
2.75
3.83
3.32
2.97
2.71
Trayectoria de 5° Boquilla
Presión
bares
8H-FLT
1.0
1.5
2.0
2.1
8Q-FLT
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
Caudal
m3⁄h
0.12
0.15
0.18
0.18
0.06
0.07
0.09
0.09
Caudal
l/m
2.1
2.6
2.9
3.0
1.1
1.3
1.4
1.5
Q
Precip.
mm/h
87
71
62
60
86
71
61
60
V
Precip.
mm/h
101
82
71
70
100
81
71
69
Nota: Todas las boquillas MPR se probaron con vástagos retráctiles de 4" (10.2 cm)
Nota: Especifique el cuerpo del aspersor y las boquillas por separado.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
Nota: No se recomienda una reducción del radio que supere el 25% del alcance normal de la
boquilla
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
27
Boquillas aspersoras
#PRVJMMBT42
Boquillas de patrón cuadrado, serie SQ
La solución de rociado de bajo volumen más precisa y eficiente
para el riego de áreas pequeñas con plantas poco espaciadas
Q El patrón de rociado cuadrado y la compensación de presión ofrecen
mayor eficiencia y control, y así se reducen el rociado excesivo y las
probabilidades de daño a la propiedad y situaciones riesgosas
Boquillas aspersoras
Q Las exclusivas capacidades de extremo a extremo para aplicaciones sin
césped reducen la cantidad de boquillas necesarias, lo cual disminuye los
costos y reduce el tiempo de instalación drásticamente
Q %JTF×PFJOTUBMBDJØOTJNQMJGJDBEPTDPOMBGMFYJCJMJEBEEFMBTBQMJDBDJPOFT
una boquilla alcanza 2.5' ó 4' (0.8 m ó 1.2 m) y se puede utilizar en una
variedad de cuerpos de aspersores y tuberías de elevación
Boquilla SQ instalada en la tubería
de elevación de PolyFlex con
adaptador de boquilla
Q Cumple con los requisitos del sistema de microrriego por menos del índice
de caudal de 26 gph (98.4 l/h) a 30 psi (2 bares)
Características
t&MQBUSØOEFSPDJBEPDVBESBEPDPODPCFSUVSBEFFYUSFNPBFYUSFNPMF
permite hacer diseños e instalaciones fácilmente en espacios pequeños
t&MEJTF×PEFDPNQFOTBDJØOEFQSFTJØOCSJOEBVODBVEBMVOJGPSNFTPCSFFM
rango de presión
t%JTQPOJCMFFONPEFMPTQBUSPOFTEFVODVBSUPNFEJPZDPNQMFUPDPO
índice de caudal proporcional a la superficie a regar
- Rendimiento virtual que no produce neblina desde 20 psi (1.4 bares) a 50
psi (3.4 bares)
Boquillas SQ con mallas
%PTEJTUBODJBTEFBMDBODFFODBEBCPRVJMMB$POVOTJNQMFDMJDTFBKVTUBB
2.5’ o 4’ (0.8 m ó 1.2 m)
Una boquilla... Dos alcances
Con sólo girar la boquilla hacia el siguiente
QVOUPEFCMPRVFPQSFGJKBEPMBCPRVJMMB42
de Rain Bird se ajusta de un alcance de 2.5
pies (0.8 m) a un alcance de 4 pies (1.2 m). Es
como tener dos boquillas en una.
- Se envían con filtro de malla azul (0.02” x 0.02” [0.5 mm x 0.5 mm]) para
mantener una distancia de caudal precisa y evitar obstrucciones
t$PNQBUJCMFDPOUPEBTMBTUVCFSÓBTEFFMFWBDJØO4QSBZT9FSJ1PQTFM
OVFWPBEBQUBEPSEFUVCFSÓBEFFMFWBDJØOEF1PMZ'MFY6/*4QSBZZUVCFSÓBT
de elevación SCH 80
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Se puede usar con…
-B#PRVJMMB42FTVOBTPMVDJØOJEFBMQBSBEJWFSTBTÈSFBTEJGÓDJMFTEFEJTF×BS
gracias a su compatibilidad con los productos de riego populares.
t¶OEJDFTEFDBVEBMZHQIZMI
t'JMUSBDJØOSFRVFSJEBNBMMB
Modelos
t42253#PRVJMMB42QBUSØOEFVODVBSUP
t42)-'#PRVJMMB42QBUSØOEFNFEJP
t42'6-#PRVJMMB42QBUSØODPNQMFUP
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSÓBEFFMFWBDJØOEFw
DN
EF1PMZ'MFY
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSÓBEFFMFWBDJØOEFw
DN
EF1PMZ'MFY
t42"%1TØMPFMBEBQUBEPS42EFUVCFSÓBEFFMFWBDJØOEF1PMZ'MFY
* Nota: se necesita un adaptador para arbustos de plástico PA-8S (consulte la página 18) cuando se
utiliza una boquilla serie SQ montada en una tubería de elevación SCH 80.
Cabezales
aspersores
serie 1800®
Xeri-Pop
Cuerpos de
difusores
Polyflex Programación 80
Tuberías de
Tuberías de
elevación
elevación
-BTCPRVJMMBTTFSJF42CSJOEBOVOQSFDJTPQBUSØOEFSJFHPDVBESBEPZVOBDPMPDBDJØOFGJDB[EFMBHVBDPODPNQFOTBDJØOEFQSFTJØOMPRVFEBDPNP
resultado hasta un 65% en ahorro de agua. Son ideales para canteros estrechos, islas de estacionamientos y divisores de caminos, carreteras y calles.
28
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
#PRVJMMBT42
Rendimiento de la boquilla SQ
Rendimiento de la boquilla SQ
Alcance de 2.5 pies (0.76 m) a una altura de 6" (15.2 cm) sobre el terreno
Presión
psi
Q
20
30
40
50
20
30
40
50
20
30
40
50
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
H
F
Alcance de 0.8 m a una altura de 0.15 m sobre el nivel del terreno
Caudal
gph
Caudal
gpm
Índice de precip.
sin superposición
pulg./h
6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3
0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46
1.64
1.90
1.32
1.32
1.31
1.57
1.22
1.22
1.28
1.55
1.22
1.22
Q
H
F
Alcance de 2.5 pies (121.92 cm) a una altura de 6" (15.2 cm) sobre el terreno
Boquilla
Presión
psi
Q
20
30
40
50
20
30
40
50
20
30
40
50
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
H
F
Alcance
Presión
bares
Radio
m.
Caudal
l/h
Caudal
l/m
Índice de precip.
sin superposición
mm/h
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
24
28
28
28
39
46
52
52
76
92
103
103
0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72
42
48
34
34
33
40
31
31
33
39
31
31
Rendimiento de la boquilla SQ
Rendimiento de la boquilla SQ
Alcance
Radio
pies
Boquilla
Caudal
gph
Caudal
gpm
Índice de precip.
sin superposición
pulg./h
6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3
0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46
0.64
0.74
0.59
0.59
0.51
0.61
0.54
0.54
0.50
0.61
0.54
0.54
Boquillas aspersoras
Boquilla
Alcance
Radio
pies
SIST. MÉTRICO
SIST. MÉTRICO
Alcance de 1.2 m a una altura de 0.15 m sobre el nivel del terreno
Boquilla
Q
H
F
Alcance
Presión
bares
Radio
m.
Caudal
l/h
Caudal
l/m
Índice de precip.
sin superposición
mm/h
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
24
28
28
28
39
46
52
52
76
92
103
103
0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72
16
19
15
15
13
16
14
14
13
15
14
14
Los datos de rendimiento se tomaron en condiciones de cero viento.
Rendimiento de la boquilla SQ
Modelo de medio
SIST. MÉTRICO
Modelo completo
Flow Rate (gph)
Modelo de un cuarto
28
24
20
16
12
8
4
0
Full
Half
Quarter
0 10
20
30
40
Pressure (psi)
50
60
105.98
90.84
75.70
60.56
45.42
30.28
15.14
0
Full
Flow Rate (l/h)
Boquillas SQ
Half
Quarter
0
1.0
2.0
2.5
Pressure (bar)
3.5
4.0
5'
4'
4'
2.5'
2.5'
4'
2.5'
5'
5'
8'
8'
8'
El uso inteligente del agua.™
29
Boquillas aspersoras
Boquillas Serie U
Modelos
Boquillas plásticas Serie U
Boquillas aspersoras de doble orificio que usan un 30% menos de agua
t62CPRVJMMBEFQBUSØOEFVODVBSUPEFDÓSDVMPEFQJFTN
Q Orificio adicional para riego cercano al cabezal. Minimiza las áreas secas
t65CPRVJMMBEFQBUSØOEFVOUFSDJPEFDÓSDVMPEFQJFTN
1
t6)CPRVJMMBEFQBUSØOTFNJDJSDVMBSEFQJFTN
alrededor de los aspersores
Q Coeficiente de la uniformidad del riego bajo para lograr un riego eficaz.
t6'CPRVJMMBEFQBUSØOCPRVJMMBEFQBUSØOEFDÓSDVMPDPNQMFUPEFQJFTN
t62CPRVJMMBEFQBUSØOEFVODVBSUPEFDÓSDVMPEFQJFTN
Usa hasta un 30% menos de agua2
Boquillas aspersoras
Q Índice de precipitación ajustado entre disposiciones y caudal ajustado
(gpm, m3/h and l/m) e índices de precipitación con boquillas MPR de
Rain Bird
t65CPRVJMMBEFQBUSØOEFVOUFSDJPEFDÓSDVMPEFQJFTN
t6)CPRVJMMBEFQBUSØOTFNJDJSDVMBSEFQJFTN
t6'CPRVJMMBEFQBUSØOCPRVJMMBEFQBUSØOEFDÓSDVMPDPNQMFUPEFQJFTN
t62CPRVJMMBEFQBUSØOEFVODVBSUPEFDÓSDVMPEFQJFTN
Características
t65CPRVJMMBEFQBUSØOEFVOUFSDJPEFDÓSDVMPEFQJFTN
t-B4FSJF6PGSFDFVOBGBNJMJBDPNQMFUBEFCPRVJMMBTMPDVBMCSJOEBNBZPS
flexibilidad
t6)CPRVJMMBEFQBUSØOTFNJDJSDVMBSEFQJFTN
t&MGJMUSPEFNBMMBGJOBQSPUFHFFMPSJGJDJPJOGFSJPSEFMBTQBSUÓDVMBTEFTVDJFEBE
t655CPRVJMMBEFQBUSØOEFEPTUFSDJPTEFDÓSDVMPEFQJFTN
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP
t652CPRVJMMBEFQBUSØOEFUSFTDVBSUPTEFDÓSDVMPEFQJFTN
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
t6'CPRVJMMBEFQBUSØOCPRVJMMBEFQBUSØOEFDÓSDVMPDPNQMFUPEFQJFTN
t$PNQBUJCMFDPOUPEPTMPTDVFSQPTEFBTQFSTPSFTZBEBQUBEPSFTQBSBBSCVTUPT
de Rain Bird
t65CPRVJMMBEFQBUSØOEFVOUFSDJPEFDÓSDVMPEFQJFTN
1
2
Cuando se instalan boquillas con doble orificio Serie U en lugar de boquillas estándar en todos los
cuerpos de aspersores de la zona. Los resultados pueden variar de acuerdo con las condiciones
específicas del sitio como el espaciamiento de los aspersores, el viento, la temperatura, el tipo de suelo
y césped
El coeficiente de programación (SC) mide la eficacia de los aspersores. El SC mide cuánto más necesita
regar TODA el área para que las secciones más secas reciban suficiente agua. Cuanto más bajo es el SC,
mejor es la distribución del agua que hace el aspersor.
t62CPRVJMMBEFQBUSØOEFVODVBSUPEFDÓSDVMPEFQJFTN
t6)CPRVJMMBEFQBUSØOTFNJDJSDVMBSEFQJFTN
t655CPRVJMMBEFQBUSØOEFEPTUFSDJPTEFDÓSDVMPEFQJFTN
t652CPRVJMMBEFQBUSØOEFUSFTDVBSUPTEFDÓSDVMPEFQJFTN
t6'CPRVJMMBEFQBUSØOCPRVJMMBEFQBUSØOEFDÓSDVMPDPNQMFUPEFQJFTN
Rango operativo
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Enfrentando a la competencia
t1SFTJØOØQUJNBQTJCBSFT
3
3
Rain Bird recomienda usar Cuerpos de aspersores 1800 PRS para mantener el rendimiento óptimo
de la boquilla en situaciones de presión más alta
Serie U patentada
Como el agua sale de ambos orificios, se genera un coeficiente de la uniformidad del riego más
bajo. Este eficaz diseño preserva el agua, ahorra dinero y reduce el desperdicio
Competidor A
Boquillas Serie U
Competidor B
Cómo especificar
U12H
Rango de radio
8: 243.84 cm (2.4 m)
12: 365.76 cm (3.7 m)
15: 457.20 cm (4.6 m)
Modelo
Boquillas Serie U
Patrón
'$PNQMFUB
H: Media
26ODVBSUP
56OUFSDJP
55%PTUFSDJPT
525SFTDVBSUPT
Las boquillas de la Serie U de Rain
Bird® producen patrones de rociado
de dos orificios para formar un caudal
de agua continuo. El resultado es que
no quedan lugares sin regar y se cubre
toda el área de riego de un modo más
uniforme*
* Basado en pruebas realizadas en el Centro de
Investigaciones de Productos Rain Bird. Pruebas
realizadas en boquillas de círculo parcial de
Rain Bird y de los principales competidores
Las boquillas de los Competidores A y B no proporcionan riego un cercano al cabezal eficaz y,
por lo tanto, necesitan un coeficiente de la uniformidad del riego más alto
Boquilla Serie U con malla
Como el agua sale de ambos orificios, se genera un coeficiente de la uniformidad del riego más bajo. Este eficaz diseño preserva el agua,
ahorra dinero y reduce el desperdicio.
30
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie U8
Trayectoria de 10° Boquilla
Presión
psi
U-8F
15
20
25
30
U8H
15
20
25
30
U8T
15
20
25
30
U8Q
15
20
25
30
Serie U8
Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8
Caudal
gpm
0.74
0.86
0.96
1.05
0.37
0.42
0.47
0.52
0.25
0.29
0.32
0.35
0.18
0.21
0.24
0.26
Q
Precip.
pulg./h
2.85
2.30
1.89
1.58
2.85
2.25
1.85
1.58
2.89
2.33
1.89
1.58
2.77
2.25
1.89
1.58
V
Precip.
pulg./h
3.29
2.66
2.18
1.83
3.29
2.59
2.13
1.83
3.34
2.69
2.18
1.83
3.20
2.59
2.18
1.83
Serie U10
Trayectoria de 12° Boquilla
Presión
psi
U-10F
15
20
25
30
U-10H
15
20
25
30
U-10T
15
20
25
30
U-10Q
15
20
25
30
Trayectoria de 10°
Boquilla
Presión
bares
U-8F
1.0
1.5
2.0
2.1
U-8H
1.0
1.5
2.0
2.1
U-8T
1.0
1.5
2.0
2.1
U-8Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
1.7
2.1
2.4
2.4
Serie U10
Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10
Caudal
gpm
1.16
1.34
1.50
1.64
0.58
0.67
0.75
0.82
0.39
0.45
0.50
0.55
0.29
0.33
0.37
0.41
Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
Trayectoria de 12°
Boquilla
Presión
bares
U-10F
1.0
1.5
2.0
2.1
U-10H
1.0
1.5
2.0
2.1
U-10T
1.0
1.5
2.0
2.1
U-10Q
1.0
1.5
2.0
2.1
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.16 2.8
72
0.20 3.4
58
0.23 3.9
48
0.24 4.0
40
0.08 1.4
72
0.10 1.7
57
0.12 1.9
47
0.12 2.0
40
0.05 0.9
73
0.07 1.1
59
0.08 1.3
48
0.08 1.3
40
0.04 0.7
70
0.05 0.8
57
0.06 1.0
48
0.06 1.0
40
V
Precip.
mm/h
84
68
55
46
84
66
54
46
85
68
55
46
81
66
55
46
SIST. MÉTRICO
Radio
m
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1
2.1
2.6
3.0
3.1
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.26 4.4
52
0.30 5.3
47
0.34 6.1
41
0.37 6.2
40
0.13 2.2
52
0.15 2.6
47
0.17 3.1
41
0.19 3.1
40
0.09 1.5
52
0.10 1.8
47
0.11 2.0
41
0.12 2.1
40
0.07 1.1
52
0.08 1.3
47
0.08 1.5
41
0.09 1.6
40
V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
Nota: Todas las boquillas Serie U se probaron con vástagos retráctiles de 4" (10.2 cm)
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar
El uso inteligente del agua.™
31
Boquillas aspersoras
Boquillas Serie U
Boquillas aspersoras
Boquillas Serie U
Serie U12
Boquillas aspersoras
Trayectoria de 23° Boquilla
Presión
psi
U-12F
15
20
25
30
U-12TQ
15
20
25
30
U-12TT
15
20
25
30
U-12H
15
20
25
30
U-12T
15
20
25
30
U-12Q
15
20
25
30
Serie U12
Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
Caudal
gpm
1.80
2.10
2.40
2.60
1.35
1.58
1.80
1.95
1.20
1.40
1.60
1.74
0.90
1.05
1.20
1.30
0.60
0.70
0.80
0.87
0.45
0.53
0.60
0.65
Q
Precip.
pulg./h
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
2.14
2.02
1.91
1.74
V
Precip.
pulg./h
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
2.47
2.34
2.21
2.01
Trayectoria de 23°
Boquilla
Presión
bares
U-12F
1.0
1.5
2.0
2.1
U-12TQ
1.0
1.5
2.0
2.1
U-12TT
1.0
1.5
2.0
2.1
U-12H
1.0
1.5
2.0
2.1
U-12T
1.0
1.5
2.0
2.1
U-12Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.40 6.8
55
0.48 8.3
47
0.59 9.7
46
0.60 9.8
44
0.30 5.1
55
0.36 6.3
47
0.45 7.3
46
0.45 7.4
44
0.26 4.5
55
0.32 5.6
47
0.40 6.5
46
0.40 6.6
44
0.20 3.4
55
0.24 4.2
47
0.30 4.8
46
0.30 4.9
44
0.13 2.3
55
0.16 2.8
47
0.20 3.2
46
0.20 3.3
44
0.10 1.7
55
0.12 2.1
47
0.15 2.4
46
0.15 2.5
44
V
Precip.
mm/h
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
63
54
53
51
Nota: Todas las boquillas Serie U se probaron con vástagos retráctiles de 4" (10.2 cm)
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar
Boquillas Serie U
32
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie U15
Serie U15
Trayectoria de 23° Boquilla
Presión
psi
U-15F
15
20
25
30
U-15TQ
15
20
25
30
U-15TT
15
20
25
30
U-15H
15
20
25
30
U-15T
15
20
25
30
U-15Q
15
20
25
30
Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.74
2.01
2.21
2.48
1.30
1.50
1.65
1.85
0.87
1.00
1.10
1.23
0.65
0.75
0.82
0.92
Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
Trayectoria de 23°
Boquilla
Presión
bares
U-15F
1.0
1.5
2.0
2.1
U-15TQ
1.0
1.5
2.0
2.1
U-15TT
1.0
1.5
2.0
2.1
U-15H
1.0
1.5
2.0
2.1
U-15T
1.0
1.5
2.0
2.1
U-15Q
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.60 9.8
52
0.72 11.8 47
0.84 13.7 41
0.84 14.0 40
0.45 7.4
52
0.54 8.8
47
0.63 10.3 41
0.63 10.5 40
0.40 6.6
52
0.48 7.9
47
0.55 9.2
41
0.56 9.4
40
0.30 4.9
52
0.36 5.9
47
0.42 6.9
41
0.42 7.0
40
0.20 3.3
52
0.24 3.9
47
0.28 4.6
41
0.28 4.7
40
0.15 2.5
52
0.18 2.9
47
0.21 3.4
41
0.21 3.5
40
V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
Nota: Todas las boquillas Serie U se probaron con vástagos retráctiles de 4" (10.2 cm)
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Los datos de rendimiento se tomaron en condiciones de cero viento.
Radio se refiere al espaciamiento recomendado del producto. Los radios reales en el arco pueden variar
Las boquillas Serie U ofrecen una mejor y más uniforme distribución del agua. El agua que sale de ambos
orificios se combina para formar un caudal de agua continuo. Evita que queden zonas sin regar y logra
una cobertura más uniforme en toda el área de riego
El uso inteligente del agua.™
33
Boquillas aspersoras
Boquillas Serie U
Boquillas aspersoras
Boquillas serie Van
Boquillas serie VAN
Serie 4 VAN
Boquillas de arco variable
Q 'ÈDJMBKVTUFEFMBSDPEF¡B¡FOMB4FSJFTZ
7"/EF¡B¡FOMBT4FSJFTZ7"/
Q El simple giro del collarín central aumenta o disminuye el ajuste del arco
Boquillas aspersoras
Q Las Series 12, 15, y 18-VAN tienen índices de precipitación ajustados con
las boquillas MPR Rain Bird
Características
t-BSBOVSBEFMUPSOJMMPFWJUBFMEFTHBTUFEFMEFTUPSOJMMBEPS
t/PSFRVJFSFIFSSBNJFOUBTFTQFDJBMFT
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMDBVEBMZFMSBEJP
t*OEJDBEPSUÈDUJMEFMFYUSFNPJ[RVJFSEP
t*EFBMQBSBSFHBSÈSFBTEFGPSNBJSSFHVMBS
t4FFOWÓBODPOGJMUSPEFNBMMBB[VMY
QBSBNBOUFOFSVOBKVTUFEF
radio preciso y evitar obstrucciones
Rango operativo
t3BEJP
4-VAN: de 3 a 4 pies (de 0.9 a 1.2 m)
6-VAN: de 4 a 6 pies (de 1.2 a 1.8 m)
8-VAN: de 6 a 8 pies (de 1.8 a 2.4 m)
10-VAN: de 8 a 10 pies (de 2.4 a 3.0 m)
12-VAN: de 10 a 12 pies (de 3.0 a 3.7 m)
15-VAN: de 12 a 15 pies (de 3.7 a 4.6 m)
18-VAN: de 14 a 18 pies (de 4.3 a 5.5 m)
t1SFTJØOEFBQTJEFBCBSFT
t1SFTJØOØQUJNBQTJCBSFT
* Estos rangos están basados en la presión adecuada de las boquillas
** Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener un rendimiento óptimo de
la boquilla en situaciones de presión más alta
Modelos
t7"/
t7"/
t7"/
t7"/
t7"/
t7"/
t7"/
Boquilla serie VAN
Trayectoria de 0° Boquilla
Presión
psi
Arco 330°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Radio
pies
3
3
4
4
3
3
4
4
3
3
4
4
3
3
4
4
Caudal
gpm
0.62
0.70
0.80
0.88
0.52
0.58
0.66
0.73
0.32
0.37
0.41
0.45
0.21
0.24
0.26
0.29
Q
Precip.
pulg./h
7.23
8.17
5.25
5.78
7.42
8.27
5.29
5.86
6.84
7.91
4.93
5.41
8.98
10.27
6.26
6.98
Serie 4 VAN
Trayectoria de 0° Boquilla
Presión
bares
Arco 330°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
V
Precip.
pulg./h
8.35
9.43
6.06
6.67
8.57
9.55
6.11
6.77
7.90
9.13
5.69
6.25
10.37
11.86
7.23
8.06
SIST. MÉTRICO
Radio
m
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2
0.9
1.0
1.2
1.2
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.14 2.3
189
0.17 2.8
183
0.20 3.3
152
0.20 3.3
152
0.12 2.0
198
0.14 2.3
187
0.16 2.7
148
0.17 2.8
157
0.07 1.2
173
0.09 1.5
180
0.10 1.7
139
0.10 1.7
139
0.05 0.8
247
0.06 0.9
240
0.06 1.1
167
0.07 1.1
194
V
Precip.
mm/h
218
215
176
176
229
216
171
181
200
208
161
161
285
277
193
224
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
Fácil de ajustar
34
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie 6 VAN
Trayectoria de 0° Boquilla
Presión
psi
Arco 330°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Serie 6 VAN
Radio
pies
4
5
5
6
4
5
5
6
4
5
5
6
4
5
5
6
Caudal
gpm
0.85
0.96
1.09
1.20
0.79
0.88
1.00
1.10
0.42
0.49
0.55
0.60
0.26
0.30
0.34
0.37
Q
Precip.
pulg./h
5.58
4.03
4.58
3.50
6.34
4.52
5.13
3.92
5.05
3.77
4.24
3.21
6.26
4.62
5.24
3.96
V
Precip.
pulg./h
6.44
4.65
5.29
4.04
7.32
5.22
5.92
4.53
5.83
4.35
4.90
3.71
7.23
5.33
6.05
4.57
Serie 8 VAN
Trayectoria de 5° Boquilla
Presión
psi
Arco 330°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Trayectoria de 0° Boquilla
Presión
bares
Arco 330°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8
1.2
1.5
1.8
1.8
Serie 8 VAN
Radio
pies
6
7
7
8
6
7
7
8
6
7
7
8
6
7
7
8
Caudal
gpm
1.21
1.36
1.55
1.70
1.11
1.24
1.41
1.55
0.84
0.97
1.09
1.19
0.51
0.59
0.66
0.72
Q
Precip.
pulg./h
3.53
2.91
3.32
2.79
3.95
3.24
3.69
3.10
4.49
3.81
4.28
3.58
5.46
4.64
5.19
4.33
V
Precip.
pulg./h
4.07
3.36
3.83
3.22
4.55
3.74
4.25
3.58
5.18
4.40
4.94
4.13
6.29
5.35
5.98
5.00
Trayectoria de 5° Boquilla
Presión
bares
Arco 330°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.19 3.2
144
0.23 3.8
112
0.27 4.5
91
0.27 4.5
91
0.18 3.0
167
0.21 3.5
124
0.24 4.1
99
0.25 4.2
103
0.10 1.6
139
0.11 1.9
98
0.13 2.2
80
0.14 2.3
86
0.06 1.0
167
0.07 1.2
124
0.08 1.4
99
0.08 1.4
99
V
Precip.
mm/h
166
129
105
105
193
143
114
119
161
113
92
99
193
143
114
114
SIST. MÉTRICO
Radio
m
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4
1.8
2.1
2.3
2.4
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.27 4.6
91
0.32 5.4
79
0.38 6.3
78
0.39 6.4
74
0.25 4.2
103
0.30 4.9
91
0.34 5.8
86
0.35 5.9
81
0.19 3.2
117
0.23 3.8
104
0.26 4.4
98
0.27 4.5
94
0.12 1.9
148
0.14 2.3
127
0.16 2.7
121
0.16 2.7
111
V
Precip.
mm/h
105
91
90
86
119
105
99
94
135
120
113
109
171
147
140
128
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
35
Boquillas aspersoras
Boquillas serie Van
Boquillas aspersoras
Boquillas serie Van
Serie 10 VAN
Boquillas aspersoras
Trayectoria de 10° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Serie 10 VAN
Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10
Caudal
gpm
1.93
2.32
2.52
2.60
1.45
1.75
1.89
2.10
0.97
1.20
1.26
1.45
0.48
0.58
0.63
0.75
Q
Precip.
pulg./h
3.80
3.50
3.00
2.50
3.80
3.50
3.00
2.70
3.80
3.50
3.00
2.80
3.80
3.50
3.00
2.90
V
Precip.
pulg./h
4.39
4.04
3.46
2.89
4.39
4.04
3.46
3.12
4.39
4.04
3.46
3.23
4.39
4.04
3.46
3.35
Serie 12 VAN
Trayectoria de 15° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Trayectoria de 10°
Boquilla
Presión
bares
Arco 360°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1
2.1
2.4
2.7
3.1
Serie 12 VAN
Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
Caudal
gpm
1.56
1.86
2.12
2.36
1.17
1.39
1.59
1.77
0.78
0.93
1.06
1.18
0.39
0.46
0.53
0.59
Q
Precip.
pulg./h
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58
1.86
1.79
1.68
1.58
V
Precip.
pulg./h
2.14
2.06
1.95
1.82
2.14
2.06
1.94
1.82
2.14
2.06
1.95
1.82
2.14
2.06
1.95
1.82
Trayectoria de 15°
Boquilla
Presión
bares
Arco 360°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.44 7.3
96
0.53 9.0
89
0.57 9.8
76
0.59 9.8
63
0.33 5.5
96
0.4
6.8
89
0.43 7.8
76
0.48 7.9
68
0.22 3.7
96
0.27 4.6
89
0.29 5.3
76
0.33 5.5
71
0.11 1.8
96
0.13 2.3
89
0.14 2.7
76
0.17 2.8
73
V
Precip.
mm/h
111
103
88
73
111
103
88
79
111
103
88
82
111
103
88
85
SIST. MÉTRICO
Radio
m
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
2.7
3.2
3.6
3.7
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.35 5.80 48
0.44 7.37 43
0.52 8.75 41
0.54 9.02 40
0.26 4.35 48
0.33 5.53 43
0.39 6.56 41
0.41 6.76 40
0.17 2.90 48
0.22 3.69 43
0.26 4.37 41
0.27 4.51 40
0.09 1.45 48
0.11 1.84 43
0.13 2.19 41
0.14 2.25 40
V
Precip.
mm/h
55
50
47
46
55
50
47
46
55
50
47
46
55
50
47
46
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
36
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie 15 VAN
Trayectoria de 23° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Serie 15 VAN
Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
Caudal
gpm
2.60
3.00
3.30
3.70
1.95
2.25
2.48
2.78
1.30
1.50
1.65
1.85
0.65
0.75
0.82
0.92
Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
Serie 18 VAN
Trayectoria de 26° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Trayectoria de 23°
Boquilla
Presión
bares
Arco 360°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
SIST. MÉTRICO
Radio
m
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
3.4
3.9
4.5
4.6
Serie 18 VAN
Radio
pies
14
15
17
18
14
15
17
18
14
15
17
18
14
15
17
18
Caudal
gpm
4.21
4.70
4.86
5.32
3.16
3.52
3.65
3.99
2.11
2.35
2.43
2.66
1.05
1.17
1.22
1.33
Q
Precip.
pulg./h
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
2.07
2.01
1.62
1.58
V
Precip.
pulg./h
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
2.39
2.32
1.87
1.83
Trayectoria de 26°
Boquilla
Presión
bares
Arco 360°
1.0
1.5
2.0
2.1
Arco 270°
1.0
1.5
2.0
2.1
Arco 180°
1.0
1.5
2.0
2.1
Arco 90°
1.0
1.5
2.0
2.1
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.60 9.8
52
0.72 11.8 47
0.84 13.7 41
0.84 14.0 40
0.45 7.4
52
0.54 8.8
47
0.63 10.3 41
0.63 10.5 40
0.30 4.9
52
0.36 5.9
47
0.42 6.9
41
0.42 7.0
40
0.15 2.5
52
0.18 2.9
47
0.21 3.4
41
0.21 3.5
40
V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
SIST. MÉTRICO
Radio
m
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5
4.3
4.8
5.4
5.5
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.96 15.9 52
1.07 18.0 47
1.20 19.8 41
1.21 20.1 40
0.72 12.0 52
0.80 13.5 47
0.90 14.8 41
0.91 15.1 40
0.48 8.0
52
0.54 9.0
47
0.60 9.9
41
0.61 10.1 40
0.24 4.0
52
0.27 4.5
47
0.30 5.0
41
0.30 5.0
40
V
Precip.
mm/h
60
55
48
46
60
55
48
46
60
55
48
46
60
55
48
46
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
37
Boquillas aspersoras
Boquillas serie Van
Boquillas aspersoras
Boquillas serie HE-VAN
Boquillas serie HE-VAN
Boquillas aspersoras de arco variable y alta eficiencia
NUEVO
Q'ÈDJMBKVTUFEFMBSDPEF¡B¡DPOVOTJNQMFHJSPEFMDPMMBSÓODFOUSBMQBSB
aumentar o disminuir el ajuste del arco.
Q La característica del ExactEdge™, le ayuda a ajustar el arco de manera más
Boquillas aspersoras
eficaz. Al girar la boquilla para ajustar el arco al patrón deseado, sentirá un
tope que indica el borde exacto de riego asegurando siempre la máxima
consistencia.
Q La tecnología de control de caudal, con patente en trámite, brinda un riego
Disponible en los
populares modelos de
12’ y 15’ (3.66 m y 4.57 m)
a corta distancia superior y cobertura uniforme en todo el patrón.
Características
t$IPSSPTNÈTFTQFTPTZHPUBTEFBHVBNÈTHSBOEFTQBSBVOBNBZPSSFTJTUFODJB
al viento.
t¶OEJDFTEFQSFDJQJUBDJØOBKVTUBEPTDPOMBTCPRVJMMBTEFMBTTFSJFT.13Z6EF
Rain Bird®.
t%FGMFDUPSTVQFSJPSSFTJTUFOUFRVFNJOJNJ[BFMEB×PBMBCPRVJMMBQSPEVDJEPQPS
el desgaste normal.
t/PTFSFRVJFSFOIFSSBNJFOUBTFTQFDJBMFT
t5PSOJMMPEFBKVTUFEFBDFSPJOPYJEBCMFQBSBBKVTUBSFMSBEJPZFMDBVEBMFMSBEJP
puede reducirse hasta un 25%.
t4FFOWÓBODPOGJMUSPEFNBMMBB[VMY
QBSBNBOUFOFSVOBKVTUFEF
radio preciso y evitar obstrucciones.
Ahora disponible en los
modelos de 8’ y 10’ (2.44
m y 3.05 m)
t$BCFFOUPEPTMPTBTQFSTPSFTEFMBTTFSJFT¥Z6/*4QSBZ™EF3BJO#JSE¥Z
adaptadores para arbustos de Rain Bird.
Clasificación de eficiencia de las boquillas HE-VAN de Rain
Bird®1
t-BTCPRVJMMBT)&7"/EF3BJO#JSE¥CSJOEBOVOBVOJGPSNJEBEFOMBEJTUSJCVDJØO
QSPNFEJP%6-2, del 70%, un 40% mejor que las boquillas aspersoras comunes
de arco variable.
t-BTCPRVJMMBT)&7"/EF3BJO#JSE¥CSJOEBOVODPFGJDJFOUFEFSFOEJNJFOUP
≤ 1.6, un 35% más bajo que el de las boquillas difusoras comunes de arco
variable.
Rango operativo
t3BEJP2
- HE-VAN-08: de 6 a 8 pies (de 1.8 a 0.4 cm)
- HE-VAN-10: de 8 a 10 pies (de 2.4 a 3.0 m)
- HE-VAN-12: de 9 a 12 pies (de 2.7 a 3.7 m)
- HE-VAN-15: de 12 a 15 pies (de 3.7 a 4.6 m)
t1SFTJØOEFBQTJEFBCBSFT
t1SFTJØOØQUJNBQTJCBSFT
3
Modelos
Cómo especificar
HE-VAN-15
Rango de radio
15: 457.20 cm (4.6 m)
t)&7"/
t)&7"/
t)&7"/
t)&7"/
1
Característica
VAN: Arco variable
Modelo
Boquilla de alta eficiencia
2
3
38
Uniformidad en la distribución (DULQ): En el riego, la DU es una medida de la uniformidad del
agua aplicada en el área regada. La DULQ se calcula tomando el volumen del cuarto inferior de las
mediciones del depósito de captación y dividiéndolo por el volumen promedio de todas las mediciones
del depósito de captación. Coeficiente de programación (SC): el SC la una medida de la cantidad de
tiempo que se debe regar una zona para proporcionarle agua suficiente a su punto más seco.
Estos rangos están basados en la presión adecuada de las boquillas.
Rain Bird recomienda usar cuerpos de aspersores 1800 PRS para mantener el rendimiento óptimo de la
boquilla en situaciones de presión más alta.
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
HE-VAN serie 8
HE-VAN serie 8
Trayectoria de 24° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Radio
pies
5
6
7
8
5
6
7
8
5
6
7
8
5
6
7
8
Caudal
gpm
0.83
0.96
1.07
1.17
0.62
0.72
0.80
0.88
0.41
0.48
0.53
0.59
0.21
0.24
0.27
0.29
Q
Precip.
pulg./h
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76
3.19
2.56
2.10
1.76
V
Precip.
pulg./h
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03
3.68
2.95
2.42
2.03
Radio
m
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44
1.52
1.83
2.13
2.44
HE-VAN serie 10
HE-VAN serie 10
Trayectoria de 27° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Trayectoria de 24°
Boquilla
Presión
bares
Arco 360°
1.03
1.38
1.72
2.07
Arco 270°
1.03
1.38
1.72
2.07
Arco 180°
1.03
1.38
1.72
2.07
Arco 90°
1.03
1.38
1.72
2.07
SIST. MÉTRICO
Radio
pies
7
8
9
10
7
8
9
10
7
8
9
10
7
8
9
10
Caudal
gpm
1.26
1.46
1.63
1.78
0.95
1.09
1.22
1.34
0.63
0.73
0.81
0.89
0.32
0.36
0.41
0.45
Q
Precip.
pulg./h
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72
2.48
2.19
1.94
1.72
V
Precip.
pulg./h
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98
2.86
2.53
2.24
1.98
Trayectoria de 27°
Boquilla
Presión
bares
Arco 360°
1.03
1.38
1.72
2.07
Arco 270°
1.03
1.38
1.72
2.07
Arco 180°
1.03
1.38
1.72
2.07
Arco 90°
1.03
1.38
1.72
2.07
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.19 3.14 82
0.22 3.62 66
0.25 4.05 54
0.27 4.43 45
0.14 2.35 82
0.16 2.72 66
0.18 3.04 54
0.20 3.33 45
0.10 1.57 82
0.11 1.81 66
0.12 2.02 54
0.13 2.22 45
0.05 0.78 82
0.05 0.91 66
0.06 1.01 54
0.07 1.11 45
V
Precip.
mm/h
95
76
62
52
95
76
62
52
95
76
62
52
95
76
62
52
SIST. MÉTRICO
Radio
m
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05
2.13
2.44
2.74
3.05
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.29 4.78 64
0.34 5.52 56
0.37 6.17 50
0.41 6.76 44
0.22 3.59 64
0.25 4.14 56
0.28 4.63 50
0.31 5.07 44
0.15 2.39 64
0.17 2.76 56
0.19 3.09 50
0.21 3.38 44
0.07 1.20 64
0.08 1.38 56
0.09 1.54 50
0.10 1.69 44
V
Precip.
mm/h
74
65
57
51
74
65
57
51
74
65
57
51
74
65
57
51
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
39
Boquillas aspersoras
Boquillas serie HE-VAN
Boquillas aspersoras
Boquillas serie HE-VAN
HE-VAN serie 12
HE-VAN serie 12
Boquillas aspersoras
Trayectoria de 23° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Radio
pies
9
10
11
12
9
10
11
12
9
10
11
12
9
10
11
12
Caudal
gpm
1.67
1.93
2.16
2.37
1.25
1.45
1.62
1.77
0.84
0.97
1.08
1.18
0.42
0.48
0.54
0.59
Q
Precip.
pulg./h
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58
1.99
1.86
1.72
1.58
V
Precip.
pulg./h
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83
2.30
2.15
1.99
1.83
Trayectoria de 23°
Boquilla
Presión
bares
Arco 360°
1.0
1.4
1.7
2.1
Arco 270°
1.0
1.4
1.7
2.1
Arco 180°
1.0
1.4
1.7
2.1
Arco 90°
1.0
1.4
1.7
2.1
SIST. MÉTRICO
Radio
m
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7
2.7
3.0
3.4
3.7
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.38 6.33 50.5
0.44 7.31 47.3
0.49 8.18 43.7
0.54 8.96 40.2
0.28 4.75 50.5
0.33 5.48 47.3
0.37 6.16 43.7
0.40 6.72 40.2
0.19 3.17 50.5
0.22 3.66 47.3
0.25 4.09 43.7
0.27 4.48 40.2
0.09 1.58 50.5
0.11 1.83 47.3
0.12 2.04 43.7
0.13 2.24 40.2
V
Precip.
mm/h
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4
58.3
54.6
50.4
46.4
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
40
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
HE-VAN serie 15
HE-VAN serie 15
Trayectoria de 25° Boquilla
Presión
psi
Arco 360°
15
20
25
30
Arco 270°
15
20
25
30
Arco 180°
15
20
25
30
Arco 90°
15
20
25
30
Radio
pies
11
12
14
15
11
12
14
15
11
12
14
15
11
12
14
15
Caudal
gpm
2.62
3.02
3.38
3.70
1.96
2.27
2.53
2.78
1.31
1.51
1.69
1.85
0.65
0.76
0.84
0.93
Q
Precip.
pulg./h
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58
2.08
2.02
1.66
1.58
V
Precip.
pulg./h
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83
2.40
2.33
1.92
1.83
Trayectoria de 25°
Boquilla
Presión
bares
Arco 360°
1.0
1.4
1.7
2.1
Arco 270°
1.0
1.4
1.7
2.1
Arco 180°
1.0
1.4
1.7
2.1
Arco 90°
1.0
1.4
1.7
2.1
SIST. MÉTRICO
Radio
m
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6
3.4
3.7
4.3
4.6
Q
Caudal Caudal Precip.
m3⁄h l/m
mm/h
0.59 9.91 52.9
0.69 11.44 51.3
0.77 12.79 42.2
0.84 14.01 40.2
0.45 7.43 52.9
0.51 8.58 51.3
0.58 9.59 42.2
0.63 10.51 40.2
0.30 4.95 52.9
0.34 5.72 51.3
0.38 6.39 42.2
0.42 7.00 40.2
0.15 2.48 52.9
0.17 2.86 51.3
0.19 3.20 42.2
0.21 3.50 40.2
V
Precip.
mm/h
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5
61.1
59.3
48.7
46.5
Nota: Puede ser necesario girar el tornillo de reducción del radio para lograr el radio y
el caudal del catálogo cuando el arco establecido es menor que el arco máximo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
El uso inteligente del agua.™
41
Boquillas aspersoras
Boquillas serie HE-VAN
Boquillas aspersoras
Boquillas rotativas
Boquillas giratorias
Índice de precipitación de 0.60 pulg./h (15.2 mm/h)
en un rango de 13 a 24 pies (4 a 7.3 m)
Q El bajo índice de precipitación de 0.60 pulg./hr (15.2 mm/hr) reduce el
escurrimiento y la erosión
Q Con aproximadamente un 60% menos de caudal que las boquillas
Boquillas aspersoras
aspersoras, las boquillas rotativas permiten la instalación de más
aspersores por zona, lo cual reduce la complejidad y el costo de todo el
sistema
Q Las boquillas rotativas de caudales múltiples distribuyen el agua de forma
uniforme en todo el rango de radio de 13' a 24' (4 a 7.3 m)
Durabilidad
- El collarín de goma mantiene fuera las partículas de suciedad grandes y
permite que las más pequeñas salgan fácilmente para mantener el deflector
limpio y sin suciedad.
- El tamaño del filtro de malla evita que grandes cantidades de suciedad entren
en la boquilla por el aspersor
- Garantía comercial de tres años
Rango operativo
t3BOHPEFQSFTJØOEFBQTJEFBCBSFT
t&TQBDJBNJFOUPEFBQJFTEFNBN
- Por encima del espaciamiento en base a condiciones sin viento
Características
Modelos
Una boquilla aspersora con rendimiento Rain Curtain
t)BZTFJTQBUSPOFTEJGFSFOUFTEJTQPOJCMFTFOEPTSBOHPTEFSBEJP
- Gotas de gran tamaño para un rendimiento constante.
- de 13' a 18' (de 4.0m a 5.5m)
- Riego cercano al cabezal eficaz.
- de 17' a 24' (de 5.2 m a 7.3 m)
%JTUSJCVDJØOVOJGPSNFTPCSFUPEPFMSBEJP
* Radio se refiere al espaciamiento recomendado para alcanzar el índice de precipitación óptimo y
la uniformidad de la distribución con el espaciamiento entre aspersor y aspersor
Instalación y mantenimiento
%JTF×BEBQBSBTFSVUJMJ[BEBFODVFSQPTEFBTQFSTPSFT3BJO#JSE
5BQPOFTEFSFEVDDJØOEFMSBEJPDPEJGJDBEPTQPSDPMPSQBSBGBDJMJUBSTV
identificación
5PSOJMMPEFBDFSPJOPYJEBCMFQBSBMBSFEVDDJØOEFMSBEJPRVFQFSNJUF
reducirlo a 13' (4 m) en el modelo R13-18 y a 17' (5.1 m) en el modelo
R17-24 según las diversas necesidades del terreno
Completa
Media
Tres cuartos
Un tercio
Dos tercios
Un cuarto
Soluciones de diseño
- Índices de precipitación ajustados a los radios y al patrón, que simplifican el
proceso de diseño
- El índice de precipitación se ajusta a las boquillas para rotores Serie 5000 y
5000 Plus MPR de Rain Bird, lo cual permite diseños de riego MPR de 13' a
35' (de 4 m a 10.67 m) (consulte la página 61)
- Mantiene un rendimiento altamente eficiente en todo el rango de presión
de 20 a 55 psi (1.4 a 3.8 bares), sin causar nebulización cuando la presión
es alta
- Utilizar junto con los aspersores 1800-SAM-P45 para lograr el máximo
rendimiento de la boquilla (consultar página 12 para obtener más
información)
Con boquillas aspersoras
convencionales
Con
Boquillas rotativas
Cómo especificar
R13-18Q
Rango de radio
13'-18' (de 4.0 a 5.5 m)
17'-24' (de 5.2 a 7.3 m)
Patrón
'$PNQMFUP
525SFTDVBSUPT
55%PTUFSDJPT
).FEJP
55FSDJP
2$VBSUP
t 5PUBMEFHQNMNJO
t 4FSFRVJFSFO[POBT
t 5PUBMEFHQNMNJO
t 4FSFRVJFSFO[POBT
Modelo
ajustable R-VAN
Nota: Especifique las boquillas y los cuerpos de aspersores por
separado. En suelos arenosos, se recomienda la instalación en
cuerpos de aspersores 1800®- SAM de Rain Bird.
La boquilla rotativa proporciona una distribución eficaz del agua a través de caudales rotativos que suministran el agua de manera uniforme
a un bajo índice de precipitación, lo cual reduce significativamente el escurrimiento y la erosión
42
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Serie R13-18 (Negro)
Arco
R13-18F
R13-18TQ
R13-18TT
R13-18H
R13-18T
R13-18Q
Presión
psi
20
25
30
3
335
440
45
4
550
55
5
20
2
25
2
30
3
35
3
40
4
45
4
50
5
555
20
2
225
330
35
3
440
45
4
50
5
555
20
2
225
30
3
35
3
440
445
50
5
55
5
220
25
2
30
3
335
440
45
4
550
555
220
225
30
3
335
440
45
4
50
5
555
Serie R13-18 (Negro)
Radio*
pies
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
Caudal
gpm
1.31
1.46
1.60
1.73
1.85
1.96
2.07
2.17
0.98
1.10
1.20
1.30
1.39
1.47
1.55
1.62
0.87
0.97
1.07
1.15
1.23
1.31
1.38
1.44
0.65
0.73
0.80
0.86
0.92
0.98
1.03
1.08
0.44
0.49
0.53
0.58
0.62
0.65
0.69
0.72
0.33
0.37
0.40
0.43
0.46
0.49
0.52
0.54
Q
Precip.
pulg./h
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
0.75
0.67
0.61
0.61
0.61
0.61
0.61
0.61
V
Precip.
pulg./h
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
0.86
0.77
0.70
0.70
0.70
0.70
0.70
0.70
Nota: Las boquillas rotativas fueron probadas con vástagos retráctiles de 4 pulgadas (10.2 cm).
Los datos de rendimiento se tomaron en condiciones de cero viento.
* Radio se refiere al espaciamiento recomendado para alcanzar el índice de precipitación óptimo y
la uniformidad de la distribución con el espaciamiento entre aspersor y aspersor
Q Patrón de distribución cuadrado sobre la base de un alcance del 50% de diámetro
V Patrón de distribución triangular sobre la base de un alcance del 50% de diámetro
El uso inteligente del agua.™
Arco
R13-18F
R13-18TQ
R13-18TT
R13-18H
R13-18T
R13-18Q
Presión
bares
1.4
1.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
22.1
22.4
22.8
33.1
33.4
3.8
3
11.4
11.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
2.1
2
22.4
22.8
33.1
33.4
33.8
11.4
11.7
22.1
22.4
22.8
33.1
33.4
33.8
1.4
1
1.7
1
2.1
2
22.4
22.8
33.1
33.4
33.8
SIST. MÉTRICO
Radio* Caudal
m
l/m
4.0
4.95
4.3
5.53
4.8
6.06
5.0
6.54
5.2
6.99
5.4
7.42
5.5
7.82
5.6
8.20
4.0
3.71
4.3
4.15
4.8
4.54
5.0
4.91
5.2
5.25
5.4
5.56
5.5
5.86
5.6
6.15
4.0
3.30
4.3
3.69
4.8
4.04
5.0
4.36
5.2
4.66
5.4
4.95
5.5
5.21
5.6
5.47
4.0
2.47
4.3
2.76
4.8
3.03
5.0
3.27
5.2
3.50
5.4
3.71
5.5
3.91
5.6
4.10
4.0
1.65
4.3
1.84
4.8
2.02
5.0
2.18
5.2
2.33
5.4
2.47
5.5
2.61
5.6
2.73
4.0
1.24
4.3
1.38
4.8
1.51
5.0
1.64
5.2
1.75
5.4
1.85
5.5
1.95
5.6
2.05
Q
Precip.
mm/h
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
19
18
15
15
15
15
15
15
V
Precip.
mm/h
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
22
21
18
18
18
18
18
18
No se recomiendan aplicaciones de una sola hilera
No reducir el radio a menos de 13' (4.0 m) en el modelo R13-18 y a menos de 17' (5.2 m)
en el modelo R17-24
En suelos arenosos, se recomienda la instalación en cuerpos de aspersores 1800®- SAM de Rain Bird.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El texto
completo de la Declaración de Certificación de Prueba ASABE se encuentra en la página 234.
43
Boquillas aspersoras
Boquillas rotativas
Boquillas aspersoras
Boquillas rotativas
Serie R17-24 (Amarillo)
Arco
R17-24F
Boquillas aspersoras
R17-24TQ
R17-24TT
R17-24H
R17-24T
R17-24Q
Presión
psi
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
20
25
30
35
40
45
50
55
Serie R17-24 (Amarillo)
Radio*
pies
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
17
19
21
22
23
23
24
24
Caudal
gpm
2.45
2.74
3.00
3.24
3.46
3.67
3.87
4.06
1.84
2.05
2.25
2.43
2.60
2.76
2.90
3.05
1.63
1.83
2.00
2.16
2.31
2.45
2.58
2.71
1.22
1.37
1.50
1.62
1.73
1.84
1.94
2.03
0.82
0.91
1.00
1.08
1.15
1.22
1.29
1.35
0.61
0.68
0.75
0.81
0.87
0.92
0.97
1.02
Q
Precip.
pulg./h
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
0.79
0.71
0.65
0.65
0.65
0.65
0.65
0.65
V
Precip.
pulg./h
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
0.92
0.82
0.75
0.75
0.75
0.75
0.75
0.75
Nota: Las boquillas rotativas fueron probadas con vástagos retráctiles de 4 pulgadas (10.2 cm).
Los datos de rendimiento se tomaron en condiciones de cero viento.
* Radio se refiere al espaciamiento recomendado para alcanzar el índice de precipitación óptimo y
la uniformidad de la distribución con el espaciamiento entre aspersor y aspersor
Q Patrón de distribución cuadrado sobre la base de un alcance del 50% de diámetro
V Patrón de distribución triangular sobre la base de un alcance del 50% de diámetro
44
Arco
R17-24F
R17-24TQ
R17-24TT
R17-24H
R17-24T
R17-24Q
Presión
bares
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
1.4
1.7
2.1
2.4
2.8
3.1
3.4
3.8
SIST. MÉTRICO
Radio*
m
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
5.2
5.8
6.4
6.7
6.9
7.1
7.3
7.4
Caudal
l/m
9.27
10.37
11.36
12.26
13.10
13.89
14.65
15.37
6.95
7.78
7.57
8.18
8.74
10.43
11.00
11.53
6.18
6.91
7.57
8.18
8.74
9.27
9.77
10.25
4.62
5.19
5.68
6.17
6.55
6.97
7.34
7.68
3.09
3.46
3.79
4.09
4.37
4.64
4.89
5.13
2.31
2.57
2.84
3.07
3.29
3.48
3.67
3.86
Q
Precip.
mm/h
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
20
18
16
16
16
16
16
16
V
Precip.
mm/h
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
23
21
19
19
19
19
19
19
No se recomiendan aplicaciones de una sola hilera
No reducir el radio a menos de 13' (4.0 m) en el modelo R13-18 y a menos de 17' (5.2 m)
en el modelo R17-24
En suelos arenosos, se recomienda la instalación en cuerpos de aspersores 1800®- SAM de Rain Bird.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El texto
completo de la Declaración de Certificación de Prueba ASABE se encuentra en la página 234.
El uso inteligente del agua.™
Boquillas aspersoras
www.rainbird.com/sprays
Boquillas serie R-VAN
Boquillas serie R-VAN
NUEVO
Las boquillas giratorias con arco variable le permiten ajustar
rápidamente el arco y el radio a mano
Q Arco y radio ajustables a mano: no se requiere ninguna herramienta
especial.
Q Un bajo índice de precipitación reduce los charcos y la posibilidad de
Boquillas aspersoras
erosión.
Q Una alta uniformidad, chorros gruesos resistentes al viento y gotas de agua
más grandes garantizan un rendimiento eficiente, aun en condiciones
adversas.
Características
t"SDPBKVTUBCMFEF¡B¡
t$VCSFQFSÓPEPTEFSJFHPFYJHFOUFTMPTØQUJNPTÓOEJDFTEFQSFDJQJUBDJØO
de la R-VAN logran el equilibrio perfecto entre el índice de aplicación y de
penetración
t&TUÈODPEJGJDBEBTQPSDPMPSQBSBJEFOUJGJDBSFMNPEFMP37"/GÈDJMNFOUF
t4PODPNQBUJCMFTDPOUPEPTMPTNPEFMPTEFDVFSQPTEFBTQFSTPSFTEF
Rain Bird y con una gran variedad de tuberías de elevación y adaptadores.
t$VBOEPTFJOTUBMBOKVOUPDPOSPUPSFTEFMBTFSJFRVFJODMVZFOCPRVJMMBT
de precipitación igualada, permiten crear diseños de riego MPR desde 13’a
35’ (de 4.0 m a 10.7 m).
Boquilla serie R-VAN
t(BSBOUÓBDPNFSDJBMEFUSFTB×PT
Rango operativo
t3BOHPEFQSFTJØOEFBQTJEFBCBSFT
t3BOHPEFQSFTJØOPQFSBUJWBSFDPNFOEBEBQTJCBSFT
t&TQBDJBNJFOUPEFBEFBN
t"KVTUFTFMBSDPZFMSBEJPTFEFCFOBKVTUBSNJFOUSBTDPSSFFMBHVB
Modelos
tR-VAN1318
%FGMFDUPSSPUBUJWPOFHSP
- Radio de 13’ a 18’ (de 4.0 a 5.5 m)
- Arco de 45º a 270º
tR-VAN1724
%FGMFDUPSSPUBUJWPBNBSJMMP
- Radio de 17’ a 24’ (de 5.2 a 7.3 m)
- Arco de 45º a 270º
Ajuste de Arco
Ajuste de Radio
Notas:
t
t
t
t
/PTFSFDPNJFOEBOBQMJDBDJPOFTEFVOBTPMBIJMFSB
/PTFSFDPNJFOEBRVFFMSBEJPPQFSFQPSEFCBKPEFMSBEJPNÓOJNPQPSNPEFMP
&OTVFMPTBSFOPTPTTFSFDPNJFOEBMBJOTUBMBDJØOEFDVFSQPTEFBTQFSTPSFT4".1EF3BJO#JSE
%BUPTEFSFOEJNJFOUPEFSJWBEPTEFQSVFCBTRVFDVNQMFODPOMBTOPSNBT"4"#&"4"#&4&MUFYUP
completo de la Declaración de Certificación de Prueba ASABE se encuentra en la sección "Boquillas
rotativas" de la página 234.
Cómo especificar
R-VAN 1318
Rango de radio
1318: de 13' a 18' (de 4.0 a 5.5 m)
1724: de 17' a 24' (de 5.2 a 7.3 m)
Modelo
Boquilla rotativa ajustable R-VAN
El uso inteligente del agua.™
45
Boquillas aspersoras
Boquillas serie R-VAN
R-VAN 1318 (Negro)
R-VAN 1318 (Negro)
Boquilla
Arco 270°
270
Boquillas aspersoras
Arco 180°
Arco 90°
Presión
psi
220
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555
Radio
pies
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
13
14
16
16
17
18
18
18
Caudal
gpm
0.95
1.12
1.26
1.35
1.42
1.51
1.57
1.62
0.75
0.83
0.85
0.91
0.98
1.01
1.07
1.09
0.37
0.39
0.42
0.47
0.50
0.50
0.54
0.58
Q
Precip.
pulg./h
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60
0.72
0.69
0.65
0.64
0.63
0.60
0.60
0.60
V
Precip.
pulg./h
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69
0.83
0.80
0.75
0.74
0.73
0.69
0.69
0.69
Arco 270°
Arco 180°
Arco 90°
Presión
psi
20
225
330
335
440
445
550
555
220
225
330
335
440
445
550
555
220
225
330
335
440
445
50
55
Arco 270
270°
Arco 180°
Arco 90°
Presión
bares
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3
1.4
1
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3.4
3
3.8
3
Radio
m
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5
4.0
4.3
4.9
4.9
5.2
5.5
5.5
5.5
Caudal
l/m
3.60
4.24
4.77
5.11
5.38
5.72
5.94
6.13
2.84
3.14
3.22
3.44
3.71
3.82
4.05
4.13
1.40
1.48
1.59
1.78
1.89
1.89
2.04
2.20
R-VAN 1724 (Amarillo)
R-VAN 1724 (Amarillo)
Boquilla
Boquilla
SIST. MÉTRICO
Radio
pies
17
19
21
22
23
24
24
24
17
19
21
22
23
24
24
24
17
19
21
22
23
24
24
24
Caudal
gpm
1.77
1.99
2.26
2.39
2.55
2.73
2.76
2.80
1.24
1.30
1.41
1.55
1.69
1.83
1.91
1.98
0.59
0.67
0.73
0.78
0.85
0.91
0.98
1.05
Q
Precip.
pulg./h
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61
0.76
0.72
0.70
0.66
0.63
0.61
0.61
0.61
V
Precip.
pulg./h
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70
0.88
0.83
0.81
0.76
0.73
0.70
0.70
0.70
Nota: "Radio" se refiere al espaciamiento recomendado para alcanzar el índice de precipitación
óptimo y uniformidad en la distribución con el espaciamiento entre aspersores.
Boquilla
Arco 270°
Arco 180°
Arco 90°
Presión
bares
1.4
1.7
1
2.1
2
2.4
2
2.8
2
3.1
3
3
3.4
3
3.8
1.4
1
1
1.7
2
2.1
2.4
2
2
2.8
3
3.1
3.4
3
3
3.8
1
1.4
1.7
1
2
2.1
2.4
2
2.8
2
3.1
3
3.4
3.8
Q
Precip.
mm/h
18
18
17
16
16
15
15
15
18
18
17
16
16
15
15
15
18
18
17
16
16
15
15
15
V
Precip.
mm/h
21
20
19
19
18
18
18
18
21
20
19
19
18
18
18
18
21
20
19
19
18
18
18
18
SIST. MÉTRICO
Radio
m
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3
5.2
5.8
6.4
6.7
7.0
7.3
7.3
7.3
Caudal
l/m
6.70
7.53
8.56
9.05
9.65
10.33
10.45
10.60
4.69
4.92
5.34
5.87
6.40
6.93
7.23
7.50
2.23
2.54
2.76
2.95
3.22
3.44
3.71
3.97
Q
Precip.
mm/h
19
18
18
17
16
15
15
15
19
18
18
17
16
15
15
15
19
18
18
17
16
15
15
15
V
Precip.
mm/h
22
21
21
19
18
18
18
18
22
21
21
19
18
18
18
18
22
21
21
19
18
18
18
18
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
V Patrón de distribución triangular basado en un alcance del 50% del diámetro.
Los datos de rendimiento se tomaron en condiciones de cero viento.
46
El uso inteligente del agua.™
Boquillas aspersoras
1300A-F
Serie 1400
Burbujeador ajustable de círculo completo
Burbujeadores de círculo completo con compensación de presión
Características
Características
t$BVEBMUPUBMNFOUFBKVTUBCMF
t-PTÓOEJDFTEFDBVEBMCBKPTQFSNJUFORVFFMBHVBTFBCTPSCBTFHÞOTFB
necesario. Reducen la erosión
t4FFOWÓBDPONBMMBEFGJMUSPEFFOUSBEB431⁄2" (1.3 cm) (15/21) para
proporcionar una fácil instalación y resistencia a las partículas de suciedad
t'VODJPOBDPOVOBNQMJPSBOHPEFQSFTJPOFT
t.BOUJFOFVODBVEBMDPOTJTUFOUFBQSFTJPOFTFOUSFZQTJ
(de 1.4 a 6.2 bares).
t&TUSVDUVSBOPDPSSPTJWBEFQMÈTUJDPZBDFSPJOPYJEBCMFTEFMBSHBWJEBÞUJM
t&MDBVEBMOPTFQVFEFBKVTUBSQBSBMPHSBSVOBNBZPSSFTJTUFODJBBMWBOEBMJTNP
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
t/PFTOFDFTBSJPBKVTUBSMP
Rango operativo
t&TUSVDUVSBEFQMÈTUJDPZHPNBSFTJTUFOUFBMBDPSSPTJØOQBSBMPHSBSVOBMBSHB
vida útil
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
t$BVEBMEFBHQNEFBMN
t4FFOWÓBDPONBMMBEFGJMUSP431⁄2" (1.3 cm) (15/21) para proporcionar una
fácil instalación y resistencia a las partículas de suciedad
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t1BUSØOEFHPUFPFOMPTNPEFMPTZQBUSØOEFDPOPFOMPTNPEFMPT
1404 y 1408
Dimensiones
t&OUSBEBIFNCSBSPTDBEBEFc
Rango operativo
t"MUVSBDN
t$BVEBMEFBHQNEFBMN
t%JÈNFUSPTVQFSJPSDN
t&TQBDJBNJFOUPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
Modelo
t"'
Dimensiones
t&OUSBEB1⁄2" entrada hembra roscada (15/21)
t"MUVSBDN
t%JÈNFUSPTVQFSJPSDN
1300A-F
1300A-F
Boquilla Presión Caudal
psi
gpm
F
10
1.0
Boquilla Presión
bares
F
0.7
20
30
40
50
60
1.4
1.7
1.9
2.1
2.3
1.0
1.5
2.0
2.5
3.0
3.5
4.0
4.1
SIST. MÉTRICO
Radio
m3⁄h
0.23
0.26
0.30
0.34
0.39
0.43
0.48
0.52
0.53
Caudal
l/m
3.6
4.2
4.8
5.4
6.0
7.2
7.8
8.4
8.4
Modelos
tHQNN3⁄h; 0.9 l/m); círculo completo, patrón de goteo
tHQNN3⁄h; 1.8 l/m); círculo completo, patrón de goteo
tHQNN3⁄h; 3.6 l/m); círculo completo, patrón de cono
tHQNN3⁄h; 7.2 l/m); círculo completo, patrón de cono
Serie 1400
1300A-F
El uso inteligente del agua.™
47
Boquillas aspersoras
www.rainbird.com/sprays
Burbujeadores
Rotores
Introducción
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
"Una vez que mis clientes verdaderamente
notan la diferencia que hacen las boquillas
Rain Curtain, solo se conformarán con
los rotores Rain Bird. Realmente me han
ayudado a desarrollar mi empresa".
Válvulas
Dennis Hoffman
Grasshopper Irrigation, Inc.
Productos principales
Rotor de
cubierta cerrada
Rotores de cubierta cerrada
Accesorios
Aplicaciones primarias
Césped de 15' a 30' (4.6 m a 9.14 m)
Programadores
Césped de 25' a 50' (7.6 a 15.2 m)
Césped de más de 50' (15.2 m)
Uso residencial
Sistemas de control
centralizado
Uso comercial
Áreas propensas a vandalismo/daños
Pendientes
Cubierta vegetal/Arbustos
Xerigation®
Campos deportivos
Regulador de presión
5000
Serie
5505
Serie
8005
Serie
Falcon™ 6504
Serie
2045A Maxi-Paw™
Serie
t
t
tt
tt
tt
tt
t
tt
t
tt
tt
tt
t
t
tt
t
tt
tt
t
tt
tt
tt
t
t
tt
t
t
tt
t
t
t
Áreas de viento excesivo
Césped más alto
Agua no potable
Bombas
3504
Serie
t
t
Sugerencias para ahorrar agua
Drenaje
t La tecnología de las boquillas
Recursos
Rain Curtain™ es la opción
estándar en cuanto al
rendimiento de las boquillas para
el ahorro de agua. El rendimiento
de Rain Curtain™ está disponible
en todos los rotores Rain Bird.
t Los rotores Serie 5000 con PRS
reducirán el desperdicio de agua de un
15% a un 45%. Al eliminar la variación
de presión o el exceso de presurización,
ahorrará agua y obtendrá un césped
más verde.
t 5PEPTMPTSPUPSFTDPOWÈMWVMBTEF
retención Seal-a-Matic™ (SAM) evitan
el drenaje de los aspersores que están
en los niveles más bajos, detienen el
desperdicio de agua y eliminan el
daño del terreno causado por las
inundaciones o la erosión.
Referencia
48
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Información general
Una familia completa que facilita su trabajo.
La tapa violeta indica
el uso de agua no potable
Ranuras para ajustar el
arco de riego izquierdo o
derecho
Torreta reforzada con
bronce
Vástago retráctil de acero
inoxidable para una mayor
Ranura para ajustar el
arco de riego a círculo
completo/parcial
Rotores
Tapa color café Versión
de alta velocidad para la
eliminación de polvo
Ranura Side Pry™
protección contra el vandalismo
Dispositivo deinterrupción
de caudal con tapa verde
Ranura de ajuste del arco
Ranura de ajuste del radio
Indicador PRS/SAM para
identificar rápidamente
Portaboquilla de
radio corto
serie 5500
Boquillas Rain
Curtain™ serie
5500
Boquillas Rain
Curtain™ series
6504 y 8005
Portaboquilla serie 3500 que
incluye seis boquillas Rain Curtain
Portaboquilla serie 5000 que
incluye cuatro boquillas Rain Curtain de
ángulo bajo y ocho boquillas de ángulo
estándar
El uso inteligente del agua.™
ROTORTOOL Dos
heramientas en una sola unidad,
destornillador plano y gancho
para el vástago a la vez
Juntas articuladas de las series
TSJ y TSJ-PRS que conectan rotores
o válvulas de acoplamiento rápido a las
tuberías laterales
49
Radio del rotor del cuadro de alcance y
Rotores
Información general
regulación de presión
Ya sea que se utilicen para
aplicaciones residenciales
o comerciales, los rotores
Rain Bird lo cubren todo.
3500
de 15' a 35'
(de 4.6 m a 10.7 m)
Serie 3500
Rotores
Los rotores de Rain Bird
establecen la pauta de durabilidad
e incluyen características que
garantizan un rendimiento
confiable. Existe un rotor de
Rain Bird para cada aplicación:
para baja presión y pendientes
pronunciadas, en áreas de
viento excesivo, con agua no
potable e incluso en áreas
donde el vandalismo podría
ser un problema. Opte por los
rotores de Rain Bird para lograr el
propósito que desee y obtenga
los resultados esperados.
Serie 5000
de 0.37 a 0.83 pulg./h
(de 9 a 22 mm/h)
de 0.20 a 1.01 pulg./h
(de 5 a 26 mm/h)
de 25 a 55 psi
(de 1.7 a 3.8 bares)
de 25 a 65 psi
(de 1.7 a 4.5 bares)
de 0.54 a 4.6 gpm
(de 1.8 a 17.4 l/m)
(de 0.12 a 1.04 m3/h)
de 0.73 a 9.63 gpm
(de 4.2 a 36.6 l/m)
(de 0.17 a 2.19 m3/h)
4" (10.2 cm)
Adaptador para
arbustos: 4" (10.2 cm)
6" (15.2 cm)
12" (30.5 cm)
Adaptador para
arbustos: 7 3/4"
(19.7cm)
4": 7 3/8" (18.5 cm)
6": 9 5/8" (24.5 cm)
12": 16 7/8" (42.9 cm)
Arbusto: 7" (17.8 cm)
4": 6.6" (16.8 cm)
›w/15
ŊŜ
/15
Características estándar
Características estándar
t El portaboquilla incorporado de seis
boquillas Rain Curtain™ ofrece un
rendimiento superior.
t Embrague deslizante para encontrar el borde
izquierdo.
t Para ajustar el arco por la parte superior
del aspersor solo se requiere un
destornillador plano
t Boquillas Rain Curtain.
t 5PSOJMMPEFBKVTUFEFMSBEJPRVFQFSNJUF
una reducción del radio de hasta un 25%
sin cambiar de boquillas.
t 'VODJØOEFWFSJöDBDJØOSÈQJEBEFMBSDP
BWBODFSÈQJEP2VJDLDIFDLBSDGBTU
forward)
t 'JMUSPEFNBMMBGÈDJMEFRVJUBS
t +VOUBMJNQJBEPSBNVMUJGVODJØOEFEPCMF
acción protege el mecanismo interno
de la suciedad y garantiza una buena
elevación y retracción del vástago
t Garantía comercial de tres años.
t Boquillas de ángulo estándar y ángulo bajo
(incluidas).
t Garantía de cinco años.
Opciones
t Dispositivo de interrupción de caudal Plus
(PL). "El de la tapa verde". Reduce el tiempo
de inactividad en las tareas limpiando y
pulverizando los rotores sin tener que caminar
hasta los controladores o las válvulas.
t PRS (R) DPOUFDOPMPHÓB'MPX0QUJNJ[FS&M
regulador de presión de 45 psi reduce el costo
de las facturas de agua, proporciona el caudal
exacto para cada rotor, equilibra las líneas
laterales y elimina la nebulización y la neblina.
Opciones
t Válvula de retención Seal-A-Matic.
t Válvulas de retención SAM Seal-A-Matic™
que previenen la erosión y el drenaje de
los aspersores bajos.
t Vástago retráctil de acero inoxidable SS
que ayuda a impedir el vandalismo en áreas
públicas con césped (disponible en los
modelos de 4 y 6 pulgadas).
t Tapa violeta (NP) que facilita la
identificación de los sistemas para agua
no potable.
50
t Puerto autolimpiante.
t Tapa violeta (NP) para sistemas de agua no
potable.
El uso inteligente del agua.™
Tecnología de boquillas Rain Curtain™
Rotores
Información general
www.rainbird.com/rotors
5000
5505
6504
8005
de 25' a 50'
(de 6.1 m a 15.2 m)
de 17' a 55'
(de 5.2 m a 16.8 m)
de 39' a 65'
(de 11.9 m a 19.8 m)
de 39' a 81'
(de 11.9 m a 24.7 m)
Falcon® 6504
Serie
de 0.21 a 1.48 pulg./h
(de 6.3 a 33.8 mm/h)
Serie 8005
de 0.48 a 1.23 pulg./h
(de 12 a 31 mm/h)
de 0.37 a 1.14 pulg./h
(de 9 a 29 mm/h)
de 40 a 90 psi
(de 2.8 a 6.2 bares)
de 50 a 100 psi
(de 3.5 a 6.9 bares)
de 30 a 90 psi
(de 2.1 a 6.2 bares)
de 1.2 a 15.5 gpm
(de 4.5 a 58.9 l/m)
(de 0.32 a 3.52 m3/h)
de 3.8 a 36.3 gpm
(de 14.4 a 137.4 l/m)
(de 0.86 a 8.24 m3/h)
de 2.9 a 21.7 gpm
(de 10.8 a 82.2 l/m)
(de 0.66 a 4.93 m3/h)
5" (12.7 cm)
5" (12.7 cm)
4" (10.2 cm)
žDN
101⁄8" (25.7 cm)
›DN
ŊŜ
/15
/15P#41EF
(2.5 cm) (26/34)
/15P#41EF
(2.5 cm) (26/34)
Características estándar
Características estándar
Características estándar
t Resistente al vandalismo
t Vástago de trinquete igual que los cuerpos
de aspersores estándar.
t Resistente al vandalismo
t 5PSSFUBSFGPS[BEBDPOCSPODFQBSB
aumentar la durabilidad ante los golpes
laterales.
t 5SBOTNJTJØOBOUJEFTHBTUFOPFYUSBÓCMF
t Memoria de arco
t Boquillas Rain Curtain de tres puertos,
codificadas por color para un riego óptimo
de largo y mediano alcance y cercano al
cabezal.
t Círculo completo y parcial en un solo
cabezal.
t 'ÈDJMBKVTUFEFMBSDPNPEFMPEFDÓSDVMP
parcial) desde la parte superior del rotor de
¡B¡
t Ajuste independiente de los arcos de
cobertura derecho e izquierdo.
t Válvula de retención Seal-A-Matic.
t Válvula de retención Seal-A-Matic.
t Boquillas Rain Curtain.
t Estátor autoajustable que no requiere
reemplazo al cambiar las boquillas
t Garantía de cinco años.
t Resorte retráctil de acero inoxidable y
gran resistencia que garantiza una buena
retracción
Opciones
t Garantía de cinco años.
t Vástago retráctil de acero inoxidable SS
que ayuda a impedir el vandalismo en
áreas públicas con césped.
Opciones
t Tapa violeta (NP) para sistemas de agua
no potable.
t Vástago retráctil de acero inoxidable SS que
ayuda a impedir el vandalismo en áreas
públicas con césped.
t Tapa violeta (NP) para sistemas de agua no
potable.
t Versión de alta velocidad (HS) con tapa
color café para la eliminación de polvo.
t 5PSSFUBSFGPS[BEBDPOCSPODFQBSB
aumentar la durabilidad ante los golpes
laterales.
t 5SBOTNJTJØOBOUJEFTHBTUFOPFYUSBÓCMF
t Memoria de arco
t Círculo completo y parcial en un solo
cabezal.
t Ajuste independiente de cobertura
izquierda y derecha.
t Válvula de retención Seal-A-Matic.
t Boquillas Rain Curtain de tres puertos,
codificadas por color para un riego óptimo
de largo y mediano alcance y cercano al
cabezal.
t Garantía de cinco años.
Opciones
t Vástago retráctil de acero inoxidable SS
que ayuda a impedir el vandalismo en
áreas públicas con césped.
t Tapa violeta (NP) para sistemas de agua
no potable.
Consulte la página 75 de referencia para intercambiar boquillas correctamente al reemplazar rotores de la competencia por los rotores de Rain Bird.
El uso inteligente del agua.™
51
Rotores
Serie 5505
Rotores
Serie 3504
Serie 3504
Opciones
'ÈDJMEFVTBSEJGÓDJMEFTVQFSBS
t5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJØOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF
t7ÈMWVMBEFSFUFODJØO4FBM".BUJD™ (SAM™) que
retiene hasta 7 pies (2.1 m) de cambio de elevación,
para evitar el encharcamiento y la erosión provocados por el drenaje de los
aspersores bajos
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
rendimiento superior
Q Vástago retráctil de altura real de 4" (10.2 cm), medido desde la tapa hasta
la boquilla
Q Confiabilidad: garantía comercial de tres años
Características
Rotores
t5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™
- El accesorio portaboquilla de seis boquillas Rain Curtain™ ofrece:
t (PUBTEFHSBOUBNB×PQBSBVOSFOEJNJFOUPDPOTUBOUF
t 3JFHPDFSDBOPBMDBCF[BMFGJDB[
t %JTUSJCVDJØOVOJGPSNFTPCSFUPEPFMSBEJP
t*OTUBMBDJØOZNBOUFOJNJFOUP
- Para ajustar el arco por la parte superior del aspersor solo se requiere un
destornillador plano
5PSOJMMPEFBKVTUFEFMSBEJPRVFQFSNJUFVOBSFEVDDJØOEFMSBEJPEF
hasta un 25% sin cambiar de boquillas
'VODJØOEFWFSJGJDBDJØOSÈQJEBEFMBSDPBWBODFSÈQJEP2VJDLDIFDLBSDGBTU
forward)
- Estator autoajustable que no requiere reemplazo al
cambiar las boquillas
- Malla de filtro fácil de quitar
'VODJØOEFFYUSBDDJØOEFMBCPRVJMMB
t4PMVDJPOFTEFEJTF×P
- El rotor Serie 3504 se encuentra disponible en los modelos con
adaptador para arbustos, de 4” (10.2 cm) y SAM™.
- La tapa de goma y el tornillo de ajuste del arco de limpieza automática
reduce la intrusión de suciedad y mejora la confiabilidad
3PUBDJØOEFMBSDPEFDÓSDVMPQBSDJBMEF¡B¡ZSPUBDJØOJOWFSTB
de círculo completo en la misma unidad
t%VSBCJMJEBE
%JTF×PEFFOHSBOBKFEFUSBOTNJTJØOMVCSJDBEPDPOBHVBQBSBVO
funcionamiento duradero y confiable
+VOUBMJNQJBEPSBNVMUJGVODJØOEFFTUBORVFJEBEEFEPCMFBDDJØORVF
protege el mecanismo interno de la suciedad y garantiza una buena
elevación y retracción del vástago
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
t3BEJPEFBQJFTEFBDN
t&MSBEJPQVFEFSFEVDJSTFIBTUBVODPOFMUPSOJMMPEFSFEVDDJØOEFMSBEJP
t1SFTJØOEFBQTJEFBCBSFT
t¶OEJDFEFGMVKPEFBHQNEFBMN
Especificaciones
t&OUSBEBIFNCSBSPTDBEBJOGFSJPS/15EF1/2” (1.3 cm)
t"KVTUFEFDÓSDVMPDPNQMFUPZEFDÓSDVMPQBSDJBMEF¡B¡
Dimensiones
t"MUVSBEFMWÈTUBHPSFUSÈDUJMDN
t"MUVSBUPUBMEFMDVFSQP"SCVTUPDN
DN
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBDN
Nota: la altura del vástago retráctil se mide desde la tapa hasta la boquilla. La altura total
del cuerpo no se mide con el vástago elevado
Modelos
Las unidades de círculo parcial (PC) son ajustables desde 40 a 360 grados.
t1$
t1$4".
t1$4"./1
t44".
Cómo especificar
3504 - S - PC - SAM - NP
Opciones
44".
/15BQBQBSBBHVB
no potable
Rotación
Círculo parcial
Modelo
Adaptador para arbustos
Modelo
Modelo Vástago retráctil de 4" (10.2 cm) Serie 3500
3504-PC
Como todos lo rotores Rain Bird, los rotores Serie 3500 utilizan la tecnología de boquillas Rain Curtain™ para brindar los resultados esperados,
al mismo tiempo que administran inteligentemente el agua.
52
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Serie 3504
Presión
psi
Boquilla
25
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
35
45
55
Radio
pies
15
20
23
27
29
31
17
21
23
27
31
33
17
21
24
27
31
35
18
22
24
28
32
35
Caudal
gpm
0.54
0.77
1.06
1.40
2.17
2.97
0.67
0.92
1.28
1.69
2.60
3.58
0.77
1.06
1.48
1.93
3.00
4.13
0.85
1.18
1.65
2.15
3.25
4.60
Q
Precip.
pulg./h
0.46
0.37
0.39
0.37
0.50
0.59
0.45
0.40
0.47
0.45
0.52
0.63
0.51
0.46
0.49
0.51
0.60
0.65
0.51
0.47
0.55
0.53
0.61
0.72
V
Precip.
pulg./h
0.53
0.43
0.45
0.43
0.57
0.69
0.52
0.46
0.54
0.52
0.60
0.73
0.59
0.53
0.57
0.59
0.69
0.75
0.58
0.54
0.64
0.61
0.71
0.83
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Presión
bares
1.7
2.0
2.5
3.0
3.5
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se encuentra
en la página 234.
El uso inteligente del agua.™
3.8
Boquilla
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
0.75
1.0
1.5
2.0
3.0
4.0
Radio
m
4.6
6.1
7.0
8.2
8.8
9.4
4.8
6.2
7.0
8.2
9.1
9.7
5.2
6.4
7.0
8.2
9.4
10.1
5.2
6.4
7.3
8.2
9.4
10.6
5.4
6.6
7.3
8.4
9.6
10.7
5.5
6.7
7.3
8.5
9.8
10.7
Caudal
m3⁄h
0.12
0.17
0.24
0.32
0.49
0.67
0.13
0.19
0.26
0.34
0.53
0.73
0.16
0.21
0.30
0.39
0.60
0.83
0.17
0.24
0.33
0.43
0.67
0.92
0.19
0.26
0.36
0.47
0.71
1.00
0.19
0.27
0.37
0.49
0.74
1.04
Caudal
l/m
2.04
2.91
4.01
5.30
8.21
11.24
2.24
3.14
4.35
5.74
8.87
12.17
2.58
3.55
4.94
6.51
10.03
13.82
2.86
3.93
5.49
7.17
11.13
15.32
3.09
4.27
5.97
7.79
11.90
16.66
3.22
4.47
6.25
8.14
12.30
17.41
Q
Precip.
mm/h
12
9
10
9
13
15
12
10
11
10
13
16
12
10
12
12
13
16
13
12
12
13
15
16
13
12
13
13
15
18
13
12
14
13
16
18
V
Precip.
mm/h
14
11
11
11
15
17
13
11
12
12
15
18
13
12
14
13
16
19
15
13
14
15
17
19
15
14
15
15
18
20
15
14
16
15
18
21
53
Rotores
Rendimiento de las boquillas de la serie 3504 SIST. MÉTRICO
Rendimiento de las boquillas de la serie 3504
Rotores
Serie 5000
Serie 5000
Rendimiento inigualable para aplicaciones residenciales y
comerciales pequeñas
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
rendimiento superior
Q Mucho más ahorro de agua con regulación de presión en el vástago
opcional (PRS)
Q Instalación más rápida con índice de precipitación ajustado al utilizar el
conjunto de boquillas MPR (ver página 61)
Características
Rotores
t5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™
- Boquillas Rain Curtain™ estándar en todos los rotores Serie 5000
t (PUBTEFHSBOUBNB×PQBSBVOBNBZPSSFTJTUFODJBBMWJFOUP
t 3JFHPDFSDBOPBMDBCF[BMFGJDB[
t %JTUSJCVDJØOVOJGPSNFTPCSFUPEPFMSBEJP
- Portaboquilla que incluye cuatro boquillas de ángulo bajo (ángulo de
trayectoria de 10º) y ocho boquillas de ángulo estándar Rain Curtain™
(ángulo de trayectoria de 25º) que proporciona una distancia de alcance de
25 a 50 pies (7.6 a 15.2 m)
- Boquillas autoalineantes
t*OTUBMBDJØOZNBOUFOJNJFOUP
- Mecanismo de embrague de deslizamiento para un rápido ajuste durante
la instalación
- Mantenimiento más rápido con un nuevo tornillo de ajuste del arco de
limpieza automática
- La serie 5000 Plus cuenta con un interruptor de flujo para detener el flujo
de agua de un aspersor en particular mientras el sistema todavía está
funcionando.
- Para ajustar el arco por la parte superior del aspersor solo se requiere un
destornillador plano
5PSOJMMPEFBKVTUFEFMSBEJPRVFQFSNJUFVOBSFEVDDJØOEFMSBEJPEFIBTUB
un 25% sin cambiar de boquillas.
t4PMVDJPOFTEFEJTF×P
- Serie 5000 en 4", 6" y 12" (10.2 cm, 15.2 cm y 30.5 cm) disponible con
adaptador para arbustos o en acero inoxidable
- Modelos de la serie 5000 de 4 y 6 pulgadas disponibles en
acero inoxidable
- Conjunto galardonado de boquillas MPR que simplifica el diseño y la
instalación al proporcionar índices de precipitación ajustados de 25' a 35'
(de 7.6 a 10.7 m)
5BQBEFHPNBFTUÈOEBSQBSBNBZPSQSPUFDDJØO-BTFSJFDVFOUBDPO
una tapa verde mientras que la serie 5000 posee una tapa negra
3PUBDJØOEFMBSDPEFDÓSDVMPQBSDJBMEF¡B¡ZSPUBDJØOJOWFSTBEF
DÓSDVMPDPNQMFUPFOMBNJTNBVOJEBE5BNCJÏOFTUÈEJTQPOJCMFMBVOJEBE
únicamente con círculo completo no reversible)
- Vástago retráctil de 4” (10.2 cm), 6” (15.2 cm) y 12” (30.5 cm) reales, medidos
desde la tapa hasta la boquilla
t%VSBCJMJEBE
- Ensamble de tapa de goma de gran resistencia para mayor durabilidad en
aplicaciones residenciales o comerciales
- Resorte retráctil de gran resistencia que garantiza una buena retracción
- Sello limpiador de múltiples funciones activado a presión, que protege
el mecanismo interno de la suciedad y garantiza una buena elevación y
retracción del vástago.
- Empaques y sellos adicionales para brindar mayor protección en el agua
"arenosa"
- Garantía comercial de cinco años.
t0QDJPOFT
5VCFSÓBEFFMFWBDJØOEFBDFSPJOPYJEBCMFRVFBZVEBBJNQFEJSFMWBOEBMJTNP
en áreas públicas con césped de (únicamente en 4" y 6" [10.2 cm y 15.2 cm]).
- Boquilla Rain Curtain preinstalada en las combinaciones más populares de la
Serie 5000 y de boquillas
- Válvula de retención Seal-A-Matic (SAM)™, que retiene hasta 7 pies (2.1 m) de
cambio de elevación, para evitar el encharcamiento y
la erosión provocados por el drenaje de los aspersores bajos
5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJØOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF
12"
6"
4"
Adaptador
para
arbustos
Se incluyen boquillas de ángulo bajo
de 10° y boquillas estándar de 25°
Todas las boquillas están
numeradas en galones
por minuto
Vista frontal
{%FTFBMPHSBSMBDPNCJOBDJØOEFSJFHPNÈTFGJDJFOUF 4FMFDDJPOFMPTSPUPSFT4FSJFDPOCPRVJMMBT4".134Z.13:BTFBRVFDPOGÓFFOMBTCPRVJMMBT
Rain Curtain para obtener un riego eficiente o en las boquillas MPR para garantizar índices de precipitación ajustados, los rotores de la serie 5000 brindan
soluciones que administran el agua de manera inteligente.
54
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Serie 5000
La confiabilidad y el rendimiento de la serie 5000 también son disponibles con estas excelentes características.
Plus (PL)
PRS (R)
SAM
APAGADOR DE FLUJO
REGULACIÓN DE PRESIÓN
VÁLVULA DE RETENCIÓN
Encendido
Sin PRS
Sin SAM
Apagado
Con PRS
Con SAM
& "" %$
!!
& ""%"
!"#'#"
!
& "!" "
! % " %
PRS con tecnología Flow Optimizer™
& #"$ !"
%"$! ) & "#
$a
& "" !")"
!'
Rotores
Con tapa verde
& # " " % ' $ " !"!"
!" !"( ! ""' "#.
Cómo especificar
Modelo
Características estándar
Características opcionales
Opciones de boquilla
Arbustos 5000
Identificador del borde izquierdo
con embrague deslizante.
8 boquillas estándar de 25 grados
4 boquillas de ángulo bajo de 10 grados
Orificio de la boquilla con muesca
Círculo parcial (PC)
$ÓSDVMPDPNQMFUP'$
PL
R
%
NP
SS
Boquilla
1.5
2.0
3.0
4.0
5004
5006
5012
Cierre por flujo "Plus"
Regulación de presión PRS
Válvula de retención SAM
No potable
Elevador de acero inoxidable
Los rotores con boquilla preinstalada
solo están disponibles en determinados
modelos.
Ejemplos
5000PCS
Arbusto, círculo parcial con válvula de retención
5004PC2.0
Vástago retráctil de 4", círculo parcial, con boquilla 2.0
5006PCPLRS
Vástago retráctil de 6", círculo parcial, con interruptor de caudal, regulación de presión y válvula de retención
El uso inteligente del agua.™
55
Rotores
Serie 5000
Serie 5000 (cont.)
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
t3BEJPEFBQJFTEFBDN
t&MSBEJPQVFEFSFEVDJSTFIBTUBVODPOFMUPSOJMMPEFSFEVDDJØOEFMSBEJP
t1SFTJØOEFBQTJEFBCBSFT
t5BTBEFDBVEBMEFBHQNEFBMN
Rendimiento de las boquillas Rain Curtain™
de ángulo estándar con PRS de la serie 5000
Presión
psi
Boquilla
25
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
Especificaciones
t&OUSBEBIFNCSBSPTDBEBJOGFSJPS/153⁄4" (20/27)
t"KVTUFJOWFSTPEFDÓSDVMPDPNQMFUPZEFDÓSDVMPQBSDJBMEF¡B¡
t"KVTUFEFDÓSDVMPDPNQMFUPEF¡ÞOJDBNFOUF
Rotores
Dimensiones
35
t"MUVSBEFMWÈTUBHPSFUSÈDUJM"EBQUBEPSQBSBBSCVTUPTDN
cm); 12" (30.5 cm)
t"MUVSBUPUBMEFMDVFSQP"EBQUBEPSQBSBBSCVTUPT3⁄4" (19.7cm) 4": 7 3⁄8" (18.5
cm); 6": 9 5⁄8" (24.5 cm); 12": 16 7⁄8" (42.9 cm)
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUB5⁄8" (4.1 cm)
Nota:la altura del vástago retráctil se mide desde la tapa hasta la boquilla. La altura total
del cuerpo no se mide con el vástago elevado.
Característica opcional de PRS
t&MSFHVMBEPSEFQSFTJØOFOFMWÈTUBHP134
SFEVDF
¡EXCLUSIVO!
la presión operativa a 45 psi (3.1 bares) para
IN 5000 PLUS
lograr un rendimiento óptimo de la boquilla
t&M134BIPSSBBHVB
- Porque elimina las variaciones de presión del
espaciamiento entre aspersor y aspersor.
- Porque elimina la nebulización causada por la alta presión.
- Mejorando la uniformidad de la distribución de la boquilla al hacerla
funcionar a una presión óptima
t1SFTJØOEFBQTJEFBCBSFT
45
55
Modelos
Las unidades de círculo parcial (PC) son ajustables desde 40 a 360 grados.
-BTVOJEBEFTEFDÓSDVMPDPNQMFUP'$
TPOEFHSBEPTÞOJDBNFOUF
t1$P'$
4".
3
t1$P'$
t1$P'$
t41-1$P'$
4".
3
/1
FTUÈOEBSDPO4".
t1-1$P'$
4".
3
/1
44
t1-1$P'$
4".
3
/1
44
t1-1$P'$
4".
3
/1
Nota: Varios modelos están disponibles con una boquilla 2.0 o 3.0 preinstalada.
Las versiones NP y SS son estándar e incluyen un SAM. R = PRS
65
Radio
pies
33
35
35
36
37
39
39
36
34
36
37
38
40
41
43
43
35
37
37
40
42
45
46
47
35
37
37
40
42
45
47
50
34
35
37
40
42
45
48
50
Caudal
gpm
1.12
1.50
1.81
2.26
2.91
3.72
4.25
5.90
1.35
1.81
2.17
2.71
3.50
4.47
5.23
7.06
1.54
2.07
2.51
3.09
4.01
5.09
6.01
8.03
1.71
2.30
2.76
3.47
4.44
5.66
6.63
8.86
1.86
2.52
3.01
3.78
4.83
6.16
7.22
9.63
Q
Precip.
pulg./h
0.20
0.24
0.28
0.34
0.41
0.47
0.54
0.88
0.22
0.27
0.31
0.36
0.42
0.51
0.54
0.74
0.24
0.29
0.35
0.37
0.44
0.48
0.55
0.70
0.27
0.32
0.39
0.42
0.48
0.54
0.58
0.68
0.31
0.40
0.42
0.45
0.53
0.59
0.60
0.74
V
Precip.
pulg./h
0.23
0.27
0.33
0.39
0.47
0.54
0.62
1.01
0.26
0.31
0.35
0.42
0.49
0.59
0.63
0.85
0.28
0.34
0.41
0.43
0.51
0.56
0.63
0.81
0.31
0.37
0.45
0.48
0.56
0.62
0.67
0.79
0.36
0.46
0.49
0.53
0.61
0.68
0.70
0.86
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
56
El uso inteligente del agua.™
Rotores
Rendimiento de las boquillas Rain Curtain™
de ángulo estándar con PRS de la serie 5000
Presión
bares
Boquilla
1.7
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
2.0
2.5
3.0
Radio Caudal Caudal
m
m3⁄h l/m
10.10 0.25 4.2
10.70 0.34 5.4
10.70 0.41 6.6
11.00 0.51 8.4
11.3
0.66 10.8
11.90 0.84 13.8
11.90 0.97 16.2
11.00 1.34 22.2
10.20 0.28 4.8
10.80 0.36 6.0
10.90 0.44 7.2
11.20 0.55 9.0
11.6
0.71 12.0
12.10 0.91 15.0
12.40 1.05 17.4
11.80 1.45 24.0
10.40 0.31 5.4
11.00 0.41 6.6
11.30 0.50 8.4
11.20 0.62 10.2
12.3
0.81 13.2
12.70 1.03 17.4
13.20 1.21 20.4
13.30 1.63 27.0
10.60 0.34 6.0
11.20 0.45 7.8
11.30 0.56 9.6
12.10 0.69 11.4
12.7
0.89 15.0
13.50 1.13 18.6
13.90 1.34 22.2
14.10 1.79 30.0
Q
Precip.
mm/h
5
6
7
8
10
12
14
22
5
6
7
9
11
12
14
21
6
7
8
9
11
13
14
19
6
7
9
9
11
12
14
18
V
Precip.
mm/h
6
7
8
10
12
14
16
26
6
7
9
10
12
14
16
24
7
8
9
11
13
15
16
21
7
8
10
11
13
14
16
21
Presión
bares
Boquilla
3.5
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
1.5
2.0
2.5
3.0
4.0
5.0
6.0
8.0
4.0
4.5
SIST. MÉTRICO
Q
V
Radio Caudal Caudal Precip. Precip.
m
m3⁄h l/m
mm/h mm/h
10.70 0.37 6.0
7
8
11.30 0.49 8.4
8
9
11.30 0.60 10.2 9
11
12.20 0.74 12.6 10
12
12.8
0.97 16.2 12
14
13.70 1.23 20.4 13
15
14.20 1.45 24.0 14
17
14.90 1.93 32.4 18
20
10.60 0.40 6.6
7
8
11.10 0.52 9.0
8
10
11.30 0.64 10.8 10
12
12.20 0.80 13.2 11
12
12.8
1.04 17.4 13
15
13.70 1.32 22.2 14
16
14.90 1.55 25.8 15
17
15.20 2.06 34.2 18
21
10.40 0.42 7.2
8
9
10.70 0.55 9.0
10
11
11.30 0.68 11.4 11
12
12.20 0.84 13.8 11
13
12.8
1.10 18.0 13
15
13.70 1.40 23.4 15
17
14.60 1.64 28.2 15
18
15.20 2.19 36.6 19
22
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
El uso inteligente del agua.™
57
Rotores
www.rainbird.com/rotors
Serie 5000
Rotores
Serie 5000
Rendimiento de las boquillas de
ángulo bajo de la serie 5000
Presión
psi
Boquilla
25
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
35
Rotores
45
55
65
Radio
pies
25
27
29
29
28
30
31
33
29
31
32
35
29
31
33
36
29
31
33
36
Rendimiento delas boquillas de
ángulo bajo de la serie 5000
Caudal
gpm
0.76
1.15
1.47
2.23
0.92
1.38
1.77
2.68
1.05
1.58
2.02
3.07
1.17
1.76
2.24
3.41
1.27
1.92
2.45
3.72
Q
Precip.
pulg./h
0.23
0.30
0.34
0.51
0.23
0.30
0.35
0.47
0.24
0.32
0.38
0.48
0.27
0.35
0.40
0.51
0.29
0.38
0.43
0.55
V
Precip.
pulg./h
0.27
0.35
0.39
0.59
0.26
0.34
0.41
0.55
0.28
0.37
0.44
0.56
0.31
0.41
0.46
0.58
0.34
0.44
0.50
0.64
Presión
bares
1.7
2.0
2.5
3.0
3.5
4.0
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
4.5
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Boquilla
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
SIST. MÉTRICO
Radio Caudal Caudal
m
m3⁄h l/m
7.60
0.17 3.0
8.20
0.26 4.2
8.80
0.33 5.4
8.80
0.51 8.4
8.00
0.18 3.0
8.60
0.28 4.8
9.10
0.36 6.0
9.30
0.55 9.0
8.60
0.20 3.6
9.20
0.32 5.4
9.50
0.41 6.6
10.10 0.62 10.2
8.80
0.22 3.6
9.40
0.35 6.0
9.70
0.45 7.8
10.60 0.68 11.4
8.80
0.24 4.2
9.40
0.38 6.6
9.90
0.49 8.4
10.80 0.74 12.6
8.80
0.26 4.2
9.40
0.41 6.6
10.10 0.52 9.0
11.00 0.80 13.2
8.80
0.27 4.8
9.40
0.44 7.2
10.10 0.56 9.0
11.00 0.84 13.8
Q
Precip.
mm/h
6
8
9
13
6
8
9
13
5
8
9
12
6
8
10
12
6
9
10
13
7
9
10
13
7
10
11
14
V
Precip.
mm/h
7
9
10
15
6
9
10
15
6
9
10
14
7
9
11
14
7
10
11
15
8
11
12
15
8
11
13
16
Boquillas Rain Curtain™: con una ingeniería que ofrece una cobertura superior en todo el rango de radio.
Las boquillas Rain Curtain™ producen gotas de agua más grandes que son mucho
menos susceptibles al viento y minimizan enormemente la neblina y la evaporación
causada por el aire. Esto garantiza que la cantidad correcta de agua se dirija hacia
donde sea necesario, para ahorrar tiempo, dinero y agua.
El riego cercano al cabezal suave y efectivo elimina las zonas secas alrededor
del rotor, y la uniformidad en la distribución compensa las diversas condiciones
ambientales para garantizar resultados de césped verde.
58
El uso inteligente del agua.™
Serie 5000
Rendimiento de las boquillas Rain Curtain™ de ángulo
estándar con PRS de la serie 5000
Q
V
Presión
Boquilla
Radio Caudal Precip. Precip.
psi
pies
gpm
pulg./h pulg./h
25
1.5
33
1.12
0.2
0.23
2.0
35
1.5
0.24
0.27
2.5
35
1.81
0.28
0.33
3.0
36
2.26
0.34
0.39
4.0
37
2.91
0.41
0.47
5.0
39
3.72
0.47
0.54
6.0
39
4.25
0.54
0.62
8.0
36
5.9
0.88
1.01
35
1.5
34
1.35
0.22
0.26
2.0
36
1.81
0.27
0.31
2.5
37
2.17
0.31
0.35
3.0
38
2.71
0.36
0.41
4.0
40
3.5
0.42
0.49
5.0
41
4.47
0.51
0.59
6.0
43
5.23
0.54
0.63
8.0
43
7.06
0.74
0.85
45
1.5
35
1.54
0.24
0.28
2.0
37
2.07
0.29
0.34
2.5
37
2.51
0.35
0.41
3.0
40
3.09
0.37
0.43
4.0
42
4.01
0.44
0.51
5.0
45
5.09
0.48
0.56
6.0
46
6.01
0.55
0.63
8.0
47
8.03
0.7
0.81
55 – 75
1.5
35
1.59
0.25
0.29
2.0
37
2.14
0.3
0.35
2.5
37
2.6
0.37
0.42
3.0
40
3.2
0.39
0.44
4.0
42
4.15
0.45
0.52
5.0
45
5.27
0.5
0.58
6.0
46
6.22
0.57
0.65
8.0
47
8.31
0.72
0.84
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
www.rainbird.com/rotors
Rendimiento de las boquillas Rain Curtain™ de
ángulo estándar con PRS de la serie 5000
SISTEMA MÉTRICO
Q
V
Presión
Boquilla Radio Caudal Caudal Precip. Precip.
bares
m
m3⁄h l/m
mm/h mm/h
1.7
1.5
10.1
0.25 4.20 5
6
2.0
10.7
0.34 5.40 6
7
2.5
10.7
0.41 6.60 7
8
3.0
11.0
0.51 8.40 8
10
4.0
11.3
0.66 10.80 10
12
5.0
11.9
0.84 13.80 12
14
6.0
11.9
0.97 16.20 14
16
8.0
11.0
1.34 22.20 22
26
2.0
1.5
10.2
0.28 4.80 5
6
2.0
10.8
0.36 6.00 6
7
2.5
10.9
0.44 7.20 7
9
3.0
11.2
0.55 9.00 9
10
4.0
11.6
0.71 12.00 11
12
5.0
12.1
0.91 15.00 12
14
6.0
12.4
1.05 17.40 14
16
8.0
11.8
1.45 24.00 21
24
2.5
1.5
10.4
0.31 5.40 6
7
2.0
11.0
0.41 6.60 7
8
2.5
11.3
0.50 8.40 8
9
3.0
11.2
0.62 10.20 9
11
4.0
12.3
0.81 13.20 11
13
5.0
12.7
1.03 17.40 13
15
6.0
13.2
1.21 20.40 14
16
8.0
13.3
1.63 27.00 19
21
3.0
1.5
10.6
0.34 6.00 6
7
2.0
11.2
0.45 7.80 7
8
2.5
11.3
0.56 9.60 9
10
3.0
12.1
0.69 11.40 9
11
4.0
12.7
0.89 16.80 11
13
5.0
13.5
1.13 18.60 12
14
6.0
13.9
1.34 22.20 14
16
8.0
14.1
1.79 30.00 18
21
3.5 – 5.2
1.5
10.6
0.35 6.00 6
7
2.0
11.2
0.47 7.80 8
9
2.5
11.3
0.58 10.20 9
11
3.0
12.1
0.71 12.00 10
11
4.0
12.7
0.92 15.60 12
13
5.0
13.5
1.17 19.20 13
15
6.0
13.9
1.39 22.80 14
17
8.0
14.1
1.85 31.20 18
21
*En este cálculo prudente, el sistema ahorra un total de
401 253 litros en un terreno con una presión de entrada
de 5.17 BAR y un riego de 4 días por semana, 40 semanas
por año. El sistema tiene 15 rotores 5000 PRS de Rain Bird®,
cada uno con una boquilla de 3 gpm, y 20 aspersores
1800® PRS de Rain Bird®, cada uno con una boquilla 15H.
Los rotores funcionan 30 minutos por día, mientras que los
aspersores funcionan 15 minutos por día.
El uso inteligente del agua.™
59
Rotores
Rotores
Rotores
Serie 5000
Rendimiento de las boquillas de
ángulo bajo Serie 5000 PRS
Presión
psi
Boquilla
25
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
35
55 – 75
Q
Caudal Precip.
gpm
pulg./h
0.76
0.22
1.15
0.3
1.47
0.34
2.23
0.51
0.92
0.21
1.38
0.3
1.77
0.35
2.68
0.47
1.05
0.23
1.58
0.32
2.02
0.38
3.07
0.48
1.09
0.25
1.64
0.33
2.09
0.39
3.18
0.5
Radio
pies
25
27
29
29
28
30
31
33
29
31
32
35
29
31
32
35
V
Precip.
pulg./h
0.26
0.35
0.39
0.59
0.25
0.34
0.41
0.55
0.26
0.37
0.44
0.56
0.29
0.38
0.45
0.58
Presión
bares
Boquilla
1.7
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
1.0 LA
1.5 LA
2.0 LA
3.0 LA
2.0
2.5
3.0
3.5 – 5.2
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Radio
m
7.6
8.2
8.8
8.8
8.0
8.6
9.1
9.3
8.6
9.2
9.5
10.1
8.8
9.4
9.7
10.6
8.8
9.4
9.7
10.6
SIST. MÉTRICO
Caudal
m3⁄h
0.17
0.26
0.33
0.51
0.18
0.28
0.36
0.55
0.20
0.32
0.41
0.62
0.22
0.35
0.45
0.68
0.23
0.36
0.47
0.70
Caudal
l/m
3.00
4.20
5.40
8.40
3.00
4.80
6.00
9.00
3.60
5.40
6.60
10.20
3.60
6.00
7.80
11.40
3.60
6.00
7.80
12.00
Q
Precip.
mm/h
6
8
9
13
6
8
9
13
5
8
9
12
6
8
10
12
6
8
10
13
V
Precip.
mm/h
7
9
10
15
6
9
10
15
6
9
10
14
7
9
11
14
7
10
12
15
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Índice de caudal y presión de entrada: boquillas Rain Curtain™
¿Cuánta agua puede ahorrar por minuto utilizando los rotores
5000 PRS de Rain Bird® con tecnología Flow Optimizer?
12.0
11.0
8.0 RC - no PRS
9.0
8.0 RC - with PRS
8.0
7.0
6.0
5.0 RC - no PRS
5.0 RC - with PRS
5.0
4.0
3.0 RC - no PRS
3.0
3.0 RC - with PRS
2.0 RC - no PRS
2.0
2.0 RC - with PRS
1.0
0.0
15
20
25
30
35
40
45
50
55
Presión de entrada (psi)
60
60
65
70
75
Caudal total de la zona en GPM
10.0
Índice de caudal (gpm)
Rotores
45
Rendimiento de las boquillas de
ángulo bajo Serie 5000 PRS
Caudal
GPM
6
8
10
12
14
16
18
20
22
24
26
28
30
45
50
55
60
65
70
75
80
0
0.33
0.66
0.96
1.25
1.54
1.81
2.06
0
0.43
0.85
1.24
1.62
1.98
2.33
2.67
0
0.55
1.07
1.57
2.05
2.52
2.96
3.39
0
0.66
1.27
1.86
2.43
2.97
3.50
4.01
0
0.77
1.49
2.18
2.84
3.48
4.10
4.70
0
0.87
1.69
2.48
3.24
3.97
4.67
5.35
0
0.98
1.90
2.79
3.64
4.46
5.25
6.01
0
1.10
2.12
3.10
4.05
4.96
5.83
6.68
0
1.21
2.33
3.42
4.46
5.47
6.44
7.37
0
1.30
2.54
3.72
4.85
5.94
7.00
8.01
0
1.41
2.76
4.04
5.27
6.45
7.60
8.70
0
1.53
2.96
4.34
5.66
6.93
8.16
9.35
0
1.63
3.17
4.65
6.07
7.43
8.74
10.02
Total de galones de agua ahorrados por minuto
durante el tiempo de riesgo
Ej: A 70 psi, una zona con 20 gpm de caudal ahorraría
4.96 galones (18.78 litros) por minuto con 5000 PRS
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Boquillas Serie 5000 MPR
Boquillas Serie 5000 MPR
Boquilla
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
Un cuarto
rendimiento superior
Q %JTF×PGMFYJCMFDPOVOÓOEJDFEFQSFDJQJUBDJØORVFTFBKVTUBFOUSFMPT
conjuntos y con la boquilla rotativa
Q Codificación por color según el radio para una fácil identificación
Tercio
Características
t5SFTQPSUBCPRVJMMBTDPOSBEJPTEFhhZhNNN
t$BEBVOBDPOUJFOFVOBCPRVJMMB2¡
5¡
)¡
Z'¡
t/PTFSFRVJFSFOQMBDBTGJKBTQBSBMPTBSDPT
t$PNQBUJCMFDPOFMSPUPSEFMBTFSJF
t-BUFDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™PGSFDF
- Gotas de gran tamaño para un rendimiento constante
- Riego eficaz cercano al cabezal
%JTUSJCVDJØOVOJGPSNFTPCSFUPEPFMSBEJP
t¶OEJDFEFQSFDJQJUBDJØOEFQVMHINNI
RVFSFEVDF
el escurrimiento y la erosión
t#PRVJMMBTGÈDJMFTEFJOTFSUBSZRVJUBS
t1PSUBCPRVJMMBTBQJMBCMFTQBSBVOBMNBDFOBNJFOUPDPOWFOJFOUF
t¶OEJDFEFQSFDJQJUBDJØORVFTFBKVTUBBMBCPRVJMMBSPUBUJWB3BJO#JSEDPOTVMUF
la página 42
Medio
Completa
Presión
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
Radio
pies
23
24
25
25
25
23
24
25
25
25
23
24
25
25
25
23
24
25
25
25
Caudal
gpm
0.74
0.88
1.00
1.11
1.21
1.00
1.21
1.38
1.53
1.67
1.44
1.73
1.98
2.21
2.41
2.78
3.34
3.82
4.25
4.63
Q
Precip.
pulg./h
0.54
0.59
0.62
0.68
0.75
0.55
0.61
0.64
0.71
0.77
0.52
0.58
0.61
0.68
0.74
0.51
0.56
0.59
0.65
0.71
V
Precip.
pulg./h
0.62
0.68
0.71
0.79
0.86
0.63
0.70
0.74
0.82
0.89
0.61
0.67
0.70
0.79
0.86
0.58
0.64
0.68
0.76
0.82
Modelos
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFTN
DPOBDDFTPSJPTEFCPRVJMMBT25)'
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFTN
DPOBDDFTPSJPTEFCPRVJMMBT25)'
t.13QPSUBCPRVJMMBQBSBVOSBEJPEFQJFTN
DPOBDDFTPSJPTEFCPRVJMMBT25)'
5000-MPR-25 (Rojo)
Presión
bares
Boquilla
Un cuarto
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
Tercio
Medio
Cómo especificar
5000 - MPR - 25 - Q
Modelo
Rotor
Patrón
2$VBSUP
55FSDJP
).FEJP
'$PNQMFUP
Completa
Rango de radio
25'
30'
35'
Boquilla
Índice de precipitación ajustado
SISTEMA MÉTRICO
Radio
m
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6
7.0
7.3
7.6
7.6
7.6
Caudal
m3⁄h
0.17
0.20
0.23
0.25
0.27
0.23
0.27
0.31
0.35
0.38
0.33
0.39
0.45
0.50
0.55
0.63
0.76
0.87
0.97
1.05
Caudal
l/m
3.0
3.6
3.6
4.2
4.8
3.6
4.8
5.4
6.0
6.6
5.4
6.6
7.2
8.4
9.0
10.8
12.6
14.4
16.2
17.4
Q
Precip.
mm/h
13.7
14.9
15.6
17.4
18.9
13.9
15.4
16.2
18.0
19.6
13.3
14.7
15.5
17.3
18.9
12.8
14.2
14.9
16.6
18.1
V
Precip.
mm/h
15.8
17.3
18.1
20.1
21.9
16.0
17.8
18.7
20.7
22.6
15.4
17.0
17.9
20.0
21.8
14.8
16.4
17.3
19.2
20.9
Boquillas Serie 5000 MPR
Las boquillas Serie 5000 MPR brindan índices de precipitación ajustados dentro y entre un radio de 25' a 35' (de 7.6 m a 10.7 m).
Esto elimina los riesgos del exceso o falta de riego.
El uso inteligente del agua.™
61
Rotores
5000-MPR-25 (Rojo)
Inspección e instalación más rápida con índice de precipitación ajustado
codificado por colores de 25' a 35' (de 7.6 a 10.7 m)
Rotores
Boquillas Serie 5000 MPR
5000-MPR-30 (Verde)
Boquilla
Un cuarto
Tercio
Rotores
Medio
Completa
Presión
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
5000-MPR-30 (Verde)
Radio
pies
29
30
30
30
30
29
30
30
30
30
29
30
30
30
30
29
30
30
30
30
Q
Caudal Precip.
gpm
pulg./h
1.03
0.47
1.23
0.53
1.40
0.60
1.56
0.67
1.69
0.72
1.34
0.46
1.62
0.52
1.85
0.59
2.06
0.66
2.24
0.72
2.15
0.49
2.59
0.55
2.96
0.63
3.30
0.71
3.60
0.77
4.24
0.49
5.08
0.54
5.78
0.62
6.39
0.68
6.92
0.74
V
Precip.
pulg./h
0.54
0.61
0.69
0.77
0.83
0.53
0.60
0.69
0.76
0.83
0.57
0.64
0.73
0.82
0.89
0.56
0.63
0.71
0.79
0.85
Radio
pies
32
34
35
35
35
32
34
35
35
35
32
34
35
35
35
32
34
35
35
35
Q
Caudal Precip.
gpm
pulg./h
1.40
0.53
1.67
0.56
1.92
0.60
2.13
0.67
2.31
0.73
1.77
0.50
2.15
0.54
2.46
0.58
2.74
0.65
2.99
0.70
2.75
0.52
3.33
0.55
3.81
0.60
4.23
0.66
4.62
0.73
5.36
0.50
6.62
0.55
7.58
0.60
8.43
0.66
9.18
0.72
V
Precip.
pulg./h
0.61
0.64
0.70
0.77
0.84
0.58
0.62
0.67
0.75
0.81
0.60
0.64
0.69
0.77
0.84
0.58
0.64
0.69
0.76
0.83
5000-MPR-35 (Beige)
Boquilla
Un cuarto
Tercio
Medio
Completa
Presión
psi
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
25
35
45
55
65
Presión
bares
Boquilla
Un cuarto
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
Tercio
Medio
Completa
SISTEMA MÉTRICO
Radio
m
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1
8.8
9.1
9.1
9.1
9.1
Caudal
m3⁄h
0.23
0.28
0.32
0.35
0.38
0.30
0.37
0.42
0.47
0.51
0.49
0.59
0.67
0.75
0.82
0.96
1.15
1.31
1.45
1.57
5000-MPR-35 (Beige)
Presión
bares
Boquilla
Un cuarto
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
1.7
2.4
3.1
3.8
4.5
Tercio
Medio
Completa
Caudal
l/m
3.6
4.8
5.4
6.0
6.6
4.8
6.0
7.2
7.8
8.4
8.4
9.6
11.4
12.6
13.8
16.2
19.2
21.6
24.0
26.4
Q
Precip.
mm/h
12.0
13.4
15.2
17.0
18.4
11.7
13.2
15.1
16.8
18.3
12.5
14.1
16.1
17.9
19.6
12.3
13.8
15.7
17.4
18.8
V
Precip.
mm/h
13.8
15.4
17.6
19.6
21.2
13.5
15.2
17.4
19.4
21.1
14.4
16.2
18.6
20.7
22.6
14.2
15.9
18.1
20.0
21.7
SISTEMA MÉTRICO
Radio
m
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7
9.8
10.4
10.7
10.7
10.7
Caudal
m3⁄h
0.32
0.38
0.44
0.48
0.52
0.40
0.49
0.56
0.62
0.68
0.62
0.76
0.87
0.96
1.05
1.22
1.50
1.72
1.91
2.09
Caudal
l/m
5.4
6.6
7.2
7.8
9.0
6.6
8.4
9.6
10.2
11.4
10.2
12.6
14.4
16.2
17.4
20.4
25.2
28.8
31.8
34.8
Q
Precip.
mm/h
13.4
14.1
15.3
17.0
18.4
12.7
13.6
14.7
16.4
17.9
13.1
14.1
15.2
16.9
18.4
12.8
14.0
15.1
16.8
18.3
V
Precip.
mm/h
15.4
16.3
17.7
19.6
21.3
14.6
15.8
17.0
18.9
20.7
15.2
16.3
17.6
19.5
21.3
14.8
16.2
17.5
19.4
21.2
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Datos de rendimiento obtenidos en condiciones de cero viento.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
62
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Serie 5500
Serie 5500
Rango operativo
Proteja su césped con rotores de alto rendimiento y resistentes al abuso y al
vandalismo de entre 17' y 55' (5.1 m y 24.7 m)
t3BEJPEFBQJFTEFBN
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHIEFBNNI
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3/h; de 4.52 a 58.88 l/m)
rendimiento superior
Q Ahorre tiempo y gastos en repuestos con esta familia de rotores
resistentes al abuso y al vandalismo
Q Costos de inventario más bajos con un funcionamiento continuo de círculo
completo de 360º y círculo parcial en un aspersor
Características
t5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™
- Boquillas Rain Curtain™ codificadas por color para una distribución y un riego
cercano al cabezal óptimos, lo que permite mayor uniformidad.
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t3FTJTUFODJBBMBCVTPZBMWBOEBMJTNP
- Memory Arc® regresa el rotor a sus parámetros de arco originales
- El mecanismo motriz antidesgaste evita los daños por vandalismo y los
ocasionados por los equipos
5PSSFUBEFCPRVJMMBSFGPS[BEBDPOMBUØOQBSBRVFMBDPOFYJØODPOFMWÈTUBHP
de elevación soporte los daños del impacto lateral
- Modelo de tubería de elevación de acero inoxidable opcional que ayuda a
impedir el vandalismo en áreas públicas con césped
t*OTUBMBDJØOZNBOUFOJNJFOUP
%FTFOHBODIFTMBUFSBMFTEFSFDIPFJ[RVJFSEP
RVFTFBKVTUBO
independientemente para facilitar la instalación sin necesidad de girar la
cubierta ni de aflojar la conexión de la tubería
'ÈDJMBKVTUFEFMBSDPFOIÞNFEPPFOTFDPVTBOEPTPMBNFOUFVO
destornillador de cabeza plana a través de la parte superior del rotor desde
DÓSDVMPQBSDJBMEF¡B¡PFODÓSDVMPDPNQMFUPOPJOWFSTPEF¡
- Reduce los requisitos de inventario con un funcionamiento continuo de
círculo completo y círculo parcial en una unidad
- Estator autoajustable que permite reemplazar las boquillas sin necesidad de
realizar otros ajustes
t4PMVDJPOFTEFEJTF×PZTFHVSJEBE
%JTQPTJUJWPEFSFUFODJØOUVCFSÓBEFFMFWBDJØO4FBM".BUJD™4".
FTUÈOEBS
para ayudar a evitar el drenaje de los aspersores bajos
5BQBEFHPNBOFHSBFTUÈOEBS
5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMBJEFOUJGJDBDJØOEFMPTTJTUFNBTQBSBBHVBOP
potable
%JÈNFUSPFYQVFTUPQFRVF×PRVFSFEVDFMBQPTJCJMJEBEEFMFTJPOFTFOÈSFBT
de juego
t%VSBCJMJEBE
- La junta limpiadora redundante reduce las partes pegadas y las fugas
- Garantía comercial de cinco años.
- Engranaje de transmisión lubricado con agua
- Resorte retráctil de gran resistencia que garantiza una buena retracción
Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15EF£wDN
t%JTQPTJUJWPEFSFUFODJØO4".RVFSFUJFOFIBTUBQJFTN
EFBTQFSTPS
t#PRVJMMBT3BJO$VSUBJO™OBSBOKB
SPKP
OFHSP
BNBSJMMP
(celeste), 8.0 (verde oscuro), 10.0 (gris), 12.0 (beige) y portaboquilla de corto
alcance 18s, 22s, 26s, 30s (aqua)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF¡
Dimensiones
t%JÈNFUSPFYQVFTUP£DN
t%JÈNFUSPUPUBM£DN
t"MUVSBUPUBMžDN
t"MUVSBEFMWÈTUBHPSFUSÈDUJMDN
Modelos
t&OUSBEBIFNCSBSPTDBEB/15EF£wDN
WÈTUBHPEFFMFWBDJØOEF
plástico de 5" [30.5 cm])
t44&OUSBEBIFNCSBSPTDBEB/15EF£wDN
WÈTUBHPEFFMFWBDJØO
cubierto de acero inoxidable de 5" [12.7 cm])
Cómo especificar
5505 - SS - NP - 06
Modelo
Serie 5505
Tamaño de
la boquilla
06
Característica opcional
5BQBEFHPNB
para agua no potable
Característica opcional
Vástago de acero inoxidable
5505
Con el rendimiento y las características de resistencia al abuso y al vandalismo de la boquilla Rain Curtain™, esta familia de rotores garantiza que
el agua se dirija hacia donde corresponde.
El uso inteligente del agua.™
63
Rotores
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
Rotores
Serie 5505
Rendimiento de las boquillas Serie 5505
Presión
psi
30
40
Rotores
50
60
70
80
90
64
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
2
3
4
5
6
8
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
10
12
Radio
pies
33
35
37
37
39
39
37
39
41
41
45
45
41
39
37
41
43
45
47
49
47
45
37
41
45
47
47
51
51
51
39
43
45
47
47
53
53
53
39
43
45
47
49
53
55
55
55
55
Q
Caudal Precip.
gpm
pulg./h
1.2
0.21
2.3
0.36
2.4
0.34
2.6
0.37
4.2
0.53
5.3
0.67
1.6
0.23
2.7
0.34
2.9
0.33
3.5
0.40
4.8
0.46
6.4
0.61
7.5
0.86
10.1
1.28
1.7
0.24
3.0
0.34
3.3
0.34
3.8
0.36
5.4
0.47
7.3
0.59
8.9
0.78
11.1
1.06
1.9
0.27
3.3
0.38
3.6
0.34
4.8
0.42
6.0
0.52
8.2
0.61
9.7
0.72
12.3
0.91
2.1
0.27
3.5
0.36
3.9
0.37
5.1
0.44
6.5
0.57
8.8
0.60
11.1
0.76
13.5
0.93
2.3
0.29
3.8
0.40
4.2
0.40
5.5
0.48
7.0
0.56
9.5
0.65
12.1
0.77
14.4
0.92
13.1
0.83
15.5
0.99
Rendimiento de las boquillas de radio corto Serie 5505
V
Precip.
pulg./h
0.25
0.42
0.39
0.42
0.61
0.77
0.26
0.39
0.38
0.46
0.53
0.70
0.99
1.48
0.28
0.40
0.40
0.42
0.54
0.68
0.90
1.22
0.31
0.44
0.40
0.48
0.60
0.70
0.83
1.05
0.31
0.42
0.43
0.51
0.65
0.70
0.88
1.07
0.34
0.46
0.46
0.55
0.65
0.75
0.89
1.06
0.96
1.14
Presión
psi
Boquilla
30
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
40
50
60
70
80
Radio
pies
17
19
25
25
19
21
25
29
21
23
29
31
23
25
29
33
23
25
29
35
25
27
29
35
Caudal
gpm
1.4
1.4
1.4
1.7
1.5
1.6
1.9
1.8
1.8
1.8
2.1
2.0
2.0
2.0
2.4
2.2
2.2
2.3
2.8
2.8
2.4
2.5
3.1
3.1
Q
Precip.
pulg./h
0.93
0.75
0.43
0.52
0.80
0.70
0.59
0.41
0.79
0.66
0.48
0.40
0.73
0.62
0.55
0.39
0.80
0.71
0.64
0.44
0.74
0.66
0.71
0.49
V
Precip.
pulg./h
1.08
0.86
0.50
0.60
0.92
0.81
0.68
0.48
0.91
0.76
0.56
0.46
0.84
0.71
0.63
0.45
0.92
0.82
0.74
0.51
0.85
0.76
0.82
0.56
Boquillas de radio corto Serie 5505
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Serie 5505
Presión
bares
2.1
2.5
3.0
3.5
4.0
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
2
3
4
5
6
8
2
3
4
5
6
8
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
Radio
m
10.1
10.7
11.3
11.3
11.3
10.1
10.8
11.4
12.0
12.0
12.4
11.2
11.3
12.1
12.7
12.9
13.3
12.3
13.1
12.5
11.3
12.5
13.2
13.8
13.8
13.2
14.4
13.9
11.3
12.5
13.6
14.2
14.2
13.6
15.3
15.2
Caudal
m3⁄h
0.32
0.52
0.59
0.73
0.86
1.23
0.35
0.58
0.66
0.81
0.96
1.37
0.38
0.64
0.74
0.90
1.07
1.53
1.74
2.30
0.41
0.69
0.80
0.98
1.17
1.67
1.83
2.54
0.45
0.75
0.85
1.05
1.25
1.80
2.12
2.74
Q
V
Caudal Precip. Precip.
l/m
mm/h mm/h
4.54 6.3
7.3
8.71 9.2
10.6
9.08 9.3
10.7
9.84 11.4 13.2
15.90 13.6 15.7
20.06 24.2 28.0
5.49 5.9
6.8
9.65 8.9
10.2
10.27 9.1
10.5
11.97 11.2 12.9
17.32 12.5 14.4
22.67 21.8 25.2
6.19 6.0
6.9
10.62 8.7
10.0
11.51 9.1
10.5
13.65 10.8 12.5
18.97 12.1 13.9
25.42 20.1 23.2
30.25 20.1 23.2
39.56 29.3 33.8
6.49 6.5
7.5
11.44 8.8
10.2
12.58 9.2
10.7
14.67 10.4 12.0
20.61 12.3 14.2
27.89 19.3 22.3
33.92 17.6 20.3
42.36 26.5 30.6
7.04 7.0
8.1
12.27 9.7
11.2
13.40 9.2
10.6
17.42 10.4 12.0
22.26 12.4 14.3
30.36 19.5 22.5
36.11 18.1 20.9
45.65 23.8 27.4
SISTEMA MÉTRICO
Presión
bares
4.5
5.0
5.5
6.0
6.2
Boquilla
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
2
3
4
5
6
8
10
12
10
12
10
12
Radio
m
11.6
12.8
13.7
14.3
14.3
14.0
15.9
15.9
11.9
13.1
13.7
14.3
14.5
14.5
16.3
16.3
11.9
13.1
13.7
14.3
14.9
14.9
16.8
16.8
16.8
16.8
16.8
16.8
Caudal
m3⁄h
0.48
0.80
0.90
1.12
1.33
1.92
2.38
2.94
0.51
0.83
0.95
1.18
1.41
2.04
2.60
3.12
0.52
0.88
1.00
1.25
1.47
2.15
2.74
3.27
2.91
3.45
2.98
3.52
Q
V
Caudal Precip. Precip.
l/m
mm/h mm/h
7.59 7.1
8.2
12.89 9.7
11.2
14.22 9.6
11.0
18.77 10.9 12.6
23.71 13.0 15.0
32.23 19.5 22.5
39.51 18.9 21.9
48.95 23.3 26.9
8.14 7.2
8.3
13.53 9.7
11.2
15.05 10.1 11.6
19.69 11.5 13.3
25.08 13.4 15.5
33.98 19.4 22.5
42.97 19.5 22.5
51.96 23.4 27.1
8.69 7.4
8.5
14.36 10.3 11.9
15.87 10.6 12.2
20.78 12.2 14.0
26.45 13.2 15.3
35.90 19.3 22.3
45.71 19.6 22.6
54.43 23.3 26.9
48.46 20.7 23.9
57.43 24.5 28.3
49.58 21.2 24.4
58.66 25.1 28.9
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
El uso inteligente del agua.™
65
Rotores
Rendimiento de las boquillas Serie 5505
Rotores
Serie 5505
Rendimiento de las boquillas de radio
corto Serie 5505
Presión
bares
2.1
2.5
Rotores
3.0
3.5
4.0
4.5
5.0
5.5
Boquilla
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
18S
22S
26S
30S
Radio
m
5.2
5.8
7.6
7.6
5.6
6.2
7.6
8.4
6.0
6.6
8.0
9.1
6.4
7.1
8.8
9.5
6.9
7.5
8.8
9.9
7.0
7.6
8.8
10.4
7.2
7.8
8.8
10.7
7.6
8.2
8.8
10.7
Caudal
m3⁄h
0.32
0.32
0.32
0.39
0.33
0.35
0.39
0.40
0.36
0.38
0.45
0.42
0.41
0.41
0.48
0.46
0.45
0.45
0.53
0.49
0.49
0.49
0.59
0.57
0.53
0.53
0.65
0.65
0.57
0.57
0.70
0.70
SIST. MÉTRICO
Caudal
l/m
5.3
5.3
5.3
6.4
5.5
5.8
6.5
6.7
6.1
6.3
7.5
7.1
6.9
6.9
8.0
7.6
7.4
7.4
8.9
8.2
8.2
8.2
9.9
9.5
8.9
8.9
10.9
10.9
9.4
9.4
11.7
11.7
Q
Precip.
mm/h
23.7
19.0
11.0
13.3
21.5
18.2
13.4
11.4
20.2
17.3
13.8
10.4
19.8
16.6
12.3
10.2
18.8
15.8
13.6
9.9
19.9
16.9
15.2
10.6
20.8
17.7
16.7
11.5
19.6
16.8
18.0
12.3
V
Precip.
mm/h
27.3
21.9
12.6
15.4
24.8
21.0
15.5
13.2
23.3
20.0
16.0
12.0
22.9
19.1
14.3
11.7
21.7
18.3
15.7
11.5
23.0
19.5
17.5
12.2
24.0
20.4
19.3
13.3
22.6
19.4
20.8
14.3
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Vista transversal (Serie 5500)
Boquillas Serie 5505
66
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
4FSJF'BMDPO¥
Serie Falcon® 6504
Confiable y económico
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
rendimiento superior
Q Ajuste e instalación rápidos con vástago de trinquete
Q La solución perfecta para un riego rápido en canchas de tenis de arcilla o
campos de deportes interiores con césped con la versión de alta velocidad
opcional (rotación completa en aproximadamente un minuto)
Características
Rotores
t5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™
- Boquillas Rain Curtain codificadas por color con orificios
múltiples para un riego óptimo de largo alcance, de mediano alcance y
cercano al cabezal, que logran mayor uniformidad
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t*OTUBMBDJØOZNBOUFOJNJFOUP
- Vástago de trinquete que acelera la instalación
'ÈDJMBKVTUFEFMBSDPNPEFMPEFDÓSDVMPQBSDJBM
EFTEFMBQBSUFTVQFSJPSEFM
SPUPSEF¡B¡
- Estator autoajustable que no requiere reemplazo al
cambiar las boquillas
5PSOJMMPEFBKVTUFEFMSBEJPRVFQFSNJUFVOBSFEVDDJØOEFMSBEJPEFIBTUB
un 25% sin cambiar las boquillas
-PTSPUPSFT'BMDPOTFQVFEFOTPMJDJUBSBMBGÈCSJDBFODBOUJEBEFTQPSDBKBT
con boquillas preinstaladas como pedido especial
t4PMVDJPOFTEFEJTF×P
- Vástago retráctil de acero inoxidable opcional que ayuda a impedir el
vandalismo en áreas públicas con césped
%JTQPTJUJWPEFSFUFODJØOEFTNPOUBCMF4FBM".BUJD™4".
RVFFWJUBFM
encharcamiento y la erosión provocados por el drenaje de los aspersores
bajos
5BQBEFHPNBOFHSBFTUÈOEBSPUBQBEFHPNBWJPMFUBPQDJPOBMQBSBBHVB
no potable
%JÈNFUSPFYQVFTUPQFRVF×PEFDN
RVFSFEVDFMBQPTJCJMJEBEEF
lesiones en áreas de juego
- Opción de alta velocidad para la colocación de inyecciones en campos
interiores o control de polvo
- Altura del vástago retráctil de 4" (10.2 cm) para que la línea central de la
boquilla corte el césped más alto
t%VSBCJMJEBE
- Garantía comercial de cinco años.
- Engranaje de transmisión lubricado con agua para una rotación duradera y
confiable
- Resorte retráctil de acero inoxidable y gran resistencia que garantiza una
buena retracción
+VOUBMJNQJBEPSBQBUFOUBEBBDUJWBEBBQSFTJØODPOWÈTUBHPDØOJDPEF
elevación en modelos de plástico y de acero inoxidable que protegen el
mecanismo interno de la suciedad y garantizan una buena elevación y
retracción
- Engranajes de desenganche de acero inoxidable que garantizan
durabilidad a largo plazo
Falcon 6504
Vista transversal
Cómo especificar
NP
o bien,
F4- PC- SS- HS- 16- P
Característica
opcional
Elevador de
de acero
inoxidable
Rotación
Círculo parcial
Falcon 6504
El uso inteligente del agua.™
Modelo
''BMDPO
Característica
opcional
Boquilla
Boquilla
Tamaño de la
boquilla
16
Características
opcionales
5BQBEFHPNBQBSBBHVBOP
potable o bien, Rotor de
alta velocidad
Nota: Para aplicaciones fuera de EE.UU., es necesario
especificar si el tipo de rosca debe ser NPT o BSP.
67
Rotores
4FSJF'BMDPO¥
Serie Falcon® 6504 (cont.)
Rendimiento de las boquillas Falcon® 6504
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
t3BEJPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 10.8 a 82.2 l/m)
Presión
psi
Boquilla
30
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
40
Especificaciones
Rotores
t&OUSBEBIFNCSBSPTDBEB/15P#41EFDN
t%JTQPTJUJWPEFSFUFODJØO4".RVFSFUJFOFIBTUBQJFTN
EFDBNCJPEF
elevación
t#PRVJMMBT3BJO$VSUBJO™OFHSP
DFMFTUF
WFSEFPTDVSP
HSJT
(beige), 14 (verde claro), 16 (marrón oscuro), 18 (azul oscuro)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF¡
Dimensiones
50
t"MUVSBUPUBM›DN
t"MUVSBEFMWÈTUBHPSFUSÈDUJMDN
t%JÈNFUSPEFMBTVQFSGJDJFFYQVFTUBDN
Nota: La altura del vástago retráctil se mide desde la tapa hasta el centro de la boquilla. La
altura total del cuerpo no se mide con el vástago elevado.
Modelos
t''$$ÓSDVMPDPNQMFUP
t'1$$ÓSDVMPQBSDJBM
t''$/1$ÓSDVMPDPNQMFUPUBQBQBSBBHVBOPQPUBCMF
t'1$/1$ÓSDVMPQBSDJBMUBQBQBSBBHVBOPQPUBCMF
t''$44$ÓSDVMPDPNQMFUPBDFSPJOPYJEBCMF
t'1$44$ÓSDVMPQBSDJBMBDFSPJOPYJEBCMF
t''$44)4$ÓSDVMPDPNQMFUPBDFSPJOPYJEBCMFSPUBDJØOEFBMUBWFMPDJEBE
t'1$44)4$ÓSDVMPQBSDJBMBDFSPJOPYJEBCMFSPUBDJØOEFBMUBWFMPDJEBE
t''$44/1$ÓSDVMPDPNQMFUPBDFSPJOPYJEBCMFUBQBQBSBBHVBOPQPUBCMF
t'1$44/1$ÓSDVMPQBSDJBMBDFSPJOPYJEBCMFUBQBQBSBBHVBOPQPUBCMF
60
70
Nota:Todos los modelos se encuentran disponibles con roscas BSP
80
90
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t
Radio
pies
39
43
41
45
49
51
53
55
55
59
41
49
51
53
55
59
61
59
41
47
51
55
57
61
63
63
41
49
51
57
59
61
63
65
43
49
53
55
61
61
63
65
65
Caudal
gpm
2.9
4.2
3.3
4.9
6.6
8.1
9.7
11.3
12.6
13.7
3.7
5.5
7.4
9.1
11.0
12.7
14.3
15.4
4.0
6.0
8.2
10.0
12.2
14.0
15.7
17.1
4.4
6.3
8.9
10.8
13.2
15.2
16.9
18.3
4.6
6.9
9.4
11.6
14.0
16.2
18.1
19.6
21.7
Q
Precip.
pulg./h
0.37
0.44
0.38
0.47
0.53
0.60
0.66
0.72
0.80
0.76
0.42
0.44
0.55
0.62
0.70
0.70
0.74
0.85
0.46
0.52
0.61
0.64
0.72
0.72
0.76
0.83
0.50
0.51
0.66
0.64
0.73
0.79
0.82
0.83
0.48
0.55
0.64
0.74
0.72
0.84
0.88
0.89
0.99
V
Precip.
pulg./h
0.42
0.50
0.44
0.54
0.61
0.69
0.77
0.83
0.93
0.87
0.49
0.51
0.63
0.72
0.81
0.81
0.85
0.98
0.53
0.60
0.70
0.73
0.83
0.84
0.88
0.96
0.58
0.58
0.76
0.74
0.84
0.91
0.95
0.96
0.55
0.64
0.74
0.85
0.84
0.97
1.01
1.03
1.14
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
68
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
4FSJF'BMDPO¥
Presión
bares
2.1
2.5
3.0
3.5
4.0
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
Radio
m
11.9
13.1
12.3
13.5
14.9
15.5
16.2
16.8
16.8
18.0
12.5
14.1
15.1
15.8
16.4
17.2
17.4
18.0
12.5
14.9
15.5
16.2
16.8
18.0
18.6
18.1
12.5
14.4
15.5
16.6
17.3
18.5
19.1
19.0
Caudal
m3⁄h
0.66
0.95
0.72
1.05
1.50
1.84
2.20
2.57
2.86
3.11
0.78
1.16
1.56
1.92
2.31
2.68
3.00
3.25
0.85
1.26
1.69
2.08
2.52
2.91
3.27
3.53
0.89
1.34
1.83
2.23
2.72
3.12
3.50
3.81
Caudal
l/m
10.98
15.90
11.92
17.56
25.20
30.60
36.60
42.60
47.40
51.60
13.02
19.34
26.04
31.99
38.44
44.63
49.95
54.11
14.09
20.96
28.24
34.70
41.98
48.45
54.53
58.78
14.91
22.33
30.44
37.17
45.28
52.01
58.37
63.45
SISTEMA MÉTRICO
Q
Precip.
mm/h
9
11
10
12
13
15
17
18
20
19
10
12
14
15
17
18
20
20
11
11
14
16
18
18
19
22
11
13
15
16
18
18
19
21
V
Precip.
mm/h
11
13
11
13
16
18
19
21
24
22
12
13
16
18
20
21
23
23
13
13
16
18
21
21
22
25
13
15
17
19
21
21
22
24
Presión
bares
4.5
5.0
5.5
6.0
6.2
Boquilla
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
18
Radio
m
12.5
14.6
15.5
17.1
17.7
18.6
19.2
19.5
12.7
14.9
15.7
17.2
18.1
18.6
19.2
19.8
13.1
14.9
16.1
16.8
18.6
18.6
19.2
19.8
19.8
19.8
Caudal
m3⁄h
0.96
1.40
1.95
2.37
2.89
3.32
3.71
4.03
1.01
1.47
2.05
2.50
3.04
3.51
3.91
4.23
1.04
1.56
2.13
2.63
3.18
3.67
4.10
4.44
4.79
4.93
Caudal
l/m
15.94
23.33
32.43
39.44
48.17
55.38
61.82
67.12
16.84
24.50
34.16
41.64
50.72
58.49
65.11
70.51
17.39
25.79
35.54
43.84
52.92
61.23
68.40
74.07
79.77
82.13
Q
Precip.
mm/h
12
13
16
16
18
19
20
21
13
13
17
17
19
20
21
22
12
14
16
19
18
21
22
23
24
25
V
Precip.
mm/h
14
15
19
19
21
22
23
24
15
15
19
19
21
23
24
25
14
16
19
22
21
25
26
26
28
29
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
El uso inteligente del agua.™
69
Rotores
Rendimiento de las boquillas Falcon® 6504
Rotores
4FSJF'BMDPO¥
Rendimiento de alta velocidad de las boquillas Falcon® 6504
Presión
psi
30
40
Rotores
50
60
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
Radio
pies
37
39
41
43
47
47
49
53
51
53
41
45
49
49
53
53
53
55
41
45
47
49
53
53
55
59
Caudal
gpm
3.0
4.3
3.5
6.0
6.6
8.1
9.9
11.4
12.6
13.9
3.7
5.6
7.5
9.2
11.2
12.9
14.3
15.6
4.2
6.2
8.3
10.2
12.4
14.2
15.7
17.2
Q
Precip.
pulg./h
0.42
0.54
0.40
0.62
0.58
0.71
0.79
0.78
0.93
0.95
0.42
0.53
0.60
0.74
0.77
0.88
0.98
0.99
0.48
0.59
0.72
0.82
0.85
0.97
1.00
0.95
V
Precip.
pulg./h
0.49
0.63
0.46
0.72
0.66
0.82
0.92
0.90
1.08
1.10
0.49
0.62
0.69
0.85
0.89
1.02
1.13
1.15
0.56
0.68
0.84
0.94
0.98
1.12
1.15
1.10
Presión
psi
70
80
90
Boquilla
tt
tt
tt
tt
tt
tt
tt
tt
t
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
Radio
pies
41
43
49
51
55
53
57
59
39
43
51
49
55
53
59
59
61
Caudal
gpm
4.6
6.7
9.0
11.1
13.5
15.3
17.1
18.6
4.9
7.1
9.7
11.9
14.4
16.5
18.4
20.0
21.3
Q
Precip.
pulg./h
0.53
0.70
0.72
0.82
0.86
1.05
1.01
1.03
0.62
0.74
0.72
0.95
0.92
1.13
1.02
1.11
1.10
V
Precip.
pulg./h
0.61
0.81
0.83
0.95
0.99
1.21
1.17
1.19
0.72
0.85
0.83
1.10
1.06
1.31
1.18
1.28
1.27
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Falcon® 6504
de alta velocidad
70
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
4FSJF'BMDPO¥
Presión
bares
2.1
2.5
3.0
3.5
4.0
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
4
6
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
Radio
m
11.3
11.9
12.0
12.7
14.2
14.2
14.8
16.0
15.4
16.0
12.5
13.3
14.5
14.5
15.4
16.2
15.8
16.4
12.5
13.7
14.9
14.9
16.2
16.2
16.2
16.9
12.5
13.7
14.4
14.9
16.2
16.2
16.6
17.7
Caudal
m3⁄h
0.68
0.98
0.75
1.22
1.49
1.83
2.24
2.58
2.85
3.15
0.81
1.33
1.57
1.93
2.35
2.71
3.00
3.29
0.85
1.28
1.72
2.11
2.56
2.95
3.27
3.57
0.93
1.38
1.85
2.27
2.76
3.17
3.50
3.83
Caudal
l/m
11.35
15.90
12.54
20.16
25.20
30.60
37.20
43.20
47.40
52.80
13.51
22.18
26.18
32.12
39.20
48.09
49.95
54.87
14.15
21.37
28.62
35.11
42.74
49.20
54.53
59.51
15.52
23.02
30.81
37.86
46.03
52.77
58.37
63.90
Q
Precip.
mm/h
11
14
10
15
15
18
20
20
24
24
10
15
15
18
20
21
24
25
11
14
16
19
20
23
25
25
12
15
18
20
21
24
25
24
V
Precip.
mm/h
12
16
12
18
17
21
24
23
28
28
12
17
17
21
23
24
28
28
13
16
18
22
23
26
29
29
14
17
21
24
24
28
29
28
SISTEMA MÉTRICO
Presión
bares
4.5
5.0
5.5
6.0
6.2
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
Boquilla
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
4
6
8
10
12
14
16
18
18
18
Radio
m
12.5
13.4
14.6
15.3
16.5
16.2
17.1
18.0
12.3
13.1
15.1
15.4
16.8
16.2
17.5
18.0
11.9
13.1
15.5
14.9
16.8
16.2
18.0
18.0
18.4
18.6
Caudal
m3⁄h
1.00
1.48
1.97
2.42
2.95
3.36
3.73
4.07
1.06
1.56
2.08
2.57
3.12
3.54
3.96
4.30
1.11
1.61
2.20
2.70
3.27
3.74
4.17
4.53
4.75
4.84
Caudal
l/m
16.69
24.46
32.81
40.40
49.13
55.94
62.22
67.89
17.70
25.74
34.73
42.78
51.96
59.06
65.96
71.74
18.52
26.84
36.65
44.97
54.43
62.35
69.53
75.58
79.16
80.62
Q
Precip.
mm/h
13
16
18
21
22
26
26
25
14
18
18
22
22
27
26
27
16
19
18
24
23
29
26
28
28
28
V
Precip.
mm/h
15
19
21
24
25
30
30
29
16
21
21
25
26
31
30
31
18
22
21
28
27
33
30
32
32
32
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
El uso inteligente del agua.™
71
Rotores
Rendimiento de alta velocidad de las boquillas Falcon® 6504
Rotores
Serie 8005
Serie 8005
Proteja su césped con rotores de alto rendimiento y resistentes al abuso y al
vandalismo de entre 39' y 81' (5.1 m y 24.7 m)
Q Césped más verde con menos agua: las boquillas Rain Curtain™ ofrecen un
rendimiento superior
Q Ahorre tiempo y gastos en repuestos con esta familia de rotores
resistentes al abuso y al vandalismo
Q Costos de inventario más bajos con un funcionamiento continuo de círculo
completo de 360º y círculo parcial en un aspersor
Características
Rotores
t5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™
- Boquillas Rain Curtain™ codificadas por color para una distribución y un riego
cercano al cabezal óptimos, lo que permite mayor uniformidad.
- Las boquillas son intercambiables desde la parte frontal sin necesidad de
herramientas especiales
t3FTJTUFODJBBMBCVTPZBMWBOEBMJTNP
- Memory Arc® regresa el rotor a sus parámetros de arco originales
- El mecanismo motriz antidesgaste evita los daños por vandalismo y los
ocasionados por los equipos
5PSSFUBEFCPRVJMMBSFGPS[BEBDPOMBUØOQBSBRVFMBDPOFYJØODPOFMWÈTUBHP
de elevación soporte los daños del impacto lateral
- Modelo de tubería de elevación de acero inoxidable opcional que ayuda a
impedir el vandalismo en áreas públicas con césped
t*OTUBMBDJØOZNBOUFOJNJFOUP
%FTFOHBODIFTMBUFSBMFTEFSFDIPFJ[RVJFSEP
RVFTFBKVTUBO
independientemente para facilitar la instalación sin necesidad de girar la
cubierta ni de aflojar la conexión de la tubería
'ÈDJMBKVTUFEFMBSDPFOIÞNFEPPFOTFDPVTBOEPTPMBNFOUFVO
destornillador de cabeza plana a través de la parte superior del rotor desde
DÓSDVMPQBSDJBMEF¡B¡PFODÓSDVMPDPNQMFUPOPJOWFSTPEF¡
- Reduce los requisitos de inventario con un funcionamiento continuo de
círculo completo y círculo parcial en una unidad
- Estator autoajustable que permite reemplazar las boquillas sin necesidad de
realizar otros ajustes
t4PMVDJPOFTEFEJTF×PZTFHVSJEBE
%JTQPTJUJWPEFSFUFODJØOUVCFSÓBEFFMFWBDJØO4FBM".BUJD™4".
FTUÈOEBS
para ayudar a evitar el drenaje de los aspersores bajos
5BQBEFHPNBOFHSBFTUÈOEBS
5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMBJEFOUJGJDBDJØOEFMPTTJTUFNBTQBSBBHVBOP
potable
%JÈNFUSPFYQVFTUPQFRVF×PRVFSFEVDFMBQPTJCJMJEBEEFMFTJPOFTFOÈSFBT
de juego
5BQBEFHPNBDPODÏTQFEBSUJGJDJBMPQDJPOBMQBSBHBSBOUJ[BSMBTFHVSJEBEEF
los jugadores en las aplicaciones de campos de deportes
t%VSBCJMJEBE
- La junta limpiadora redundante reduce las partes pegadas y las fugas
- Garantía comercial de cinco años.
- Engranaje de transmisión lubricado con agua
- Resorte retráctil de gran resistencia que garantiza una buena retracción
Rango operativo
-
Radio: de 39 a 81 pies (de 11.9 a 24.7 m)
Índice de precipitación: de 0.48 a 1.23 pulgadas por hora (de 12 a 31 mm/h)
Presión: de 50 a 100 psi (de 3.5 a 6.9 bares)
Caudal: de 3.8 a 36.3 gpm (de 0.86 a 8.24 m3/h; de 14.4 a 137.4 l/m)
Nota: Los flujos de rango del 7005 y el 8005 se combinan en el rotor del 8005
Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15P#41EFDN
t%JTQPTJUJWPEFSFUFODJØO4".RVFSFUJFOFIBTUBQJFTN
EFBTQFSTPS
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF
t#PRVJMMBT3BJO$VSUBJO™04 (negro), 06 (celeste), 08 (verde oscuro),
10 (gris), 12 (beige), 14 (verde claro), 16 (marrón oscuro),
18 (azul oscuro), 20 (rojo), 22 (amarillo), 24 (naranja), 26 (blanco)
Dimensiones
t%JÈNFUSPFYQVFTUPŎDN
t%JÈNFUSPUPUBM ňDN
t"MUVSBUPUBM ňDN
t"MUVSBEFMWÈTUBHPSFUSÈDUJMDN
Modelos
t&OUSBEBIFNCSBSPTDBEB/15EFDN
WÈTUBHPEFFMFWBDJØOEF
plástico)
t44&OUSBEBIFNCSBSPTDBEB/15
B /15
(vástago de elevación cubierto de acero
cero
inoxidable de 5" [12.7 cm])
t5BQBWJPMFUBPQDJPOBMRVFGBDJMJUBMB
identificación de los sistemas para agua
gua
no potable
t5BQBDPODÏTQFEBSUJGJDJBMPQDJPOBM
Nota: Todos los modelos se encuentran disponibles
sponibles
con roscas BSP
** Nota: La altura del vástago retráctil se mide
desde la tapa hasta el orificio principal de la
a
boquilla. La altura total del cuerpo no se mide
ide con el
vástago elevado.
Cómo especificar
8005 - SS - NP - 16
Modelo
Serie 8005
Tamaño de
la boquilla
16
Característica opcional
5BQBEFHPNB
para agua no potable
Característica opcional
Vástago de acero inoxidable
Nota: Para aplicaciones fuera de EE.UU., es necesario
especificar si el tipo de rosca debe ser NPT o BSP.
8005
72
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Serie 8005
Presión
psi
50
60
70
80
Boquilla
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26
04
06
08
10
12
14
16
18
20
22
24
26
Radio
pies
39
45
49
53
57
59
61
63
65
65
63
65
39
45
49
53
59
61
65
65
67
71
69
73
39
45
49
55
59
63
67
67
71
73
75
75
39
45
49
55
61
63
67
69
71
75
77
79
Caudal
gpm
3.8
5.6
6.6
9.3
11.1
12.6
14.3
16.1
18.6
20.7
22.3
24.3
3.8
6.1
8.4
10.1
12.0
14.3
15.9
17.8
20.1
23.2
24.7
26.7
4.7
6.7
9.0
11.1
13.2
15.3
17.2
19.3
22.0
25.2
27.0
29.4
5.0
7.1
9.8
11.8
14.2
16.4
18.6
20.9
23.9
27.3
29.2
31.5
Q
Precip.
pulg./h
0.48
0.53
0.53
0.64
0.66
0.70
0.74
0.78
0.85
0.94
1.08
1.11
0.48
0.58
0.67
0.69
0.66
0.74
0.72
0.81
0.86
0.89
1.00
0.96
0.60
0.64
0.72
0.71
0.73
0.74
0.74
0.83
0.84
0.91
0.92
1.01
0.63
0.68
0.79
0.75
0.73
0.80
0.80
0.85
0.91
0.93
0.95
0.97
V
Precip.
pulg./h
0.56
0.62
0.61
0.74
0.76
0.81
0.85
0.90
0.98
1.09
1.25
1.28
0.56
0.67
0.78
0.80
0.77
0.85
0.84
0.94
1.00
1.02
1.15
1.11
0.69
0.74
0.83
0.82
0.84
0.86
0.85
0.96
0.97
1.05
1.07
1.16
0.73
0.78
0.91
0.87
0.85
0.92
0.92
0.98
1.05
1.08
1.10
1.12
Presión
psi
90
100
Boquilla
tt
tt
tt
t
tt
t
12
14
16
18
20
22
24
26
20
22
24
26
Caudal
gpm
14.7
17.9
20.0
22.2
25.3
29.1
31.0
33.7
26.8
30.7
32.8
36.3
Q
Precip.
pulg./h
0.76
0.82
0.81
0.85
0.91
1.00
0.96
1.04
0.85
1.00
1.01
1.07
V
Precip.
pulg./h
0.88
0.94
0.93
0.98
1.06
1.15
1.10
1.20
0.97
1.15
1.17
1.23
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Vista transversal
(Serie 8005)
El uso inteligente del agua.™
Radio
pies
61
65
69
71
73
75
79
79
75
77
79
81
Tapa con césped para
el modelo 8005
73
Rotores
Rendimiento de las boquillas Serie 8005
Rotores
Serie 8005
Rendimiento de las boquillas Serie 8005
Presión
bares
3.5
Rotores
4.0
4.5
5.0
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
tt
tt
tt
tt
tt
t
Boquilla
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26
4
6
8
10
12
14
16
18
20
22
24
26
Radio
m
11.9
13.7
14.9
16.1
17.5
18.0
18.7
19.2
19.9
20.0
19.3
20.0
11.9
13.7
14.9
16.3
17.7
18.5
19.6
19.7
20.3
21.3
20.7
21.8
11.9
13.7
14.9
16.5
18.0
18.9
20.1
20.1
21.1
22.0
22.0
22.6
11.9
13.7
14.9
16.7
18.3
19.2
20.4
20.6
21.6
22.4
23.0
23.2
Caudal
m3⁄h
0.86
1.28
1.59
2.10
2.52
2.89
3.28
3.69
4.25
5.08
5.11
5.57
0.93
1.37
1.75
2.30
2.70
3.17
3.54
3.97
4.50
5.23
5.50
6.01
1.00
1.45
1.92
2.40
2.87
3.37
3.77
4.22
4.79
5.51
5.88
6.42
1.06
1.54
2.09
2.50
3.05
3.54
3.99
4.47
5.11
5.84
6.26
6.80
Caudal
l/m
14.38
21.34
25.50
35.43
42.27
48.18
54.59
61.43
70.83
79.07
85.10
92.67
14.38
22.71
30.44
37.63
44.74
52.85
58.98
66.10
74.95
85.94
91.69
99.26
16.18
24.28
32.99
40.22
47.81
56.12
62.77
70.36
79.87
91.80
98.08
106.44
18.08
25.74
34.83
42.68
50.92
58.96
66.44
74.58
85.08
97.39
104.29
113.28
SISTEMA MÉTRICO
Q
Precip.
mm/h
12
14
14
16
16
18
19
20
21
25
27
28
13
15
16
17
17
19
18
20
22
23
26
25
14
15
17
18
18
19
19
21
22
23
24
25
15
16
19
18
18
19
19
21
22
23
24
25
V
Precip.
mm/h
14
16
16
19
19
21
22
23
25
29
32
32
15
17
18
20
20
21
21
24
25
27
30
29
16
18
20
20
20
22
22
24
25
26
28
29
17
19
22
21
21
22
22
24
25
27
27
29
Presión
bares
5.5
6.0
6.2
6.5
6.9
tt
tt
tt
tt
tt
t
tt
tt
tt
t
tt
tt
tt
tt
t
Boquilla
4
6
8
10
12
14
16
18
20
22
24
26
12
14
16
18
20
22
24
26
14
16
18
20
22
24
26
20
22
24
26
Radio
m
11.9
13.7
14.9
16.8
18.5
19.2
20.4
21.0
21.6
22.8
23.5
24.1
18.6
19.6
20.9
21.5
22.1
22.9
23.9
24.1
19.8
21.0
21.7
22.5
23.4
24.1
24.3
22.9
23.5
24.1
24.7
Caudal
m3⁄h
1.13
1.62
2.25
2.70
3.23
3.72
4.22
4.74
5.42
6.19
6.62
7.14
3.30
3.96
4.45
4.95
5.65
6.71
6.92
7.50
4.06
4.54
5.04
5.89
6.84
7.22
7.91
6.09
6.97
7.45
8.24
Caudal
l/m
18.90
26.84
37.02
44.60
53.66
61.98
70.28
78.97
90.30
103.15
110.33
119.05
55.07
66.06
74.12
82.56
94.18
108.12
115.31
125.08
67.75
75.70
84.02
98.19
112.73
120.25
131.76
101.43
116.19
124.14
137.39
Q
Precip.
mm/h
16
17
20
19
19
20
20
21
23
24
24
25
19
21
20
21
23
26
24
26
21
21
21
23
25
25
27
23
25
26
27
V
Precip.
mm/h
18
20
23
22
22
23
23
25
27
28
28
28
22
24
24
25
27
30
28
30
24
24
25
27
29
29
31
27
29
30
31
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
Boquillas Rain Curtain™ 8005
74
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
Guía de boquillas de repuesto Rain Curtain™
Guía de referencia cruzada para boquillas Rain Curtain™
Guía de referencia cruzada para boquillas Rain Curtain™
Hunter vs. Rain Bird
Toro® vs. Rain Bird
®
Si está
reemplazando:
PGP
1
2
3
4
5
6
7
8
9
10
11
12
Utilice esta boquilla Rain Bird
Por flujo
Por radio
Serie 5000
Serie 5000
1.5
1.5
2.0
2.0
2.5
2.5
3.0
3.0
4.0
4.0
5.0
5.0
8.0
6.0
8.0
8.0
Hunter vs. Rain Bird Rotores de 3/4" (1.9 cm)
Si está
reemplazando:
I-20
0.5 SR
1.0 SR
2.0 SR
0.75 SR
1.5 SR
3.0 SR
1.0
1.5
2.0
3.0
3.5
4.0
6.0
8.0
Utilice esta boquilla Rain Bird
Por flujo
Por radio
Serie 5000
5500
Serie 5000
5500
18S
18S
18S
18S
22S
22S
22S
26S
22S
1.5
1.5
30S
1.5
1.5
2
30S
2.0
2.0
2
2
2.5
2.5
3
2
3.0
3.0
4
3
4.0
4.0
5
3
5.0
5.0
6
4
6.0
6.0
8
8
Hunter vs. Rain Bird Rotores de 1" (2.5 cm)
Si está
reemplazando:
I-25
4
5
7
8
10
13
15
18
20
23
25
28
I-40
40
41
42
43
44
45
I-35
9
12
15
18
21
24
27
30
Utilice esta boquilla Rain Bird
Por flujo
Por radio
6504
8005
6504
8005
4
4
4
4
6
6
6
6
8
8
6
8
10
10
8
8
12
12
10
10
12
12
12
12
14
14
14
12
16
16
16
14
18
18
18
14
22
16
24
20
26
22
6504
8005
6504
8005
8
8
6
8
12
12
10
10
12
12
10
12
16
16
14
14
18
20
18
16
22
20
6504
8005
6504
8005
8
8
8
8
12
12
10
10
14
14
12
12
16
16
14
14
18
18
14
14
22
16
16
24
16
16
26
20
El uso inteligente del agua.™
Toro vs. Rain Bird Rotores de 3/4" (1.9 cm)
Si está
reemplazando:
Super 800
0.5
0.75
1.0
2.0
2.5
3.0
4.0
6.0
8.0
Utilice esta boquilla Rain Bird
Por flujo
Por radio
Serie 5000
Serie 5000
1.5
1.5
2.5
2.0
3.0
2.5
4.0
2.5
5.0
3.0
6.0
4.0
8.0
5.0
Rotores
Hunter vs. Rain Bird Rotores de 3/4" (1.9 cm)
Toro vs. Rain Bird Rotores de 3/4" (1.9 cm)
Si está
reemplazando:
TR50
1.0
1.5
2.0
3.0
4.5
6.0
7.5
9.0
Utilice esta boquilla Rain Bird
Por flujo
Por radio
Serie 5000
5505
Serie 5000
5505
1.5
1.5
2
2
2.0
2.0
2
3
3.0
3.0
3
3
4.0
4.0
5
3
5.0
4.0
6
4
6.0
4.0
8
4
8.0
5.0
10
4
Toro vs. Rain Bird Rotores de 1" (2.5 cm)
Si está
reemplazando:
Toro 2001
9
12
15
18
24
TR70
7
9
12
16
20
24
27
Toro 640
40
41
42
43
44
Utilice esta boquilla Rain Bird
Por flujo
Por radio
6504
8005
6504
8005
10
10
10
10
12
12
12
12
16
16
14
14
18
20
18
16
22
20
6504
8005
6504
8005
8
8
6
8
8
8
8
12
12
10
10
16
16
14
12
20
14
14
20
16
14
20
18
16
6504
8005
6504
8005
8
8
8
10
10
12
10
10
14
14
12
12
16
16
14
14
18
20
16
14
75
Rotores
2045A Maxi-Paw™
2045A Maxi-Paw™
Rango operativo
Aplicaciones con agua sucia: espaciamiento de hasta 45 pies (13.7 m)
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
t&TQBDJBNJFOUPEFBQJFTEFBN
t¶OEJDFEFGMVKPEFBHQNEFBN3/h; de 0.6 a 31.2 l/m)
t3BEJPEFBQJFTEFBN
t1SFTJØOEFBQTJBCBSFT
Q 'MFYJCJMJEBEGMVKPEJSFDUPQBSBBQMJDBDJPOFTDPOBHVBTVDJB
Q Confiabilidad: transmisión de impacto probada
Q Rendimiento: cinco boquillas MPR codificadas por color intercambiables
Características
Especificaciones
Rotores
t$PNCJOBDJØOEFFOUSBEBIFNCSBJOGFSJPSEF1⁄2" (15/21) o 3⁄4" (20/27)
t*OTUBMBDJØOZNBOUFOJNJFOUP
t 1⁄2" (15/21) entrada hembra lateral
- No se requieren herramientas para cambiar las boquillas
t#PRVJMMBTSPKP
OFHSP
B[VM
BNBSJMMP
CFJHF
- Se puede hacer el mantenimiento desde la parte superior de la cubierta
t#PRVJMMBTEFÈOHVMPCBKP-"OFHSP
-"BNBSJMMP
PQDJPOBM
t4PMVDJPOFTEFEJTF×P
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEF¡
%PTCPRVJMMBTEFÈOHVMPCBKP-"
JOUFSDBNCJBCMFTPQDJPOBMFT
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMBEFÈOHVMPCBKPEF¡
- Brazo con doble peso para una rotación más lenta y una distancia de
t/PTFSFDPNJFOEBMBJOTUBMBDJØOEFMBFOUSBEBMBUFSBMFODMJNBTDPOUFNQFSBUVSB
alcance aumentada
bajo cero
- Resorte de brazo ajustable para lograr un funcionamiento a baja presión y
bajo consumo de agua
Dimensiones
'VODJPOBNJFOUPBCBKBQSFTJØOZCBKPDPOTVNPEFBHVBRVFBIPSSBFOFSHÓB
t"MUVSBUPUBM3⁄10" (23.6 cm)
$ÓSDVMPDPNQMFUPPBSDPBKVTUBCMFEF¡B¡
t%JÈNFUSPTVQFSJPSDN
$IPSSPUVCVMBSEFQSFDJTJØO1+™
Modelos
- Alfiler del aspersor para controlar la distancia
t".BYJ1BX
1BMBODB'1QBSBGVODJPOBNJFOUPEFDÓSDVMPDPNQMFUPPDÓSDVMPQBSDJBM
- Combinación de entrada inferior de 1/2” (1.3 cm) (15/21) o 3/4” (1.9 cm) (20/27) t".BYJ1BX4".
t".BYJ1BX4"./1
t%VSBCJMJEBE
- Cubierta de plástico de gran resistencia con diseño nervado reforzado y sólido
Boquillas disponibles
%FTFOHBODIFJOUFSOPEFMJNQJF[BBVUPNÈUJDBDPOQBMBODBJOUFSJPSNFKPSBEB
t5SBZFDUPSJBFTUÈOEBS
- Potente acción inversa
t«OHVMPCBKP-"-"
- Cojinete cubierto para mayor durabilidad
+VOUBMJNQJBEPSBNVMUJGVODJØOBDUJWBEBBQSFTJØO
- Entrada con malla de filtro
Opciones
t4FBM".BUJD™ (SAM) interno que evita el encharcamiento y
la erosión provocados por el drenaje de los aspersores bajos, y
ahorra agua (retiene 10’ [3.1 m] o aspersor)
t5BQBWJPMFUBRVFGBDJMJUBMBJEFOUJGJDBDJØOEFMPTTJTUFNBTQBSBBHVBOPQPUBCMF
2045A Maxi-Paw
Llave Maxi-Paw®
t1BSBSFUJSBSFMFOTBNCMFJOUFSOPEFMBDVCJFSUB
Cómo especificar
2045A- SAM-10- LA
Modelo
t
Característica
opcional
Ángulo bajo
Boquilla
Tamaño de la boquilla
10
Característica opcional
SAM
Modelo
2045A Maxi-Paw
42064
Con su flujo de agua directo y pocas partes movibles, el Maxi-Paw brinda una distribución de agua superior en las condiciones
de agua más difíciles.
76
El uso inteligente del agua.™
Rotores
Rendimiento de Maxi-Paw™
Presión
psi
25
35
45
55
60
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t
Boquilla
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
06
07 LA
07
08
10 LA
10
12
Radio
pies
22
32
35
25
38
39
37
23
37
38
29
41
42
38
25
39
40
31
42
44
38
25
41
41
32
43
45
38
25
41
42
32
44
45
Rendimiento de Maxi-Paw™
Q
Caudal Precip.
gpm
pulg./h
1.5
0.60
2.2
0.41
2.8
0.44
3.4
1.05
4.2
0.56
5.5
0.70
2.0
0.28
1.9
0.69
2.7
0.38
3.3
0.44
4.0
0.92
4.8
0.55
6.3
0.69
2.3
0.31
2.1
0.65
3.0
0.38
3.7
0.45
4.5
0.90
5.4
0.59
7.1
0.71
2.5
0.33
2.3
0.71
3.3
0.38
4.1
0.47
5.0
0.94
6.0
0.62
7.9
0.75
2.6
0.35
2.4
0.74
3.5
0.40
4.2
0.46
5.4
1.02
6.4
0.64
8.4
0.80
V
Precip.
pulg./h
0.69
0.48
0.51
1.21
0.65
0.80
0.32
0.80
0.44
0.51
1.06
0.64
0.79
0.35
0.75
0.44
0.51
1.04
0.68
0.82
0.39
0.82
0.44
0.54
1.09
0.72
0.87
0.40
0.85
0.46
0.53
1.17
0.74
0.92
Presión
bares
2.0
2.5
3.0
3.5
4.0
Boquilla
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
6
07 LA
7
8
10 LA
10
12
Radio
m
6.8
10.4
11.0
8.1
11.9
12.3
11.3
7.1
11.4
11.7
8.9
12.5
12.9
11.5
7.5
11.8
12.1
9.4
12.8
13.3
11.6
7.6
12.2
12.4
9.6
13.0
13.6
11.6
7.6
12.5
12.7
9.8
13.3
13.7
SIST. MÉTRICO
Q
V
Caudal Caudal Precip. Precip.
m3⁄h l/m
mm/h mm/h
0.38 6.0
16
19
0.55 9.0
10
12
0.68 11.4 11
13
0.83 13.8 25
29
1.01 16.8 14
16
1.32 22.2 18
20
0.46 7.8
7
8
0.44 7.2
17
20
0.62 10.2 10
11
0.76 12.6 11
13
0.92 15.6 23
27
1.11 18.6 14
16
1.45 24.0 18
20
0.51 8.4
8
9
0.47 7.8
17
19
0.67 11.4 10
11
0.83 13.8 11
13
1.01 16.8 23
27
1.21 20.4 15
17
1.59 26.4 18
21
0.55 9.0
8
9
0.50 8.4
17
20
0.72 12.0 10
11
0.89 15.0 12
13
1.09 18.0 23
27
1.30 21.6 15
18
1.72 28.8 19
21
0.58 9.6
9
10
0.54 9.0
18
21
0.78 13.2 10
11
0.94 15.6 12
14
1.19 19.8 25
29
1.42 23.4 16
19
1.86 31.2 20
23
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Datos de rendimiento obtenidos en condiciones de cero viento.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Boquillas 2045A Maxi-Paw
El uso inteligente del agua.™
77
Rotores
www.rainbird.com/rotors
2045A Maxi-Paw™
Rotores
4FSJFT54+:54+134
Series TSJ Y TSJ-PRS
+VOUBTBSUJDVMBEBTRVFDPOFDUBOWÈMWVMBTEFBDPQMBNJFOUPSÈQJEPP
SPUPSFTEF£wDN
ZwDN
BMBTUVCFSÓBTMBUFSBMFT
Q El diseño patentado de codo curvado minimiza la turbulencia y la pérdida
de presión mientras que maximiza el rendimiento del rotor
t"MUPÓOEJDFEFQSFTJØOPQFSBUJWBQTJCBS
QFSGFDUPQBSBTVVTPFO
condiciones de presión constante
t&OUSBEBEFMMBWFEJTQPOJCMFFOKVOUBTBSUJDVMBEBTEFDN
t$POTVMUFMBTUBCMBTQBSBWFSMBDPNQBSBDJØOEFQÏSEJEBEFQSFTJØOZMB
regulación de la presión
Q Sin ángulos internos filosos (como tienen algunos competidores)
Información sobre la aplicación de TSJ-PRS
Q Sin obstrucciones internas (como tienen algunos competidores)
t/PTFSFDPNJFOEBVUJMJ[BS54+134FOTJTUFNBTEPOEFMBQSFTJØOEFMBTMÓOFBT
laterales sea igual o menor que la presión de regulación nominal, dado que
el descenso incrementado de la presión puede afectar desfavorablemente su
rendimiento.
t1BSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF3BJO#JSESFDPNJFOEBRVFMPT
índices de flujo en la línea de suministro no superen los 5 pies/s (1.5 m/s).
&MNPEFMP54+134OPUJFOFDPNPQSPQØTJUPGVODJPOBSDPNPEJTQPTJUJWPEF
prevención de "golpes de ariete".
t/PDPOUJFOFQJF[BTRVFSFRVJFSBONBOUFOJNJFOUPEFMVTVBSJP&MSFTPSUF
interno está bajo compresión. No abra la unidad PRS bajo ninguna
circunstancia.
Características
Rotores
t6OJEBEFTQSFFOTBNCMBEBTRVFBIPSSBOUJFNQPZSFEVDFOMPTDPTUPTEF
instalación
t&YDFMFOUFJOUFHSJEBEFTUSVDUVSBMEFCJEPBMEJTF×PEFDPEPDVSWBEPRVF
reduce los costos asociados con las fallas por fatiga
t&OUSBEBTSPTDBEBTEFHSBOUBNB×PFNQV×BEVSBTFYUSBHSBOEFTZSFUFOFT
grandes bien visibles que simplifican la torsión manual
t&MFNQBRVFEPCMFQBUFOUBEPCSJOEBNBZPSQSPUFDDJØOBOUFQÏSEJEBTZ
mantiene las roscas libres de suciedad durante la instalación
t-BWFOUJMBDJØOEFBMJWJPEFQSFTJØOCBKBFWJUBRVFMBQSFTJØOTFBDVNVMF
entre el empaque principal y el secundario cuando la junta articulada está
ensamblada en agua, lo que elimina los empaques fundidos
t$POTUSVJEPDPO17$SÓHJEP5JQP*QBSBCSJOEBSNBZPSEVSBDJØODMBTJGJDBDJØO
#EFMBDFMEBRVFDVNQMFDPOMBOPSNB"45.%5PEBTMBTSPTDBT
EF/15DMBWJKBTZMMBWFTTPOEF17$4DIFEVMFTFHÞOMBTOPSNBT"45.
%Z%
Características únicas de TSJ-PRS
t.BOUJFOFVOBQSFTJØODPOTUBOUFZVOJGPSNFFOFMSPUPSJOEFQFOEJFOUFNFOUF
de la boquilla usada:
QTJCBSFT
QBSBKVOUBTBSUJDVMBEBTEF£wDN
- 70 psi (4.8 bares) para juntas articuladas de 1” (2.5 cm)
t1FSNJUFRVFMPTSPUPSFTEFDBEB[POBGVODJPOFOBVOBNJTNBQSFTJØOMPDVBM
mejora la coherencia y el rendimiento de todo el sistema
t3FEVDFMBOFCVMJ[BDJØOZPUSPTQSPCMFNBTEFSFOEJNJFOUPPDBTJPOBEPTQPSMB
alta presión
t-BDBSDBTBEFMSFHVMBEPSFTUÈDPOTUSVJEBDPO17$RVFDPJODJEFDPOMB
clasificación de alta presión de la junta articulada para césped Rain Bird y
supera la clasificación de presión de los rotores
t&MEJBGSBHNBFTUÈDPOTUSVJEPDPOVOBUFMBSFGPS[BEBDPOFMBTUØNFSP
para una mayor vida útil
t&MGJMUSPQPSPTPCSJOEBVOBSFGFSFODJBBUNPTGÏSJDBTJOQFSNJUJSRVFJOHSFTF
contaminación, lo que permite que el sistema se pueda enterrar
en cualquier tipo de suelo
Modelos
t54+wDN
EFMPOHJUVEKVOUBBSUJDVMBEB.Y./15EF
3
/4” (1.9 cm) (20/27)
t54+DN
EFMPOHJUVEKVOUBBSUJDVMBEB.Y./15EF
1" (2.5 cm) (26/34)
t54+DN
EFMPOHJUVEKVOUBBSUJDVMBEB.Y./15EF
1" (2.5 cm) (26/34)
t54+1343/4” (1.9 cm) con regulador de presión de 45 psi (3.1 bares), 12”
DN
EFMPOHJUVEFOUSBEBZTBMJEB.Y./15EF3/4” (1.9 cm) (20/27)
t54+134KVOUBBSUJDVMBEBEFDN
DPOSFHVMBEPSEFQSFTJØOEF
QTJCBSFT
wDN
EFMPOHJUVEFOUSBEBZTBMJEB.Y./15EF
1" (2.5 cm) (26/34)
Rango operativo
t¶OEJDFEFQSFTJØOQTJB'CBSFTB$
TFHÞO"45.%
- Probado sin pérdidas por 60 minutos a 790 psi (54.5 bares)
- Probado sin pérdidas durante una corta exposición a 1000 psi
(68.9 bares)
t1ÏSEJEBEFQSFTJØOEFKVOUBTEF£QTJBHQNCBSBMT
t1ÏSEJEBEFQSFTJØOEFKVOUBTEFQTJBHQNQTJBHQNCBS
a 1.1 l/s; 0.2 bar a 1.5 l/s)
t'MVKPNÈYJNPEF54+134HQNMT
TSJ-075-PRS, TSJ-100-PRS
TSJ-12075, TSJ-12,
TSJ-18
-BTFSJF54+134DPOTFSWBFMBHVBSFEVDJFOEPMBOFCVMJ[BDJØOZPUSPTQSPCMFNBTEFSFOEJNJFOUPPDBTJPOBEPTQPSMPTTJTUFNBTEFBMUBQSFTJØO
78
El uso inteligente del agua.™
Rotores
www.rainbird.com/rotors
4FSJFT54+:54+134
TSJ-100-PRS
70
60
50
TSJ-075-PRS
40
30
20
20 30
40
50
60
70
80
90 100 110 120 130 140 150
Presión de entrada de la junta articulada (psi)
SIST. MÉTRICO
5.5
TSJ-100-PRS
4.8
4.1
3.5
TSJ-075-PRS
2.8
2.1
1.4
1.4 2.1 2.8 3.5 4.1 4.8 5.5 6.2 6.9 7.6 8.3 9.0 9.7 10.3
Presión de entrada de la junta articulada (bares)
Rotores
Salida de la junta articulada (entrada del rotor)
Presión (psi)
80
Salida de la junta articulada (entrada del rotor)
Presión (bares)
Regulación de presión de TSJ-PRS
Regulación de presión de TSJ-PRS
Especificaciones de las juntas articuladas
Número de modelo
EE. UU.
54+
54+
54+
54+134
54+134
Longitud
4*45.²53*$0
12"
12"
18"
12"
12"
HOLDUPTOOL
(herramienta de
sostén) con nivel de
burbuja
Características
t-BDPNCJOBDJØOFOUSFMBIFSSBNJFOUB
de sostén y el nivel de burbuja
permite una instalación adecuada y
más fácil
t'VODJPOBDPOMBT4FSJFT
'BMDPO® 6504 y 8005
30.5 cm
30.5 cm
45.7 cm
30.5 cm
30.5 cm
EE. UU.
Entrada
4*45.²53*$0
£.
1" M
1" M
£.
1" M
20/27 M
26/34 M
26/34 M
20/27 M
26/34 M
EE. UU.
£.
1" M
1" M
£.
1" M
Salida
4*45.²53*$0
20/27 M
26/34 M
26/34 M
20/27 M
26/34 M
Rosca
Regulación de presión
EE. UU.
4*45.²53*$0
/15
/15
/15
/15
/15
n/c
n/c
n/c
45 psi
70 psi
n/c
n/c
n/c
45 psi
70 psi
ROTORTOOL
Calculadores de ahorro de agua en línea
Características
Rain Bird posee varios calculadores en línea disponibles que lo ayudarán a
mostrarles a los clientes los porcentajes de ahorro de agua potenciales que se
obtienen al usar los rotores y las boquillas de riego eficiente Rain Bird:
t3PUPSFT4FSJFZ1MVT134
t#PRVJMMBTQBSBSPUPS4FSJFZ1MVT.13
t+VOUBTBSUJDVMBEBT54+134
t%FTUPSOJMMBEPSEFDBCF[BQMBOBZ
herramienta para jalar y sostener el
vástago en una misma unidad
Modelo
t30503500-
HOLDUPTOOL
El uso inteligente del agua.™
Disponibilidad
www.rainbird.com/calculators
ROTORTOOL
79
Impactos
Introducción
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
Válvulas
Rain Bird lanzó el primer aspersor de
impacto en el mercado en 1933 (Patente
N.º 1,997,901), y así dio comienzo a la era
de las técnicas de irrigación modernas. Este
compromiso con el diseño de aspersores de
impacto superiores y eficientes es tan fuerte
hoy como lo fue hace 80 años y se hace
evidente en cada producto que ofrecemos.
Accesorios
Productos principales
Programadores
Aplicaciones primarias
Pendientes
Sistemas de control
centralizado
Cubierta vegetal/Arbustos
Sistemas de baja presión
Áreas de viento excesivo
Aguas residuales
2045-PJ
Maxi-Bird
20ADJB
25BPJ-ADJ
35A-TNT
65PJADJ-TNT
tt
tt
t
tt
tt
t
tt
tt
t
tt
t
tt
t
Xerigation®
Bombas
Sugerencias para ahorrar agua
Drenaje
t Los aspersores de impacto Rain Bird se
Recursos
diseñaron para satisfacer los requisitos
exigentes de la irrigación agrícola. Estos
productos han probado ser tolerantes a la
arenilla y resistentes al agua dura.
t Los modelos de círculo completo y círculo
t Una gran selección de boquillas, que
parcial incluyen mecanismos motrices que
se han refinado para proporcionar el
funcionamiento más confiable y eficaz
que se ofrece actualmente en la industria.
se utilizan en un amplio rango de
presión, le garantiza que podrá
encontrar un aspersor especialmente
diseñado para sus necesidades.
Referencia
80
El uso inteligente del agua.™
Impactos
1+.BYJ#JSE™
www.rainbird.com/impacts
2045-PJ Maxi-Bird™
Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubería de
elevación utilizado para aplicaciones sobre el terreno en pendientes y áreas
grandes
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFO
agua sucia
Q Confiabilidad: transmisión de impacto probada
Q Rendimiento: cinco boquillas con índices de precipitación ajustados (MPR) y
dos boquillas de ángulo bajo (LA)
Características
t#SB[PDPOEPCMFQFTPQBSBVOBSPUBDJØONÈTMFOUBZVOBNBZPS
distancia de alcance. Potente acción inversa
Impactos
t3FTPSUFEFCSB[PBKVTUBCMFQBSBMPHSBSVOGVODJPOBNJFOUPBCBKBQSFTJØOZCBKP
consumo de agua
t5VCPEFDIPSSPEFQSFDJTJØO1+™) que minimiza las salpicaduras laterales
t#PRVJMMBTJOUFSDBNCJBCMFTEFNPOUBKFEFCBZPOFUBDPEJGJDBEBTQPSDPMPSFT
- No se requieren herramientas para cambiar las boquillas
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPEFDÓSDVMPQBSDJBMPDPNQMFUPEF¡
B¡
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
2045-PJ-08 Maxi-Bird
t$BVEBMEFBHQNEFBN3⁄h; de 5.4 a 31.8 l/m)
t3BEJPEFBQJFTEFBN
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
Especificaciones
t#PRVJMMBTEFFOUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB¡QBSBMBTCPRVJMMBTZ
t¡QBSB-"Z-"
t#PRVJMMBTEFÈOHVMPEFUSBZFDUPSJBFTUÈOEBSSPKP
OFHSP
B[VM
10 (amarillo); 12 (beige)
t#PRVJMMBTEFÈOHVMPCBKP-"
-"OFHSP-"BNBSJMMPPQDJPOBM
Modelo
t1+.BYJ#JSE
2045-PJ-08 Boquillas
El uso inteligente del agua.™
81
Impactos
1+.BYJ#JSE™
Rendimiento del 2045-PJ-08 Maxi-Bird
Presión
psi
25
35
Impactos
45
55
60
Boquilla
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
t
06
07 LA
07
10 LA
10
12
06
07 LA
07
10 LA
10
12
06
07 LA
07
10 LA
10
12
06
07 LA
07
10 LA
10
12
06
07 LA
07
10 LA
10
12
Radio
pies
22
32
25
38
39
37
23
37
29
41
42
38
25
39
31
42
44
38
25
41
32
43
45
38
25
41
32
44
45
Caudal
gpm
1.5
2.2
3.4
4.2
5.5
2.0
1.9
2.7
4.0
4.8
6.3
2.3
2.1
3.0
4.5
5.4
7.1
2.5
2.3
3.3
5.0
6.0
7.9
2.6
2.4
3.5
5.4
6.4
8.4
Rendimiento del 2045-PJ-08 Maxi-Bird SISTEMA MÉTRICO
Q
Precip.
pulg./h
0.60
0.41
1.05
0.56
0.70
0.28
0.69
0.38
0.92
0.55
0.69
0.31
0.65
0.38
0.90
0.59
0.71
0.33
0.71
0.38
0.94
0.62
0.75
0.35
0.74
0.40
1.02
0.64
0.80
V
Precip.
pulg./h
0.69
0.48
1.21
0.65
0.80
0.32
0.80
0.44
1.06
0.64
0.79
0.35
0.75
0.44
1.04
0.68
0.82
0.39
0.82
0.44
1.09
0.72
0.87
0.40
0.85
0.46
1.17
0.74
0.92
Presión
bares
2.0
2.5
3.0
3.5
4.0
Boquilla
ttt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
tt
6
07 LA
7
10 LA
10
12
6
07 LA
7
10 LA
10
12
6
07 LA
7
10 LA
10
12
6
07 LA
7
10 LA
10
12
6
07 LA
7
10 LA
10
12
Radio
m
6.8
10.4
8.1
11.9
12.3
11.3
7.1
11.4
8.9
12.5
12.9
11.5
7.5
11.8
9.4
12.8
13.3
11.6
7.6
12.2
9.6
13.0
13.6
11.6
7.6
12.5
9.8
13.3
13.7
Caudal Caudal
m3⁄h l/m
0.38 6.0
0.55 9.0
0.83 13.8
1.01 16.8
1.32 22.2
0.46 7.8
0.44 7.2
0.62 10.2
0.92 15.6
1.11 18.6
1.45 24.0
0.51 8.4
0.47 7.8
0.67 11.4
1.01 16.8
1.21 20.4
1.59 26.4
0.55 9.0
0.50 8.4
0.72 12.0
1.09 18.0
1.30 21.6
1.72 28.8
0.58 9.6
0.54 9.0
0.78 13.2
1.19 19.8
1.42 23.4
1.86 31.2
Q
Precip.
mm/h
16
10
25
14
18
7
17
10
23
14
18
8
17
10
23
15
18
8
17
10
23
15
19
9
18
10
25
16
20
V
Precip.
mm/h
19
12
29
16
20
8
20
11
27
16
20
9
19
11
27
17
21
9
20
11
27
18
21
10
21
11
29
19
23
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Tamaño de la boquilla estándar
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE;
ASABE S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se
encuentra en la página 234.
82
El uso inteligente del agua.™
Impactos
www.rainbird.com/impacts
"%+#
Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubería de
elevación utilizado en aplicaciones de pendientes o áreas sin césped
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisión de impacto probada
Q %VSBCJMJEBE FTUSVDUVSBEFMBUØOSFTJTUFOUF
Rendimiento del modelo 20ADJB
Presión
psi
Boquilla
30
08
09
08
09
08
09
08
09
08
09
40
Características
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMEFEJTUBODJBRVFQFSNJUFVOBSFEVDDJØOEFM
radio de hasta un 25% sin cambiar las boquillas
50
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
60
t3BEJPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 9.0 a 22.2 l/m)
70
Especificaciones
Radio
pies
38
39
39
40
40
41
40
41
40
41
Caudal
gpm
2.4
3.1
2.9
3.6
3.2
4.0
3.6
4.4
3.9
4.8
Q
Precip.
pulg./h
0.16
0.20
0.18
0.22
0.19
0.23
0.22
0.25
0.23
0.27
V
Precip.
pulg./h
0.18
0.23
0.21
0.25
0.22
0.26
0.25
0.29
0.27
0.32
t&OUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)
t1BSBMBCPRVJMMBBMBQSFTJØOEFGVODJPOBNJFOUPOPSNBMFMQVOUPEFDBVEBM
más alto es 7 pies (2.1 m) por encima de la boquilla
t#PRVJMMBT
Modelo
t"%+#
Rendimiento del modelo 20ADJB
Presión
bares
Boquilla
2.1
8
9
8
9
8
9
8
9
8
9
8
9
8
9
2.5
3.0
3.5
4.0
4.5
4.8
Radio
m
11.6
11.9
11.8
12.1
11.9
12.2
12.0
12.3
12.1
12.4
12.2
12.5
12.2
12.5
SISTEMA MÉTRICO
Caudal Caudal
m3⁄h l/m
0.54 9.0
0.70 12.0
0.61 10.2
0.77 12.6
0.67 11.4
0.84 13.8
0.73 12.0
0.91 15.0
0.79 13.2
0.98 16.2
0.85 14.4
1.05 17.4
0.89 15.0
1.09 18.0
Q
Precip.
mm/h
4
5
4
5
5
6
5
6
5
6
6
7
6
7
V
Precip.
mm/h
5
6
5
6
5
7
6
7
6
7
7
8
7
8
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
20ADJB
Tamaño de la boquilla estándar
La distribución óptima del agua se alcanza a una presión de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se encuentra en
la página 234.
El uso inteligente del agua.™
83
Impactos
20ADJB
Impactos
4FSJF#1+"%+
Serie 25BPJ-ADJ
Rendimiento de la Serie 25BPJ-ADJ
Cabezal de impacto 1/2" (1.3 cm) (15/21) para montaje sobre tubería de
elevación utilizado en aplicaciones de pendientes o áreas grandes sin césped
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFO
agua sucia
Presión
psi
Boquilla
30
09
09
09
Q Confiabilidad: transmisión de impacto probada
40
Q %VSBCJMJEBEFTUSVDUVSBEFMBUØOCSPODFZBDFSPJOPYJEBCMFSFTJTUFOUF
Cuerpo y brazo de bronce, ensamble de palanca de acero inoxidable, funda
y niple de cojinete de latón. Eje de articulación, resorte del brazo,
resorte de palanca y collarines de fricción de acero inoxidable
50
Características
Radio
pies
38
39
40
Caudal
gpm
3.1
3.6
4.0
Rendimiento de la Serie 25BPJ-ADJ
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODÓSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEF¡B¡
Impactos
t$IPSSPUVCVMBSEFQSFDJTJØO1+™
FONFUBMGVOEJEPRVFNJOJNJ[BMBT
salpicaduras laterales
Presión
bares
Boquilla
2.1
9
9
9
9
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
2.5
t3BEJPEFBQJFTEFBN
3.0
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 12.0 a 19.2 l/m)
3.5
Especificaciones
Radio
m
11.6
11.8
12.0
12.2
Q
Precip.
pulg./h
0.41
0.46
0.48
V
Precip.
pulg./h
0.48
0.53
0.56
SIST. MÉTRICO
Caudal Caudal
m3⁄h l/m
0.70 12.0
0.77 12.6
0.85 13.8
0.91 15.0
Q
Precip.
mm/h
10
11
12
12
V
Precip.
mm/h
12
13
14
14
Los índices de precipitación se basan en un funcionamiento en semicírculo.
t&OUSBEBNBDIPSPTDBEBEF1/2" (1.3 cm) (15/21)
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB¡
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
t#PRVJMMBT
Tamaño de la boquilla estándar
La distribución óptima del agua se alcanza a una presión de 40 a 50 psi (de 2.8 a 3.5 bares)
Modelos
Datos de rendimiento obtenidos en condiciones de cero viento.
t#1+'1"%+
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se encuentra
en la página 234.
t#1+'1"%+%"
t#1+'1"%+%"5/5
t#1+&TQFDJBM
25BPJ-FP-ADJ
Boquilla de latón con alfiler del aspersor
de acero inoxidable montado en puente y
paleta tipo barril a prueba de obstrucciones.
El alfiler del aspersor permite una reducción
del radio de hasta un 25% sin necesidad de
cambiar las boquillas
25BPJ-ADJ-DA-TNT
*HVBMRVFFMNPEFMP#1+'1"%+%"
DPODPKJOFUF5/5
Cómo especificar
25BPJ-ADJ- 09
Boquilla
09
Modelo
#1+'1"%+
84
25BPJ Especial
*HVBMRVFFMNPEFMP#1+'1"%+%"
5/5DPODPMMBSJOFTEFGSJDDJØOBQSVFCB
de golpes y palanca fija y ajustada para
operar únicamente en círculo parcial
25BPJ-FP-ADJ-DA
*HVBMRVFFMNPEFMP#1+'1"%+
DPOBMFUB%"QBSBDPOUSPMEFEJTUBODJB
montada en puente
El uso inteligente del agua.™
Impactos
www.rainbird.com/impacts
4FSJF"5/5
Serie 35A-TNT
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisión de impacto probada
Q %VSBCJMJEBEFTUSVDUVSBEFMBUØOZBDFSPJOPYJEBCMFSFTJTUFOUF
Rendimiento de la Serie 35A-TNT
Presión
psi
Boquilla
30
10
11
10
11
10
11
10
11
40
Características
50
t$PKJOFUF5/5EFMBSHBEVSBDJØO
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODÓSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEF¡B¡
60
t$IPSSPUVCVMBSEFQSFDJTJØO1+™
RVFNJOJNJ[BMBTTBMQJDBEVSBTMBUFSBMFT
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMBSMBEJTUBODJBZBMFUBQBSBDPOUSPMEFEJTUBODJB
%"EFBDFSPJOPYJEBCMFRVFQFSNJUFOVOBSFEVDDJØOEFMSBEJPEFIBTUBVO
sin cambiar las boquillas
Radio
pies
42
43
44
45
45
47
46
48
Caudal
gpm
3.9
4.6
4.5
5.4
5.0
6.0
5.4
6.6
Rendimiento de la Serie 35A-TNT
Q
Precip.
pulg./h
0.43
0.48
0.45
0.51
0.48
0.52
0.49
0.55
SISTEMA MÉTRICO
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
Boquilla
t3BEJPEFBQJFTEFBN
Presión
bares
t1SFTJØOEFBQTJEFBCBSFT
2.1
10
11
10
11
10
11
10
11
10
11
10
11
t$BVEBMEFBHQNEFBN3⁄h; de 15.0 a 29.4 l/m)
2.5
Especificaciones
3
t&OUSBEBNBDIPSPTDBEBEF /4" (1.3 cm) (20/27)
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB¡
3.0
Modelos
t"5/5
3.5
t""%+5/5
t"1+%"5/5
4.0
t"1+"%+5/5
35A-PJDA-TNT
*HVBMRVFFMNPEFMP"5/5
con tubo de chorro de precisión
1+™
ZBMFUBQBSBDPOUSPMEF
EJTUBODJB%"
4.1
Radio
m
12.8
13.1
13.1
13.5
13.4
13.9
13.7
14.3
14.0
14.6
14.0
14.6
V
Precip.
pulg./h
0.49
0.55
0.52
0.59
0.55
0.60
0.57
0.64
Caudal Caudal
m3⁄h l/m
0.89 15.0
1.04 17.4
0.97 16.2
1.15 19.2
1.05 17.4
1.26 21.0
1.13 18.6
1.37 22.8
1.21 20.4
1.48 24.6
1.23 20.4
1.50 25.2
Q
Precip.
mm/h
11
12
11
13
12
13
12
13
12
14
12
14
V
Precip.
mm/h
12
14
13
15
13
15
14
16
14
16
14
16
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Tamaño de la boquilla estándar
La distribución óptima del agua se alcanza a una presión de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE S398.1. El
texto completo de la Declaración de Certificación de Prueba ASABE se encuentra en la página 234.
35A-TNT
Cojinete macho de 3/4" (1.9 cm) (20/27).
$PKJOFUF5/5ÞOJDBNFOUF$VFSQPZCSB[PEF
MBUØOGVOEJEP'VOEBZOJQMFEFDPKJOFUFEF
latón. Resorte del brazo, resorte de palanca y
collarines de palanca de acero inoxidable. La
palanca de acero inoxidable se puede
fijar para un funcionamiento de círculo
completo o parcial
El uso inteligente del agua.™
Cómo especificar
35A-PJADJ-TNT- 10
35A-PJADJ-TNT
*HVBMRVFFMNPEFMP"5/5DPO
alfiler del aspersor con control de
EJTUBODJB"%+
ZUVCPEFDIPSSPEF
QSFDJTJØO1+™
Boquilla
10
35A-ADJ-TNT
*HVBMRVFFMNPEFMP"5/5
con alfiler del aspersor para controlar
MBEJTUBODJB"%+
Modelo
"1+"%+5/5
85
Impactos
Cabezal de impacto de 3/4" (1.9 cm) (20/27) para montaje sobre tubería de
elevación utilizado en aplicaciones de pendientes o áreas grandes sin césped
Impactos
4FSJF"5/5
65PJADJ-TNT
Cabezal de impacto de 1" (2.5 cm) (26/34) para montaje sobre tubería de
elevación utilizado en aplicaciones de pendientes o áreas grandes sin césped
Q 'MFYJCJMJEBEDBVEBMEJSFDUPQBSBVOSFOEJNJFOUPTVQFSJPSFOBHVBTVDJB
Q Confiabilidad: transmisión de impacto probada
Q %VSBCJMJEBEFTUSVDUVSBEFMBUØOZBDFSPJOPYJEBCMFSFTJTUFOUF
Rendimiento de la Serie 65PJADJ-TNT
Presión
psi
Boquilla
50
60
70
80
16
16
16
16
Radio
pies
57
58
63
65
Caudal
gpm
12.9
14.2
15.4
16.5
Q
Precip.
pulg./h
0.76
0.81
0.75
0.75
V
Precip.
pulg./h
0.88
0.94
0.86
0.87
Características
t$PKJOFUF5/5EFMBSHBEVSBDJØO
Rendimiento de la Serie 65PJADJ-TNT SISTEMA MÉTRICO
t1BMBODB'1RVFQFSNJUFFMGVODJPOBNJFOUPFODÓSDVMPQBSDJBMPDPNQMFUP
"KVTUBCMFEF¡B¡
t$IPSSPUVCVMBSEFQSFDJTJØO1+™
RVFNJOJNJ[BMBTTBMQJDBEVSBTMBUFSBMFT
t"MGJMFSEFMBTQFSTPSQBSBDPOUSPMBSMBEJTUBODJBEFBDFSPJOPYJEBCMFRVFQFSNJUF
una reducción del radio de hasta un 25% sin cambiar las boquillas
Impactos
Rango operativo
t¶OEJDFEFQSFDJQJUBDJØOEFBQVMHBEBTQPSIPSBEFBNNI
t3BEJPEFBQJFTEFBN
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 48.6 a 62.4 l/m)
Especificaciones
t&OUSBEBIFNCSBSPTDBEB/15P#41EFDN
t5SBZFDUPSJBEFTBMJEBEFMBCPRVJMMB¡
Modelo
Presión
bares
Boquilla
3.5
4.0
4.5
5.0
5.5
16
16
16
16
16
Radio
m
17.4
17.9
18.5
19.2
19.8
Caudal Caudal
m3⁄h l/m
2.93 48.6
3.16 52.8
3.35 55.8
3.55 59.4
3.75 62.4
Q
Precip.
mm/h
19
20
19
19
19
V
Precip.
mm/h
22
23
23
22
22
Los índices de precipitación se basan en un funcionamiento en semicírculo.
Q Patrón de distribución cuadrado basado en un alcance del 50% de diámetro.
VPatrón de distribución triangular sobre la base de un alcance del 50% de diámetro
Tamaño de la boquilla estándar
La distribución óptima del agua se alcanza a una presión de 40 a 50 psi (de 2.8 a 3.5 bares)
Datos de rendimiento obtenidos en condiciones de cero viento.
Datos de rendimiento derivados de pruebas que cumplen con las normas ASABE; ASABE
S398.1. El texto completo de la Declaración de Certificación de Prueba ASABE se encuentra
en la página 234.
t1+"%+5/5
t1+"%+5/5#41.PEFMP#41
Cómo especificar
65PJADJ-TNT
65PJADJ-TBT
Boquilla
16
Modelo
1+"%+5/5
86
El uso inteligente del agua.™
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Válvulas
Impactos
"Instalé otras válvulas, pero la confiabilidad
no era como la de las válvulas DV de Rain
Bird®. Es por eso que durante los últimos 15
años instalé solo válvulas DV, porque no voy
a arriesgar mi reputación por nada".
Válvulas
Joe DiBlasi,
Directivo JKJ Lawn Sprinkler Inc.
Productos principales
Entrada inferior
Caudal bajo
JTV
I/E
I/E
I/E
z
z
z
z
%7"
%7'"
z
z
z
JTVF
HV
PGA
PEB
PESB/PESB-R
z
QC
I/E
I
I/E
I/E
I/E
I/E
E
E
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
z
Sitios que requieren latón
z
BPES
z
Agua no potable
z
BPE
I/E
Agua sucia
z
EFB-CP
z
$PNQBUJCMFDPO134%JBM
Sitios que requieren plástico
GB
z
Compatible con el sistema
decodificador
z
Accesorios
ASVF
Programadores
I/E
Control de caudal
DVF
Sistemas de control
centralizado
Purga manual
DV
Xerigation®
Aplicaciones primarias
Bombas
t%7%7'EJTQPOJCMFTFOMBTDPOGJHVSBDJPOFTEFHMPCPEFÈOHVMPEFFOUSBEBTMJTBTZNBDIPYDPOFDUPSEFQVOUB
t1BSBVODBVEBMJOGFSJPSBHQNN3IMT
JOTUBMFVOGJMUSP3#:EFDPSSJFOUFBTDFOEFOUFt*&JOUFSOPFYUFSOP
t+57+57'EJTQPOJCMFTFOMBTDPOGJHVSBDJPOFTEFHMPCPEFFOUSBEBTMJTBTZNBDIPYDPOFDUPSEFQVOUB
t-BTWÈMWVMBT1&4#3(#Z&'#$1FTUÈOFTQFDÓGJDBNFOUFEJTF×BEBTDPODPNQPOFOUFTSFTJTUFOUFTBMDMPSPQBSBMBTBQMJDBDJPOFTEFBHVBSFDJDMBEB
Drenaje
Sugerencias para ahorrar agua
El uso inteligente del agua.™
t Las válvulas de Rain Bird
proporcionan características
de filtración excelentes para
obtener la máxima fiabilidad
en entornos muy diversos.
t Las válvulas de agua reciclada
1&4#3(#Z&'#$1CSJOEBOVO
funcionamiento confiable en todas las
condiciones de agua. Los diafragmas
de las válvulas están compuestos de
&1%.VONBUFSJBMEFHPNBRVFFT
resistente al cloro y a los químicos.
Recursos
para regular la presión de salida de
la válvula, independientemente de
las fluctuaciones de la presión de
entrada. Ayuda a garantizar la presión
óptima en el aspersor.
Referencia
t 134%JBMFTVONFEJPFYDFMFOUF
87
Válvulas para contratistas
4FSJF%7
Especificaciones eléctricas
Serie DV
Q %JTF×PEFDBVEBMQJMPUPDPOEPCMFGJMUSBDJØOQBSBVOBNÈYJNB
confiabilidad
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT
Q %JBGSBHNBDPOQSFTJØOCBMBODFBEBEFMBSHBEVSBDJØO
Dimensiones
Q Solenoide encapsulado de baja potencia que ahorra energía, con
émbolo cautivo y filtro de solenoide con malla 90 (200 micrones)
t"MUVSB1⁄2" (11.4 cm)
t"MUVSBÈOHVMP
1⁄2" (14 cm)
t-BSHP3⁄8" (11.1 cm)
t-BSHPÈOHVMP
3⁄4" (9.5 cm)
t-BSHP.#
3⁄4" (14.6 cm)
t"ODIP1⁄3" (8.4 cm)
3
Válvulas residenciales de plástico de /4", 1" (1.9 cm, 2.5 cm)
(20/27, 26/34)
Características
Válvulas
t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUÓDVMBT
de suciedad durante la instalación y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJØONBOVBMFOTFDP
t%JBGSBHNB#VOB/DPOGJMUSPEFBHVBQJMPUPDPONBMMBNJDSPOFT
de limpieza automática y resorte cautivo
t'VODJPOBFOBQMJDBDJPOFTEFDBVEBMCBKPZSJFHPQPSHPUFP
DVBOEPFMGJMUSP3#:FTUÈJOTUBMBEPBHVBTBSSJCB6OBPQDJØOQBSBMBT
aplicaciones de caudal bajo (3 gpm o menos; 0.68 m3/h; 11.4 l/m) es usar
VOBWÈMWVMBQBSBDBVEBMCBKP-'7DPOTVMUFMBQÈHJOB
PFM
kit de control de zona para riego por goteo (consulte la página 191)
t5PSOJMMPTEFDBCF[B1IJMMJQTDVBESBEBEFBDFSPJOPYJEBCMFEF1/4" (3.2 cm)
t(BSBOUÓBDPNFSDJBMEFDJODPB×PT
Opciones
t$POGJHVSBDJØOEFFOUSBEBTMJTBTQBSBJOTUBMBDJPOFTEFCBKPDPTUPDPO
uniones cementadas
t$POGJHVSBDJØONBDIPYDPOFDUPSEFQVOUBQBSBJOTUBMBDJØODPOUVCPEF
polietileno
t$POGJHVSBDJØOEFÈOHVMPQBSBJOTUBMBDJPOFTGMFYJCMFTFTQFDJBMNFOUF
cuando los conductos secundarios son profundos
t"ENJUFTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
Rain Bird que funcionan a pilas
Modelos
t%73⁄4
/15
t%7IFNCSBYIFNCSB/15EFDN
t%744FOUSBEBTMJTBTEFDN
t%7"IFNCSBYIFNCSB/15EFDN
t%7.#NBDIPYDPOFDUPSEFQVOUBEFDN
*Disponible con roscas BSP
Recomendaciones
1.Rain Bird recomienda que los índices de caudal que producen velocidad de descarga en la línea
EFTVNJOJTUSPOPTVQFSFOMPTQJFTTNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Las válvulas de la serie DV y las otras válvulas de uso residencial de Rain Bird no se pueden
utilizar con módulos reguladores de presión PRS.
3. No se recomienda su uso con sistemas de dos cables.
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFMBWÈMWVMB%7EFBHQNEFBN3⁄h; de 0.76 a
83.3 l/m).
t$BVEBMEFMBWÈMWVMB%7EFBHQNEFBN3⁄h; de 0.76
a 151.4 l/m).
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
075-DV
100-DV
Cómo especificar
100 - DV - MB
Configuración opcional:
MB: Macho x conector
de punta
A: Ángulo
SS: entradas lisas
Modelo
%7WÈMWVMBEFDPOUSPMSFNPUP
ASV: válvula antisifón
Tamaño
075: 3⁄4" (20/27);
100: 1" (26/34)
Aquí se especifica una válvula 100-DV; macho x conector de
QVOUBEFDN
DPODPOUSPMEFMDBVEBMNota:
para aplicaciones fuera de EE.UU., es necesario especificar si
el tipo de rosca debe ser NPT o BSP (sólo 1" [2.5 cm]).
100-DV-MB
88
100-DV-A
100-DV-SS
El uso inteligente del agua.™
Válvulas para contratistas
www.rainbird.com/valves
4FSJF%7'
Serie DVF
Pérdida de presión de las válvulas DV y DVF (psi)
Válvulas residenciales de plástico, de 1" (2.5 cm) (26/34) con control de caudal
Q Válvula de riego económico para aplicaciones residenciales y
comerciales livianas en donde se requiere control de caudal
Q *ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMBTWÈMWVMBTTFSJF%7
Q Sintonización del sistema un 60% más fácil con control de caudal
de dirección asistida, un exclusivo mecanismo asistido por presión,
patentado y fácil de accionar
Q La manija de control de caudal es extraíble para evitar el vandalismo
Caudal
gpm
1
3
5
10
20
30
40
075-DV
3
⁄4" psi
3.2
3.9
4.2
5.0
7.7
-
100-DV/100-DVF
1" psi
3.3
3.6
3.8
3.8
5.1
6.4
8.6
Rango operativo
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT
Pérdida de presión de las válvulas DV y DVF (bares) SIST. MÉTRICO
Caudal
m3⁄h
0.23
0.60
1.20
3.60
4.50
6.00
9.00
l/m
4
10
20
60
75
100
150
075-DV
⁄4" bares
0.22
0.26
0.29
0.45
0.53
-
100-DV/100-DVF
1" bar
0.23
0.24
0.26
0.32
0.35
0.41
0.59
3
Dimensiones
Pérdida de presión de las válvulas 100-DV/DVF de ángulo, MxB (psi)
t"MUVSB3⁄5" (14.2 cm)
t"MUVSBÈOHVMP
1⁄8" (15.5 cm)
t-BSHP3⁄8" (11.1 cm)
t-BSHPÈOHVMP
3⁄4" (9.5 cm)
t-BSHP.#
3⁄4" (14.6 cm)
t"ODIP1⁄3" (8.4 cm)
Caudal
gpm
1
3
5
10
20
30
40
Vista transversal de una
válvula DVF
Modelos
t%7'IFNCSBYIFNCSB/15EFDN
t%7'44FOUSBEBTMJTBTEFDN
t%7'"/15EFDN
t%7'.#NBDIPYDPOFDUPSEFQVOUBEF
1" (2.5 cm) (26/34)
*Disponible con roscas BSP
100-DVF
Recomendaciones
1.Rain Bird recomienda que los índices de caudal que
QSPEVDFOWFMPDJEBEEFEFTDBSHBFOMBMÓOFBEFTVNJOJTUSPOPTVQFSFOMPTQJFTT
NT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Las válvulas de la serie DV y las otras válvulas de uso residencial de Rain Bird no se
pueden utilizar con módulos reguladores de presión PRS.
3. No se recomienda su uso con sistemas de dos cables.
Ángulo
1" psi
2.8
3.0
3.2
3.9
4.3
5.4
8.2
Macho x conector de punta
1" psi
2.5
2.9
3.0
3.1
4.3
7.4
12.7
Pérdida de presión de las válvulas 100-DV/DVF de ángulo, MxB (bares) SIST. MÉTRICO
Caudal
m3/h
0.23
0.60
1.20
3.60
4.50
6.00
9.00
l/m
4
10
20
60
75
100
150
Ángulo
1" bar
0.19
0.20
0.22
0.28
0.30
0.35
0.56
Macho x conector de punta
1" bar
0.17
0.19
0.21
0.26
0.30
0.44
0.86
Nota: consulte la sección Xerigation (página 200) para
PCUFOFSEBUPTTPCSFQÏSEJEBEFDBVEBMEFMGJMUSP3#:
Nota: para caudales superiores a 30 gpm (6.81 m3I
MN
OPTFSFDPNJFOEBOMBTWÈMWVMBT%7%7'
macho x conector de punta
100-DVF-SS
100-DVF-A
100-DVF-MB
El uso inteligente del agua.™
89
Válvulas
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFMBWÈMWVMB%7'EFBHQNEFBN3⁄h; de
0.76 a 151.40 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Válvulas para contratistas
4FSJF"47'
Serie ASVF
Válvulas residenciales con vacuo regulador de recaudal de 3/4", 1"
(1.9 cm, 2.5 cm) (20/27, 26/34)
Q $PNCJOBDJØODPOGJBCMFEFWÈMWVMB%7'ZWÈMWVMBWBDVPSFHVMBEPSBFO
una unidad
Q Homologado por I.A.P. M.O. y A.S.S.E
Q Homologado en ciudad de Los Ángeles y por la Asociación de Normas
Canadienses (CSA, por sus siglas en inglés)
Características
Pérdida de presión de la válvula ASVF (psi)
Caudal
gpm
1
3
5
10
20
30
40
075-ASVF
3
⁄4" psi
2.8
3.4
3.8
4.6
6.5
-
100-ASVF
1" psi
2.9
3.1
3.3
3.9
5.0
7.8
13.4
t*ODPSQPSBUPEBTMBTDBSBDUFSÓTUJDBTEFMBTWÈMWVMBTEFMBTTFSJFT%7Z%7'
Rango operativo
Válvulas
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFMBWÈMWVMB"47'EFBHQNEFBN3⁄h; de 0.76
a 83.3 l/m). Una opción para las aplicaciones de caudal bajo (3 gpm o
menos; 0.68 m3IMN
FTVTBSVOBWÈMWVMBQBSBDBVEBMCBKP-'7
100/075 (consulte la página 193) o el kit de control de zona para riego
por goteo (consulte la página 191)
t$BVEBMEFMBWÈMWVMB"47'EFBHQNEFBN3⁄h; de
0.76 a 151.42 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Especificaciones
Pérdida de presión de la válvula ASVF (bares) SIST. MÉTRICO
Caudal
m3⁄h
0.23
0.6
1.2
3.6
4.5
6.0
9.0
l/m
3.8
10
20
60
75
100
150
075-ASVF
3
⁄4" bares
0.19
0.23
0.26
0.39
0.45
-
100-ASVF
1" bar
0.20
0.21
0.23
0.31
0.34
0.47
0.91
* Consulte la sección Xerigation (página 200) para obtener datos sobre pérdida de caudal
EFMGJMUSP3#:3BJO#JSESFDPNJFOEBRVFMPTÓOEJDFTEFDBVEBMFOMBMÓOFBEFTVNJOJTUSPOP
TVQFSFOMPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBEFBPINJPT
Códigos
t&MBOUJTJGØOEFCFJOTUBMBSTFBMNFOPTBDN
QPSFODJNBEFMQVOUP
más alto de agua en el tubo y los aspersores que abastece
t/JOHVOBWÈMWVMBQVFEFDPMPDBSTFBHVBTBCBKPEFMBWÈMWVMBBOUJTJGØO
t-BTWÈMWVMBTBOUJTJGØOOPEFCFOGVODJPOBSDPOUJOVBNFOUFEVSBOUFNÈT
de doce (12) horas
t$POTVMUFDVÈMFTTPOMPTDØEJHPTMPDBMFT
Dimensiones
t"MUVSB1⁄4" (15.8 cm)
t-BSHP1⁄10" (15.5 cm)
t"ODIP1⁄5" (8.1 cm)
t%JNFOTJØOEFMBMÓOFBDFOUSBMFOUSBEBTBMJEB
Modelos
t"47'3⁄4" (20/27)
t"47'
Vista transversal de
una válvula ASVF
Modelos disponibles con roscas NPT solamente
No se recomienda su uso con sistemas
de dos cables.
100-ASVF
90
El uso inteligente del agua.™
Válvulas para contratistas
www.rainbird.com/valves
4FSJFT+57Z+57'
Válvula "Jar Top" Series JTV y JTVF
Pérdida de presión de las válvulas Jar Top (psi)
1" (26/34) – Versatilidad, Valor, Conveniencia
Q La tapa roscada facilita la extracción sin tornillos
Q Admite solenoide de enganche para utilizar con los
controladores de Rain Bird que funcionan a pilas
Características
Confiabilidad
t%JBGSBHNBDPOQSFTJØOCBMBODFBEBEFMBSHBEVSBDJØO
t%JBGSBHNB#VOB/DPOGJMUSPEFBHVBQJMPUPDPONBMMBNJDSPOFT
de limpieza automática y resorte de acero inoxidable
t4PMFOPJEFFODBQTVMBEPEFCBKBQPUFODJBRVFBIPSSBFOFSHÓB
con émbolo cautivo
Versatilidad
t%JTQPOJCMFFOWBSJPTUJQPTEFBDDFTPSJPT
t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUÓDVMBT
de suciedad durante la instalación y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJØONBOVBMFOTFDP
t%JTQPOJCMFDPOMBGVODJØOPQDJPOBMEFDPOUSPMEFDBVEBMTPMP#41
Facilidad de reparación
t3FQBSBDJØOTJODPNQMJDBDJPOFTDPOQPDBTQJF[BT
t%JBGSBHNBSFNPWJCMFQBSBVONBOUFOJNJFOUPTJOFTGVFS[P
Caudal
gpm
1
3
5
10
15
20
30
JTV/JTVF
psi
3.0
3.4
3.8
4.5
5.6
6.9
9.7
Macho x conector de punta
psi
3.8
4.2
4.4
4.6
4.7
5.5
9.8
Pérdida de presión de las válvulas Jar Top (bares) SIST. MÉTRICO
Caudal
m3/h
0.23
0.6
1.2
3.6
4.5
6.0
6.8
l/m
3.8
10
20
60
75
100
114
JTV/JTVF
bares
0.20
0.23
0.27
0.40
0.49
0.60
0.67
Macho x conector de punta
bares
0.27
0.29
0.30
0.34
0.41
0.57
0.67
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 0.95 a 113.6 l/m)
t5FNQFSBUVSBTEFGVODJPOBNJFOUPUFNQFSBUVSBEFMBHVBIBTUB¡'
¡$
UFNQFSBUVSBBNCJFOUFIBTUB¡'¡$
t'VODJPOBFOBQMJDBDJPOFTEFDBVEBMCBKPZ9FSJHBUJPO¥DVBOEPFMGJMUSP
3#:TFJOTUBMBBHVBTBSSJCB
100-JTV
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
100-JTV-SS
Dimensiones
t"MUVSBDN
t-BSHPDN
t-BSHP.Y#
DN
t"ODIP 1⁄8" (7.9 cm)
Modelos
t+57IFNCSBYIFNCSBSPTDBEBEFDN
t+5744FOUSBEBTMJTBTEFDN
100-JTV-MB
t+57.#NBDIPYDPOFDUPSEFQVOUBEFDN
t+57'#41IFNCSBYIFNCSBEFDN
DPODPOUSPMEF
DBVEBM
*Disponible con roscas BSP
** Nota importante: BSP es la única opción de rosca disponible con control de caudal
No se recomienda su uso con sistemas de dos cables.
El uso inteligente del agua.™
Cómo especificar
100 - JTVF - SS
Configuración opcional:
SS: entradas lisas
MM: macho x macho
MB: Macho x conector
de punta
Modelo
+57WÈMWVMB+BS5PQ
+57'WÈMWVMB+BS5PQDPODPOUSPM
de caudal
Tamaño
100: 1" (26/34)
Nota: para aplicaciones fuera de EE.UU., es
necesario especificar si el tipo de rosca debe ser NPT
o BSP (sólo 1" [2.5 cm]).
91
Válvulas
Q Caudal piloto con doble filtración para una máxima confiabilidad
Válvulas para contratistas
Serie HV
Serie HV
NUEVO
Válvulas residenciales de plástico, de 1" (2.5 cm) (26/34)
3FOEJNJFOUPTVQFSJPS%VSBCJMJEBEJODPNQBSBCMF
Q El diafragma excéntrico permite un cierre suave y reduce el golpe
de ariete
Q %JTF×PDPNQBDUPSBEJPEFHJSPEFDN
QBSBJOTUBMBDJPOFT
estrechas
Q Herramientas a elegir para abrir la válvula (destornillador de dado,
destornillador Phillips, destornillador plano)
Pérdida de presión de la válvula HV (psi)
1" HV
(psi)
1.57
2.07
2.38
3.33
4.59
6.14
8.23
Caudal
(gpm)
1
3
5
10
20
30
40
1" HV-MB
(psi)
1.73
2.03
2.25
2.80
4.45
7.85
13.68
Características
t$POGJBCJMJEBE
- Cuerpo de polipropileno con fibra de vidrio para una mayor resistencia
%JTF×PEFDBVEBMJOWFSTPOPSNBMNFOUFDFSSBEP
- Reparación sin complicaciones con pocas piezas
%JBGSBHNB#VOB/oDPONBMMBNJDSPOFT
EFMJNQJF[B
automática, filtro piloto de agua y resorte de acero inoxidable.
Válvulas
t7FSTBUJMJEBE
'VODJPOBFOBQMJDBDJPOFTEFGMVKPCBKPZ9FSJHBUJPO¥DVBOEPFMGJMUSP
3#:TFJOTUBMBDPODPSSJFOUFBTDFOEFOUF
- Purga externa para limpiar el sistema manualmente y quitar las
partículas de suciedad durante la instalación y el arranque del sistema
- Purga interna para una operación manual en seco
t'BDJMJEBEEFSFQBSBDJØO
5PSOJMMPTDBVUJWPTEFNÞMUJQMFTDPOFYJPOFTQBSBGBDJMJUBSFM
mantenimiento
- Acceso rápido al diafragma con solo cuatro tornillos
- Poste de localización de diafragma para un servicio confiable
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
tEFBHQNEFBN3/h; 0.01 a 1.89 l/s); para caudales por
debajo de 3 gph (0.68 m3/h; 0.19 l/s) o cualquier aplicación Xerigation®,
VTFVOGJMUSP3#:.9EFDPSSJFOUFBTDFOEFOUF
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Pérdida de presión de la válvula HV (psi) SISTEMA MÉTRICO
Caudal
(m³/h)
0.25
0.75
1.00
2.00
5.00
7.50
9.10
Caudal
(l/s)
0.06
0.21
0.28
0.56
1.39
2.08
2.52
1" HV
(bares)
0.11
0.14
0.16
0.23
0.32
0.42
0.57
1" HV-MB
(bares)
0.12
0.14
0.16
0.19
0.31
0.54
0.94
* Consulte la sección Xerigation (página 200) para obtener datos sobre pérdida de caudal
EFMGJMUSP3#:3BJO#JSESFDPNJFOEBRVFMPTÓOEJDFTEFDBVEBMFOMBMÓOFBEFTVNJOJTUSP
OPTVQFSFOMPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
Modelos
t)7/15IFNCSBYIFNCSB/15EFDN
t)744FOUSBEBTMJTBTEFDN
t)7.#NBDIPYDPOFDUPSEFQVOUBEFDN
t)7'IFNCSBYIFNCSB/15EFDN
t)7'44FOUSBEBTMJTBTEFDN
*Disponible con roscas BSP
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[
t$PSSJFOUFEFFOUSBEBNÈYJNB"B);
t$PSSJFOUFEFSFUFODJØO"B);
t3FTJTUFODJBEFMBCPCJOBEFB0INJPT
100 HVF-SS
Cómo especificar
100 - HV - SS
Dimensiones
t"MUVSBDN
t-BSHPDN
t"MUVSB.#
DN
t-BSHP.#
DN
t"ODIPDN
100-HV-MB
Configuración opcional:
SS: entradas lisas
MB: Macho x conector
de punta
Modelo
HV: válvula de mayor valor
)7'WÈMWVMBEFNBZPSWBMPSDPO
control de caudal
Tamaño
100: 1" (26/34)
100HV
Nota: para aplicaciones fuera de EE.UU., es
necesario especificar si el tipo de rosca debe ser NPT
o BSP (sólo 1" [2.5 cm]).
100-HV-SS
92
El uso inteligente del agua.™
Válvulas para contratistas
www.rainbird.com/valves
Calibre de los cables de las válvulas residenciales
Calibre de los cables de las válvulas residenciales
Válvulas VA de 4.6 VA (DV / JTV) - Pies equivalentes a la
longitud del circuito
Presión de agua en la válvula de 80 psi (5.5 bares)
Presión de agua en la válvula de 125 psi (8.6 bares)
común
Calibre del cable
18
común
Calibre del cable
18
18
16
14
12
3000
3680
4290
4800
18
16
14
12
1400
1720
2000
2240
4700
5850
6840
7570
9300
12050
Calibre del cable de control
16
14
12
2200
2730
3190
3530
4340
Presión de agua en la válvula de 100 psi (6.9 bares)
Presión de agua en la válvula de 150 psi (10.4 bares)
común
Calibre del cable
18
común
Calibre del cable
18
18
16
14
12
2300
2820
3290
3680
18
16
14
12
600
730
860
960
Calibre del cable de control
16
14
12
3660
4490
5240
5800
7130
9420
5620
Calibre del cable de control
16
14
12
950
1170
1370
1510
1860
Válvulas
Calibre del cable de control
16
14
12
2410
Válvulas VA de 4.6 VA (HV) - Pies equivalentes a la longitud
del circuito
Presión de agua en la válvula de 80 psi (5.5 bares)
Presión de agua en la válvula de 125 psi (8.6 bares)
común
Calibre del cable
18
común
Calibre del cable
18
18
16
14
12
3100
3900
4500
5100
18
16
14
12
2400
3000
3500
4000
Calibre del cable de control
16
14
12
5000
6200
7200
8000
9900
12800
Calibre del cable de control
16
14
12
3900
4800
5600
6300
7700
Presión de agua en la válvula de 100 psi (6.9 bares)
Presión de agua en la válvula de 150 psi (10.4 bares)
común
Calibre del cable
18
común
Calibre del cable
18
18
16
14
12
2800
3400
4000
4500
18
16
14
12
2000
2400
2900
3200
Calibre del cable de control
16
14
12
4500
5500
6400
7100
8800
11300
10000
Calibre del cable de control
16
14
12
3200
3900
4600
5100
6200
8100
Para calcular el calibre de los cables de las válvulas comerciales de Rain Bird, consulte la página 109
El uso inteligente del agua.™
93
Válvulas
Serie PGA
Serie PGA
1", 1Válvulas plásticas de globo/ángulo de 1/2", 2" (2.5 cm, 3.8 cm, 5.1
cm) (26/34, 40/49, 50/60)
Q Válvula plástica de globo/ángulo para aplicaciones residenciales
o comerciales livianas. La serie PGA ofrece versatilidad a un precio
conveniente
Vista transversal de
una válvula PGA
Q %JBGSBHNBSFGPS[BEPDPOUFMBQBSBVOBNBZPSEVSBCJMJEBE
Q Nylon con fibra de vidrio y PVC
Características
Válvulas
t$POGJHVSBDJØOEFHMPCPZEFÈOHVMPQBSBMPHSBSGMFYJCJMJEBEFO
el diseño y la instalación
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
daño del sistema
t4PMFOPJEFEFVOBQJF[BDPOÏNCPMPDBVUJWPZSFTPSUFQBSBVOB
reparación fácil. Evita la pérdida de piezas durante el servicio en terreno
t.BOJKBFSHPOØNJDBTJOFMFWBDJØOQBSBDPOUSPMBSFMDBVEBMEFBHVBTFHÞO
sea necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWÈMWVMBTJORVFFMBHVBFOUSFFOMB
caja de válvulas. Permite el ajuste del regulador de presión sin encender
la válvula en el controlador
t%JTF×PEFDBVEBMIBDJBEFMBOUFOPSNBMNFOUFDFSSBEP
Opciones
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBM
instalado en campo, para garantizar un rendimiento óptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBTEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBVOBGÈDJMJEFOUJGJDBDJØOEF
los sistemas de agua no potable
- PGA-NP-HAN1 (para válvulas de 1" y 11/2" [2.5 cm y 3.8 cm])
- PGA-NP-HAN2 (para válvulas de 2" [5 cm])
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
Rango operativo
150-PGA
Cómo especificar
100 - PGA - PRS-D
Modelo
Característica
PGA
opcional
134%JBMNØEVMP
Tamaño
regulador de presión
100: 1" (26/34)
(se debe encargar por
1
150: 1 ⁄2" (40/49)
separado)
200: 2" (50/60)
t1SFTJØOEFBQTJEFBCBSFT
t134%JBMSFHVMBIBTUBQTJCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 7.8 a 568 l/m)
t$BVEBMDPO134%JBMEFBHQNEFBN3⁄h; de 19.2 a
568 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
DPOTVMUFMBUBCMB
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
Nota: la válvula y el módulo PRS-Dial se deben
encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca
debe ser NPT o BSP.
94
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Serie PGA
Dimensiones
Modelo
t1("
t1("
t1("
Altura
1⁄4" (18.4 cm)
DN
DN
Longitud
5 1⁄2" (14.0 cm)
3⁄4" (17.2 cm)
3⁄4" (19.7 cm)
Ancho
3 1⁄4" (8.3 cm)
3 1⁄2" (8.9 cm)
5" (12.7 cm)
Nota: PRS-Dial agrega 2" (5.1 cm) a la altura de la válvula
Modelos
t1("
t1(" 1⁄2" (40/49)
t1("
Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mĨIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma
Pérdida de presión de las válvulas serie PGA (psi)
Caudal
gpm
100PGA
Globo
1"
5.1
5.5
5.9
6.0
6.4
7.0
-
1
5
10
20
30
40
50
75
100
125
150
100PGA
Ángulo
1"
4.3
5.0
5.5
5.6
5.5
7.5
-
150PGA
Globo
11⁄2"
1.9
3.2
4.8
11.1
19.2
-
150PGA
Ángulo
11⁄2"
1.3
2.0
3.0
6.5
11.7
-
200PGA
Globo
2"
1.2
1.5
3.0
5.5
8.6
12.0
200PGA
Ángulo
2"
1.0
0.9
1.7
3.0
4.8
6.5
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vástago del control de caudal dos veces desde la posición totalmente abierta
Caudal Caudal 100- 100- 150- 150- 200- 200m3⁄h I/m
PGA PGA PGA PGA PGA PGA
Globo Ángulo Globo Ángulo Globo Ángulo
Índice de temperatura de la serie PGA
Temperatura del agua
„'
„'
„'
„'
„'
Presión continua
QTJ
QTJ
QTJ
QTJ
QTJ
Índice de temperatura de la serie PGA
Temperatura del agua
23˚ C
27˚ C
32˚ C
38˚ C
43˚ C
2.5 cm 2.5 cm 3.8 cm 3.8 cm 5.1 cm 5.1 cm
SIST. MÉTRICO
Presión continua
10.4 bares
9.1 bares
7.7 bares
6.4 bares
5.2 bares
El uso inteligente del agua.™
0.23
0.6
1.2
3
6
9
12
15
18
21
24
27
30
34
3.8
10
20
50
100
150
200
250
300
350
400
450
500
568
0.35
0.36
0.38
0.41
0.43
0.48
-
0.30
0.32
0.35
0.38
0.38
0.51
-
0.10
0.22
0.38
0.61
0.86
1.16
-
0.07
0.14
0.23
0.36
0.51
0.70
-
0.08
0.12
0.17
0.24
0.33
0.43
0.54
0.66
0.83
0.07
0.07
0.10
0.13
0.18
0.23
0.30
0.36
0.45
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial está recomendado sólo para áreas con sombra
95
Válvulas
Pérdida de presión de las válvulas serie PGA (bares) SIST. MÉTRICO
Válvulas
Series PEB y PESB
Series PEB y PESB
1", 1Válvulas industriales de plástico de 1/2", 2" (2.5 cm, 3.8 cm, 5.1 cm)
(26/34, 40/49, 50/60)
Q Válvula construida de nylon con fibra de vidrio de larga duración para
Vista transversal de
una válvula PEB
VOSFOEJNJFOUPSFTJTUFOUFZVOBNBZPSWJEBÞUJM5BDIVFMBTEFBDFSP
inoxidable moldeadas en el cuerpo que resisten el daño de la rosca
Q Cierre lento para evitar el golpe de ariete y el posterior daño
del sistema
Q %JBGSBHNBSFGPS[BEPDPOUFMBQBSBVOBNBZPSEVSBCJMJEBE
Características
Válvulas
Vista transversal de
una válvula PESB
t'VODJØOEFDBVEBMCBKPQBSBVOBNQMJPSBOHPEFBQMJDBDJPOFT
t%FQVSBEPSEFQMÈTUJDPFOMBWÈMWVMB1&4#RVFSBTQBMBNBMMBEFBDFSP
inoxidable para limpiar y eliminar la arenilla y el material vegetal. Impide
la acumulación de partículas de suciedad y la posterior obstrucción del
sistema
t4PMFOPJEFEFVOBQJF[BDPOÏNCPMPDBVUJWPZSFTPSUFQBSBVOB
reparación fácil. Evita la pérdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHÞOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWÈMWVMBTJORVFFMBHVBFOUSFFOMB
caja de válvulas. Permite el ajuste del regulador de presión sin encender
la válvula en el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUÓDVMBTEFTVDJFEBEEFM
sistema. Recomendada para la puesta en marcha del sistema y después
de las reparaciones.
t%JTF×PEFDBVEBMIBDJBEFMBOUFOPSNBMNFOUFDFSSBEP
t$POGJHVSBDJØOEFHMPCP
Opciones
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBM
instalado en campo, para garantizar un rendimiento óptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBTEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBVOBGÈDJMJEFOUJGJDBDJØOEF
los sistemas de agua no potable (se venden por separado)
- PEB-NP-HAN1(1" [2.5 cm])
- PEB-NP-HAN2 (11/2" y 2" [3.8 cm y 5.1 cm])
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
Cómo especificar
200-PEB
200-PESB
100 - PEB - PRS-D
Modelo
PEB
Tamaño
100: 1" (26/34)
150: 11⁄2" (40/49)
200: 2" (50/60)
Característica
opcional
134%JBMNØEVMP
regulador de presión
(se debe encargar por
separado)
Nota: la válvula y el módulo PRS-Dial se deben
encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca
debe ser NPT o BSP.
96
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Series PEB y PESB
t1SFTJØOEFBQTJEFBCBSFT
t134%JBMSFHVMBIBTUBQTJCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 1.2 a 757 l/m)
t$BVEBMDPO134%JBMEFBHQNEFBN3⁄h; de 19.2 a
757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
Dimensiones
Modelo
t1&#Z1&4#
t1&#Z1&4#
t1&#Z1&4#
Altura
1⁄2" (16.5 cm)
DN
DN
Longitud
4" (10.2 cm)
DN
DN
Ancho
4" (10.2 cm)
DN
DN
Nota: la opción con PRS-Dial agrega 2" (5.1 cm) a la altura de la válvula
Pérdida de presión de las válvulas de las series PEB y PESB (psi)
Caudal
gpm
0.25
0.5
1
5
10
20
30
40
50
75
100
125
150
175
200
100-PEB
1"
0.8
1.0
1.3
1.7
1.8
2.9
5.6
10.0
15.6
-
150-PEB
11⁄2"
3.9
3.6
3.5
3.6
5.4
9.6
14.6
21.2
-
200-PEB
2"
4.8
4.5
5.2
8.2
11.8
15.5
19.5
Válvulas
Rango operativo
Pérdida de presión de las válvulas de
las seriesPEB y PESB (bares)
SIST. MÉTRICO
Modelos
t1&#Z1&4#
t1&#Z1&4#1⁄2" (40/49)
t1&#Z1&4#
Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mĨIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vástago del control de caudal dos veces desde la posición totalmente abierta
4. Para las aplicaciones con PRS-Dial, Rain Bird recomienda la instalación de una válvula
maestra reguladora de presión o un regulador de presión en línea cuando la presión de
entrada supera los 100 psi (6.9 bares)
Caudal
m3⁄h
0.06
0.3
0.6
1.2
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45
Caudal
l/m
1
5
10
20
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757
100-PEB
2.5 cm
0.06
0.09
0.10
0.12
0.15
0.32
0.68
-
150-PEB
3.8 cm
0.26
0.24
0.26
0.33
0.42
0.57
0.74
0.92
1.14
1.38
-
200-PEB
5.1 cm
0.33
0.32
0.32
0.34
0.41
0.51
0.64
0.77
0.90
1.04
1.18
1.34
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial está recomendado sólo para áreas con sombra
El uso inteligente del agua.™
97
Válvulas
Serie PESB-R
Válvulas serie PESB-R
1", 1Válvulas durables resistentes al cloro para aplicaciones con agua
reciclada, de 1/2", 2" (2.5, 3.8 y 5.1 cm) (26/34, 40/49, 50/60)
Q 'VODJPOBNJFOUPDPOGJBCMFJODMVTPFOBHVBDPONVDIPDMPSP-PT
EJBGSBHNBTEFMBTWÈMWVMBTFTUÈODPNQVFTUPTEF&1%.VONBUFSJBMEF
goma que es resistente al cloro y a los químicos
Q Válvula construida de nylon con fibra de vidrio de larga duración para
un rendimiento resistente y una mayor vida útil a una presión de 200
psi (13.8 bares)
Q %JTF×PEFTPMFOPJEFEFVOBQJF[BDPOÏNCPMPDBVUJWPZSFTPSUFQBSB
una reparación fácil. Evita la pérdida de piezas durante la reparación
in situ
Características
Válvulas
Vista transversal de
una válvula PESB-R
t-PTLJUTEFDPOWFSTJØO1&4#3UBNCJÏOFTUÈOEJTQPOJCMFTQBSBDPOWFSUJS
válvulas PEB y PESB existentes en válvulas para agua reciclada. El
kit incluye manija NP, etiquetas, ensamble del diafragma, raspador y
rondana a presión
t5BDIVFMBTEFBDFSPJOPYJEBCMFNPMEFBEBTFOFMDVFSQP-BUBQBTFQVFEF
colocar y retirar fácilmente sin dañar las roscas
t-BQVSHBFYUFSOBQSPUFHFMPTDBOBMFTEFEFTBHàFEFMTPMFOPJEFEFMB
suciedad cuando se limpia el sistema.
t-BQVSHBJOUFSOBBDDJPOBMBWÈMWVMBTJOQFSNJUJSRVFFOUSFBHVBFOMB
caja de válvulas y permite ajustar el regulador de presión sin tener que
conectar primero la válvula del controlador
t'VODJØOEFDBVEBMCBKPHQNN3/h; 1.2 l/m) para un amplio
rango de aplicaciones
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
daño del sistema
t&MNFDBOJTNPEFQVSBEPSSBTQBMBNBMMBEFBDFSPJOPYJEBCMFQBSBMJNQJBS
y eliminar la arenilla y el material vegetal
t.BOJKBEFDPOUSPMEFDBVEBMFTUÈOEBSDPMPSWJPMFUBFOMBTWÈMWVMBTTFSJF
PESB-R
150-PESB-R
Cómo especificar
100 - PESBR - PRS-D
Modelo
PESB-R:
depurador
modelo
Tamaño
100: 1" (26/34)
150: 11⁄2" (40/49)
200: 2" (50/60)
Característica
opcional
134%JBMNØEVMP
regulador de
presión (se debe
encargar por
separado)
Nota: la válvula y el módulo PRS-Dial se deben
encargar por separado.
98
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Serie PESB-R
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBMPQDJPOBM
e instalado en campo, para garantizar un rendimiento óptimo del aspersor
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 1.2 a 757 l/m)
t$BVEBMDPO134%JBMEFBHQNEFBN3⁄h; de 19.2 a
757 l/m)
t5FNQFSBUVSBIBTUB¡'¡$
Especificaciones eléctricas
t"MJNFOUBDJØOTPMFOPJEFEF7$"BDJDMPT
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
Dimensiones
Modelo Altura
t1&4#3
t1&4#3
t1&4#3
Longitud
1⁄2" (16.5 cm)
DN
DN
Ancho
4" (10.2 cm)
DN
DN
Pérdida de presión de las válvulas serie PESB-R (psi)
Caudal
gpm
0.25
0.5
1
5
10
20
30
40
50
75
100
125
150
175
200
100-PESB-R
1"
1.6
3.0
1.8
2.9
2.9
2.6
5.8
10.2
16.0
-
150-PESB-R
11⁄2"
3.5
3.1
2.3
2.1
4.3
7.5
11.9
17.0
-
Pérdida de presión de las válvulas
serie PESB-R (bares)
4" (10.2 cm)
DN
DN
Nota: la opción con PRS-Dial agrega 2" (5.1 cm) a la altura de la válvula
Modelos
t1&4#3
t1&4#31⁄2" (40/49)
t1&4#3
t1&4#38,,JUEFDPOWFSTJØOEFDN
t1&4#38,,JUEFDPOWFSTJØOEF1⁄2" (3.8 cm) (40/49)
t1&4#38,,JUEFDPOWFSTJØOEFDN
Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mĨIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vástago del control de caudal dos veces desde la posición totalmente abierta
Caudal
m3/h
0.06
0.3
0.6
1.2
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45
Caudal
l/m
1
5
10
20
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757
100-PESB-R
2.5 cm
0.11
0.13
0.15
0.20
0.19
0.32
0.69
-
200-PESB-R
2"
3.7
3.3
4.7
8.6
12.6
14.8
18.9
SIST. MÉTRICO
150-PESB-R
3.8 cm
0.22
0.16
0.16
0.24
0.33
0.45
0.59
0.75
0.91
1.10
-
200-PESB-R
5.1 cm
0.25
0.24
0.25
0.30
0.38
0.53
0.67
0.82
0.92
1.00
1.13
1.30
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial está recomendado sólo para áreas con sombra
El uso inteligente del agua.™
99
Válvulas
Opciones
Válvulas
Serie GB
Válvulas de latón Serie GB
1", 11⁄4", 11⁄2", 2" (26/34, 33/42, 40/49, 50/60)
Q Estructura resistente de latón rojo para mayor durabilidad
Q %JBGSBHNBEVSBEFSPZSFGPS[BEPDPOUFMBQBSBNBZPSEVSBCJMJEBE
incluso en condiciones extremas
Vista transversal
de GB
Q %JTF×PEFDBVEBMJOWFSTPOPSNBMNFOUFDFSSBEPRVFHBSBOUJ[BRVFMB
válvula se cerrará si se produce una rotura o desgarro en el diafragma.
Evita inundaciones, desperdicio de agua y el daño del terreno
Características
Válvulas
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
daño del sistema
t4PMFOPJEFEFVOBQJF[BDPOÏNCPMPDBVUJWPZSFTPSUFQBSBVOB
reparación fácil. Evita la pérdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHÞOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWÈMWVMBTJORVFFMBHVBFOUSFFOMB
caja de válvulas. Permite el ajuste del regulador de presión sin encender
el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUÓDVMBTEFTVDJFEBE
del sistema. Recomendada para la puesta en marcha del sistema y otras
reparaciones
t$POGJHVSBDJØOEFHMPCP
tAptas para agua reciclada: ahora todos los modelos tienen diafragmas
&1%.ZQJF[BTSFTJTUFOUFTBMDMPSPDPNPQBSUFEFMFRVJQPFTUÈOEBS
t5BQBEFNBOJKBWJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF
Opciones
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBM
instalado en campo, para garantizar un rendimiento óptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
5BQBEFNBOJKBWJPMFUB
para identificar el
agua no potable
Cómo especificar
100 - GB - PRS-D
Modelo
GB
Tamaño
100: 1" (26/34)
ž
›
200: 2" (50/60)
Característica
opcional
134%JBMNØEVMP
regulador de presión
(se debe encargar por
separado)
150-GB
Nota: la válvula y el módulo PRS-Dial se deben
encargar por separado.
100
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Serie GB
t1SFTJØOEFBQTJEFBCBSFT
t134%JBMSFHVMBIBTUBQTJCBSFT
t$BVEBMDPOTJO134%JBMEFBHQNHBMPOFTQPSNJOVUPEFB
45.40 m3⁄h; de 19.2 a 757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
Dimensiones
Modelo Altura
t(#
DN
t(#
3⁄4" (14.6 cm)
t(#
1⁄2" (16.5 cm)
t(#
DN
Longitud
1⁄2" (11.4 cm)
5" (12.7 cm)
51⁄2" (14 cm)
3⁄4" (17.1 cm)
Ancho
21⁄4" (5.7 cm)
3" (7.6 cm)
4" (10, 2 cm)
51⁄4" (13.3 cm)
Nota: la opción con PRS-Dial agrega 2" (5.1 cm) a la altura de la válvula
Modelos
t(#
t(#1⁄4" (33/42)
t(#1⁄2" (40/49)
t(#
Roscas BSP no disponibles
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mĨIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEBHJSBS
por completo el vástago del control de caudal dos veces desde la posición totalmente
abierta
* Funcionamiento confiable incluso en agua con mucho cloro. Los diafragmas de las
válvulas están compuestos de EPDM, un material de goma que es resistente al cloro y a
los químicos
Pérdida de presión de la válvula de la Serie GB (psi)
Caudal
gpm
5
10
15
20
30
40
50
60
80
100
120
140
160
180
200
100-GB
1"
0.4
0.8
1.2
2.1
5.0
8.2
13.0
-
125-GB
11⁄4"
1.4
2.3
4.1
6.8
9.8
16.5
-
150-GB
11⁄2"
2.3
2.9
2.0
3.3
4.6
7.5
11.8
16.6
-
Pérdida de presión de la válvula
de la Serie GB (bares)
Caudal
m3⁄h
1
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45
Caudal
l/m
19
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757
100-GB
2.5 cm
0.03
0.07
0.27
0.56
-
125-GB
3.8 cm
0.14
0.28
0.53
0.82
1.12
-
200-GB
2"
0.6
0.7
0.9
1.1
1.7
2.6
3.9
5.9
7.8
10.0
12.4
15.1
SIST. MÉTRICO
150-GB
3.8 cm
0.19
0.14
0.25
0.38
0.51
0.70
0.91
1.13
-
200-GB
5.1 cm
0.05
0.06
0.09
0.14
0.18
0.24
0.31
0.40
0.49
0.58
0.68
0.79
0.90
1.04
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. PRS-Dial está recomendado sólo para áreas con sombra
El uso inteligente del agua.™
101
Válvulas
Rango operativo
Válvulas
4FSJF&'#$1
Válvulas de latón Serie EFB-CP
1", 11⁄4", 11⁄2", 2" (26/34, 33/42, 40/49, 50/60)
Q 3FOEJNJFOUPDPOGJBCMFJODMVTPFOVTPTDPOBHVBTVDJB'JMUSPEF
limpieza automática que resiste la acumulación de partículas de
suciedad
Q Estructura resistente de latón rojo para mayor durabilidad
Q Los diafragmas duraderos reforzados con tela están compuestos
EF&1%.VONBUFSJBMEFHPNBRVFFTSFTJTUFOUFBMDMPSPZBMPT
productos químicos
Características
Válvulas
Vista transversal de
EFB-CP
t%JTF×PEFDBVEBMJOWFSTPOPSNBMNFOUFDFSSBEPRVFHBSBOUJ[BRVFMB
válvula se cerrará si se produce una rotura o desgarro en el diafragma.
Evita inundaciones, desperdicio de agua y el daño del terreno
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPSEB×PEFM
sistema
t4PMFOPJEFEFVOBQJF[BDPOÏNCPMPDBVUJWPZSFTPSUFQBSBVOB
reparación fácil. Evita la pérdida de piezas durante el servicio en terreno
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHÞOTFB
necesario
t1VSHBNBOVBMJOUFSOBRVFBDDJPOBMBWÈMWVMBTJORVFFMBHVBFOUSFFOMB
caja de válvulas. Permite el ajuste del regulador de presión sin encender
el controlador
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUÓDVMBTEFTVDJFEBE
del sistema. Recomendada para la puesta en marcha del sistema y otras
reparaciones
t.BMMBEFGJMUSPEFMJNQJF[BBVUPNÈUJDBZBQSVFCBEFDPOUBNJOBDJØO
que resiste la acumulación de partículas de suciedad. El caudal de agua
limpia continuamente la malla y quita
las partículas de suciedad antes de que se acumulen y obstruyan el filtro
t$POGJHVSBDJØOEFHMPCP
tAptas para agua reciclada: ahora todos los modelos tienen diafragmas
&1%.ZQJF[BTSFTJTUFOUFTBMDMPSPDPNPQBSUFEFMFRVJQPFTUÈOEBS
t5BQBEFNBOJKBWJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF
5BQBEFNBOJKBWJPMFUB
para identificar el
agua no potable
Cómo especificar
100 - EFB-CP - PRS-D
Modelo
&'#$1
Tamaño
100: 1"
125: 11⁄4"
150: 11⁄2"
200: 2"
Característica
opcional
134%JBMNØEVMP
regulador de
presión (se debe
encargar por
separado)
125-EFB-CP
Nota: la válvula y el módulo PRS-Dial
se deben encargar por separado.
102
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
4FSJF&'#$1
Pérdida de presión de la válvula de la serie EFB-CP (psi)
Opciones
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBM
instalado en campo, para garantizar un rendimiento óptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t4PMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFT
de hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t134%JBMSFHVMBIBTUBQTJCBSFT
t$BVEBMDPOTJO134%JBMEFBHQNHBMPOFTQPSNJOVUPEFB
45.40 m3⁄h;
de 19.2 a 757 l/m)
t5FNQFSBUVSBEFMBHVBIBTUB¡'¡$
t5FNQFSBUVSBBNCJFOUFIBTUB¡'¡$
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPT
Longitud
DN
3⁄4" (14.6 cm)
1⁄2" (16.5 cm)
DN
Ancho
1⁄2" (11.4 cm)
5" (12.7 cm)
51⁄2" (14 cm)
3⁄4" (17.1 cm)
31⁄4" (8.3 cm)
31⁄4" (8.3 cm)
41⁄2" (11.4 cm)
53⁄4" (14.6 cm)
Nota: la opción con PRS-Dial agrega 2" (5.1 cm) a la altura de la válvula
Modelos
t&'#$1
t&'#$11⁄4" (33/42)
t&'#$11⁄2
t&'#$1
* Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
2. Para caudales inferiores a 5 gpm (1.14 mĨIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma
3. Para caudales inferiores a 10 gpm (2.27 m3IMN
3BJO#JSESFDPNJFOEB
girar por completo el vástago del control de caudal dos veces desde la posición
totalmente abierta
El uso inteligente del agua.™
125
EFB-CP
11⁄4
150
EFB-CP
11⁄2"
200
EFB-CP
2"
5
10
15
20
30
40
50
60
80
100
120
140
160
180
200
0.2
0.7
1.2
2.1
5
8.2
13
-
1.4
2.3
4.1
6.8
9.8
16.5
-
2.3
2.9
2
3.3
4.6
7.5
11.8
16.6
-
0.5
0.6
0.8
1.1
1.8
2.4
3.8
5.9
7.8
10
12.5
15.8
Pérdida de presión de la válvula
de la serie EFB-CP (bares)
Dimensiones
Modelo Altura
t&'#$1
t&'#$1
t&'#$1
t&'#$1
100
EFB-CP
1"
Válvulas
Especificaciones eléctricas
Caudal
gpm
SIST. MÉTRICO
Caudal
m3/h
Caudal
l/m
100
EFB-CP
2.5 cm
125
EFB-CP
3.2 cm
150
EFB-CP
3.8 cm
200
EFB-CP
5.1 cm
1
3
6
9
12
15
18
21
24
27
30
33
36
39
42
45
19
50
100
150
200
250
300
350
400
450
500
550
600
650
700
757
0.01
0.07
0.27
0.56
-
0.14
0.28
0.53
0.82
1.12
-
0.19
0.14
0.25
0.38
0.51
0.70
0.91
1.13
-
0.04
0.05
0.09
0.14
0.16
0.23
0.30
0.40
0.49
0.58
0.68
0.79
0.92
1.09
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. Módulo PRS-Dial recomendado para todos los índices de caudal
103
Válvulas
Válvulas 300-BPE y 300-BPES
Válvulas de latón 300-BPE/300-BPES
Pérdida de presión de las válvulas BPE y BPES de 3" (7.6 cm) (psi)
3" (80/90)
Q El cuerpo de latón y la tapa de nylon con fibra de vidrio que equipan
estas válvulas son confiables y permiten soportar aumentos extremos
de presión, aguas residuales y obstrucciones de partículas de
suciedad. Para brindar protección adicional, el modelo BPES está
equipado con un mecanismo depurador patentado
que combate la suciedad y las partículas de forma activa
Q Exclusiva estructura híbrida que cuenta con un cuerpo de latón rojo
duradero y una tapa de nylon con fibra de vidrio de larga duración a
un precio conveniente
Q %JBGSBHNBEVSBEFSPZSFGPS[BEPDPOUFMBQBSBVOBNBZPSWJEBÞUJM
Características
Válvulas
t$JFSSFMFOUPQBSBFWJUBSFMHPMQFEFBSJFUFZFMQPTUFSJPS
daño del sistema
tSólo para BPES: depurador de nylon patentado que raspa la malla
de acero inoxidable para limpiar y eliminar la arenilla y el material
vegetal. Impide la acumulación de partículas de suciedad y la posterior
obstrucción del sistema
t$POGJHVSBDJØOEFHMPCPZEFÈOHVMPQBSBMPHSBSGMFYJCJMJEBE
en el diseño y la instalación
t%JTF×PEFDBVEBMIBDJBEFMBOUFOPSNBMNFOUFDFSSBEP
t4PMFOPJEFSFTJTUFOUFRVFQSPQPSDJPOBVOSFOEJNJFOUPDPOGJBCMFBVO
durante el funcionamiento constante
t.BOJKBEFDPOUSPMEFDBVEBMRVFSFHVMBFMDBVEBMEFBHVBTFHÞO
sea necesario e incorpora un casquillo roscado de latón para mayor
durabilidad
t1VSHBNBOVBMFYUFSOBRVFQFSNJUFMJNQJBSMBTQBSUÓDVMBTEFTVDJFEBEEFM
sistema. Recomendada para la puesta en marcha y las reparaciones del
sistema
t'VODJPOBNJFOUPEFBMUBFGJDJFODJBDPOQÏSEJEBEFQSFTJØO
extremadamente baja
Opciones
t1VFEFVUJMJ[BSTFDPOFMNØEVMPSFHVMBEPSEFQSFTJØODPO134%JBM
instalado en campo para garantizar un rendimiento óptimo del aspersor.
Regula hasta 100 psi (6.9 bares)
t.BOJKBEFDPOUSPMEFDBVEBMDPMPSWJPMFUBQBSBBQMJDBDJPOFTEFBHVBOP
potable. (BPE-NP-HAN)
t"ENJUFFMTPMFOPJEFEFFOHBODIFQBSBVUJMJ[BSDPOMPTDPOUSPMBEPSFTEF
hasta 150 psi (10.4 bares) de Rain Bird que funcionan a pilas
t$PNQBUJCMFDPOEFDPEJGJDBEPSFT&41-9%
Cómo especificar
Globo
Ángulo
6.6
5.1
3.2
1.8
1.8
2.0
2.2
2.7
4.0
4.9
6.8
5.9
3.5
1.8
2.1
2.1
2.0
2.5
3.4
4.5
Pérdida de presión de las válvulas BPE y BPES
de 3" (7.6 cm) (bares)
Caudal
m3⁄h
13.6
24
36
48
60
68
Caudal
l/m
227
400
600
800
1000
1136
SIST. MÉTRICO
Globo
Ángulo
0.46
0.19
0.14
0.21
0.29
0.34
0.47
0.21
0.14
0.19
0.26
0.31
Notas
1. Los valores de pérdida se calcularon con el control de caudal totalmente abierto
2. Módulo PRS-Dial recomendado para todos los índices de caudal
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t134%JBMSFHVMBIBTUBQTJCBSFT
t$BVEBMDPOTJO134%JBMEFBHQN
(de 13.62 a 68.10 m3⁄h; de 227 a 1136 l/m)
t5FNQFSBUVSBIBTUB¡'¡$
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB"7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
B)[
t3FTJTUFODJBEFMBCPCJOBPINJPTOPNJOBM
Vista transversal de
una válvula BIES
Dimensiones
Modelo
t
Altura
5⁄8" (34.61 cm)
Longitud
8" (20.32 cm)
Ancho
7" (17.78 cm)
Modelos
t#1&
t#1&4
300 - BPE - PRS-D
Modelo Característica opcional
BPE
134%JBMNØEVMP
regulador de presión
(se debe encargar por
Tamaño
separado)
3" (80/90)
Roscas BSP disponibles; especifique al hacer el pedido
Recomendaciones
1. Rain Bird recomienda que los índices de caudal en la línea de suministro no superen
MPTQJFTTFHNT
QBSBSFEVDJSMPTFGFDUPTEFMHPMQFEFBSJFUF
Nota: la válvula y el módulo PRS-Dial se deben
encargar por separado. Para aplicaciones fuera de
EE.UU., es necesario especificar si el tipo de rosca debe
ser NPT o BSP.
1BSBDBVEBMFTJOGFSJPSFTBHQNNIMNJO
3BJO#JSESFDPNJFOEBFMVTPEF
filtración ascendente para evitar que se acumule suciedad debajo del diafragma.
300-BPES
104
Caudal
gpm
60
80
100
120
140
160
180
200
250
300
1BSBDBVEBMFTJOGFSJPSFTBHQNNIMN
3BJO#JSESFDPNJFOEBHJSBSQPS
completo el vástago del control de caudal dos veces desde la posición totalmente abierta.
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
134%JBM
Módulo regulador de presión
Q &M134%JBMFTVONFEJPFYDFMFOUFQBSBSFHVMBSMBQSFTJØOEFTBMJEBEF
la válvula, independientemente de las fluctuaciones de la presión de
entrada. La escala visible permite un ajuste rápido y fácil. El regulador
puede utilizarse con todas las válvulas Rain Bird de las Series PGA, PEB,
1&4#1&4#3(#&'#$1#1&Z#1&4
Q Regula y mantiene una presión de salida constante de entre 15 y 100
psi (de 1.04 a 6.9 bares) dentro de ±3 psi (±0.21 beres)
Q Perilla de ajuste con retenes que permite ajustar los parámetros a
incrementos de 1/3 psi (0.02 beres). Cartucho de disco que permite que
la instalación y el ajuste se realicen de forma sencilla, rápida y precisa
Características
t.BZPSDBQBDJEBEQBSBSFEVDJSMPTQJDPTEFQSFTJØORVFEJTNJOVZFFM
golpe de ariete
t%JTF×PFSHPOØNJDPDPOUBQBIFSNÏUJDBRVFBZVEBBFWJUBSFMWBOEBMJTNP
t$BSUVDIPEFEJTDPBQSVFCBEFBHVBRVFFMJNJOBFMFNQB×BNJFOUPZMB
impregnación
t$BSUVDIPEFEJTDPRVFTFSFUSPBEBQUBBUPEBTMBTVOJEBEFT134#
existentes
t7ÈMWVMB4DISBEFSRVFDPOFDUBMBNBOHVFSBEFMNBOØNFUSPTPMJDJUBSQPS
separado
t'ÈDJMJOTUBMBDJØOFODBNQP-BTSPTDBTEFM134%JBMTFFODVFOUSBOEFCBKP
del solenoide y el adaptador
t/ZMPODPOGJCSBEFWJESJPSFTJTUFOUFBMBDPSSPTJØOZEFSFOEJNJFOUP
resistente
Rangos de caudal de la válvula*
Modelo
gpm
m3/h
l/m
100-PGA
150-PGA
200-PGA
100-PEB
150-PEB
200-PEB
100-PESB/PESB-R
150-PESB/PESB-R
200-PESB/PESB-R
100-GB
125-GB
150-GB
200-GB
&'#$1
&'#$1
&'#$1
&'#$1
300-BPE
300-BPES
5-40
30-100
40-150
5-50
20-150
75-200
5-50
20-150
75-200
5-50
20-80
20-120
20-200
5-50
20-80
20-120
20-200
60-300
60-300
1.14-9.08
6.81-22.70
9.08-34.05
1.14-11.35
4.54-34.05
17.03-45.40
1.14-11.35
4.54-34.05
17.03-45.40
1.14-11.35
4.54-18.16
4.54-31.78
4.54-45.40
1.14-11.35
4.54-18.16
4.54-31.78
4.54-45.40
13.62-68.10
13.62-68.10
19.2-151
113-378
151-568
19.2-189
76-568
284-757
19.2-189
76-568
284-757
19.2-189
76-302
76-529
76-757
19.2-189
76-302
76-529
76-757
227-1136
227-1136
Válvulas
PRS-Dial
* Estos son los rangos de caudal de las válvulas. PRS-Dial regula sólo hasta 100 psi (6.9 bares)
Rango operativo
t1SFTJØO)BTUBQTJCBSFT
t3FHVMBDJØOEFBQTJEFBCBSFT
t1SFDJTJØOœQTJœCFSFT
t$BVEBMDPOTVMUFMBUBCMB
PRS-Dial
* Aunque el regulador PRS puede soportar presiones de hasta 200 psi (13.8 bares), la
regulación precisa de presión se puede mantener sólo hasta 100 psi (6.9 bares)
Modelo
t134%
Información sobre el uso
t1BSBMPHSBSVOGVODJPOBNJFOUPDPSSFDUPTFSFRVJFSFRVFMBQSFTJØOEF
entrada sea por lo menos 15 psi (1.04 beres) más alta que la presión de
salida deseada
t1BSBMBTÈSFBTDPOQSFTJØONVZBMUBPUFSSFOPTEFTOJWFMBEPTJOTUBMF
aspersores con vástagos reguladores de presión PRS y/o válvulas de
retención SAM
t$VBOEPMBQSFTJØOEFFOUSBEBTVQFSBMPTQTJCBSFT
TFSFRVJFSFMB
utilización de una válvula maestra reguladora de presión o un regulador
de presión dentro de la línea
t3BJO#JSEOPSFDPNJFOEBVUJMJ[BSFMNØEVMPSFHVMBEPSEFQSFTJØO
para aplicaciones cuyos rangos de caudal estén fuera de los límites
recomendados
t3BJO#JSESFDPNJFOEBRVFMPTÓOEJDFTEFDBVEBMFOMBMÓOFBEFTVNJOJTUSP
no superen los 7.5 pies/seg. (2.29 m/s) para reducir los efectos del golpe
de ariete
t1BSBDBVEBMFTJOGFSJPSFTBHQN3/h; 37.8 l/m), Rain Bird recomienda
girar por completo el vástago del control de caudal dos veces desde la
posición totalmente abierta
El uso inteligente del agua.™
Vista transversal
de PRS-Dial
Válvula 300-BPE con
instalación de PRS-Dial†
† Nota: La válvula y el
módulo PRS-Dial se
deben ordenar por
separado
GB con instalación
de PRS-Dial†
Válvula 150-PESB-R con
instalación de PRS-Dial†
105
Válvulas
Válvulas de acoplamiento rápido
Válvulas de acoplamiento rápido
Pérdida de presión de las válvulas de acoplamiento rápido (psi)
Q Válvulas de latón y acoplamiento rápido con resistencia industrial para un
Caudal
3-RC
gpm
3
⁄4"
1.8
4.7
7.2
-
conveniente acceso de agua en sistemas de agua potable y no potable
Q Estructura resistente de latón rojo para mayor durabilidad y un
rendimiento confiable
Q 'VODJPOBNJFOUPDPOGJBCMFDPOVOGVFSUFSFTPSUFEFBDFSPJOPYJEBCMF
resistente a la corrosión
Características
t5BQBEFTFHVSJEBEPQDJPOBMFOMPTNPEFMPT%-3$-3$-3$
%/1/1Z/1VTFMBDMBWFQBSBEFTCMPRVFBS
5BQBEFNFUBM
sólo en el modelo 7
t%JTF×PEFDVFSQPEFVOBTPMBQJF[BFOMPTNPEFMPT3$3$Z
t%JTF×PEFDVFSQPEFEPTQJF[BTQBSBVOBSFQBSBDJØOGÈDJMNPEFMPT
%3$-3$3$%/1Z/1
t'VFSUFSFTPSUFEFBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJØORVFFWJUBMBT
fugas
t5BQBUFSNPQMÈTUJDBQBSBQSPMPOHBSMBEVSBCJMJEBE
t-BTUBQBTEFMPTNPEFMPT%/1/1Z/1UJFOFOMBBEWFSUFODJB
i%P/PU%SJOL/0#&#"FOJOHMÏTZFTQB×PM
10
15
20
30
40
50
60
70
80
100
125
33-DRC
33-DLRC
33-DNP
3
⁄4"
2
4.3
7.6
-
Válvulas
Dimensiones (altura)
t3$1⁄4" (10.8 cm)
t%3$3⁄8" (11.1 cm)
t%-3$5⁄8" (11.7 cm)
t3$DN
t-3$DN
t3$1⁄2" (14.0 cm)
t-3$: 51⁄2" (14 cm)
t: 53⁄4" (14.6 cm)
t%/1: 43⁄8" (11.1 cm)
t/1: 6" (15.2 cm)
t/1: 51⁄2" (14 cm)
Modelos
t3$UBQBEFHPNBEFDN
DVFSQPEFQJF[B
t%3$BHBSSBEFSBEFTFHVSJEBEDPOEPCMFHVÓBEFDN
tapa de goma, cuerpo de 2 piezas
t%-3$BHBSSBEFSBEFTFHVSJEBEDPOEPCMFHVÓBEFDN
tapa de goma, cuerpo de 2 piezas
t3$UBQBEFHPNBEFDN
DVFSQPEFQJF[B
t-3$UBQBEFTFHVSJEBEEFHPNBEFDN
DVFSQPEF
pieza
t3$UBQBEFHPNBEFDN
DVFSQPEFQJF[B
t-3$UBQBEFTFHVSJEBEEFHPNBEFDN
DVFSQPEFQJF[B
tUBQBEFNFUBMEFDN
DVFSQPEFQJF[B
t3$#41UBQBEFHPNBEFDN
DVFSQPEFQJF[BDPO
roscas BSP
t-3$#41UBQBEFTFHVSJEBEEFHPNBEFDN
cuerpo de 1 pieza, con roscas BSP
t%/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF
(1.9 cm) (20/27), cuerpo de 2 piezas
t/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF
cm) (26/34), cuerpo de 2 pieza
t/1UBQBEFTFHVSJEBEEFHPNBWJPMFUBQBSBBHVBOPQPUBCMFEF
cm) (26/34), cuerpo de 1 pieza
Nota: para aplicaciones fuera de EE.UU., es necesario especificar si el tipo de rosca debe
ser NPT o BSP
106
5-RC
5-LRC
5-NP
1"
2.2
4.4
11.5
-
4.1
7.3
11
15.7
21.5
-
7
11⁄2"
1.7
2.5
3.6
4.9
8.4
14
Pérdida de presión de las válvulas de acoplamiento rápido (bares) SIST. MÉTRICO
Caudal
3-RC
m3⁄h
l/m
1.9 cm
33-DRC
33-DLRC
33-DNP
1.9 cm
2.3
4
5
6
7
8
9
10
12
14
16
22
28
38
67
83
100
117
133
150
167
200
233
267
367
473
0.12
0.41
0.57
-
0.12
0.42
0.62
-
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t$BVEBMEFBHQNEFBN3⁄h; de 37.8 a 473 l/m)
t$BVEBMEFMBTWÈMWVMBT%/1/1Z/1EFBHQNEFBN3⁄h;
de 37.8 a 265 l/m)
44-RC
44-LRC
44-NP
1"
Vista transversal
de una válvula de
acoplamiento rápido
44-RC
44-LRC
44-NP
2.5 cm
5-RC
5-LRC
5-NP
2.5 cm
7
3.8 cm
0.23
0.40
0.62
0.83
-
0.30
0.40
0.50
0.61
0.85
1.15
1.50
-
0.13
0.18
0.25
0.54
0.97
Válvulas de
acoplamiento rápido
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Accesorios para válvulas
Llaves de válvulas
Llaves de válvulas correspondientes
Llaves de acoplamiento rápido
Características
Válvula
t"EBQUBMBTSPTDBTFOMBQBSUFTVQFSJPSEFMBWÈMWVMBEFBDPQMBNJFOUPSÈQJEP 3$
para proporcionar acceso al agua
%3$/1
3$/1
Modelos
3$/1
t%,3⁄4" (20/27)
t,
t,
t,1⁄2
Llave
%,
%,
,
,
,
Roscas superiores para tuberías
Macho
Hembra
3
1
⁄4"
⁄2"
3
1
⁄4"
⁄2"
3
⁄4"
1⁄2"
11⁄44%4R
Llaves de válvulas correspondientes
* Disponible con roscas BSP;
especifique al hacer el pedido
Llave
%,
%,
,
,
,
Roscas superiores para tuberías
Macho
Hembra
Válvulas
Válvula
3$
%3$/1
3$/1
3$/1
SIST. MÉTRICO
55-K-1
Serie SH
Llave para tapa de seguridad
%JTQPTJUJWPHJSBUPSJPQBSBNBOHVFSB
Características
Características
t'JKBMBNBOHVFSBEFBHVBBMBMMBWFEFMBWÈMWVMBEFBDPQMBNJFOUPSÈQJEP
t(JSBIBTUB¡
t1FSNJUFKBMBSMBNBOHVFSBFODVBMRVJFSEJSFDDJØO
t&WJUBFMEB×PEFMBNBOHVFSB
t"CSFZDJFSSBMBUBQBEFTFHVSJEBEPQDJPOBMFOMBTWÈMWVMBTEF
acoplamiento rápido
t"DDJPOBFMDJFSSFEFDPNQSFTJØOEFMNBSDBEPSEFWÈMWVMB
t$PNQBUJCMFDPOMPTNPEFMPT%-3$%/1-3$/1-3$
y 5-NP
Especificaciones
Modelo
t4)SPTDBIFNCSBEFUVCPEF3/4" (1.9 cm) (20/27) x rosca macho para
manguera de 3/4" (1.9 cm) (20/27)
t4)SPTDBIFNCSBEFUVCPEFDN
YSPTDBNBDIPQBSB
manguera de 3/4" (1.9 cm) (20/27)
t4)SPTDBIFNCSBEFUVCPEFDN
YSPTDBNBDIPQBSB
manguera de 1" (2.5 cm) (26/34)
t4)SPTDBIFNCSBEFUVCPEF1/2" (1.3 cm) (40/49) por rosca macho para
manguera de 1" (2.5 cm) (26/34)
t-MBWFEFUBQB
Modelos
t4)
t4)
t4)
t4)
*Disponible con roscas BSP
El uso inteligente del agua.™
SH-0
2049
107
Válvulas
Accesorios para válvulas
SPLICE-1
Ensamble de manija violeta para válvula
Empalme de cables
Características
Características
t&NQBMNFSÈQJEPZDPOGJBCMF
t-BDBSDBTBOFHSBSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUBTWJFOFMMFOBEFHSBTB
de litio no tóxica
t.BOJKBWJPMFUBEFDPOUSPMEFDBVEBMRVFJEFOUJGJDBMBWÈMWVMB
como parte del sistema de agua no potable
t'ÈDJMJOTUBMBDJØOFODBNQP
t5BNB×PTEJTQPOJCMFTQBSBUPEBTMBTWÈMWVMBTDPNFSDJBMFTEF3BJO#JSE
Especificaciones
Modelos
t&NQBMNBDBCMFTEFDPOUSPMFMÏDUSJDPEFCBKPWPMUBKF7NÈYJNP
t'JKBDBCMFTEFIBTUB
- 5 #18, #20 ó #22 AWG
- 4 #16 AWG
- 2 #14 AWG
t1("/1)"/QBSBWÈMWVMBT1("EFZ1/2" [2.5 cm y 3.8 cm])
t1("/1)"/QBSBWÈMWVMBT1("EF<DN>
t1&#/1)"/QBSBWÈMWVMBT1&#1&4#EF<DN>
t1&#/1)"/QBSBWÈMWVMBT1&#1&4#EF1/2" y 2" [3.8 cm y 5.1 cm])
t#1&/1)"/QBSBWÈMWVMBT#1&#1&4EF<DN>
Modelo
t41-*$&
Válvulas
PEB-NP-HAN PGA-NP-HAN
BPE-NP-HAN
SPLICE-1
108
El uso inteligente del agua.™
Válvulas
www.rainbird.com/valves
Calibre de los cables de las válvulas comerciales: 50 Hz
Cálculo del calibre del cable de las válvulas de solenoide de 24 VCA – 50 Hz
Válvula de 9.8 VA (EZ) con transformadores de 26.5 V - Pies equivalentes del circuito
Q
t
t t
común
Calibre del cable
Calibre del cable de control
18
16
14
12
10
18
16
14
12
10
8
6
4
2800
3400
4000
4500
4800
5100
5300
5400
11300
13900
16200
18100
19500
18000
22100
25700
28800
t
t
t
4400
5500
6400
7100
7700
8100
8400
7100
8700
10200
11400
12300
13000
Presión de agua en la válvula de 100 psi (6.9 bares)
común
Calibre del cable
Calibre del cable de control
18
16
14
18
16
14
12
10
8
6
4
2600
3200
3800
4200
4500
4800
4900
5100
t
t
t
4200
5100
6000
6700
7200
7600
7900
6700
8200
9600
10700
11600
12200
t
12
10600
13100
15200
17000
18400
10
Presión de agua en la válvula de 125 psi (8.6 bares)
t
10
10200
12600
14700
16400
17700
16300
20000
23300
26100
6400
7900
9200
10300
11200
11800
Presión de agua en la válvula de 150 psi (10.4 bares)
t
12
10
18
16
14
12
10
8
6
4
2400
3000
3500
3900
4200
4400
4600
4700
9900
12100
14100
15800
17100
15700
19300
22500
25200
t
t
3900
4800
5600
6200
6700
7100
7300
6200
7600
8900
10000
10700
11300
Presión de agua en la válvula de 200 psi (13.8 bares)
común
Calibre del cable
Calibre del cable de control
18
16
14
18
16
14
12
10
8
6
4
1800
2200
2600
2900
3200
3300
3500
3500
t
t
2900
3600
4200
4700
5100
5300
5500
t
4700
5800
6700
7500
8100
8600
El uso inteligente del agua.™
t
12
7400
9200
10700
11900
12900
6
11900
14600
17000
19000
t t
25900
31700
37100
40900
50300
4
t t
6
25000
30500
35800
39300
48400
18900
23100
27000
4
63000
V
6
%FUFSNJOFMBEJTUBODJBSFBMBMPMBSHPEFMBFYUFOTJØOEFM
cable, desde el controlador hasta la primera válvula de un
circuito y entre cada válvula subsiguiente de un circuito
EFWBSJBTWÈMWVMBTDPNPTFNVFTUSBFOMB'JHVSB"QÈHJOB
93). Ejemplo: (solenoide de dos vatios, transformador
de 26.5 V a 50Hz y 150 psi de presión de agua en las
válvulas).
Paso 2
Calcule la longitud del circuito equivalente para cada
circuito de válvula en el controlador. (Consulte el cuadro
de la izquierda.)
t t
29800
36600
Paso 3
Selección del tamaño del cable común: con la mayor
longitud equivalente ya calculada, vaya a la tabla de
válvulas correspondiente para seleccionar un cable
común y un cable de control que tengan el tamaño más
similar posible (el tamaño del cable común siempre debe
ser igual o mayor que el tamaño del cable de control). En
FMFKFNQMPBOUFSJPSFMDJSDVJUPQBSBMBFTUBDJØO/¡UJFOF
la longitud equivalente más larga, 7000 pies (2134 m). En
la tabla (para este ejemplo, utilice la tabla para 150 psi
de presión de agua en la válvula y un transformador de
26.5 V), seleccione una combinación de cables de calibre
14 y 12. Seleccione un cable común como cable calibre
%BEPRVFEFCFVUJMJ[BSTFVOTPMPDBCMFDPNÞOQBSB
todas las válvulas en el controlador, usted ha establecido
el calibre del cable común para dicho controlador como
cable calibre 12.
65400
V
8
t t
67800
V
6
8
Paso 1
4
42400
52200
Q
10
72100
t t
8
t t
Calibre del cable de control
18
16
14
4
V
Q
común
Calibre del cable
t
26900
32900
38500
t t
12
2500
3100
3600
4100
4400
4600
4800
4900
4000
5000
5800
6500
7000
7400
7600
45000
55400
Q
18
16
14
12
10
8
6
4
t
28600
35000
40900
8
Calibre del cable de control
18
16
14
t
6
t t
16900
20800
24200
27100
t t
8
Q
común
Calibre del cable
t
V
4
Paso 4
Cálculo del calibre de los cables de control del circuito: a
partir de la lectura de la fila del calibre del cable común
seleccionado en el Paso 3 (calibre 12), proceda con la
selección del calibre de cada cable de control de la tabla
utilizando la longitud equivalente calculada para cada
circuito.
Estación Nº 1:-POHJUVEFRVJWBMFOUFWÈMWVMBY
QJFTN
QJFTN
Seleccione un cable de control calibre 18
Estación Nº 2:-POHJUVEFRVJWBMFOUFWÈMWVMBY
QJFT<N>
WÈMWVMBTYQJFT<N>
pies (1524 m) Seleccione un cable de control calibre 16
Estación Nº 3:-POHJUVEFRVJWBMFOUFWÈMWVMBY
pies [152 m]) + (2 válvulas x 1000 pies [305 m]) + (3
WÈMWVMBTYQJFT<N>
QJFTN
Seleccione un cable de control calibre 14
47600
109
Válvulas
Presión de agua en la válvula de 80 psi (5.5 bares)
Procedimiento para calcular el
calibre de los cables de la válvula
Válvulas
Calibre de los cables de las válvulas comerciales: 60 Hz
Cálculo del calibre del cable de las válvulas de solenoide de 24 VCA – 60Hz
Válvula de 9.8 VA (EZ) con transformadores de 26.5 V - Pies equivalentes del circuito
Presión de agua en la válvula de 80 psi (5.5 bares)
Q
t
t t
común
Calibre del cable
Calibre del cable de control
18
16
14
12
10
18
16
14
12
10
8
6
4
2300
2800
3300
3700
4000
4200
4400
4500
9400
11500
13500
15000
16300
15000
18400
21400
24000
t
t
t
3700
4500
5300
5900
6400
6700
7000
5900
7200
8500
9500
10200
10800
Presión de agua en la válvula de 100 psi (6.9 bares)
Válvulas
común
Calibre del cable
Calibre del cable de control
18
16
14
18
16
14
12
10
8
6
4
2100
2500
3000
3300
3600
3800
3900
4000
t
t
3300
4100
4700
5300
5700
6000
6200
t
5300
6500
7600
8500
9100
9600
t
12
8400
10300
12000
13400
14500
10
Presión de agua en la válvula de 125 psi (8.6 bares)
t
10
7400
9100
10600
11900
12800
11800
14500
16900
18900
4600
5700
6700
7500
8100
8500
Presión de agua en la válvula de 150 psi (10.4 bares)
t
12
10
18
16
14
12
10
8
6
4
1600
2000
2300
2600
2800
3000
3100
3200
6600
8200
9500
10600
11500
10600
13000
15200
17000
t
2600
3200
3700
4200
4500
4800
4900
t
4200
5100
6000
6700
7200
7600
Presión de agua en la válvula de 200 psi (13.8 bares)
común
Calibre del cable
Calibre del cable de control
18
16
14
18
16
14
12
10
8
6
4
1300
1600
1900
2100
2300
2400
2500
2500
110
t
t
2100
2600
3000
3400
3600
3800
3900
t
3300
4100
4800
5400
5800
6100
t
12
5300
6500
7600
8500
9200
6
t t
18700
22900
26900
29600
36400
4
t t
6
16800
20600
24100
26600
32700
13500
16500
19400
4
42500
V
6
t t
21300
26200
Paso 1
%FUFSNJOFMBEJTUBODJBSFBMBMPMBSHPEFMBFYUFOTJØOEFM
cable, desde el controlador hasta la primera válvula de un
circuito y entre cada válvula subsiguiente de un circuito
EFWBSJBTWÈMWVMBTDPNPTFNVFTUSBFOMB'JHVSB"QÈHJOB
93). Ejemplo: (solenoide de dos vatios, transformador
de 26.5 V a 60 Hz y 150 psi de presión de agua en las
válvulas).
Paso 2
Calcule la longitud del circuito equivalente para cada
circuito de válvula en el controlador. (Consulte el cuadro
de la izquierda.)
Paso 3
Selección del tamaño del cable común: con la mayor
longitud equivalente ya calculada, vaya a la tabla de
válvulas correspondiente para seleccionar un cable
común y un cable de control que tengan el tamaño más
similar posible (el tamaño del cable común siempre debe
ser igual o mayor que el tamaño del cable de control). En
FMFKFNQMPBOUFSJPSFMDJSDVJUPQBSBMBFTUBDJØO/¡UJFOF
la longitud equivalente más larga, 7000 pies (2134 m). En
la tabla (para este ejemplo, utilice la tabla para 150 psi
de presión de agua en la válvula y un transformador de
26.5 V), seleccione una combinación de cables de calibre
12 y 10. Seleccione un cable común como cable calibre
%BEPRVFEFCFVUJMJ[BSTFVOTPMPDBCMFDPNÞOQBSB
todas las válvulas en el controlador, usted ha establecido
el calibre del cable común para dicho controlador como
cable calibre 10.
47300
V
8
8
53700
V
6
t t
8500
10400
12100
13600
4
33500
41300
Q
10
60000
t t
8
t t
Calibre del cable de control
18
16
14
4
V
Q
común
Calibre del cable
t
21300
26000
30500
t t
12
1800
2200
2600
2900
3200
3300
3400
3500
2900
3600
4200
4700
5000
5300
5500
37500
46100
Q
18
16
14
12
10
8
6
4
t
23800
29100
34000
8
Calibre del cable de control
18
16
14
t
6
t t
13400
16400
19100
21400
t t
8
Q
común
Calibre del cable
t
V
Procedimiento para calcular el
calibre de los cables de la válvula
4
Paso 4
Cálculo del calibre de los cables de control del circuito: a
partir de la lectura de la fila del calibre del cable común
seleccionado en el Paso 3 (calibre 10), proceda con la
selección del calibre de cada cable de control de la tabla
utilizando la longitud equivalente calculada para cada
circuito.
Estación Nº 1:-POHJUVEFRVJWBMFOUFWÈMWVMBY
QJFTN
QJFTN
4FMFDDJPOFVODBCMFEF
control calibre 18
Estación Nº 2:-POHJUVEFRVJWBMFOUFWÈMWVMBY
QJFT<N>
WÈMWVMBTYQJFT<N>
pies (1524 m) Seleccione un cable de control calibre 14
Estación Nº 3:-POHJUVEFRVJWBMFOUFWÈMWVMBY
pies [152 m]) + (2 válvulas x 1000 pies [305 m]) + (3
WÈMWVMBTYQJFT<N>
QJFTN
Seleccione un cable de control calibre 12
34100
El uso inteligente del agua.™
Impactos
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Cuerpos de difusores
Accesorios
Programadores
Accesorios
Válvulas
“En proyectos anteriores, instalé un
tubo de plástico con aproximadamente
una docena de orificios perforados a mano
y un burbujeador retroadaptado, pero
nunca estuve totalmente satisfecho con
este método de 'hágalo usted mismo'. En
un trabajo reciente necesitábamos sembrar
200 plántulas de roble blanco en un sitio
de 20 acres y utilizamos el RWS de Rain
Bird. Un año después de haberlos sembrado,
los árboles muestran una vitalidad
extremadamente buena. Si busca vitalidad
a largo plazo y árboles sanos, esta es una
excelente herramienta".
Greg Houck
Bombas
Xerigation®
Sistemas de control
centralizado
Ad Land Venture
Drenaje
Sugerencias para ahorrar agua
Serie de riego de raíces
El uso inteligente del agua.™
t Solución de la más alta eficacia para el
riego de los árboles: uniformidad de
emisión de hasta un 95% con mínimas
pérdidas por viento, evaporación o
control de borde.
t Las zonas de riego subterráneas
Recursos
para la distribución de agua en las
zonas de raíces de los árboles y
arbustos que los burbujeadores
sobre el terreno.
específicas del RWS reducen el
estrés de los árboles y arbustos
causado por las estrictas
restricciones de riego del césped.
Referencia
t El RWS posee mayor eficiencia
111
Accesorios
Ensambles flexibles
Serie SA
Los ensambles flexibles conectan los aspersores a los tubos laterales
Q Alternativa de calidad para los accesorios de tuberías flexibles y de
conectores de punta espiralados ensamblados de forma local que no
posean garantía del fabricante
Q Un completo rango de productos permite una variedad de soluciones
paisajísticas
Q Los accesorios de alta ingeniería y los aspersores complementarios
inspiran confianza en la especificación del producto
Sistema exclusivo de Rain Bird que ofrece:
montajes flexibles y aspersores
Especificaciones
El rango operativo de los Montajes flexibles de Rain Bird alcanza o supera el
SBOHPPQFSBUJWPEFMBNBZPSÓBEFMPTBTQFSTPSFTEF›
DN
ZEFMPTSPUPSFTEF£DN
t1SFTJØOPQFSBUJWBIBTUBQTJCBSFT
t1SFTJØOEFEFTDBSHBIBTUBQTJCBSFT
t5FNQFSBUVSBIBTUB¡'¡$
t$BVEBMNÈYJNPHQNMT
t-BQÏSEJEBEFQSFTJØOBHQNMT
FTEFQTJCBSFT
Accesorios
Cómo especificar
SA 12 5050
Entrada/salida
›Y›DNYDN
›Y›DNYDN
›Y£DNYDN
£Y£DNYDN
Longitud
18"
12"
6"
Serie SA
Modelo
Ensamble flexible
Especificaciones de los ensambles flexibles de la Serie SA
Número de modelo
SA-6050
SA-65075
SA-125050
SA-125075
SA-127575
SA-185050
112
Número de pieza
A48030
A48055
A48035
A48045
A48050
A48065
Longitud
EE. UU.
4*45.²53*$0
Entrada
EE. UU.
4*45.²53*$0
Salida
EE. UU.
4*45.²53*$0
6"
6"
12"
12"
12"
18"
15.2 cm
15.2 cm
30.5 cm
30.5 cm
30.5 cm
45.7 cm
›
›
›
›
£
›
1.3 cm
1.3 cm
1.3 cm
1.3 cm
1.9 cm
1.3 cm
›
£
›
£
£
›
1.3 cm
1.9 cm
1.3 cm
1.9 cm
1.9 cm
1.3 cm
El uso inteligente del agua.™
Accesorios
www.rainbird.com/accessories
5VCFSÓBGMFYJCMFZDPOFDUPSFTEFQVOUBFTQJSBMBEPT
Tubería flexible serie SPX
La tubería flexible con conectores de punta espiralados ofrece un
ensamble flexible para aspersores y rotores ·
Características y beneficios
t419'-&9
'MFYJCJMJEBETVQFSJPSRVFQFSNJUFRVFMBTUVCFSÓBTTFFOSVUFO
eficientemente en paisajes rocosos, terrazas y terrenos desnivelados para
convertir el diseño paisajístico en realidad
- Superficie texturada que logra que el producto sea más fácil de manipular,
lo cual contribuye a mejorar la eficiencia de la mano de obra, en especial
bajo condiciones de humedad
)BTUBVONÈTGMFYJCMFRVFMBTUVCFSÓBTGMFYJCMFTEFMBDPNQFUFODJB
Hasta un 30% más flexible
que la competencia
- Resistente a torcimientos
- Instalación rápida y fácil que reduce los costos de material y mano de obra
- Se instala rápidamente. Así, queda tiempo para realizar instalaciones
adicionales del sistema y se generan oportunidades de aumento de
ingresos
* Basado en pruebas realizadas en el Centro de Investigaciones de Productos Rain Bird.
Pruebas realizadas en tuberías flexibles de Rain Bird y de los principales competidores
Especificaciones
t%JÈNFUSPJOUFSOPDN
t1SFTJØOPQFSBUJWBIBTUBQTJCBSFT
Accesorios
t5FNQFSBUVSBIBTUB¡'¡$
Modelos
t419'-&9#PCJOBEFhN
SPX-FLEX100
Conectores de punta en espiral de la Serie SB
Un producto natural, complemento de la tubería flexible de la Serie SPX
Características y beneficios
t-PTBDDFTPSJPTFTUÈOGBCSJDBEPTDPONBUFSJBMBDFUBMSFTJTUFOUFQBSBRVFMB
conexión de la tubería flexible sea rápida y fácil
t'ÈDJMJOTFSDJØOHJSBUPSJBOPTFOFDFTJUBOBCSB[BEFSBTOJQFHBNFOUPQBSBMB
instalación
t#PSEFSFTJTUFOUFEFMDPOFDUPSEFQVOUBRVFQFSNJUFVOBDPOFYJØOTFHVSB
con menor probabilidad de fugas
t"NQMJBWBSJFEBEEFGPSNBTZUBNB×PTRVFQFSNJUFORVFFMDPOUSBUJTUBFMJKB
los mejores accesorios para la aplicación
SB-CPLG
SBA-050
SBFE-050
SBE-075
t-BMPOHJUVEFYUFOEJEBZFMCPSEFSFTJTUFOUFEFMDPOFDUPSEFQVOUBFWJUBOMBT
explosiones, y así se reduce la probabilidad de que tenga que volver a llamar
al contratista
Especificaciones
t1SFTJØOPQFSBUJWBIBTUBQTJCBSFT
t5FNQFSBUVSBIBTUB¡'¡$
Modelos
t4#&./15EF›DN
YDPEPDPODPOFDUPSEFQVOUBEF›DN
t4#&#./15EF›DN
YDPEPDPODPOFDUPSEFQVOUBEF›
paquete al por mayor
t4#&./15EF£DN
YDPEPDPODPOFDUPSEFQVOUBEF›DN
t4#&#./15EF£DN
YDPEPDPODPOFDUPSEFQVOUBEF›
cm); paquete al por mayor
t4#"./15EF›DN
YBEBQUBEPSEFMDPOFDUPSEFQVOUBEF›DN
t4#"./15EF£DN
YBEBQUBEPSEFMDPOFDUPSEFQVOUBEF›DN
t4#5&&DPOFDUPSEFQVOUBEF›DN
YDPOFDUPSEFQVOUBEF›Y
DPOFDUPSEFQVOUBFO5EF›DN
t4#$1-(DPOFDUPSEFQVOUBEF›DN
YBDPQMFEFDPOFDUPSEFQVOUBEF
›DN
t4#'&'/15EF›DN
YDPEPDPODPOFDUPSEFQVOUBEF›DN
SB-NPT-TEE
SBE-050
SB-TEE
El uso inteligente del agua.™
SBA-075
t4#/155&&./15EF›DN
YDPOFDUPSEFQVOUBEF›DN
Y
DPOFDUPSEFQVOUBFTQJSBMBEPEF›DN
113
Accesorios
Riego de raíces
Serie RWS
La Serie de riego de raíces promueve el crecimiento profundo de las raíces y
el desarrollo saludable de los árboles
Q La aireación y el riego subterráneos evitan el impacto causado por el trasplante
de los árboles y arbustos
Q El riego y la aireación de las raíces profundas subterráneas garantizan la salud
de los árboles y promueven un crecimiento acelerado
Q Solución de la más alta eficacia para el riego de los árboles: uniformidad de
emisión de hasta un 95% con viento, evaporación o pérdidas de control de
extremos mínimos
Características y beneficios
t#VSCVKFBEPSTVCUFSSÈOFPEJTF×BEPFTUÏUJDBNFOUFQBSBDPOUSJCVJSBMB
apariencia natural del paisaje
t-BSFKJMMBDPOMMBWFFOFMHSBEJFOUFTJSWFDPNPPCTUÈDVMPTJBMHVJFOJOUFOUB
dañar algún componente
t "ZVEBBFWJUBSFMDSFDJNJFOUPTVQFSGJDJBMEFMBTSBÓDFTZFMEB×PEFMPTQBJTBKFT
rocosos
t&TUÏUJDBNFOUFBUSBDUJWPQPSEFCBKPEFMBJOTUBMBDJØOEFMHSBEJFOUF
t6OJEBEFTBSNBEBTEFGÈCSJDBFJOEFQFOEJFOUFTQBSBVOBDPOGJBCJMJEBE
garantizada
t7BSJFEBEEFNPEFMPTEJTQPOJCMFTRVFTFBEBQUBOBMBGMFYJCJMJEBEEFMEJTF×P
Para el modelo RWS:
Accesorios
- Cubierta de retención de 4" (10.2 cm) y rejilla con llave resistente al
vandalismo que se encuentra en la parte superior de un tubo de malla
semi-rígido de 36" (91.4 cm)
RWS-B-1401
RWS-M-B-1401
- Ensambles flexibles instalados de fábrica (excluido el RWS-BGX) con
burbujeador 1401 (0.25 gpm; 1.2 l/min), 1402 (0.5 gpm; 1.8 l/min) o 1404
(1.00 gpm; 3.6 l/min) en una tubería de elevación fija que facilita la conexión
a las líneas laterales
'VOEBPQDJPOBMJEFBMQBSBVUJMJ[BSFOFMTVFMPBSFOPTP
RWS-S-B-1401
Para el RWS - Mini:
- Cubierta de retención de 4" (10.2 cm) y rejilla con llave resistente al
vandalismo que se encuentra en la parte superior de un tubo de malla
semi-rígido de 18" (91.4 cm)
$PEPDPODPOFDUPSEFQVOUBFTQJSBMBEPEF›DN
JOTUBMBEPEFGÈCSJDB
con un burbujeador 1401 o 1402 que facilita la conexión a las líneas laterales
'VOEBQBSBTVFMPTBSFOPTPTPQDJPOBMJEFBMQBSBVUJMJ[BSFOTVFMPTDPOUJFSSB
fina
Para el RWS - Suplementario:
- Cubierta base y cubierta a presión de 2" (5.1 cm) que contienen un tubo de
malla semi-rígido de 10" (25.4 cm)
$PEPDPODPOFDUPSEFQVOUBFTQJSBMBEPEF›DN
JOTUBMBEPEFGÈCSJDB
con un burbujeador 1401 que facilita la conexión a las líneas laterales
- El tamaño adecuado para los arbustos
Funda del RWS
Diseñado para adaptarse a
las unidades del RWS y RWSMini. Ideal para utilizar en
suelos con tierra fina; para
evitar que la tierra se infiltre
en el recipiente del RWS
Collarín integrado y sujetador
para rejilla con llave del RWS
114
El uso inteligente del agua.™
Accesorios
www.rainbird.com/accessories
Riego de raíces
Dimensiones
t3JFHPEFSBÓDFTEJÈNFUSPEFwDN
YwDN
EFMPOHJUVE
t3JFHPEFSBÓDFTo.JOJEJÈNFUSPEFwDN
YwDN
EFMPOHJUVE
t3JFHPEFSBÓDFTo4VQMFNFOUBSJPEJÈNFUSPEFwDN
YwDN
EFMPOHJUVE
Modelos/Especificaciones
Modelo
Burbujeador
Válvula de
retención
Ensamble flexible
c/entrada M NPT de ½"
(1.3 cm) (15/21)
Codo con conector de punta
espiralado c/entrada M NPT
de ½" (1.3 cm) (15/21)
–
–
–
(18")
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
Riego de raíces (con rejilla con llave de 4" [10.2 cm] resistente al vandalismo)
RWS
*EFBMQBSBUVCFSÓBEFHPUFPEFžiP
equipos suministrados por el cliente
RWS-B-C-1401
RWS-B-1401
RWS-B-X-1401
RWS-B-C-1402
RWS-B-1402
RWS-B-C-1404
0.25 gpm (1.2 l/m)
0.25 gpm (1.2 l/m)
0.25 gpm (1.2 l/m)
0.50 gpm (1.8 l/m)
0.50 gpm (1.8 l/m)
1.00 gpm (3.6 l/m)
–
–
–
RWS-M
*EFBMQBSBUVCFSÓBEFHPUFPEFžiP
equipos suministrados por el cliente
RWS-M-B-C-1401
RWS-M-B-1401
RWS-M-B-C-1402
RWS-M-B-1402
0.25 gpm (1.2 l/m)
0.25 gpm (1.2 l/m)
0.50 gpm (1.8 l/m)
0.50 gpm (1.8 l/m)
–
–
Accesorios
Riego de raíces - Mini (con rejilla con llave de 4" [10.2 cm] resistente al vandalismo)
Riego de raíces - Suplementario (con cubierta base y cubierta a presión de 2" [5.1 cm])
RWS-S-B-C-1401
RWS-S-B-1401
0.25 gpm (1.2 l/m)
0.25 gpm (1.2 l/m)
–
FUNDA DEL RWS (Funda para suelos arenosos para riego de raíces) (6 por bolsa)
'6/%"%&-384'VOEBEFSJFHPEFSBÓDFT
3&+*--"1Á31%&-3843FKJMMBWJPMFUBEFMB4FSJFEFSJFHPEFSBÓDFTQBSB384Z384.JOJ
Instale el producto
alineado con nivel
de terminación
El oxígeno y la
circulación del
agua promueven el
crecimiento saludable
de las plantas
Coloque las
unidades
espaciadas de
manera uniforme
alrededor del
cepellón
El uso inteligente del agua.™
Cómo especificar
RWS - x - x - x - xxxx
Modelo de
burbujeador
1401
1402
1404
Característica
C: Válvula de retención
Burbujeador
B: Burbujeador preinstalado
Otro tamaño
M: Mini-RWS (4" [10.2 cm] x 18" [45.7 cm])
S: RWS-Suplementario (2" [5.1 cm] x
10" [25.4 cm] )
Modelo
Serie de riego de raíces RWS
115
Accesorios
Cajas de válvulas
Una variedad de tamaños y formas de cajas de válvulas que facilitan la
elección de la caja adecuada para el trabajo. Cuerpo negro y tapas negras
totalmente fabricadas con materiales reciclados
Las tapas ciegas para
pernos impiden el acceso
a insectos y plagas cuando
no se utilicen pernos
Los lados corrugados
mantienen la integridad
estructural con cargas pesadas
Las tapas con bordes
biselados evitan los
daños ocasionados
por los aparatos
p
p
para
p
césped
Ranura de acceso
para pala para
quitar fácilmente
la tapa
Cajas de válvulas Serie VB
Las cajas de válvulas ofrecen una resistencia de caja superior para una
mejor protección de las válvulas
Q Pestaña ancha con estructura corrugada que ofrece una resistencia de caja
superior para una mejor protección de las válvulas
Q Ranura de acceso para pala exclusiva que ofrece una mejor accesibilidad
para hacer mantenimiento
Q Las tapas sin orificios reducen el peligro por abejas, arañas y serpientes
Q .BUFSJBMFTFDPMØHJDPTDFSUJGJDBEPTQPS-&&%UPUBMNFOUFGBCSJDBEPTDPO
materiales reciclados (cajas negras solamente)
Características y beneficios
Estas características se aplican a las cajas de válvulas Estándar, Jumbo, Super
Jumbo, Maxi Jumbo y Redonda de 7 y 10" :
t&YDMVTJWBTUBQBTDJFHBTQBSBQFSOPTEJTF×BEBTFOMBTUBQBTRVFNBOUJFOFOBMPT
insectos y plagas fuera de la caja
t"DDFTPQBSBQBMBFOFMDVFSQPRVFQFSNJUFRVJUBSMBUBQBGÈDJMNFOUF
t4VKFUBEPSFTQBSBUBQBTDJFHBTRVFTPTUJFOFOEFNBOFSBTFHVSBMBTUBQBTDJFHBT
quitadas por encima de los tubos, lo que mantiene la suciedad fuera durante el
relleno
t#PSEFTEFMBUBQBCJTFMBEPTRVFBZVEBOBFWJUBSMPTEB×PTPDBTJPOBEPTQPS
aparatos para césped
Accesorios
La característica de
enganche
bloquea dos cajas
juntas cuando
están ajustadas
por la parte inferior
para instalaciones
profundas
Los sujetadores para
tapas ciegas, una vez
quitadas las tapas,
las mantienen en
su lugar durante el
relleno
Tapas ciegas
en los cuatro
lados
La pestaña
ancha estabiliza
la caja, elimina
la necesidad de
ladrillos y ofrece
una resistencia
de carga lateral
mejorada
t1BSUFJOGFSJPSDPOUSBCBRVFQFSNJUFVOJSMBTDBKBTEFGPSNBTFHVSBQBSB
instalaciones profundas
t«SFBEFTF×BMJ[BDJØOEFMBUBQBRVFQSPQPSDJPOBVOBVCJDBDJØOFTQFDÓGJDBQBSB
identificación
Dimensiones y características adicionales por modelo
SERIE RECTANGULAR ESTÁNDAR (VB-STD)
t %JNFOTJPOFT-Y"OY"MDN-YDN"OYDN"M
t%PTUBQBTDJFHBTHSBOEFTZDFOUSBMFTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEF
IBTUB›DN
ZPODFUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEF
hasta 2" (5.0 cm)
t7#45%DVFSQPOFHSPZUBQBWFSEF
t7#45%1DVFSQPOFHSPZUBQBWJPMFUBDPOBEWFSUFODJBCJMJOHàFEFOPQPUBCMF
t7#45%#DVFSQPOFHSPTPMBNFOUF
t7#45%-UBQBWFSEF
Todas las cajas excepto la
Redonda de 6" (15.2 cm) se
unen de forma segura
t7#45%1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHàFEFOPQPUBCMF
t7#45%#,-UBQBOFHSB
t7#45%)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal
%JNFOTJPOFTEFFYUFOTJØOFTUÈOEBSEF-Y"OY"M
(50.8 cm L x 37.5 cm An x 17.1 cm Al)
Parte inferior con traba para
instalaciones profundas
t7#45%&95FYUFOTJØOFTUÈOEBSEFDPODVFSQPOFHSPZUBQBWFSEF
t7#45%&95#FYUFOTJØOFTUÈOEBSEFDPODVFSQPOFHSPTPMBNFOUF
Idioma y símbolo
internacional de no potable
116
El uso inteligente del agua.™
Accesorios
www.rainbird.com/accessories
Cajas de válvulas
SERIE RECTANGULAR JUMBO (VB - JMB)
SERIE RECTANGULAR SUPER JUMBO (VB - SPR)
t %JNFOTJPOFT-Y"OY"MDN-YDN"OYDN"M
t %JNFOTJPOFT-Y"OY"MDN-YDN"OYDN"M
t%PTUBQBTDJFHBTHSBOEFTZDFOUSBMFTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEF
IBTUB›DN
-BTFYUFOTJPOFTOPUJFOFOUBQBTDJFHBT
t7#+.#DVFSQPOFHSPZUBQBWFSEF
t$BUPSDFUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEFIBTUB›DN
t*ODMVZFEPTQFSOPTZBCSB[BEFSBTEFBDFSPJOPYJEBCMFRVFBKVTUBOMBUBQBBMDVFSQPEF
forma segura
t7#+.#1DVFSQPOFHSPZUBQBWJPMFUBDPOBEWFSUFODJBCJMJOHàFEFOPQPUBCMF
t7#413)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPTEFTFHVSJEBEEFDBCF[BIFYBHPOBM
t7#+.##DVFSQPOFHSPTPMBNFOUF
t7#413-UBQBWFSEF
t7#+.#-UBQBWFSEF
t7#4131-UBQBWJPMFUB"EFDVBEBTPMPQBSBDBKBTEFWÈMWVMBT7#413DPOMBT
dimensiones siguientes: 33.1" L x 23.8" An x 15.0" Al (84.1 cm L x 60.5 cm An x
38.1 cm Al)
t7#+.#1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHàFEFOPQPUBCMF
t7#+.##,-UBQBOFHSB
t7#+.#)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal
SERIE RECTANGULAR MAXI JUMBO (VB - MAX)
t %JNFOTJPOFT-Y"OY"MDN-YDN"OYDN"M
t %JNFOTJPOFTEFFYUFOTJØO+VNCPEF-Y"OY"M
(62.0 cm L x 45.5 cm An x 17.1 cm Al)
t7#+.#&95FYUFOTJØO+VNCPEFDPODVFSQPOFHSPZUBQBWFSEF
t7#+.#&95#FYUFOTJØO+VNCPEFDPODVFSQPOFHSPTPMBNFOUF
t%JFDJPDIPUBQBTDJFHBTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEFIBTUB›DN
t*ODMVZFEPTQFSOPTZBCSB[BEFSBTEFBDFSPJOPYJEBCMFRVFBKVTUBOMBUBQBBMDVFSQPEF
forma segura
t7#."9)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPTEFTFHVSJEBEEFDBCF[B
hexagonal
t7#."9-UBQBWFSEF
t7#."91-UBQBWJPMFUB"EFDVBEBTPMPQBSBDBKBTEFWÈMWVMBT7#."9DPOMBT
dimensiones siguientes: 40.3" L x 27.1" An x 18.0" Al (102.4 cm L x 68.8 cm An x
45.7 cm Al)
Accesorios
t7#."9#DVFSQPOFHSPTPMBNFOUF
VB-SPR-PL
VB-MAX-PL
VB-STD
VB-10RND
VB-JMB
VB-7RND
El uso inteligente del agua.™
VB-6RND
VB-SPR
VB-STD-6
6EXT
VB-MAX
Tapas de cajas de válvulas: verde,
violeta (para indicar agua no
potable), negro
117
Accesorios
Cajas de válvulas Serie VB, válvulas de drenaje
Cajas de válvulas Serie VB (cont.)
SERIE REDONDA DE 10" (25.4 cm) (VB-10RND)
SERIE REDONDA DE 6" (15.2 cm) (VB-6RND)
t %JNFOTJPOFTEJÈNTVQY"MYEJÈNJOG
(26.0 cm x 25.4 cm x 34.9 cm)
t %JNFOTJPOFTEJÈNTVQY"MYEJÈNJOGDNYDNYDN
t$VBUSPUBQBTDJFHBTJHVBMNFOUFFTQBDJBEBTDPOFTQBDJPQBSBUVCPTDPOVO
diámetro de hasta 2" (5.0 cm). (Las extensiones no tienen tapas ciegas)
t%PTBCFSUVSBTMBUFSBMFTQSFNPMEFBEBTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEF
hasta 2" (5.0 cm)
t7#3/%DVFSQPWFSEFZUBQBWFSEF
t7#3/%DVFSQPOFHSPZUBQBWFSEF
RESISTENTE AL VANDALISMO
t7#3/%#DVFSQPOFHSPTPMBNFOUF
SISTEMAS DE SEGURIDAD
t7#3/%-UBQBWFSEF
t7#-0$,)QFSOPEFDBCF[BIFYBHPOBMEF3⁄8" x 21⁄4" (1.0 x 5.7 cm), rondana y
abrazadera
t7#3/%1-UBQBWJPMFUBDPOBEWFSUFODJBCJMJOHàFEFOPQPUBCMF
t7#3/%#,-UBQBOFHSB
t7#3/%)DVFSQPOFHSPZUBQBWFSEFDPOQFSOPEFTFHVSJEBEEFDBCF[B
hexagonal
t7#-0$,1QFSOPEFDBCF[BQFOUBHPOBMEF3⁄8" x 21⁄4" (1.0 x 5.7 cm), rondana y
abrazadera
SERIE REDONDA DE 7" (17.8 cm) (VB-7RND)
t %JNFOTJPOFTEJÈNTVQY"MYEJÈNJOG
(16.3 cm x 22.9 cm x 24.9 cm)
t%PTBCFSUVSBTMBUFSBMFTQSFNPMEFBEBTDPOFTQBDJPQBSBUVCPTDPOVOEJÈNFUSPEF
hasta 2" (5.0 cm)
t7#3/%DVFSQPOFHSPZUBQBWFSEF
t7#3/%1DVFSQPOFHSPZUBQBWJPMFUB
t7#3/%#,DVFSQPOFHSPZUBQBOFHSB
Accesorios
Tapas para cajas de
válvulas color violeta para
identificar sistemas de
riego de agua no potable
16A-FDV / 16A-FDV-075
Especificaciones
Las válvulas de drenaje vacían las líneas laterales después de cada ciclo de
riego para reducir el daño ocasionado por las temperaturas bajo cero
t1SFTJØOIBTUBQTJCBSFT
t$BVEBMÓOEJDFNÈYJNPEFHNQN3/h; 0.06 l/s) antes del sellado
Características y beneficios
t1SFTJØOEFBQFSUVSBQSPNFEJPDVBOEPFTUÈJOTUBMBEBWFSUJDBMNFOUFQTJ
(0.2 bares)
t7BDÓBMBTMÓOFBTEFBHVBFOGPSNBBVUPNÈUJDBQBSBFWJUBSFMDPOHFMBNJFOUP
t$VCJFSUBTEFQMÈTUJDPQFSGPSBEBTRVFFMJNJOBOMBTQBSUÓDVMBTHSBOEFT
t1SFTJØOEFDJFSSFQSPNFEJPDVBOEPFTUÈJOTUBMBEBWFSUJDBMNFOUFQTJ
(0.4 bares)
t"MNPIBEJMMBEFEJTQFSTJØORVFGJMUSBMBTQBSUÓDVMBTQFRVF×BT
t%JÈNFUSPDN
-POHJUVEDN
Modelos
t"'%7FOUSBEBNBDIPSPTDBEBEF›DN
t"'%7FOUSBEBNBDIPSPTDBEBEF£DN
16A-FDV
118
El uso inteligente del agua.™
www.rainbird.com/controllers
Impactos
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Controladores
Accesorios
Válvulas
“El ESP-Me es una adquisición importante para la
familia de controladores de riego de Rain Bird. Una
mayor capacidad de expansión de estaciones
permite mayor flexibilidad al elegir un controlador
para sistemas residenciales más grandes o sistemas
comerciales más pequeños. La programación de este
controlador no es más complicada que la del ESPModular. Todas las funciones son fáciles de encontrar y
comprender. La actualización de Smart Panel también
puede ser una buena opción para las necesidades de
conservación del agua.”
Programadores
Michael Thompson,
Contratista certificado de sistemas de riego
Xerigation®
Sistemas de control
centralizado
Gerente de servicio de riego
Michael Hatcher & Associates
Memphis, TN
optimizar realizando ajustes diarios de los
horarios de riego para ajustarlo de forma
adecuada, según las condiciones
NFUFPSPMØHJDBTEFMNPNFOUP5PEPTMPT
controladores de la serie ESP-LX pueden
actualizarse fácilmente para que incluyan
la función inteligente de control de riego
por evapotranspiración basada en
condiciones meteorológicas o en la
humedad del suelo agregando el
DBSUVDIP&5.BOBHFSEF3BJO#JSE
t 5PEPTMPTDPOUSPMBEPSFT3BJO#JSETJNQMJGJDBO
la conservación por medio de una variedad
de funciones flexibles de programación. Con
solo presionar un botón, el controlador ESPMe puede restaurar un horario de riego
previamente guardado del programa
i$POUSBDUPS%FGBVMUwQSFEFUFSNJOBEPQPSFM
contratista), y la función de “Restauración con
retraso programable” del controlador serie
ESP-LX permite volver automáticamente a
los horarios de riego típicos después de un
período de tiempo configurado por el
usuario
Drenaje
t El ahorro de agua también se puede
Referencia
Adjust) está disponible en todos los
controladores de Rain Bird que funcionan
con corriente alterna, para que los
usuarios puedan ajustar fácilmente los
horarios de riego según los cambiantes
requisitos del riego paisajístico por
temporada. Los controladores de la serie
ESP-LX también cuentan con una función
de ajuste estacional mensual automático
que contribuye al ahorro de agua por
medio de ajustes automáticos que se
realizan todos los meses del año.
Recursos
t La función de ajuste estacional (Seasonal
Bombas
Sugerencias para ahorrar agua
El uso inteligente del agua.™
119
Controladores
Productos principales
Productos principales
Aplicaciones primarias
ESP-RZX
Programadores
O
Uso residencial
Uso comercial liviano
Uso comercial/industrial
Tipo de controlador
O
Híbrido
%FFTUBEPTØMJEP
Controlado con pilas
O
Ubicación interior
O
Ubicación exterior
Características
Estaciones (máximo)
8
Programas (máximo)
8
Cronometraje de las estaciones (máximo)
240 min
Número de arranques por programa (máximo)
48
O
Protección contra descargas
O
230 VCA opcional
O
Arranque de válvula maestra/bomba
O
Water Budgeting (control del porcentaje de riego)
O
Interruptor de programas/zonas individuales
Retraso de riego por lluvia
O
Programable con pila
O
5FSNJOBMFTEFTFOTPSFTJOEJDBEPSEFFTUBEPZBOVMBDJØO
Retraso de tiempo entre estaciones (máximo)
O
%FUFDDJØOEFDBVEBM
Operación simultánea de varias estaciones
Sistema Cycle + Soak™ (de ciclo/remojo)
Programas superpuestos
O
Encendido y apagado manual
O
Compatible con control remoto
Pruebas de diagnóstico
O
%JBHOØTUJDPEFDPSUBDJSDVJUPT
Programación fuera de caja de válvulas
Sumergible (máximo)
Resistente al vandalismo y a los golpes
Solenoide de limpieza automática
Indicador de pila baja
Guardar / restaurar programas
Encendido/apagado de válvula maestra por estación
Calculador de tiempo total de riego por programa
O
Invalidación del sensor de lluvia por estación
Horario de programación
O
7 días a la semana
Ciclos fijos de 2, 3 o 5 días
Ciclos variables de 1 a 7 días
O
Ciclos variables de 1 a 31 días
Ciclos variables de 1 a 99 días
O
Ciclos de días pares/impares
%ÓBTJNQBSFTFYDFQUPFMEÓBEFDBEBNFT
O
365 días del año
Apagado por día de evento
Compatibilidad con el sistema de control centralizado
Se puede actualizar a Maxicom2® y SiteControl
4FQVFEFBDUVBMJ[BSB*2™
Gabinete
O
Para interior, de plástico
O
Para exterior, de plástico
Para exterior, de metal con recubrimiento de pintura en polvo
Pedestal de acero inoxidable
Pedestal de metal con recubrimiento de pintura en polvo
Tornillería/Accesorios
%FDPEJGJDBEPSFTEFEPTIJMPTZBDDFTPSJPT
O
Sensor de lluvia
Sensor de caudal
BSUVDIP&5.BOBHFS™
1 Con la función de control del porcentaje de riego, se puede extender el cronometraje
120
Modular ESP
ESP-Me
ESP-SMT
O
O
O
O
O
O
O
O
O
ESP-LXME
ESP-LXMEF
ESP-LXD
TBOS™
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
13
3
6 h1
4
22
4
6 h1
6
13
13
en base al clima
/%
48
4
12 h1
8
48
4
12 h1
8
200
4
12 h1
8
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O2
O2
O2
O
O
O6
O
O6
O
O6
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
9h
9h
9h
0 - 10 min.
0 - 10 min.
0 - 10 min.
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
4
3
12 h
8
O
O
O
O
3.3 pies (1 m)
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
2 Programable por estación
3 No compatible con los controladores Rain Bird a control remoto
O
4 Se puede seleccionar para cada programa y por mes
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
$POUSPMBEPSTFSJF&413;9
Controlador serie ESP-RZX
NUEVO
Controlador para interiores o exteriores de 4, 6, 8 estaciones
fijas de nivel contratista para uso residencial
Especificaciones de operación
t5JFNQPTEFFTUBDJØOBNJO
t"KVTUFFTUBDJPOBMB
t1SPHSBNBDJØOJOEFQFOEJFOUFQPS[POB
Q Las funciones de programación flexibles hacen que el controlador sea ideal
para una amplia variedad de aplicaciones, entre las que se incluyen los
sistemas de riego residenciales y comerciales sencillos
tIPSBSJPTEFJOJDJPQPS[POB
t-PTDJDMPTEFEÓBEFMQSPHSBNBTPOEÓBTEFMBTFNBOBQFSTPOBMJ[BEPTJNQBSFT
pares y fechas cíclicas
Q La programación basada en zonas permite que cada válvula se programe
de forma independiente; y hace innecesaria la explicación al usuario final
de cómo "programar", lo que elimina prácticamente todas las llamadas de
servicio técnico
Especificaciones eléctricas
Q -BHSBOQBOUBMMB-$%NVFTUSBUPEBTMBTQSPHSBNBDJPOFTQBSBDBEB[POBBM
mismo tiempo
t&OUSBEBSFRVFSJEB7$"œ)[
modelos internacionales: 230 VCA ±10%, 50 Hz
Características
t3FTQBMEPEFFOFSHÓBQJMBT"""NBOUJFOFOMBGFDIBZMBIPSBNJFOUSBTRVF
la memoria no volátil mantiene la programación
t;POB1"35*$6-"3NBOFKBEBFOGPSNBNBOVBM
t50%"4MBT[POBTNBOFKBEBTFOGPSNBNBOVBM
t4BMJEB7$"N"
t3FRVJFSFÞOJDBNFOUFEPTUPSOJMMPTEFNPOUBKF
t6OBHVÓBQBSBDPOEVDUPTEF›iP£wQFSNJUFMBJOTUBMBDJØOQSPGFTJPOBMEF
cables de terreno en la caja
t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGÈDJMOBWFHBDJØO
t&OUSBEBEFTFOTPSNFUFPSPMØHJDPDPOJOWBMJEBDJØO
t$JSDVJUPEFJOJDJPEFWÈMWVMBNBFTUSBCPNCB
t.FNPSJBEFQSPHSBNBOPWPMÈUJMB×PT
t1SPHSBNBCMFDPOBMJNFOUBDJØOBQJMB
Funciones de programación
t1SPHSBNBDJØOCBTBEBFO[POBTQFSNJUFUFOFSQSPHSBNBTJOEFQFOEJFOUFT
asignados para cada zona. (Los tiempos el funcionamiento, horarios de inicio
y días de riego se personalizan para cada zona)
t$POUSBDUPS3BQJE1SPHSBNNJOH™DPQJBBVUPNÈUJDBNFOUFMPTIPSBSJPT
de inicio y los días de riego de la zona 1 al resto de las zonas durante la
configuración inicial
tIPSBSJPTEFJOJDJPJOEFQFOEJFOUFTQPS[POB
tPQDJPOFTEFEÓBTEFSJFHPQPS[POB%ÓBTQFSTPOBMJ[BEPTFOMBTFNBOBEÓBT
IMPARES del calendario, días PARES del calendario, cíclico (cada 1 – 14 días)
Certificaciones
t6-D6-$&$5JDL'$$1BSUF*OEVTUSZ$BOBEB*$&4*3".4.BSL*OEJB
452$*TSBFM4**4"4""SBCJB4BVEJUB4"#44VEÈGSJDB
Dimensiones
t"ODIPDNQVMH
t"MUVSBDNQVMH
t'POEPDNQVMH
Modelos
Modelos para interiores
Modelos para exteriores
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
t3;9J7FTUBDJPOFT7
t3;97FTUBDJPOFT7
Modelos para interiores
en Argentina
Modelos para exteriores
en Australia
t3;9J"3(FTUBDJPOFT7
t3;9"64FTUBDJPOFT"64
t3JFHVFNBOVBMNFOUF50%"4MBT[POBTP6/"40-"TFHÞOMBEFNBOEB
t3;9J"3(FTUBDJPOFT7
t3;9"64FTUBDJPOFT"64
Funciones avanzadas
t3;9J"3(FTUBDJPOFT7
t3;9"64FTUBDJPOFT"64
t$PSUBDJSDVJUPTFMFDUSØOJDPEFEJBHOØTUJDPT
t$POUSBDUPS3BQJE1SPHSBNNJOH™Zi$PQJBSMB[POBQSFWJBwQFSNJUFOVOB
configuración inicial más rápida
t(VBSEBSSFTUBVSBSQSPHSBNBEF$POUSBDUPS%FGBVMU™
t*OWBMJEBDJØOEFMTFOTPSEFMMVWJB
Hardware del controlador
t$BKBEFQMÈTUJDPQBSBNPOUBSFOMBQBSFE
t6OJEBEFTEFVFTUBDJPOFT
tQJMBT"""QBSBSFTQBMEPEFMBGFDIBZMBIPSBJODMVJEBT
ESP-RZX para
interiores
El uso inteligente del agua.™
121
Programadores
t-BTFODJMMBJOUFSGB[EFVTVBSJPFTGÈDJMEFFYQMJDBSZNVFTUSBMBGVODJØOEFDBEB
controlador en una sola pantalla
Controladores
Serie ESP-Me
Controladores de la serie ESP-Me
NUEVO
El controlador modular favorito de América, el ESP-Modular, tiene un
diseño completamente nuevo y un conjunto de funciones mejorado
para ofrecer a los contratistas la solución de controladores de riego más
flexible de la industria. El controlador ESP-Me admite hasta 22 estaciones, 4
programas y 6 horarios de inicio.
Q Capacidad para 4 a 22 estaciones
Q La fijación de horarios según programa permite que haya 4 programas
individuales con 6 horarios de inicio independientes por programa para 24
horarios de inicio en total
Q %JBHOØTUJDPBWBO[BEPZEFUFDDJØODPSUBDPOBMFSUB-&%
Q Calculador de tiempo total de riego por programa
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7$"œ)[
(modelos internacionales: 230/240 VCA ± 10%, 50/60 Hz)
t7ÈMWVMBNBFTUSB3FMÏEFBSSBORVFEFCPNCBT
t7PMUBKFPQFSBUJWP7$")[
t&OUSBEBEFCPCJOBNÈY7"
t3FUFODJØOEFCPCJOBNÈY7"
- Consumo de energía cuando está inactivo/apagado: 0.06 A a 120 VCA
t/PTFSFRVJFSFSFTQBMEPEFFOFSHÓB-BNFNPSJBOPWPMÈUJMHVBSEB
permanentemente la programación actual y una batería de litio con vida
útil de 10 años mantiene la fecha y la hora de los controladores durante los
cortes de energía.
Certificaciones
Características
t6-D6-$&$4"$5JDL'$$1BSUFC8&&&4.BSL*1
t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGÈDJMOBWFHBDJØO
Dimensiones
t&OUSBEBEFTFOTPSEFMMVWJBDPODBQBDJEBEEFJOWBMJEBDJØO
t$JSDVJUPEFJOJDJPEFWÈMWVMBNBFTUSBCPNCB
t"ODIP4%4R (27.2 cm)
t.FNPSJBEFBMNBDFOBNJFOUPOPWPMÈUJMB×PT
t"MUVSB4%4R (19.5 cm)
t1SPHSBNBCMFEFGPSNBSFNPUBDPOCBUFSÓBEF7OPJODMVJEB
t1SPGVOEJEBE4%4R (11.2 cm)
t0QDJPOFTEFQSPHSBNBDJØOEFSJFHP4FHÞOMPTEÓBTEFMBTFNBOBEÓBT
IMPARES del calendario, días PARES del calendario, cíclico (cada 1 – 30 días)
t(VBSEBSSFTUBVSBSQSPHSBNBTHVBSEBEPTEF$POUSBDUPS%FGBVMU™
t*OWBMJEBDJØOEFMTFOTPSEFMMVWJBQPSFTUBDJØO
t$BMDVMBEPSEFUJFNQPUPUBMEFSJFHPQPSQSPHSBNB
t3JFHPNBOVBMDPOVOTPMPCPUØO
Programadores
t3FUSBTFFMSJFHPIBTUBQPSEÓBTTFBQMJDBÞOJDBNFOUFBMBTFTUBDJPOFTRVF
no están configuradas para ignorar el sensor de lluvia)
t0QDJØOEFSJFHPNBOVBMQPSQSPHSBNBPFTUBDJØO
Modelos en Norteamérica (120 VCA)
t.PEFMPTCBTFEFMDPOUSPMBEPS
- ESP4MEI: modelo para interiores de 4 estaciones
&41.&NPEFMPQBSBFYUFSJPSFTEFFTUBDJPOFT
t.ØEVMPT
- ESPSM3: módulo de 3 estaciones
- ESPSM6: módulo de 6 estaciones (compatible únicamente con los
controladores de la serie ESP-Me)
t"KVTUFFTUBDJPOBMBQMJDBEPBUPEPTMPTQSPHSBNBTPBQSPHSBNBTQBSUJDVMBSFT
Accesorios
t5JFNQPEFFTQFSBBKVTUBCMFFOUSFMBTWÈMWVMBTFMWBMPSQSFEFUFSNJOBEPFT
t$"#-&'-&9*#-&%&$0/&9*»/: cable flexible de conexión aprobado por UL
t&ODFOEJEPBQBHBEPEFWÈMWVMBNBFTUSBQPSFTUBDJØO
*También disponible en modelos de 230 VCA y 240 VCA
Especificaciones de operación
t$SPOPNFUSBKFEFFTUBDJPOFT%FNJOVUPBIPSBT
t"KVTUFFTUBDJPOBMB
t5FNQFSBUVSBPQFSBUJWBNÈY¡¡'
Controlador y módulos
de la serie ESP-Me
La función de calculador de tiempo total de funcionamiento ESP-Me le dice cuál es el tiempo total de riego por programa para cumplir con
cualquier restricción de riego para ahorro de agua, al permitir que el tiempo total de funcionamiento se determine antes del riego.
122
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
Serie modular ESP
Controlador para interiores o exteriores de 4 a 13 estaciones para uso
residencial y comercial pequeño
Q Modularidad: empieza con el controlador base de 4 estaciones y
se expande fácilmente a 13. Minimiza el inventario y mantiene siempre a
mano el conteo correcto de las estaciones
Q Calidad: confiabilidad incorporada; diseñado con partes duraderas, mayor
protección contra descargas y tolerancia a temperaturas elevadas
Q Programación estilo ESP fácil de usar: sencillo de configurar,
con prueba de horario y aprobado para uso doméstico, para que usted
pueda continuar con su labor más rápido que nunca
Características
t&MQSPHSBNB$POUSBDUPS%FGBVMU™ (predeterminado por el contratista) le
permite al contratista guardar su propio programa predeterminado y
recuperarlo con solo presionar un botón. Apto para recargar fácilmente un
horario que ha sido alterado por un usuario o para reemplazar un horario
temporal para nuevas semillas o césped
t-B"VYJMJBSZ4UBUJPO™ (estación 13) puede configurarse para derivar un sensor
activo para permitir el riego aunque las estaciones estén deshabilitadas o
pueden establecerse como una estación normal. Ideal para riego de patios
cubiertos o sistemas que no requieren riego como iluminación de paisajismo
o fuentes
t%ÓBQSPHSBNBCMFTJOSJFHPRVFQFSNJUFBMVTVBSJPDPOGJHVSBSDVBMRVJFSEÓBEF
la semana como día sin riego en cualquier programa u horario, facilitando el
cumplimiento de las restricciones de riego y demás requisitos, tales como el
cuidado o mantenimiento semanal del césped
t(MPCBMTFBTPOBMBEKVTUBKVTUFHMPCBMQPSUFNQPSBEB
EFB
RVF
permite al usuario alterar el tiempo de riego de todas las válvulas de cada
programa para satisfacer las necesidades cambiantes de cada temporada
t5FSNJOBMFTEFTFOTPSFTEFEJDBEPTRVFQFSNJUFOBMVTVBSJP
conectar fácilmente un sensor al controlador para lograr la máxima eficiencia
EFSJFHP6OBMV[-&%
ZVONFOTBKFFOMBQBOUBMMBEFDSJTUBMMÓRVJEPJOEJDBO
cuándo un sensor está activo
t*OUFSSVQUPSEFCZQBTTEFMTFOTPSRVFQFSNJUFBMVTVBSJPBOVMBSVOTFOTPS
activo
t$JSDVJUPEFBSSBORVFEFWÈMWVMBNBFTUSBCPNCBQSPHSBNBCMFQPSFTUBDJØO
que permite el funcionamiento de la bomba conectada, según sea necesario
t3FUSBTPEFUJFNQPFOUSFFTUBDJPOFTRVFQSPWFFUJFNQPBEJDJPOBMFOUSF[POBT
para la recuperación de agua de pozo o el cierre lento de las válvulas
t-BGVODJØO&OIBODFE%JBHOPTUJD'FFECBDL™ (Reacción de diagnóstico
mejorado) avisa al usuario cuál es el problema cuando el riego se suspende
a causa de un sensor activado, estaciones en cortocircuito o errores de
programación con una luz de advertencia y un mensaje en la pantalla de
cristal líquido
t%JBHOØTUJDPEFDPSUBDJSDVJUPTTJOGVTJCMFTRVFJEFOUJGJDBVOBFTUBDJØODPO
problemas en las válvulas o en el cableado y continúa con el riego de las
estaciones que están en funcionamiento
t5FSNJOBMEFQSVFCBQBSBMBWÈMWVMBRVFQFSNJUFBMJOTUBMBEPSQSPCBSMPT
cables de la válvula durante la instalación, a fin de determinar a qué válvula
está conectado cada cable
t$BMFOEBSJPEFEÓBTRVFDPOUFNQMBB×PTCJTJFTUPTZHBSBOUJ[BFMSJFHP
exacto en días pares e impares
t.FNPSJBOPWPMÈUJMRVFNBOUJFOFFMIPSBSJPEFSJFHPJOEFGJOJEBNFOUF
durante un corte de energía
t1JMBEFMJUJPEFB×PTEFEVSBDJØORVFNBOUJFOFMBGFDIBZIPSBEVSBOUFVOB
vida acumulada de cinco años durante los cortes de energía
Especificaciones de operación
t$BOUJEBEEFQSPHSBNBTJOEFQFOEJFOUFT
t"SSBORVFTBVUPNÈUJDPTQPSQSPHSBNBFOUPUBM
t$SPOPNFUSBKFEFFTUBDJPOFTBIPSBTQBSBUPEBTMBTFTUBDJPOFT
t)PSBSJPTEFQSPHSBNBDJØOJOEFQFOEJFOUFT
- personalizado (riego por día de la semana)
- Impar (riego en los días impares excepto el día 31 y el 29 de febrero si es
año bisiesto)
- Par (riego en los días pares del mes)
- Cíclico (de 1 a 31 días: riego entre una vez al día y una vez cada 31 días)
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7$"œ)[7$"œ)[7$"œ
10%, 50 Hz
t4BMJEB7$""
t4PQPSUFEF7.3FMÏEFJOJDJPEFCPNCBT#PCJOBNÈYFO7"Z#PCJOBNÈY
mantiene 5VA
t1SPUFDDJØODPOUSBEFTDBSHBT-BFOUSBEBQSJODJQBMUJFOFEPTWBSJTUPSFTEF
óxido metálico (MOV, por sus siglas en inglés) incorporados para proteger
los circuitos. La salida tiene 2 varistores de óxido metálico incorporados para
cada estación de válvulas
t3FTQBMEPEFFOFSHÓB1JMBEFCPUØOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB
mientras que la memoria no volátil mantiene la programación
t$BQBDJEBEEFFTUBDJØOEFWÈMWVMBTNÞMUJQMFT)BTUBEPTWÈMWVMBTTPMFOPJEFT
de 24 VCA, 7 VA por estación, más una válvula maestra
Dimensiones
t"ODIPDN
"MUVSBDN
'POEPDN
Modelos en Norteamérica (120 VCA)
Programadores
Serie modular ESP
t.PEFMPTCBTFEFMDPOUSPMBEPS
- ESP-4Mi: modelo para interiores de 4 estaciones
- ESP-4M: modelo para exteriores de 4 estaciones
t.ØEVMPT
- ESPSM3: módulo de expansión de 3 estaciones
Accesorios
t$"#-&'-&9*#-&%&$0/&9*»/: cable flexible de conexión aprobado por UL
Modular ESP
5SFTQSPHSBNBTJOEFQFOEJFOUFTDPOUSJCVZFOBMBIPSSPEFBHVBMPDVBMQFSNJUFVOBGÈDJMQSPHSBNBDJØOEFIPSBSJPTEFSJFHPÞOJDPTQBSBEJWFSTBT
aplicaciones paisajísticas.
El uso inteligente del agua.™
123
Controladores
4JTUFNBEFDPOUSPMNPEVMBSJOUFMJHFOUF&414.5
Características
Sistema de control modular
inteligente ESP-SMT
t1SPQPSDJPOBHFOFSBMNFOUFVOBIPSSPEFBHVBEFMBMNÈTRVFMPT
controladores tradicionales basados en la hora
Sistema de control modular inteligente de 4 a 13 estaciones
para uso residencial y comercial liviano
&M&414.5JOUFHSBUFDOPMPHÓBVTBEBQPSMPTNFKPSFTDBNQPTEFHPMGEVSBOUF
décadas y la agrupa en un controlador fácil de usar
Q &M&414.5FTFMQSJNFSDPOUSPMBEPSEFVOGBCSJDBOUFEFVOBMÓOFB
completa de riego que obtiene la etiqueta WaterSense de la Environmental
Protection Agency (EPA, Agencia de Protección Ambiental)
Q %BUPTEFQSFDJQJUBDJPOFTFOFMTJUJPFM&414.5SFDPHFMBJOGPSNBDJØOEF
las cantidades de precipitaciones en el sitio y usa esta información para
recalcular el tiempo funcionamiento de cada zona
Q %BUPTNFUFPSPMØHJDPTIJTUØSJDPTMBNFNPSJBJOUFSOBEFM&414.5DPOUJFOF
más de 8 años de datos meteorológicos históricos. Estos datos, junto con
la información de precipitaciones y temperatura se utilizan para ajustar los
tiempos de funcionamiento de riego a diario.
Q 3FEVDDJØOEFMBFTDPSSFOUÓBMBGVODJØO&414.5$ZDMFBOE4PBL™QFSNJUF
al controlador ajustar los tiempos de funcionamiento de la zona según las
condiciones del suelo y la inclinación para reducir/eliminar la escorrentía
de agua
El dial de diez posiciones
simplifica la programación
Las posiciones de configuración
codificadas por color promueven
la facilidad de uso
t&M&414.5BIPSSBBHVBBMIBDFSBKVTUFTFOUJFNQPSFBMEFMQSPHSBNBEF
SJFHPTPCSFMBBTFEFVOWBMPSEFFWBQPUSBOTQJSBDJØO&5
EFSFGFSFODJBRVF
se determina mediante los parámetros meteorológicos recolectados por el
sensor meteorológico en el sitio
t&MTFOTPSEFMMVWJBEFMCBMEFNJEFMBDBOUJEBEEFMMVWJBDBÓEBZFMUJFNQPEF
duración de la lluvia para registrar la lluvia utilizable y evitar el riego excesivo
t&MFRVJMJCSJPEFIVNFEBEEFMTVFMPEFDBEB[POBTFNBOUJFOFFOFMOJWFM
óptimo usando el método comprobado de programación de riego de
NÈYJNPDPOTVNPQFSNJUJEP."%QPSMBTTJHMBTFOJOHMÏT
t&MQFSÓPEPEFDSFDJNJFOUPQPSTFQBSBEPQFSNJUFBMVTVBSJPDPOGJHVSBSVO
programa inicial por horarios para establecer las plantas para una cantidad
de días preestablecidos. Una vez que termina este período, la zona vuelve
automáticamente a una programación basada en el clima
t-BTVTQFOTJØOEFMBMMVWJBFTUÈBDUJWBEBDVBOEPFMCBMEFEFNFEJDJØOEFMMVWJB
ha alcanzado el umbral de lluvia establecido por el usuario, lo que evita el
riego durante la lluvia
t&MQSPHSBNBBVUPNÈUJDP$ZDMFBOE4PBL™EFUFSNJOBEPQPSFMUJQPEFTVFMPZ
el grado de inclinación evita la escorrentía de la superficie
La pantalla grande con
iluminación de fondo
permite su lectura fácil
Programadores
El programa
predeterminado
por el
contratista que
ahorra tiempo
almacena y
recupera los
ajustes deseados
ESP-SMT con 3 módulos de
expansión instalados para
13 estaciones en total
Botones de navegación
convenientes que
permiten una
programación rápida
y sencilla
El cable de
comunicación
conecta el panel y
el sensor a través
de terminales de
conexión rápida
Los botones en
inglés y español
ofrecen cambio
de idioma con
un solo toque
El soporte de montaje
ajustable y resistente
permite una nivelación
sencilla
Texto en inglés
Texto en español
El diseño ergonómico
permite la programación
remota
Malla extraíble
para impedir el
paso de basura
El protector solar
resguarda el sensor de
temperatura del calor
reflexivo
Módulos de expansión
de 3 estaciones
sustituibles en caliente
El contenedor removible
mide los niveles de
precipitación y brinda la
función de interruptor
por lluvia
La función de
madurez de la
planta asegura
el riego efectivo
de la vegetación
establecida y
recientemente
plantada
La etiqueta WaterSense de la EPA certifica que este controlador es cuando menos un 20% más eficiente que otros controladores, sin sacrificar
el rendimiento.
124
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
4JTUFNBEFDPOUSPMNPEVMBSJOUFMJHFOUF&414.5
t&MQSPHSBNB$POUSBDUPS%FGBVMU™QFSNJUFRVFFMDPOUSBUJTUBHVBSEFFM
programa predeterminado en la memoria del controlador y este se recupera
fácilmente con solo tocar un botón si el propietario ha alterado el programa
original del contratista
Especificaciones eléctricas
t%B×PTZSFTQPOTBCJMJEBESFEVDJEPTEFMPTDPNQPOFOUFTEFMTJTUFNBEFSJFHP
ZBRVFFMDPOUSPMBEPS&414.5JOUFSSVNQFFMSJFHPEVSBOUFIFMBEBTFOFM
lugar
t1SPUFDDJØODPOUSBEFTDBSHBT-BFOUSBEBQSJODJQBMUJFOFEPTWBSJTUPSFTEF
óxido metálico (MOV, por sus siglas en inglés) incorporados para proteger
los circuitos. El costado de la salida tiene 2 varistores de óxido metálico
incorporados para cada estación de válvulas
t1JMBEFMJUJPJOUFHSBMRVFNBOUJFOFMBGFDIBZIPSBBDUVBMFTEVSBOUFVOBWJEB
acumulada de cinco años durante los cortes de energía
t3FUSBTPEFUJFNQPFOUSFFTUBDJPOFTRVFQSPWFFUJFNQPBEJDJPOBMFOUSF[POBT
para la recuperación de agua de pozo o el cierre lento de las válvulas
t$JSDVJUPEFBSSBORVFEFWÈMWVMBNBFTUSBCPNCBQSPHSBNBCMFQPSFTUBDJØO
que permite el funcionamiento de la bomba conectada, según sea necesario
t$BEB[POBTFQVFEFDPOGJHVSBSQBSBSFDPOPDFSPJHOPSBSMPTBKVTUFTEFMCBMEF
de lluvia basculante. Es ideal para regar plantas que están ubicadas en un
patio cubierto o para funciones que no necesitan riego, como la iluminación
paisajística
t3FTQBMEPEFFOFSHÓB1JMBEFCPUØOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB
mientras que la memoria no volátil mantiene la programación
t$BQBDJEBEEFFTUBDJØOEFWÈMWVMBTNÞMUJQMFT)BTUBEPTWÈMWVMBTTPMFOPJEFT
de 24 VCA, 7 VA por estación, más una válvula maestra
Dimensiones
t$POUSPMBEPS
- Ancho: 10.7" (27.2 cm)
- Altura: 7.7" (19.5 cm)
- Profundidad: 4.4" (11.2 cm)
t4FOTPS(parte transversal más larga)
- Ancho: 6.0" (15.2 cm)
t%JBHOØTUJDPEFDPSUBDJSDVJUPTTJOGVTJCMFTRVFJEFOUJGJDBVOB[POBDPO
problemas de cortocircuitos en el cableado y continúa con el riego de las
zonas en funcionamiento mientras identifica la zona con fallas
- Largo: 8.8" (22.4 cm)
- Altura: 5.9" (15.0 cm)
t5FSNJOBMEFQSVFCBQBSBMBWÈMWVMBRVFQFSNJUFBMJOTUBMBEPSQSPCBSMPTDBCMFT
de la válvula durante la instalación, a fin de determinar el cable de la válvula
que corresponde a cada zona
t4PQPSUFEFNPOUBKF
- Extensión máxima: 7.0" (17.8 cm)
t4FBDUVBMJ[BGÈDJMNFOUFEFVONPEFMPCBTFEFFTUBDJPOFTBVOPEF
estaciones agregando módulos de expansión de 3 estaciones sustituibles en
caliente sin desconectar la energía hacia el controlador
Modelos
t-BQBOUBMMBHSÈGJDBEFNBUSJ[EFQVOUPTSFUSPJMVNJOBEBFTGÈDJMEFMFFSFO
áreas con iluminación tenue. El texto de gran tamaño facilita la lectura y
puede cambiarse de inglés a español con solo tocar el botón English/Spanish
(Inglés/español) ubicado en la parte delantera del controlador
t(BCJOFUFFTQBDJPTPEFHSBOSFTJTUFODJBDPODBKBEFFNQBMNFTNPEFMPQBSB
exteriores) que proporciona un amplio espacio para el cableado. Modelo
para exterior provisto de un gabinete con llave
t.PEFMPTEFDPOUSPMEFTJTUFNBCBTF(incluye controlador ESP-SMT y
sensor meteorológico)
&414.5JFTUBDJPOFTQBSBJOUFSJPSFT7
&414.5FTUBDJPOFTQBSBFYUFSJPSFT7
Programadores
t-BNFNPSJBOPWPMÈUJMNBOUJFOFMBDPOGJHVSBDJØOEFMDPOUSPMBEPSFOGPSNB
indefinida incluso durante un corte de energía prolongado
t&OUSBEBSFRVFSJEB7$")[
t4BMJEB7$""
t.PEFMPQBSBBDUVBMJ[BDJØO(incluye panel controlador ESP-SMT y sensor
meteorológico)
&414.561(LJUQBSBBDUVBMJ[BSDPOUSPMBEPSFTNPEVMBSFT&41
t.ØEVMPT
- ESPSM3: módulo de expansión de 3 estaciones
* Para expandir hasta a 13 estaciones, use los módulos de expansión de tres estaciones ESPSM3
** Aplica a los controladores ESP-M fabricados después de abril de 2005
Nota: todos los modelos de ESP-SMT vienen con soporte ajustable resistente y 25 pies (7.62 m)
de cable de comunicación no enterrado para montar y cablear el sensor meteorológico
El panel del controlador se ajusta al chasis del ESP modular para actualizar fácilmente
&OTFHVOEPTBDUVBMJDFVODPOUSPMBEPS&41NPEVMBSBMTJTUFNBEFDPOUSPMJOUFMJHFOUF&414.5DPOTPMPDBNCJBSMPTQBOFMFT
1
El uso inteligente del agua.™
2
3
4
125
Controladores
Controlador ESP-LXME
Controlador ESP-LXME
Controladores comerciales con capacidad de 8 a 48 estaciones
Q Simple - Programación ESP extremadamente fácil
Q .PEVMBS'ÈDJMNFOUFFYQBOEJCMFEFPFTUBDJPOFTBFTUBDJPOFTDPO
módulos de 4-, 8- y 12- estaciones
Q Posibilidad de actualización a Controlador inteligente o Control centralizado
Características
t(SBOQBOUBMMB-$%DPOJOUFSGB[EFVTVBSJPEFGÈDJMOBWFHBDJØOBUSBWÏTEF
teclas programables
t.ØEVMPTTVTUJUVJCMFTiFODBMJFOUFwTJOOFDFTJEBEEFBQBHBSMBBMJNFOUBDJØO
del controlador para añadir/extraer módulos
t-BOVNFSBDJØOEJOÈNJDBEFMBTFTUBDJPOFTFMJNJOBFSSPSFTFOMBOVNFSBDJØO
de las estaciones
t&OUSBEBEFTFOTPSNFUFPSPMØHJDPDPODPONVUBEPSEFJOWBMJEBDJØO
t$JSDVJUPEFJOJDJPEFWÈMWVMBNBFTUSBCPNCB
tJEJPNBTTFMFDDJPOBCMFTQPSFMVTVBSJP
Controlador ESP-LXME
t.FNPSJBEFQSPHSBNBOPWPMÈUJMB×PT
t1SPUFDDJØODPOUSBTPCSFUFOTJPOFTFTUÈOEBSEF̓L7
t&MQBOFMGSPOUBMFTFYUSBÓCMFZQSPHSBNBCMFDPOBMJNFOUBDJØOBQJMB
t4FQVFEFBDUVBMJ[BSBMDPOUSPMDFOUSBM*2WDPOTVMUFMBQÈHJOB
Características de administración de agua
t'MPX4NBSU.PEVMF™PQDJPOBMDPOVUJMJEBEEFBERVJTJDJØOEFDBVEBMZ
totalizador de uso de caudal
Programadores
t1SPUFDDJØO'MP8BUDI™QBSBTJUVBDJPOFTEFBMUPZCBKPDBVEBMDPOSFBDDJPOFT
definidas por el usuario
t'MP.BOBHFS™NBOFKBMBEFNBOEBIJESÈVMJDBIBDJFOEPVTPDPNQMFUPEFM
agua disponible para reducir el tiempo total de riego
t4JNVM4UBUJPOT™QSPHSBNBCMFTQBSBQFSNJUJSFMGVODJPOBNJFOUPTJNVMUÈOFPEF
hasta 5 estaciones
Módulos de 4, 8 y 12 estaciones
t4FDVFODJBEFFTUBDJPOFTQPSOÞNFSPEFFTUBDJØOPQPSQSJPSJEBEFTEF
estaciones
t*OUFSWBMPTEFSJFHPQPSQSPHSBNBFJOUFSWBMPEFSJFHPNBOVBMEFMBWÈMWVMB
maestra
t$ZDMF4PBL™FODBEBFTUBDJØO
t3FUSBTPEFSJFHPQPSMMVWJB
t%ÓBJOBDUJWPEFMDBMFOEBSJPEFEÓBT
t%FNPSBQSPHSBNBCMFEFFTUBDJPOFTQPSQSPHSBNB
t7ÈMWVMBNBFTUSBOPSNBMNFOUFBCJFSUBPDFSSBEBQSPHSBNBCMFQPSFTUBDJØO
t4FOTPSNFUFPSPMØHJDPQSPHSBNBCMFQPSFTUBDJØOQBSBFWJUBSPEFUFOFSFM
riego
t"KVTUFFTUBDJPOBMEFQSPHSBNB
t"KVTUFFTUBDJPOBMNFOTVBMHMPCBM
-BGVODJØOEF3FTUBVSBDJØODPOSFUSBTPQSPHSBNBCMF$POUSBDUPS%FGBVMU3FHSFTBEFNBOFSBBVUPNÈUJDBBVOQSPHSBNBOPSNBMEFSJFHP
después de completar el riego intenso sobre semillas y césped nuevo. No requiere datos del usuario.
126
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
Controlador ESP-LXME
Funciones de diagnóstico
Modelos
t-V[EFBMBSNBDPOMFOUFFOMBDBKBFYUFSOB
t.PEFMPTCBTFEFMDPOUSPMBEPS
t$PSUBDJSDVJUPTFMFDUSØOJDPEFEJBHOØTUJDPT
- ESP8LXME: 8 estaciones, 120 VAC
t3FTVNFOZSFWJTJØOEFMQSPHSBNB
- ESP12LXME: 12 estaciones, 120 VAC
t1SPHSBNBEFQSVFCBEFWBSJBCMFT
- I8LXME: 8 estaciones, para mercados internacionales, 230 VCA
t1SVFCBEFDBCMFBEPEFFTUBDJPOFT3"45&3™
- I12LXME: 12 estaciones, para mercados internacionales, 230 VCA
Especificaciones de operación
- I8LXMEEU: 8 estaciones para Europa, 230 VCA
t$SPOPNFUSBKFEFFTUBDJPOFTEFNJOBIPSBT
- I12LXMEEU: 12 estaciones para Europa, 230 VCA
t"KVTUFFTUBDJPOBMEFBUJFNQPNÈYJNPEFGVODJPOBNJFOUPEFMB
estación de 16 horas)
- I8LXMEAU: 8 estaciones para Australia, 240 VCA
t-PTQSPHSBNBT"#$%QVFEFOTVQFSQPOFSTF
tIPSBTEFJOJDJPQPSQSPHSBNB
t-PTDJDMPTEFEÓBEFMQSPHSBNBTPOEÓBTEFMBTFNBOBQFSTPOBMJ[BEPT
impares, impares menos el 31, pares y fechas cíclicas
t&TUBDJØOQSPHSBNBZQSPHSBNBEFQSVFCBNBOVBMFT
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7$"œ)[NPEFMPTJOUFSOBDJPOBMFT7$"
± 10%, 50 Hz; (modelos australianos: 240 VCA ± 10%,50 Hz)
t4BMJEB7$""
- I12LXMEAU: 12 estaciones para Australia, 240 VCA
t.PEFMPTDPOEFUFDDJØOEFDBVEBM
&41-9.&'FTUBDJPOFT7"$
&41-9.&'FTUBDJPOFT7"$
*-9.&'FTUBDJPOFTQBSBNFSDBEPTJOUFSOBDJPOBMFT7$"
*-9.&'FTUBDJPOFTQBSBNFSDBEPTJOUFSOBDJPOBMFT7$"
*-9.&&6'FTUBDJPOFTQBSB&VSPQB7$"
*-9.&&6'FTUBDJPOFTQBSB&VSPQB7$"
*-9.&"6'FTUBDJPOFTQBSB"VTUSBMJB7$"
*-9.&"6'FTUBDJPOFTQBSB"VTUSBMJB7$"
t3FTQBMEPEFFOFSHÓB1JMBEFCPUØOEFMJUJPRVFNBOUJFOFMBIPSBZMBGFDIB
mientras que la memoria no volátil mantiene la programación
Módulos
t$BQBDJEBEEFWÈMWVMBTNÞMUJQMFT6ONÈYJNPEFDJODPWÈMWVMBTTPMFOPJEFTEF
24 VCA, 7 VA funcionando simultáneamente incluida la válvula maestra, dos
válvulas solenoides por estación como máximo
t&41-9.4..ØEVMPEFFTUBDJPOFT
t41-9.4..ØEVMPEFFTUBDJPOFT
t$FSUJGJDBDJPOFT
t'4.-9.&.ØEVMPEF'MVKPJOUFMJHFOUF
t&41-9.4..ØEVMPEFFTUBDJPOFT
Programadores
tQSPHSBNBTJOEFQFOEJFOUFT"#$%
6-D6-$&$4"$5JDL'$$1BSUF
Dimensiones
t"ODIPQVMHDN
t"MUVSBQVMHTDN
t1SPGVOEJEBEQVMHDN
Accesorios opcionales
t-*.3,JU,JUEFDPOUSPMSFNPUP-*.3QBSB$POUSPMBEPSFT3BJO#JSE
(ver página 133)
t-9..(BCJOFUFEFNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSB
controlador modular ESP-LX (ver página 140)
t-9..1&%(BCJOFUFEFNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSB
controlador modular ESP-LX (ver página 140)
t&5$-9$BSUVDIP&5.BOBHFSWFSQÈHJOB
t$BSUVDIPEF$PNVOJDBDJØO*2WFSQÈHJOB
t1BSBPCUFOFSNÈTJOGPSNBDJØOTPCSFMPTTFOTPSFTEFDBVEBMTFSJF'4EF
Rain Bird, consulte la página 135
Controlador
ESP-LXME en
gabinete de metal
LXMM opcional
Pedestal de metal
LXMMPED opcional
El uso inteligente del agua.™
127
Controladores
$POUSPMBEPS&41-9%DPOEFDPEJGJDBEPS
Controlador ESP-LXD con decodificador
Controlador comercial con decodificador de dos cables
con capacidad para 50 a 200 estaciones
Q Simple: utiliza la misma programación extra simple que otros controladores
ESP-LX
Q 'MFYJCMFoGÈDJMNFOUFFYQBOTJCMFEFBFTUBDJPOFTDPNQBUJCMFDPO
5 válvulas maestras, 5 sensores de caudal, 4 sensores meteorológicos y
diversos complementos para actualizaciones
Q 5FDOPMPHÓBDPNQSPCBEBVUJMJ[BMPTNJTNPTEFDPEJGJDBEPSFTEFEPTIJMPT
'%563'RVFMPTQSPHSBNBEPSFT.%$Z.%$DPONÈTEFNFEJPNJMMØO
de decodificadores instalados en todo el mundo en los últimos 20 años
Q 4FQVFEFBDUVBMJ[BSBMDPOUSPMDFOUSBM*2WDPOTVMUFMBQÈHJOB
Características
t&41JOUVJUJWPEF3BJO#JSE1SPHSBNBDJØOFYUSBTJNQMF
- Utiliza la misma interfaz de programación que otros programadores ESP
de Rain Bird
Controlador ESP-LXD
con decodificador
- Seis idiomas seleccionables por el usuario, que incluyen alemán, español,
francés, inglés, italiano y portugués
%JBHOØTUJDPTEFEPTIJMPTQBSBTJNQMJGJDBSZBHJMJ[BSMBSFTPMVDJØOEF
problemas
- Cuatro programas independientes con capacidad de superposición
t$POUSPMGMFYJCMF
- Caja espaciosa con ocho conexiones para un máximo de ocho canales de
dos cables (todos gestionados como un único canal de dos cables)
- Caja de plástico para exteriores resistente a radiación UV, con posibilidad
de montaje en pared
Programadores
6UJMJ[BFMNJTNPIBSEXBSFEFEFDPEJGJDBDJØORVFMPTTJTUFNBT.%$
.%$Z4JUF$POUSPM-PTEFDPEJGJDBEPSFTDPNQBUJCMFTTPO'%563'
'%563''%563''%563'Z'%563'DPNPBTÓ
UBNCJÏOMPTEFDPEJGJDBEPSFTEFTFOTPS4%563'ZMPTQSPUFDUPSFTEF
sobretensión de la línea LSP-1 (consulte la página 130)
Módulo
ESPLXD-SM75
- Las direcciones precodificadas del decodificador eliminan la confusión
asociada a las direcciones de decodificador definidas por el usuario; nuevo
sistema de introducción de direcciones del decodificador por escáner de
DØEJHPEFCBSSBTDPOFMDBSUVDIP1#$-9%PQDJPOBM
- Los sistemas SimulStations™ ajustables por el usuario en los niveles
de programa y programador permiten controlar el funcionamiento
simultáneo de las estaciones
- Secuencia de estaciones por número de estación o por prioridad de
estación
Módulo
ESPLXD-M50
Cómo especificar
ESP-LXD - SM75
Controlador
Módulos y cartuchos
&41-9%
120V Exterior
SM75: Módulo de
expansión de 75
estaciones
*&41-9%
230V Internacional
*&41-9%&6
230V Europeo
*&41-9%"7
Australiano
240V Australiano
128
1#$-9%$BSUVDIPTEF
copia de seguridad de
programa (ver página
siguiente)
&M&41-9%FTDPNQBUJCMFDPOFMDPOUSPMSFNPUP-*.3
- El programador incluye 50 estaciones; ampliable hasta 200 si se añaden
oNØEVMPTEFFYQBOTJØOEFFTUBDJPOFT&41-9%4.DBEBNØEVMPEF
expansión de estaciones añade 75 estaciones adicionales)
t(FTUJØOZBIPSSPEFMBHVB
- Cycle+Soak™ en cada estación
3FUBSEPQPSMMVWJBZ%ÓBEFMDBMFOEBSJPTJOSJFHP
- Retardo de la estación programable para cada programa
- Ajuste estacional mensual y a nivel de programa
- Hasta 5 inicios de bombas / válvulas maestras programables por estación y
además hasta 5 sensores de caudal
- Hasta 4 sensores meteorológicos programables por estación
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
$POUSPMBEPS&41-9%DPOEFDPEJGJDBEPS
t(FTUJØOEFDBVEBM
'MP.BOBHFS™QBSBMBHFTUJØOEFMBDBQBDJEBEIJESÈVMJDBEFTVTJTUFNBOP
requiere sensores de caudal)
'MP8BUDI™QBSB4&&'4FFLBOE&MJNJOBUF&YDFTTJWF'MPXEFUFDDJØOZ
FMJNJOBDJØOEFDBVEBMFYDFTJWP
Z4&-'4FFLBOE&MJNJOBUF-PX'MPX
detección y eliminación de caudal bajo) para diagnóstico automático y
gestión de caudal bajo y roturas en la línea principal
- Las funciones de aprendizaje de caudal y de caudal introducido por el
usuario son compatibles con el aprendizaje automático y las tasas de
caudal estimadas por el usuario
- Registro de caudal para el ahorro y el control del consumo de agua
- Admite mediciones de caudal en el sistema inglés (GPM) y métrico (LPM,
LPS, M3/seg.)
Dimensiones, especificaciones eléctricas y certificaciones
t%JNFOTJPOFT"OY"MY'
wYwYwYYDN
t7PMUBKFEFFOUSBEBSFRVFSJEP7$")[NPEFMPT
internacionales 230 VCA +/- 10%, 50 Hz; modelos australianos 240 VCA +/10%, 50 Hz
t$FSUJGJDBDJPOFT6-$&$6-$5JDL
t6OBCBUFSÓBEFMJUJPUJQPCPUØOZVOBNFNPSJBOPWPMÈUJMNBOUJFOFOMBGFDIB
la hora y la programación
t$BQBDJEBEQBSBWÈMWVMBTNÞMUJQMFTIBTUBWÈMWVMBTEFMTPMFOPJEFQPS
FTUBDJØOTFSFRVJFSFOEFDPEJGJDBEPSFT'%P'%
DPOGVODJPOBNJFOUP
simultáneo ajustable por el usuario de hasta ocho válvulas y/o válvulas
maestras
Cartucho PBC-LXD de respaldo de
programación para ESP-LXD
Proporciona funciones de respaldo de programa y lectura de código
EFCBSSBTQBSBFMDPOUSPMBEPS&41-9%
Características del kit de actualización
t1SPQPSDJPOBIBTUBDPQJBTEFSFTQBMEPDPNQMFUBTJODMVZFOEPUPEPT
los programas, información de caudal y direcciones de decodificadores
(permite archivar fácilmente 8 programadores diferentes); se tarda
normalmente dos minutos o menos en restaurar toda la información
t4FBDPQMBBMBQBSUFQPTUFSJPSEFMQBOFMGSPOUBMEFM&41-9%TFJOTUBMB
sin necesidad de herramientas; no necesita cajas ni cableado externo
adicionales
t&MLJUJODMVZFVODBCMFQBSBMBDPOFYJØOEFMMÈQJ[MFDUPSEFDØEJHP
de barras (lápiz no incluido), que le permite introducir rápidamente
EJSFDDJPOFTEFMPTEFDPEJGJDBEPSFTFOFMQSPHSBNBEPS&41-9%EVSBOUF
la instalación para ahorrarle tiempo
Modelo
t1#$-9%GVODJPOBDPOUPEBTMBTWFSTJPOFTEFMQSPHSBNBEPS&41-9%
Modelo
Programadores
t&41-9%FTUBDJPOFT7"$
t*&41-9%FTUBDJPOFTQBSBNFSDBEPTJOUFSOBDJPOBMFT7$"
t*&41-9%&6FTUBDJPOFTQBSB&VSPQB7$"
t*&41-9%"6FTUBDJPOFTQBSB"VTUSBMJB7$"
Accesorios opcionales
t&41-9%4.NØEVMPEFFTUBDJPOFTQBSB&41-9%
t1#$-9%$BSUVDIPEFSFTQBMEPEFQSPHSBNBQBSB&41-9%
t-*.3,*5&RVJQPEFDPOUSPMSFNPUP-*.3QBSBDPOUSPMBEPSFT3BJO#JSE
(consulte la pág. 133)
t'%563'EFDPEJGJDBEPSFTEFEPTDBCMFTDPOTVMUFMBQÈH
t4%563'EFDPEJGJDBEPSEFTFOTPSEFEPTDBCMFTDPOTVMUFMBQÈH
t-41563'QSPUFDDJØODPOUSBTPCSFDBSHBTEFMÓOFBEFEPTDBCMFTDPOTVMUFMB
pág. 136)
t%16VOJEBEEFQSPHSBNBDJØOEFEFDPEJGJDBEPSEFEPTDBCMFTDPOTVMUF
la pág. 136)
t-9..BSNBSJPNFUÈMJDPDPOSFWFTUJNJFOUPEFQJOUVSBFOQPMWPQBSB
controladores de la serie ESP-LX (consulte la pág. 136)
t-9..1&%QFEFTUBMNFUÈMJDPDPOSFWFTUJNJFOUPEFQJOUVSBFOQPMWPQBSB
controladores de la serie ESP-LX (consulte la pág. 140)
t&5$-9DBSUVDIP&5.BOBHFS™ para controladores de la serie ESP-LX
(consulte la página 132)
t*2/$$DBSUVDIPEFDPNVOJDBDJPOFTEFSFEQBSBDPOUSPMBEPSFTEFMBTFSJF
ESP-LX (consulte la página 146)
t1BSBPCUFOFSNÈTJOGPSNBDJØOTPCSFMPTTFOTPSFTEFDBVEBMTFSJF'4EF3BJO
Bird, consulte la página 135
Cartucho PBC-LXD
1
Los decodificadores FD-TURF incluyen etiquetas adhesivas de dirección de código de
barras
2
Lápiz lector de código de barras no incluido, se vende por separado; se recomienda el
modelo Unitech MS100-2 (www.ute.com)
El uso inteligente del agua.™
129
Sistemas de control centralizado
%FDPEJGJDBEPSFTEFEPTDBCMFT'%563'
Decodificadores de dos cables FD-TURF
%FDPEJGJDBEPSFT&41-9%Z4JUF$POUSPMRVFBENJUFOØEJSFDDJPOFT
de decodificadores
Q Instalación, expansión y actualización fáciles y redituables entre los
TJTUFNBT&41-9%ZP4JUF$POUSPM
Q Se instala fuera del alcance de la vista y cuenta con protección contra los
factores climáticos y el vandalismo
Q Permite características avanzadas de sensor y diagnóstico
Especificaciones de operación
Seleccione diferentes decodificadores de dos cables para operar una, dos,
cuatro o seis válvulas. Cinco opciones de decodificador diferentes le permiten
elegir la cantidad precisa de control de irrigación paisajística que necesita.
Decodificadores
%FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMÓOFBEFTF×BMZ
una válvula
Decodificadores
%FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMÓOFBEFTF×BMZ
una válvula o un par de válvulas
%FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMÓOFBEFTF×BMZ
válvulas o
2 pares de válvulas
%FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMÓOFBEFTF×BMZ
hasta 4 válvulas individuales
%FDPEJGJDBEPSEFDBNQP'%563'FOJOUFSGB[DPOMBMÓOFBEFTF×BMZ
hasta 6 válvulas individuales
1SPUFDDJØODPOUSBEFTDBSHBTEFMBMÓOFB-41563'
Programadores
%FDPEJGJDBEPSEFTFOTPSFOJOUFSGB[4%563'DPOMBMÓOFBEFTF×BMZ
decodificadores análogos o digitales
- Relé de inicio de bombas. Utilice el decodificador de campo como interfaz
entre el relé de la bomba y la línea de dos cables
t1PUFODJBEFTBMJEBAjustable desde el controlador; valores de corriente de
entrada y de retención ajustables desde el controlador.
t&ODBQTVMBDJØO5PUBMNFOUFBQSVFCBEFBHVB
t%JSFDDJØOPrecodificada desde la fábrica (es decir, sin interruptores)
t&OUSBEBFMÏDUSJDB
- Voltaje nominal: 34 Vpp (24 V CA) desde la línea de dos cables
- Voltaje mínimo: 21 Vpp (15V AC)
t$PSSJFOUFBVYJMJBS'%563''%563'N"'%563'
'%563'Z'%563'N"
t.POUBKFEn caja de válvulas (recomendado) o para enterrar
Cómo especificar
FD - 101 - TURF
Aplicación
563'QBSB&41-9%
o SiteControl
Tipo de decodificador
ÁOJDBEJSFDDJØOTPMFOPJEF
ÁOJDBEJSFDDJØOIBTUBTPMFOPJEFT
%JSFDDJØOEVBMIBTUBTPMFOPJEFT
401: Cuatro direcciones (hasta 4
solenoides)
601: Seis direcciones (hasta 6 solenoides)
t$POTVNPEFFOFSHÓB
'%563'N"JOBDUJWP
N"QPSTPMFOPJEFBDUJWP
'%563'N"JOBDUJWP
N"QPSTPMFOPJEFBDUJWP
'%563'N"JOBDUJWP
N"QPSTPMFOPJEFBDUJWP
'%563'N"JOBDUJWP
N"QPSTPMFOPJEFBDUJWP
'%563'N"JOBDUJWP
N"QPSTPMFOPJEFBDUJWP
Modelo
'%%FDPEJGJDBEPSEFDBNQP
130
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/controllers
%FDPEJGJDBEPSFTEFEPTDBCMFT'%563'%16
'%563'-BSHPQVMHNN
%JÈNFUSPQVMHNN
t'VTJCMFEFFOUSBEB'%563'Z'%563'TPMBNFOUF
300 a 500 mA,
térmico
'%563'-BSHPQVMHNN
%JÈNFUSPQVMHNN
t&OUSBEBFMÏDUSJDB
'%563'-BSHPQVMHNN
%JÈNFUSPQVMHNN
- Voltaje máximo: 36 Vpp
'%563'-BSHPQVMHNN
%JÈNFUSPQVMHNN
- Carga máxima:
'%563'-BSHPQVMHNN
%JÈNFUSPQVMHNN
t4PMFOPJEFT
'%563'DPODPOUSPMJOEJWJEVBM
'%563'PTJNVMUÈOFBNFOUF
'%563'%FBTJNVMUÈOFBNFOUF
'%563'%FBDPODPOUSPMJOEJWJEVBM
'%563'%FBDPODPOUSPMJOEJWJEVBM
t$BCMFT
'%563'"[VMQBSBDBCMFCMBODPQBSBTPMFOPJEF
'%563'"[VMQBSBDBCMFCMBODPQBSBTPMFOPJEF
'%563'"[VMQBSBDBCMFCMBODPZNBSSØOQBSBTPMFOPJEFT
'%563'"[VMQBSBDBCMFDPEJGJDBEPTQPSDPMPSQBSBTPMFOPJEFT
'%563'"[VMQBSBDBCMFDPEJGJDBEPTQPSDPMPSQBSBTPMFOPJEFT
t1SPUFDDJØODPOUSBEFTDBSHBT4FSFRVJFSFVOPEFMPTTJHVJFOUFTDBEB
pies a lo largo del trazado de dos cables (40 V; 1.5 kW transil)
- Protección contra descargas de la línea LSP-1
'%563'DPOQSPUFDDJØODPOUSBEFTDBSHBTJODPSQPSBEB
'%563'DPOQSPUFDDJØODPOUSBEFTDBSHBTJODPSQPSBEB
Nota: Se requiere una resistencia a tierra mínima de 10 ohmios en el controlador y en
cada protector de sobretensión
t '%563'TPMFOPJEF3BJO#JSEVOPQPSEJSFDDJØO
t '%563'TPMFOPJEFT3BJO#JSEEPTQPSEJSFDDJØO
t '%563'TPMFOPJEFT3BJO#JSEEPTQPSEJSFDDJØO
t '%563'TPMFOPJEFT3BJO#JSEVOPQPSEJSFDDJØO
t '%563'TPMFOPJEFT3BJO#JSEVOPQPSEJSFDDJØO
t5FOEJEPTEFDBCMFNÈYJNPT
- Calibre 14
t &TUSFMMBLN
t #VDMFLN
t$BCMFTEFMEFDPEJGJDBEPSTPMFOPJEF
t 3FTJTUFODJBFMÏDUSJDB.ÈYJNPEFPINJPT
t%JTUBODJBNÈYJNBEFDPEJGJDBEPSTPMFOPJEFT
t -POHJUVEEFMDBCMFQJFTDBMJCSF
t$BCMFBEP."9*$BCMFEF6'DPOEPCMFFOWBJOBEP
t&OUPSOP
t 3BOHPEFUSBCBKP%F¡'B¡'EF¡$B¡$
t 3BOHPEFBMNBDFOBNJFOUP%F¡'B¡'EF¡$B¡$
t )VNFEBE
Nota:3BJO#JSESFDPNJFOEBVUJMJ[BSDPOFDUPSFTBQSVFCBEFBHVB.%#3%#:QBSB
todas las conexiones.
Nota: los decodificadores serie FD no son compatibles con válvulas de uso residencial
como las válvulas HV, DV, DVF, ASVF, JTV y JTVF de Rain Bird.
Unidad de programación del decodificador
DPU-210
1BSBEFDPEJGJDBEPSFTEFEPTDBCMFT'%5VSG&41-9%.%$.%$Z
SiteControl
t-BVOJEBEEFQSPHSBNBDJØOEFMEFDPEJGJDBEPSQSVFCBZWFSJGJDBFM
GVODJPOBNJFOUPEFMPTEFDPEJGJDBEPSFTEFDBNQP&41-9%.%$.%$P
4JUF$POUSPMEFMBTFSJF'%5BNCJÏOQFSNJUFSFQSPHSBNBSMBTEJSFDDJPOFTEFM
decodificador para obtener la máxima flexibilidad de instalación en el sitio
DPU-210
El uso inteligente del agua.™
131
Programadores
t%JNFOTJPOFT
Controladores
$BSUVDIP&5.BOBHFS™
Cartucho ET Manager™
Modelos
Actualiza cualquier controlador serie ESP-LX a un controlador
de riego de evapotranspiración o basado en condiciones
meteorológicas
t&5.3.,TPQPSUFQBSBBOUFOBSFNPUBQBSBFM&5$-9
Características
Beneficios del ahorro de agua
&MDBSUVDIP&5.BOBHFS™BIPSSBBHVBNFEJBOUFMBSFBMJ[BDJØOEFBKVTUFTFO
tiempo real en los horarios de riego según la información meteorológica por
hora
t&5$-9$BSUVDIP&5.BOBHFSQBSBDPOUSPMBEPSFT-9
t&5.3(NFEJEPSEFMMVWJBCBTDVMBOUF
t&5.14TPGUXBSFEFQSPHSBNBDJØOEF&5.BOBHFS
* Permite que la antena se monte remotamente para lograr una mejor recepción de la
señal. El ET Manager™ posee una antena incorporada, pero los sitios que tienen una
señal de localización débil pueden necesitar una antena externa
Para solicitar más información llame a la línea directa de
ET Manager™: 1-877-351-6588
- Ahorro de agua del 20% al 50% sobre el control de riego
tradicional basado en horarios
.JEFMPTDVBUSPDPNQPOFOUFTDMBWFEF&5SBEJBDJØOTPMBSIVNFEBE
relativa, viento y temperatura, más las precipitaciones efectivas
- Ajusta los tiempos de riego del programa y la frecuencia de riego
- Se mantienen cuatro equilibrios de humedad separados, uno para cada
programa o hidrozona, para regar varios tipos de plantas de forma
eficiente (por ejemplo: césped, arbustos, árboles, plantas anuales, etc.)
Fácil instalación
- Se instala en segundos sin herramientas en los controladores serie ESP-LX,
se introduce en un espacio dedicado en la parte trasera del panel frontal
del controlador
- La antena se monta en el manguito NPS
- El asistente de configuración guía al usuario hacia todos los parámetros
clave de configuración
Menos riesgos
Programadores
'VODJØOEFJOUFSSVQDJØOQPSUFNQFSBUVSBNÓOJNBQBSBFWJUBSFMSJFHP
durante condiciones de temperatura bajo cero,
lo que reduce los riesgos asociados con el congelamiento de senderos
Características adicionales de ETC-LX
&MDBSUVDIP&5.BOBHFS™VUJMJ[BMBTF×BM8FBUIFS3FBDI™
- Elimina la necesidad de trasladarse a los sitios del controlador para realizar
ajustes o cambios de programación, lo cual contribuye al ahorro significativo
de mano de obra
$BCMFQMBOPRVFDPOFDUBFMDBSUVDIP&5$-9BMDPOUSPMBEPS
- El cable de la antena se conecta al conector a presión
-BTMVDFT-&%EFFTUBEPNVFTUSBOFMFTUBEPBDUVBMEFMBTDPNVOJDBDJPOFT
&MFRVJQP&5$-9JODMVZFFMDBSUVDIP&5.BOBHFS™BOUFOBSFDFQUPSB
NBOVBMZ$%EFSFDVSTPTEF&5.BOBHFS™RVFMFBZVEBSÈBQSPHSBNBSMPT
tiempos de riego según los parámetros paisajísticos
Cartucho ET Manager™
para ETC-LX
Especificaciones de operación
t&MDPOUSPMBEPS-9TVNJOJTUSBMBFOFSHÓBFMÏDUSJDB
t3BOHPEFUFNQFSBUVSBPQFSBUJWBEF¡'B¡'¡$Z¡$
UFNQFSBUVSB
PQFSBUJWBEFSFDFQDJØOEFSBEJPEF¡'B¡'<EF¡$B¡$>
t$BCMFNFEJEPSEFMMVWJBCBTDVMBOUFoAWG
132
El uso inteligente del agua.™
Controladores
www.rainbird.com/controllers
$POUSPM3FNPUPQBSBSJFHPEF+BSEJOFT-*.3
Control remoto para riego y mantenimiento
de jardines (LIMR)
El sistema remoto. Vuelve a nacer.
El sistema de riego de jardines y mantenimiento remoto (LIMR) de
Rain Bird® fue diseñado para brindar facilidad de uso, rendimiento y
confiabilidad. Cada una de las funciones de que dispone le ahorrará tiempo
y dinero en el mantenimiento del sistema de riego eficiente de Rain Bird y
la alineación de cabezales. Utilizar menos agua para hacer más. Eso sí es un
uso inteligente del agua.
Riego remoto compatible con todos los nuevos controladores modulares
&41.&Z&413;9&414.5&41-9&41-9&41-9.&&41-9.&'&41
-9%Z&41-9
Q Instale de manera permanente el cable de conexión rápida para conectar
rápidamente un receptor cuando visite un lugar de trabajo
Q En aplicaciones comerciales, monte permanentemente un receptor y
conéctelo fácilmente con su transmisor portátil
Q Puede operar simultáneamente varios receptores con el mismo transmisor
portátil
Especificaciones
t3BOHPPQFSBUJWPIBTUBNJMMBTLN
FOMÓOFBWJTVBM
t$PNVOJDBDJØOCJEJSFDDJPOBMNFEJBOUFSBEJPTEF.)[DPODFSUJGJDBDJØOEF
'$$
t$POSFDPOPDJNJFOUP6t$BQBDJEBEEF[POBTEFB
t5JQPEFQJMBQJMBT"""BMDBMJOBT
t4FQVFEFOBTJHOBSOPNCSFTQFSTPOBMJ[BEPTBSFDFQUPSFTQBSBGBDJMJUBSMB
identificación
t$BEBDPOUSPMSFNPUPQPSUÈUJMQVFEFDPOUSPMBSTJNVMUÈOFBNFOUF
receptores
Dimensiones
t,*5wDN
"MYwDN
"OYwDN
'
t59wDN
"MYwDN
"OYwDN
'
t39wDN
"MYwDN
"OYwDN
'
Modelos (EE. UU. y Canadá solamente)
t-*.3,*5JODMVZF59392$2$QJMBTZVONBMFUÓOEFUSBOTQPSUFEF
plástico resistente.
t-*.359USBOTNJTPS
Características
t*OUFSGB[TFODJMMBDPOJOTUSVDDJPOFTFOQBOUBMMBGÈDJMFTEFTFHVJSDPNP
- Ejecutar una prueba del sistema
t-*.339SFDFQUPS
t-*.32$DPOFDUPSSÈQJEPEFQBUJMMBTQJFTEFMPOHJUVEDN
t-*.32$DPOFDUPSSÈQJEPEFQBUJMMBTQJFTEFMPOHJUVEN
- Activar una zona
t-*.32$DPOFDUPSSÈQJEPEFQBUJMMBTQJFTEFMPOHJUVEDN
- Ejecute un programa (únicamente controladores de 6 patillas)
t-*.32$DPOFDUPSSÈQJEPEFQBUJMMBTQJFTEFMPOHJUVEN
- Acceso a cualquier zona tan solo ingresando el número
Programadores
t"IPSSFUJFNQPZEJOFSPNBOUFOJFOEPFMGVODJPOBNJFOUPEFMTJTUFNB
Rain Bird y la alineación de cabezales eficientemente
t&MNBOUFOJNJFOUPEFMGVODJPOBNJFOUPEFMTJTUFNB3BJO#JSEZMBBMJOFBDJØOEF
cabezales es más fácil y rápida que nunca, porque ya no tiene que caminar al
controlador para activar o desactivar zonas
t6OBÞOJDBQFSTPOBQVFEFBDUJWBS[POBTBQBHBSTJTUFNBTZFGFDUVBSPUSBT
tareas de adaptación a invierno o mantenimiento, reduciendo los costos de
la actividad
t*OTUBMFFMSFDFQUPSFOTFHVOEPTDPOVOBTPMBNBOPZDPOUSPMFIBTUB
zonas
t"DDFEBBDVBMRVJFS[POBUBOTPMPJOHSFTBOEPFMOÞNFSP/PFTOFDFTBSJP
desplazarse por las zonas en orden consecutivo
t&KFDVUFVOBQSVFCBEFMTJTUFNBFTQFDJGJDBOEPDVÈOUPTNJOVUPTDPORVÏ
zona empezar y con cuál finalizar
t-BDPNVOJDBDJØOCJEJSFDDJPOBMFOUSFFMDPOUSPMSFNPUPZFMDPOUSPMBEPS
permite que la información de la actividad remota se muestre en el
dispositivo portátil
t4FQVFEFOBTJHOBSOPNCSFTQFSTPOBMJ[BEPTBSFDFQUPSFTQBSB
facilitar la identificación. Cada control remoto portátil puede controlar
simultáneamente 128 receptores
t3BOHPPQFSBUJWPEFIBTUBNJMMBTLN
FOMÓOFBWJTVBM
- El rango real varía según el terreno y los obstáculos que bloquean la
visibilidad. Los obstáculos como edificios y paredes, así como la potencia
de las señales de interferencia, pueden afectar el rango.
Control remoto para riego y
mantenimiento de jardines (LIMR)
El uso inteligente del agua.™
133
Controladores
5#04™
TBOS™
t-BQJMBEVSBVOB×PFODBTPEFTFSVOBQJMBBMDBMJOBEF7EFQSJNFSBDBMJEBE
Controlador para uso comercial, controlado con pilas
t$VCJFSUBBQSVFCBEFBHVBDPODMBTJGJDBDJØO*1RVFQFSNJUFVOBPQFSBDJØO
confiable bajo el agua
Q -BMÓOFBEFDPOUSPMBEPSFTTVCUFSSÈOFPT5#04DPOUSPMBEPTDPOQJMBTQFSNJUF
t%JNFOTJPOFT3⁄4 x 51⁄8 x 2 pulg. (9.5 x 13.0 x 5.3 cm)
el uso de riego automático cuando hay interrupción de la energía CA
Q El estuche resistente, la instalación de la caja de válvulas interna y la
separación del transmisor del módulo de control impiden el vandalismo y
el sabotaje de sus programas
Q El estuche a prueba de agua, con clasificación IP-68, garantiza la operación
confiable bajo el agua y protege su inversión
Características
t*EFBMQBSBBQMJDBDJPOFTDPNFSDJBMFTJODMVJEPTQBSRVFTNVOJDJQBMFTQSPZFDUPT
paisajísticos en calles y autopistas y proyectos de construcción
t$POWFOJFOUFPQDJØOUFNQPSBMQBSBQSPQPSDJPOBSSJFHPJOJOUFSSVNQJEP
mientras se realizan reparaciones a un sistema que funciona con energía CA
t1FTPPO[BTH
t&YUFOTJØONÈYJNBEFDBCMFTFOUSFFMNØEVMPZFMTPMFOPJEF
Calibre del cable
18 AWG (0.75 mm2)
16 AWG (1.5 mm2)
14 AWG (2.5 mm2)
Distancia máxima
32 pies (10 m)
50 pies (15 m)
80 pies (24 m)
t"QSPCBEPQPS$5JDL
Transmisor de campo TBOS
t5SBOTNJTPSEFDBNQPSFRVFSJEPQBSBMBQSPHSBNBDJØOEFMNØEVMPEFDPOUSPM
t%JNFOTJPOFT1⁄2 x 71⁄2 x 17⁄8 pulg. (9.0 x 19.0 x 4.5 cm)
t1FTPPO[BTH
t$BMFOEBSJPEFEÓBTDPOUFNQMBB×PTCJTJFTUPT
t5FNQFSBUVSBEFGVODJPOBNJFOUPEF¡'B¡'EF¡$B¡$
t3FMPKDPOWJTVBMJ[BDJØO".1.PEFIPSBT
t"QSPCBEPQPS$5JDL
t5JFNQPEFSJFHPEFNJOVUPBIPSBTFOJODSFNFOUPTEFNJOVUP
Solenoide de enganche encapsulado TBOS
t1SPHSBNBDJØOCÈTJDBNPEPFTUÈOEBS
RVFJODMVZFQSPHSBNBT
independientes en un ciclo de programas de 7 días
t4FTVNJOJTUSBOEPTDBCMFTDBMJCSFNN2): 23.6 pulg. (60 cm) de largo
t$JDMPTBEJDJPOBMFTNPEPUVSCP
DPODJDMPTEFQSPHSBNBTQBSBEÓBTQBSFT
impares, impares sin riego los días 31 y de 1 a 6 días, que proporcionan
máxima flexibilidad
tIPSBSJPTEFBSSBORVFQPSQSPHSBNBBMEÓB
t*OEJDBEPSEFQJMBCBKBRVFBWJTBFMFTUBEPEFMBTQJMBTFOFMUSBOTNJTPSEF
DBNQP5#04
Programadores
t0QFSBDJØOEFFTUBDJPOFTJOEFQFOEJFOUFTRVFQFSNJUFIPSBSJPTEFBSSBORVF
simultáneos o secuenciales basados en la capacidad hidráulica del sistema
t&MUSBOTNJTPSEFDBNQP5#04DVFOUBDPOVOBQBOUBMMBHSBOEFEFDSJTUBM
MÓRVJEP-$%
DPOÓDPOPTEFGVODJPOFTGÈDJMFTEFFOUFOEFS$BEBGVODJØOFTUÈ
señalada con un símbolo fácil de comprender
t&MUFDMBEPEFUFDMBTFNJUFVOiCJQwDBEBWF[RVFTFQSFTJPOBVOBUFDMBBTÓTF
logra una programación rápida y segura
t6OUSBOTNJTPSEFDBNQP5#04QSPHSBNBVOOÞNFSPJMJNJUBEPEFNØEVMPT
EFDPOUSPM5#04
t5SBOTNJTPSEFDBNQPZNØEVMPEFDPOUSPMDPODPOFDUPSFTØQUJDPTFYUFSOPT
para una fácil conexión
t$PNQBUJCMFDPOWÈMWVMBT3BJO#JSETFSJF%7%7'"47'1("1&#1&4#(#
&'#$1#1&Z#1&4
t1SFTJØOPQFSBUJWBNÈYJNBEFQTJCBSFT
t%JNFOTJPOFT3⁄8" x 23⁄8" x 11⁄2" (4.0 cm x 6.0 cm x 4.2 cm)
Adaptadores de solenoide TBOS
t'ÈDJMEFJOTUBMBS
t"EBQUBEPSOFHSPQBSBWÈMWVMBTEFQMÈTUJDPRVFQFSNJUFFMVTPEFMTPMFOPJEFEF
FOHBODIFFODBQTVMBEP5#04DPOEFUFSNJOBEBTWÈMWVMBT*SSJUSPM)BSEJF3JDIFM
y Buckner
t"EBQUBEPSNBSSØOQBSBWÈMWVMBTEFMBUØORVFQFSNJUFFMVTPEFMTPMFOPJEF
EFFOHBODIFFODBQTVMBEP5#04DPOEFUFSNJOBEPTBDDJPOBEPSFTEFWÈMWVMBT
Champion y Superior
Modelos
t5#04'564USBOTNJTPSEFDBNQP
t5#04$.64NØEVMPEFDPOUSPMEF
1 estaciones
t&TQPTJCMFUSBOTNJUJSJOGPSNBDJØOBVOTJFMNØEVMPTFFODVFOUSBCBKPBHVB
t5#04$.64NØEVMPEFDPOUSPMEF
2 estaciones
t4PMFOPJEFEFFOHBODIFFODBQTVMBEP5#04DPNQBUJCMFDPOUPEBTMBTWÈMWVMBT
EFMBT4FSJFT%7%7'"47'1("1&#1&4#(#&'#$1#1&Z#1&4EF3BJO#JSE
t5#04$.64NØEVMPEFDPOUSPMEF
4 estaciones
t-PTBEBQUBEPSFTEFTPMFOPJEF5#04TFBEBQUBOBMTPMFOPJEFEFFOHBODIF
encapsulado para ser utilizados en aplicaciones de retroadaptación
con determinadas válvulas Irritrol® (Hardie/Richdel) y Buckner®, o con
accionadores de válvulas Champion® y Superior®
t5#04140-TPMFOPJEFEFFOHBODIF
encapsulado
Módulo de control TBOS
t5#04"%"1#BEBQUBEPSEF
solenoide para
válvulas de latón
t%JTQPOJCMFFONPEFMPTEFZFTUBDJPOFT
t0QFSBVOBWÈMWVMBQPSFTUBDJØO
t5#04"%"11BEBQUBEPSEF
solenoide para válvulas de plástico
Módulo de control y
transmisor de campo TBOS
t$SPOPNFUSBKFEFFTUBDJPOFTNJOVUPBIPSBTFOJODSFNFOUPTEFNJOVUP
con un calendario de 365 días. Las estaciones se asignan a un único programa
t-BDPOFYJØOQBSBTFOTPSBDUJWPBENJUFFMTFOTPSEFMMVWJB34%#&Y
de Rain Bird®
t0QFSBDPOTPMPVOBQJMBBMDBMJOBEF7TFSFDPNJFOEB&OFSHJ[FS™ y
%VSBDFMM™) tipo 6AM6 (estándar internacional) o 6LR61 (estándar europeo):
pila no incluida
134
Solenoides de enganche
encapsulado TBOS y
adaptadores de solenoide
El uso inteligente del agua.™
Accesorios para controladores
Sensores de flujo y transmisores
www.rainbird.com/controllers
Sensores de flujo y transmisores
Maxicom2®4JUF$POUSPM&41-9%P*2™
Características (sensores)
t4FODJMMPEJTF×PEFJNQVMTPSEFTFJTQBMFUBT
t%JTF×BEPQBSBBQMJDBDJPOFTFYUFSJPSFTPTVCUFSSÈOFBT
t%JTQPOJCMFFOFTUSVDUVSBEF17$MBUØOPBDFSPJOPYJEBCMF
t7FSTJPOFTQSFJOTUBMBEBTFOi5wPDPOJOTFSDJPOFTTVTQFOEJEBT
Características (transmisores)
t%JTF×PDPOGJBCMFEFFTUBEPTØMJEPEJTQPOJCMFDPOPTJOQBOUBMMBEFDSJTUBM
MÓRVJEP-$%
t%JTF×PGÈDJMEFQSPHSBNBSDPOUSPMBEPQPSNFOÞT
t1SPHSBNBCMFEFTEFVOBDPNQVUBEPSB15ÞOJDBNFOUFFOTJTUFNBT
.BYJDPNZ4JUF$POUSPMOPTFSFRVJFSFQBSB&41-9.&'P&41-9%
t0QFSBDPO."9*-JOL™ y sistemas de satélites de los cables
(conexión con cables)
t.POUBEPFODBKB/&."PQDJPOBMÞOJDBNFOUFFO15
Especificaciones de operación (sensores)
t1SFDJTJØOœFTDBMBDPNQMFUB
t¶OEJDFEFGMVKPQJFTNFUSPT
QPSTFHVOEPEFQFOEJFOEPEFM
modelo
t1SFTJØOQTJCBSFT
B¡$¡'
NÈY
FOMPTNPEFMPTEFNFUBM
QTJCBSFT
B¡$¡'
NÈY
FOMPTNPEFMPTEFQMÈTUJDP
Sensores de flujo
Programadores
t5FNQFSBUVSB¡$¡'
NÈY
FONPEFMPTEFNFUBM¡¡
NÈY
FO
modelos de plástico
Especificaciones operativas (transmisores)
t&OUSBEBSFRVFSJEB
7$$7$"FO15
7$"7$"SFD
FO15
7$"7$$FO15
t4BMJEB4BMJEBEFQVMTP
t5FNQFSBUVSBEFGVODJPOBNJFOUP%F¡'B¡'EF¡$B¡$
t6OJEBEFT6OJEBEFTOBDJPOBMFTFJOUFSOBDJPOBMFTEJTQPOJCMFTFO15
Dimensiones
t15YYNNYNYNN
t15YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
t'41YYNNYNNYNN
Transmisores de sensor de flujo
y Accesorios
t'4#YYNNYNNYNN
t'4#YYNNYNNYNN
t'4#YYNNYNNYNN
t'4#YEJÈNFUSP
NNYNNEJÈNFUSP
t'444YEJÈNFUSP
NNYNNEJÈNFUSP
El uso inteligente del agua.™
135
Accesorios para controladores
Sensores de flujo y transmisores
Sensores de flujo y transmisores (cont.)
Configuración
t Para sistemas de satélite de dos cables (conexión con cables)
(Maxicom2® y SiteControl), el sensor de flujo se instala con un
transmisor de pulsos y unEFDPEJGJDBEPSEFQVMTPTEF3BJO#JSE%&$16--3
t Para sistemas de satélite con radio de enlace (Maxicom2 y
SiteControl), el sensor de flujo se instala con un transmisor de pulsos (no
se requiere decodificador de pulsos)
t Para sistemas de satélite ESP-SITE (Maxicom2), el sensor de flujo se
instala con un transmisor de pulsos (no se requiere decodificador)
t Para sistemas decodificadores SiteControl, el sensor de flujo se
JOTUBMBDPOVOEFDPEJGJDBEPSEFTFOTPSFTEFEPTDBCMFT4%563'
t Para sistemas decodificadores ESP-LXD, el sensor de flujo se instala
DPOVOEFDPEJGJDBEPSEFTFOTPSFTEFEPTDBCMFT4%563'
Accesorios
151834611BMJNFOUBDJØOEFMUSBOTNJTPSEFQVMTPT
/&."$"#DBKB/&."QBSB15
'4463(&,*5LJUEFQSPUFDDJØODPOUSBEFTDBSHBTEFMTFOTPSEFDBVEBM
%&$16--3EFDPEJGJDBEPSEFQVMTPTQBSBTBUÏMJUFTEFEPTDBCMFT
4%563'EFDPEJGJDBEPSEFTFOTPSFTQBSBTJTUFNBTEFDPEJGJDBEPSFT
'4.-9.&NØEVMPJOUFMJHFOUFEFDBVEBMQBSBDPOUSPMBEPSFTTFSJF&41-9.&
Rango operativo sugerido para sensores de flujo Rain Bird
La tabla que aparece a continuación indica el rango de flujo sugerido para los
sensores de flujo Rain Bird. Los sensores Rain Bird funcionan tanto por debajo
como por encima del índice de flujo indicado. Sin embargo, las prácticas correctas
del diseño determinan el uso de este rango para obtener un mejor rendimiento.
Los sensores se deben dimensionar para el flujo y no para el tamaño de la tubería.
tPara sistemas ESP-LXMEF, el sensor de flujo se instala en el
NØEVMPJOUFMJHFOUFEFDBVEBM'4.-9.&
t4FSFDPNJFOEBMBQSPUFDDJØODPOUSBEFTDBSHBT'4463(&,*5
FOMPTTJTUFNBT
Maxicom y SiteControl: una en el transmisor de pulsos y, si la extensión del
cable es mayor a 50’ (15.24 m), una en el sensor de caudal. La protección
DPOUSBEFTDBSHBT'4463(&,*5OPFTDPNQBUJCMFDPOMPTDPOUSPMBEPSFT&41
-9.&'Z&41-9%
Modelos
Latón en T
t'4#TFOTPSEFDBVEBMEFMBUØOFO5EFwNN
t'4#TFOTPSEFDBVEBMEFMBUØOFO5EFDN
t'4#TFOTPSEFDBVEBMEFMBUØOFO5EFwDN
Programadores
Plástico en T
t'41TFOTPSEFDBVEBMEF17$FO5EFwDN
t'41TFOTPSEFDBVEBMEF17$FO5EFwNN
Modelo
'41
'41
'41
'41
'41
'41
'41
'4#
'4#
'4#
'4#
'444
Rango operativo
Rango operativo
sugerido
sugerido
(galones por minuto) (litros por minuto)
1.9 - 18.9
3.3 - 33.2
5.4 - 53.9
5 - 100
10 - 200
20 - 300
40 - 500
2 - 40
2 - 82.6
4.9 - 294
7.2 - 71.7
12.6 - 125.8
20.4 - 204
18 - 378
36 - 756
78 - 1134
150 - 1890
6 - 150
6.3 - 313
18.5 - 1112
Rango operativo
sugerido
(Metros cúbicos / Hora)
0.43 - 4.3
0.75 - 7.5
1.2 - 12.2
1.1 - 22.7
2.3 - 45.4
4.5 - 68.1
9.1 - 113.6
0.5 - 9
0.4 - 18.7
1.1 - 66.7
%FQFOEFEFMUJQPZFMUBNB×PEFMBUVCFSÓBDPOTVMUF
MBTFTQFDJöDBDJPOFTUÏDOJDBTEFMPTTFOTPSFTEFDBVEBM%'
t'41TFOTPSEFDBVEBMEF17$FO5EFwNN
t'41TFOTPSEFDBVEBMEF17$FO5EFDN
t'41TFOTPSEFDBVEBMEF17$FO5EFwDN
t'41TFOTPSEFDBVEBMEF17$FO5EFwNN
t'41TFOTPSEFDBVEBMEF17$FO5EFwDN
Accesorios de inserción
t'444BDDFTPSJPEFJOTFSDJØOEFBDFSPJOPYJEBCMFEFwZNÈT
t'4#BDDFTPSJPEFJOTFSDJØOEFMBUØOEFwZNÈT
t'45*/4&35BDDFTPSJPEFJOTFSDJØOEFSFQVFTUPQBSBTFOTPSFTFO5
Transmisores de pulsos (no son necesarios con los controladores LX)
t15USBOTNJTPSEFQVMTPTTJOQBOUBMMB
t15USBOTNJTPSEFQVMTPTQBOUBMMB-$%
t1548TPGUXBSFEFQSPHSBNBDJØOEFMUSBOTNJTPSEFQVMTPT15
136
El uso inteligente del agua.™
Accesorios para controladores
www.rainbird.com/controllers
Sensores de lluvia y heladas inalámbricos Serie WR2
Sensores de lluvia y
heladas inalámbricos serie WR2
Mucho más que ahorro de agua.
Los sensores de lluvia y heladas se están convirtiendo en componentes
necesarios para los sistemas de riego de la actualidad. Rain Bird diseñó
el nuevo sensor WR2 para superar los estándares. Este sensor dispone de
características revolucionarias que ahorran tiempo, mejoran el rendimiento
del sistema y aumentan su reputación como experto en la gestión de agua.
La transmisión fiable de la señal y otras innovaciones proporcionan una
respuesta excelente a la lluvia y a las bajas temperaturas, mientras que la
facilidad de uso de las funciones reduce a la mitad el tiempo de instalación
y programación. Elija los niveles de lluvia preestablecidos y ahorre hasta un
35% de agua a la vez que aumenta la suntuosidad y belleza de los jardines.
Q Este producto de alta calidad ha sido diseñado para sistemas de riego
residenciales y comerciales a 24 VCA, ahorra agua y aumenta la vida útil
del sistema de riego al detectar automáticamente las precipitaciones e
interrumpir el riego cuando llueve lo suficiente o las temperaturas son
demasiado bajas
Sensores de lluvia y heladas
inalámbricos Serie WR2
Q La interfaz del controlador es muy intuitiva y utiliza iconos, lo que simplifica
la programación
Q Un sistema de antena mejorado proporciona una fiabilidad excelente a la
señal, que supera la mayoría de las obstrucciones de la línea visual
Características y beneficios
t&MJOEJDBEPSEFJOUFOTJEBEEFMBTF×BMQFSNJUFMBDPOGJHVSBDJØOQPSQBSUFEF
una persona, reduciendo el tiempo de instalación
t-BMØHJDBEFQSPHSBNBDJØOQVFEFTVTQFOEFSFMSJFHPNFEJBOUFMBGVODJØO
de desconexión rápida o cuando la cantidad de lluvia supere el nivel
preestablecido
t&MTFOTPSEFMMVWJBZIFMBEBTJOBMÈNCSJDPTVTQFOEFSÈFMSJFHPDVBOEPFM
sistema alcance un nivel de temperatura mínima preestablecido
t-BTVTUJUVDJØOEFMBCBUFSÓBFTVOBPQFSBDJØONVZTJNQMFRVFOPSFRVJFSF
herramientas ni desmontar el sensor
t&MTPQPSUFEFMTFOTPSBVUPOJWFMBOUFTFJOTUBMBGÈDJMNFOUFTPCSFTVQFSGJDJFT
planas o canalones de lluvia
Programadores
t$ØNPEPBKVTUFZDPOUSPMEFMBDPOGJHVSBDJØOEFMMVWJBPIFMBEBTFOMBJOUFSGB[
del controlador.
El sólido soporte
autonivelante
mantiene la
orientación del
sensor de lluvia
La sustitución de la
batería no requiere
herramientas
t-BTBOUFOBTFTUÈOPDVMUBTFOFMJOUFSJPSEFMBTVOJEBEFTQBSBNFKPSBSFM
aspecto visual y la dureza del producto
Antenas internas
robustas para
mejorar la estética
Especificaciones eléctricas
t"QMJDBDJØOBEFDVBEBQBSBVTPDPODPOUSPMBEPSFTEF7$"EF3BJO#JSEZEF
competidores (con o sin bomba de arranque / válvula maestra)
t$BQBDJEBEFMÏDUSJDBBEFDVBEBQBSBVTBSIBTUBTFJTTPMFOPJEFTEF7$"7"
y una válvula maestra o bomba de arranque que no exceda de 53 VA
t$BCMFEFMBJOUFSGB[EFMDPOUSPMBEPSBMBSHBEPSEFwDN
EFMPOHJUVE
calibre 22 (0.64 mm), resistente a la radiación UV
Cómo especificar
t$FSUJGJDBDJPOFT6-D6-$&$5JDLZ8&&&
WR2 - RC
t5SBOTDFQUPSFTEFSBEJPEFEPTWÓBTEFFTQFDUSPBNQMJPBQSPCBEPTQPSMB'$$
como Clase B
Modelo
Norteamérica (916 MHz)
WR2
RC: combo lluvia
3'$DPNCPMMVWJBIFMBEBT
RS: sensor de lluvia solamente
3'4TFOTPSEFMMVWJBIFMBEB
solamente
3'*JOUFSGB[EFMDPOUSPMBEPSEF
lluvia / heladas solamente
t%JTUBODJBEFUSBOTNJTJØOEFMBTF×BMEFN
FOMÓOFBWJTVBM
t%VSBDJØOEFMBQJMBIBTUBB×PTFODPOEJDJPOFTEFVTPOPSNBMFT
t1SPUFDDJØODPOUSBTPCSFDBSHBTSBZPTEF,7
El uso inteligente del agua.™
137
Accesorios para controladores
Sensores de lluvia y heladas inalámbricos Serie WR2
Sensores de flujo y transmisores (cont.)
Modelos
t833$DPNCPMMVWJB
Propiedades mecánicas
t833'$DPNCPMMVWJBIFMBEBT
t7BMPSFTEFMMVWJBBKVTUBCMFTEFwBwEFBNN
t7BMPSFTEFUFNQFSBUVSBCBKBBKVTUBCMFTEF¡'B¡'EFB¡$
t5SFTNPEPTEFSJFHPTFMFDDJPOBCMFT1SPHSBNBEP3JFHPDBODFMBEPEVSBOUF
72 horas, Ignorar el sensor durante 72 horas
t8334TFOTPSEFMMVWJBTPMBNFOUF
t833'4TFOTPSEFMMVWJBIFMBEBTPMBNFOUF
t833'*JOUFSGB[EFMDPOUSPMBEPSEFMMVWJBIFMBEBTTPMBNFOUF
t6OJEBEFTEFQPMÓNFSPEFBMUBDBMJEBESFTJTUFOUFBMPTSBZPT67ZBMB
intemperie
Piezas de sustitución o repuesto
t-BGVODJØOEFEFTDPOFYJØOSÈQJEBTVTQFOEFFMDJDMPEFSJFHPBDUJWPFO
aproximadamente dos minutos
t%JTDPEFNPOUBKFQBSB834
t1JMBQBSB834
Dimensiones
t*OUFSGB[EFMDPOUSPMBEPS83
- Ancho: 3.1“ (7.9 cm)
- Largo: 6.8” (17.2 cm)
- Profundidad: 1.7” (4.3 cm)
%JTUBODJBFOUSFPSJGJDJPTEFNPOUBKFDN
t$POKVOUPEFMTFOTPS83
- Largo del sensor: 5.8” (14.7 cm)
- Largo del soporte de unión: 4.6” (11.7 cm)
%JTUBODJBFOUSFPSJGJDJPTEFNPOUBKFDN
%FTQMB[BNJFOUPIPSJ[POUBMTPQPSUFCSB[PEFCPMBGJKP
wDN
Programadores
Paso 1
Programe en segundos
138
Paso 2
Determine la mejor
ubicación del sensor
Paso 3
Instale el sensor
fácilmente con el
soporte de montaje
El uso inteligente del agua.™
Accesorios para controladores
4FOTPSFTEFMMVWJB34%#&Y34%$&Y
www.rainbird.com/controllers
RSD-BEx / RSD-CEx
Sensor de lluvia
Características y beneficios
t&MBQBHBEPBVUPNÈUJDPQPSMMVWJBFWJUBFMSJFHPFYDFTJWPDBVTBEPQPSMBT
precipitaciones naturales
t&MEJTF×PSFTJTUFOUFZDPOGJBCMFSFEVDFMBQSPCBCJMJEBEEFRVFTFSFBMJDFO
llamadas por disconformidad del servicio
La bisagra de enganche
mantiene la alineación
t-PTEJTDPTTFOTPSFTEFIVNFEBEGVODJPOBOFOVOBWBSJFEBEEFDMJNBT
t-PTEJGFSFOUFTNPOUBKFTEFMTFOTPSMPHSBOWFMPDJEBEZGMFYJCJMJEBEFOFMMVHBS
de trabajo
t-BCJTBHSBEFFOHBODIFNBOUJFOFMBBMJOFBDJØO
Propiedades mecánicas
t.ÞMUJQMFTQBSÈNFUSPTEFQSFDJQJUBDJØOEFTEFňcŠwIBTUB£wEFBNN
rápidos y fáciles de ajustar con solo girar el disco de selección
t"OJMMPEFWFOUJMBDJØOBKVTUBCMFQBSBDPOUSPMBSFMUJFNQPEFTFDBEP
RSD-BEx
t$VFSQPEFQPMÓNFSPEFBMUBDBMJEBESFTJTUFOUFBMPTSBZPT67ZBMBJOUFNQFSJF
t%JTQPOJCMFFOWFSTJØOEFNÏOTVMBSFTJTUFOUFFMNPEFMP34%#&YJODMVZF
ménsula de aluminio de enganche de 5” [12.7 cm]) o versión de conductos
34%$&Y
QBSBVOBJOTUBMBDJØOQSPMJKBZQSPGFTJPOBM
Especificaciones eléctricas
t"QMJDBDJØOBQUPQBSBDJSDVJUPTEFDPOUSPMEF7$"EFCBKPWPMUBKFZDJSDVJUPT
EFSFMÏEFBSSBORVFEFCPNCBEF7$"
t&TQFDJGJDBDJPOFTFMÏDUSJDBTEFMJOUFSSVQUPS"B7$"
t$BQBDJEBEFTQFDJGJDBDJPOFTFMÏDUSJDBTBQUBTQBSBVTPDPOIBTUBEJF[WÈMWVMBT
solenoides de 24 VCA, 7 VA por estación, más una válvula maestra
Programadores
t$BCMFDBCMFEFFYUFOTJØOSFTJTUFOUFBMPTSBZPT67EFEPTDPOEVDUPSFT
de 25’ (7.6 m) de largo, Nº 20
t"QSPCBEPQPS6-D6-$&Z$5JDL
* No se recomienda su uso con circuitos o dispositivos para arranques de bomba o para relés de
arranque de bomba de alto voltaje.
Dimensiones
t34%#&Y
- Longitud general: 6.5" (16.5 cm)
- Altura total: 5.4" (13.7 cm)
- Patrón de orificios de la ménsula: 1.25" (3.2 cm)
t34%$&Y
RSD-CEx
- Longitud general: 3" (7.6 cm)
- Altura total: 2.75" (7 cm)
Modelos
t34%#&YTFOTPSEFMMVWJBDNÏOTVMBEFFOHBODIFDBCMFEFFYUFOTJØO
t34%$&YTFOTPSEFMMVWJBDBEBQUBEPSSPTDBEPDBCMFEFFYUFOTJØO
Cómo especificar
RSD-BEx
Cable de extensión
25' (7.6 m) de largo
Montaje
BE: soporte de metal
CE: versión de conductos
Modelo
34%EJTQPTJUJWPTFOTPSEFMMVWJB
El uso inteligente del agua.™
139
Accesorios para controladores
Rain Check™, pedestales de controladores
Dimensiones
Rain Check™
t-BSHPwNÈYJNPDN
Apagado automático por lluvia
t"MUVSBNÈYJNPDN
Características
t4POEBTTFOTPSBTEFBDFSPJOPYJEBCMFBKVTUBCMFTRVFCSJOEBOMBGMFYJCJMJEBEEF
activar el apagado por lluvia con tan solo 1/8” (3.2 mm) de precipitación
t&MBHVBFOMBDPMFDUPSBEFMMVWJBTFFWBQPSBNÈTSÈQJEBNFOUFRVFMB
humedad del suelo para permitir el riego si es necesario
t"ODIP1⁄2" máximo (6.4 cm)
Modelo
t3BJO$IFDL
t&MEJTF×PFMFDUSØOJDPFMJNJOBMPTNJDSPJOUFSSVQUPSFTZMPTEJTDPTEF
absorción de agua que pueden oxidarse o desgastarse
t$POTUSVJEPFOQMÈTUJDPSFTJTUFOUFBMPTSBZPT67QBSBBVNFOUBS
su vida operativa en ambientes adversos
t'VODJPOBDPOQSÈDUJDBNFOUFUPEPTMPTDPOUSPMBEPSFTEF7$"QBSBVOB
máxima versatilidad
Especificaciones
t&OUSBEBSFRVFSJEBTFDPOFDUBBMDBCMFDPNÞOEFMBWÈMWVMB
t'VTJCMF"
t$PMFDUPSBFYUSBÓCMFQBSBQPEFSMJNQJBSMB
t$BQBDJEBEEFWÈMWVMBTNÞMUJQMFTIBTUBUSFTWÈMWVMBTTPMFOPJEFTEF7$"QPS
estación
t/PSFDPNFOEBEPQBSBVTPDPOSFMÏTEFBSSBORVFEFCPNCBT
de acción directa (interruptor para cortar el caudal)
t/PFTDPNQBUJCMFDPODPOUSPMBEPSFTEFMBTFSJF&41.FZ&413;9
Rain Check
Programadores
Pedestales de controlador
1FEFTUBMFTQBSBTFSJFT&41.$&41-9&414"5Z$$6
Características
t*ODMVZFUPEPTMPTQFSOPTMBTUVFSDBTZMBTSPOEBOBTOFDFTBSJPTQBSBFMNPOUBKF
Especificaciones
t.BUFSJBMBDFSPSFDVCJFSUPEFQJOUVSBFOQPMWP
t$POFYJØOQBSBFMDBCMFBEPEFMUFSSFOPFOFMDPOUSPMBEPS
El PED-DD16 se muestra con
el ESP-12 SAT-2W
Dimensiones
Ancho
Fondo
t1&%%%
Modelo Altura
›DN
›DN
DN
t-9..1&%
DN
žDN
žDN
t-9..
7⁄ 8DN
›DN
£DN
Modelo
t1&%%%1FEFTUBMQBSB&414"5&414*5&Z$$6
t-9..HBCJOFUFEFNFUBMQBSBDPOUSPMBEPSFTTFSJF41-9
t-9..1&%QFEFTUBMEFNFUBMQBSBDPOUSPMBEPSFTTFSJF&41-9
* Nota: los armarios y pedestales de metal no son estándar para los controladores de la
serie ESP-LX y deben adquirirse por separado. Con LXMMPPD se requiere LXMM.
El LXMMPED se muestra
con el ESP-LXME en el
gabinete de metal LXMM
140
El uso inteligente del agua.™
Accesorios para controladores
www.rainbird.com/controllers
Accesorios, tablas de uso de energía
Conector de cables serie DB
Cable flexible de conexión
Conector de cables roscado para instalación subterránea con alivio de
tensión
Características
Características y beneficios
t5SFTDBCMFTDPOEVDUPSFTUSFO[BEPTDBMJCSF
tQJFTN
EFMBSHP
t$POFDUPSEFVOBTPMBQJF[BGÈDJMEFVTBS
t5JQPEFDPOFDUPSNPMEFBEPEFHSBEPT/FNB1
t"MJWJPEFUFOTJØOQBSBBTFHVSBSRVFMPTDBCMFTFTUÏOTFHVSPTZOPTF
desconecten
t$PMPSHSJT
t$FSUJGJDBDJØO6-%EFBQUJUVEQBSBFOUFSSBS
Modelo
t&MTFMMBEPEFTJMJDPOBBQSVFCBEFBHVBQSPUFHFDPOUSBMBDPSSPTJØO
t1*(5"*-
Especificaciones
t1BSBDBCMFTEFDBMJCSFB
t6TPFODPOFYJPOFTEF7$"B7$"
Modelo
t%#58$
Conector de cables serie DB
PIGTAIL
Programadores
Resumen de uso de energía del controlador de Rain Bird (con una válvula maestra)
STP Plus
ESP-Modular
ESP-SMT
Serie ESP-LX
7.26 W
Energía auxiliar del controlador
0.86 W
2.62 W
8
Energía usada por la válvula maestra
4.5 W
4.5 W
4.5 W
5.0 W
Energía usada para cada válvula activa
3.40 W
3.75 W
3.75 W
3.75 W
* Controlador con sensor acoplado
ZONA
1
2
3
4
5
6
7
8
a) Energía de la válvula maestra de la tabla (si es aplicable)
9
10
Vatios
b) Nº. de válvulas en esta zona
c) Energía de la válvula de la tabla anterior
Vatios
E
5JFNQPEFSJFHPEJBSJPQBSBFTUB[POB
minutos
6TPEFFOFSHÓBEJBSJPEFMBWÈMWVMBQPS[POBBCD
E
60,000
,XI
Uso de energía total diario de la válvula Sume el uso diario de todas las zonas anteriores
Uso de energía diario del controlador Energía auxiliar del controlador 24 / 1000
Uso de energía anual/ mensual (Uso de energía diario del controlador Nº. de días que el sistema está
enchufado) + (Uso de energía total diario de la válvula Cantidad de días
que riega el sistema)
El uso inteligente del agua.™
kWh
kWh
kWh
141
Cuerpos de difusores
Controles centralizados
Introducción
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
“Recomendamos Maxicom2® a nuestros
clientes porque el sistema es el método
más eficaz y eficiente para controlar
áreas individuales dentro de sistemas de
riego complejos. Maxicom2 analiza las
condiciones meteorológicas a partir de las
24 horas previas y ajusta la cantidad de
agua necesaria según dichas condiciones y
para cada área específica. Nuestros clientes
disfrutan de los beneficios: costos más bajos
de mano de obra y agua, además de plantas
y césped más sanos”.
Válvulas
Accesorios
Programadores
Ellen Beighley, Presidente
Irrigation management Systems
Sistemas de control
centralizado
Xerigation®
Bombas
Drenaje
Sugerencias para ahorrar agua
.
t Los sistemas Maxicom , SiteControl e
2
Recursos
*2™ proporcionan un ajuste
completamente automático de
FWBQPUSBOTQJSBDJØO&5
EFQSPHSBNBT
de riego para ahorrar mayor cantidad
de agua.
Referencia
142
t Los sistemas Maxicom F*2
2
™
proporcionan las herramientas para
manejar de manera eficaz docenas y
hasta cientos de sistemas de riego en
diversos sitios remotos desde una
sola computadora.
t -BGVODJØO'MP8BUDI
™
de Maxicom2
F*2™ vigila y registra los flujos en
tiempo real, realiza un diagnóstico
automático y elimina los problemas
de flujo provocados por tuberías
rotas, vandalismo o válvulas
obstruidas.
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
Productos principales
Características principales
Aplicaciones principales
IQ™
Control centralizado para múltiples sitios
Control centralizado para un solo sitio
Sistema de controlador satelital
Sistema de decodificador de dos cables
Sistema de decodificador/satelital híbrido
Características
Programa de computadora
Monitoreo por computadora
Operación manual de la computadora
Interfaz de mapa interactivo
1SPHSBNBDJØOEF&5
"KVTUFBVUPNÈUJDPEF&5
Reacción de Smart Weather
Programación de operación en seco
Gestión de caudal
Monitoreo de flujo
Busca/Elimina problemas de flujo
Cierre por flujo alto
Cierre por flujo bajo
Rain Watch
Apagado por lluvia
Sistema Cycle + Soak (de ciclo/remojo)
Hardware
Computadora incluida con el software
*OUFSGB[&414"5$$6
*OUFSGB[&414"558*
*OUFSGB[EFMEFDPEJGJDBEPS4%*-%*
%FDPEJGJDBEPSFTEFEPTDBCMFT'%563'
4BUÏMJUF&414"5
4BUÏMJUFEFTJUJP&414*5&4"5
,JUEFBDUVBMJ[BDJØO&41.*#
,JUEFBDUVBMJ[BDJØO&414*5&6
Satélite de la serie ESP-LX
,JUEFBDUVBMJ[BDJØO*2/$$
,JUSBEJPNØEFNEFFOMBDF
$POUSPMSFNPUP'3&&%0.
%FTDPEJGJDBEPSFTEFTFOTPSFTEFQVMTPT%&$
%JTQPTJUJWPEFBQBHBEPQPSMMVWJB34%
'4TFOTPSFTEFGMVKP
Estación meteorológica WSPRO2
&TUBDJØONFUFPSPMØHJDB84130-5
4&/403%&--67J"3BJOHBVHF
"/&.».&530TFOTPSEFWJFOUP
O
O
O
O
O
SiteControl
O
O
O
O
O
O
O
O
O
O
O
O
O
Maxicom2®
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
O
Información sobre los sistemas de control centralizado
El sistema de control centralizado de riego es un sistema computarizado que
permite la programación, el monitoreo y la operación de un sistema de riego
desde una ubicación central. Los sistemas de control centralizado están diseñados
para que un solo sitio (como un campus universitario o una sede corporativa) o
un grupo de sitios (tales como distritos escolares, oficinas gubernamentales de
parques y recreación) puedan controlar todo el riego desde una computadora
central. El control centralizado permite monitorear y adaptar automáticamente el
funcionamiento del sistema y los tiempos de riego como respuesta a condiciones
en el sistema y en las áreas circundantes (como cambios climáticos, roturas de
tuberías, etc.), además de los parámetros definidos por el operador.
Sistema de control centralizado de Rain Bird
Rain Bird desarrolló el sistema original de control centralizado computarizado en la
década de 1970, y actualmente tiene miles de sistemas instalados en todo el mundo.
Controladores de satélite y decodificadores de campo
Programación centralizada
Un sistema de control centralizado permite realizar la programación desde
una sola computadora, lo que ahorra el tiempo y el dinero que por lo general
se gasta en el traslado hasta los controladores. Los cambios que realiza el
programa a los múltiples controladores en múltiples sitios pueden realizarse
en sólo unos minutos. Los tiempos de riego se pueden ajustar de manera
automática agregando una estación meteorológica o sensores.
Comunicación del sistema
Opciones de comunicación entre la computadora central y los controladores
de riego, los decodificadores, los sensores y las estaciones meteorológicas se
incluyen la conexión con cables, conexión directa, teléfono, teléfono celular,
SBEJPGJCSBØQUJDB&UIFSOFUZ8J'J
Funcionamiento y monitoreo del sistema
El sistema de control centralizado realiza monitoreos y puede utilizar sensores
de flujo, lluvia, viento, humedad y demás para ajustar el funcionamiento
o llevar a cabo una acción en tiempo real. Los registros operativos del
sistema y cualquier alarma por los problemas que ocurran se comunican a la
computadora central, en donde se generan los reportes.
Sistemas Rain Bird de control centralizado para
múltiples sitios
Maxicom2®
Maxicom2 es una herramienta de administración de riego con características
que permiten controlar múltiples sistemas de riego remotos, pequeños y
grandes. Maxicom2 ofrece características superiores de administración de riego
con la tecnología de controlador por satélite. Maxicom2 es la herramienta de
elección de los administradores de riego, las oficinas gubernamentales de
parques y recreación, los distritos escolares y los parques temáticos en todo el
mundo.
IQ™
&MTJTUFNB*2PGSFDFVOQSPHSBNBEFTPGUXBSFNPEVMBSTJNQMFZGÈDJMEF
entender y un hardware modular para la supervisión de los controladores
de satélite en múltiples sitios. Además, incluye muchas características para el
ahorro de tiempo y agua que eliminan la necesidad de trasladarse al sitio para
volver a programar o monitorear el sistema de riego. Es la herramienta ideal
para una amplia variedad de aplicaciones comerciales.
Sistemas Rain Bird de control centralizado para
un solo sitio
SiteControl
El sistema SiteControl ofrece características de control centralizado altamente
eficaces para sitios simples, grandes y contiguos. SiteControl proporciona
un control interactivo basado en mapas y una comunicación en tiempo real
entre el campo y la computadora central. Puede controlar decodificadores
de dos cables, controladores de satélite o ambos a la vez, a fin de permitir la
posibilidad de expansión y lograr una flexibilidad inigualable. Es ideal para
los desarrollos de propiedades, complejos de campos de deportes, centros
comerciales, cementerios, complejos vacacionales y hoteles.
Rain Bird ofrece una variedad de sistemas para satisfacer las necesidades del cliente,
de presupuesto, sitio o aplicación. Seleccione sistemas diseñados específicamente
para un solo sitio o para múltiples sitios, ya sean pequeños o grandes. Los sistemas
de control centralizado de Rain Bird pueden utilizar controladores de satélite,
decodificadores de dos cables o una combinación de ambos.
El uso inteligente del agua.™
143
Sistemas de control
centralizado
Productos principales
Sistemas de control centralizado
4PGUXBSF*2™W
Software de control centralizado IQ™ v2.0
Control centralizado modular para múltiples sitios
Q 'VODJPOFTBWBO[BEBTEFDPNBOEPZDPOUSPMDPOVOBJOUFSGB[GÈDJMEF
aprender y utilizar
Q Proporciona funciones de gestión de agua avanzadas que permiten
ahorrar tiempo y dinero
Q &MTPGUXBSFEF*2DVFOUBDPODBQBDJEBEZGVODJPOFTQBSBDPOUSPMBEPSFT
de satélites modulares. Compre sólo lo que necesite y actualícelo en el
futuro a medida de que cambien sus necesidades
*2QSPQPSDJPOBQSPHSBNBDJØOHFTUJØOZDPOUSPMSFNPUPTEFMPTDPOUSPMBEPSFT
EFMBTFSJF&41-9EFTEFFMPSEFOBEPSEFTVPGJDJOB*2FTMBTPMVDJØOEF
control de riego perfecta para departamentos de parques, distritos escolares,
administradores de propiedades, contratistas de mantenimiento paisajístico y
HFTUPSFTEFSJFHP*2QVFEFHFTUJPOBSFNQMB[BNJFOUPTDPOVOTPMPDPOUSPMBEPS
y también emplazamientos con múltiples controladores y admite tanto los
controladores de la serie ESP-LX cableados del modo tradicional como los
controladores con decodificador de 2 cables.
Paquete de software IQ v2.0
Software IQ v2.0
t&MQBRVFUFEFTPGUXBSFCÈTJDP*245"35$%UJFOFDBQBDJEBEQBSB
controladores de 5 satélites y ofrece un conjunto de funciones básicas.
-B̓DBQBDJEBEEFDPOUSPMBEPSFTEFTBUÏMJUFTEFMTPGUXBSFEF*2TFQVFEF
BNQMJBSFOJODSFNFOUPTEFTBUÏMJUFTDPOMBBDUVBMJ[BDJØO*24"5486IBTUB
la capacidad total de satélites que se necesite. Los paquetes de funciones del
TPGUXBSFEF*2JODMVZFOGVODJPOFTBEJDJPOBMFT-PTQBRVFUFTEFGVODJPOFT
incluyen un lote de funciones relacionadas que amplían las capacidades del
QBRVFUFEFTPGUXBSFCÈTJDPEF*2
Sistemas de control
centralizado
t&MTPGUXBSFCÈTJDPEF*2ZMPTQBRVFUFTEFGVODJPOFTJODMVZFOVOTJTUFNBEF
ayuda sensible al contexto. Haga clic en el icono de ayuda disponible en la
mayoría de las pantallas e irá directamente al tema de ayuda de la función
que esté utilizando. El software ofrece múltiples idiomas y formatos de fecha/
hora y unidades, lo que permite al usuario interactuar con el software en su
idioma principal. Los idiomas que puede seleccionar el usuario son inglés,
español, francés, alemán, italiano y portugués.
Funciones del paquete de software básico
t$BQBDJEBEEFDPOUSPMBEPSFTEFTBUÏMJUFTEFMTPGUXBSFBNQMJBCMFFO
incrementos de 5 satélites
Cómo especificar
SOFTWARE IQ V2.0 Y
PAQUETES DE FUNCIONES
*245"35$% 1BRVFUFEFTPGUXBSFCÈTJDP
capacidad para 5 satélites
*24"5486 "NQMJBDJØOEFMBDBQBDJEBE
del software en 5 satélites
adicionales
*24"5/$$6 "NQMJBDJØOEFMBDBQBDJEBE
EF*2/FUFOTBUÏMJUFT
cliente adicionales
*2"$0.'1 1BRVFUFEFGVODJPOFT
avanzadas de
comunicaciones
*2"1(.'1 1BRVFUFEFGVODJPOFT
avanzadas de programación
*2"&5'1
1BRVFUFEFGVODJPOFT
BWBO[BEBTEF&5
*2"'4&/'1 1BRVFUFEFGVODJPOFT
avanzadas de detección de
caudal
t$BQBDJEBEEFDPOUSPMBEPSFTEFTBUÏMJUFTDMJFOUFEF*2/FUBNQMJBCMFFO
incrementos de 5 satélites
t$PNQBUJCMFDPODPOUSPMBEPSFT&41-9.Z&41-9.&DBCMFBEPTEFGPSNB
USBEJDJPOBMZDPOUSPMBEPSFT&41-9%DPOEFDPEJGJDBEPSEFDBCMFTDPOTVMUF
las páginas 126-128)
t/PNCSFTEFFNQMB[BNJFOUPTBUÏMJUFZFTUBDJØO
t1SPHSBNBDJØOFOTFHVOEPTNJOVUPTZIPSBT
tEFBKVTUFFTUBDJPOBMEJBSJPPNFOTVBMPBKVTUFTEFUJFNQPEF
GVODJPOBNJFOUPEFFTUBDJPOFT&5̓QPSFNQMB[BNJFOUP
t3FWJTJØODPOFMQSPHSBNBHSÈGJDP%SZ3VO™
t$PNVOJDBDJØOQBSB4JODSPOJ[BSZ3FDVQFSBSSFHJTUSPTJOJDJBEBQPSFMVTVBSJP
t*OJDJPTEFQSPHSBNBNBOVBMQSPHSBNBEFQSVFCBZFTUBDJØO
t3FHJTUSPTFJOGPSNFTEFUBMMBEPT
-BFWBQPUSBOTQJSBDJØO&5
FTMBDPNCJOBDJØOEFMBQÏSEJEBEFBHVBEFMTVFMPQPSFWBQPSBDJØOZMBQÏSEJEBEFBHVBQPSMBUSBOTQJSBDJØOEFMBTQMBOUBT
&MDPOTVNPUPUBMEFMBHVBTFQVFEFSFEVDJSNFEJBOUFMBDBSBDUFSÓTUJDBEF&5EFMTJTUFNB*2QBSBEFUFSNJOBSDVÈOEPZRVÏDBOUJEBETFEFCFSFHBS
144
El uso inteligente del agua.™
Sistemas de control centralizado
4PGUXBSF*2™W
www.rainbird.com/centralcontrols
Requisitos del ordenador recomendados
Paquete de funciones avanzadas de programación
t4JTUFNBPQFSBUJWP8JOEPXT¥91PEFCJUTPEFCJUT
t1SPUFDDJØODPODØEJHP1*/EFMPTTBUÏMJUFTTF̓SFRVJFSFVODØEJHP1*/EF
dígitos para hacer cambios de programación en el satélite)
t1SPDFTBEPS*OUFM*.PFRVJWBMFOUF
t.FNPSJB3"..ÓOJNPEF(#
t&TQBDJPEJTQPOJCMFFOFMEJTDPEVSP(#
t6OJEBEEF$%30.7FMPDJEBENÓOJNBEF9
t3FTPMVDJØOEFMBQBOUBMMBYNÓOJNP
t1SPHSBNBDJØOCJEJSFDDJPOBMEFTBUÏMJUFTMPTDBNCJPTSFBMJ[BEPTFOFMTBUÏMJUF
TFQVFEFOWFSZBDFQUBSFOFMTPGUXBSFEF*2
t6UJMJEBEQBSBDPQJBSUSBTMBEBSTBUÏMJUFTDPQJBPUSBTMBEBVOTBUÏMJUFBPUSP
emplazamiento)
t.PEFNUFMFGØOJDP'MFY̓,DPNVOJDBDJØOUFMFGØOJDB
Paquete de funciones avanzadas de ET
t$POFYJØOEFSFEQBSB&UIFSOFU8J'JDPNVOJDBDJØO(134
t"KVTUFTBVUPNÈUJDPTEFMBQSPHSBNBDJØOEFSJFHP."%HFTUJØOEFMDPOTVNP
permitido)
t1VFSUPEFTFSJFPBEBQUBEPSEF64#BTFSJFQBSB̓DPOFYJØOEJSFDUBZ
comunicación por módem externo)
Ampliación de la capacidad en 5 satélites adicionales
t-BDBQBDJEBEEFDPOUSPMBEPSFTEFTBUÏMJUFTDMJFOUFEFMTPGUXBSF*2F*2/FUTF
puede ampliar en incrementos de 5 satélites
t4FQVFEFB×BEJSDBQBDJEBEBEJDJPOBMDPNQSBOEPVODØEJHPEFBDUJWBDJØOEF
software
t&MTPGUXBSFFNQMFBMBUFDOPMPHÓBZMBTGØSNVMBTEFMB"TPDJBDJØOEF3JFHP
t-BTGVFOUFTNFUFPSPMØHJDBTEF&5MMVWJBTPOMBTTJHVJFOUFT
- Servicio de Internet CIMIS (sólo California)
%JSFDUPS&5.*&5EFMTFSWJDJPEF8FBUIFS3FBDI"NÏSJDBEFM/PSUF
solamente)
&TUBDJØONFUFPSPMØHJDB3BJO#JSE84130-5
- Estación meteorológica Rain Bird WSPRO2
Paquetes de funciones de IQ
tUBMPOBSJPTEF&5QPSDPOUSPMBEPSEFTBUÏMJUFT
t-PTQBRVFUFTEFGVODJPOFTTFBDUJWBODPNQSBOEPVODØEJHPEFBDUJWBDJØOEF
software
t&YQPSUBDJØOB.JDSPTPGU&YDFM¥QBSBJOGPSNFTQFSTPOBMJ[BEPT
t-PTQBRVFUFTEFGVODJPOFTTFBDUJWBOQBSBUPEPTMPTFNQMB[BNJFOUPTZ
TBUÏMJUFTFOFMTPGUXBSFEF*2
Paquete de funciones avanzadas de detección de caudal
Paquete de funciones avanzadas de comunicaciones
t$PNVOJDBDJØOBVUPNBUJ[BEBQBSB4JODSPOJ[BSZ3FDVQFSBSSFHJTUSPTZ
Recuperar datos meteorológicos de la fuente meteorológica
t*2$BMMJO™QBSBTBUÏMJUFTFMTBUÏMJUFJOJDJBMBDPNVOJDBDJØOTPMPDBSUVDIP
telefónico NCC-PH)
t3FDVQFSBSFHJTUSPTEFDBVEBMNJOVUPBNJOVUPEFMTFOTPSEFDBVEBMJOUFHSBEP
FOMPTDPOUSPMBEPSFTEFTBUÏMJUFT&41-9.&'Z&41-9%
t*OGPSNFHSÈGJDPEFSFHJTUSPTEFDBVEBMGSFOUFBDBVEBMQSFWJTUPJEFOUJGJDBRVÏ
programas y estaciones estaban funcionando en un momento determinado)
t*OGPSNFEFUPUBMFTEFDBVEBMBDUVBMFTB×BEJEPTBMUJFNQPEFGVODJPOBNJFOUP
de la estación de satélites (incluidos en los informes de correo electrónico
automáticos)
Sistemas de control
centralizado
t"MBSNBBMFSUBEFDPSSFPFMFDUSØOJDPBVUPNÈUJDBFJOGPSNFTEFUJFNQPEF
funcionamiento de las estaciones de satélites
El uso inteligente del agua.™
145
Sistemas de control centralizado
$BSUVDIPEFDPNVOJDBDJPOFTEFSFE*2/$$
Cartucho de comunicaciones de red IQ NCC
Actualiza cualquier controlador serie ESP-LX a un controlador de
TBUÏMJUFEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEPEF*2
Q *2FTMBTPMVDJØOEFDPOUSPMEFSJFHPQFSGFDUBQBSBEFQBSUBNFOUPTEF
parques, distritos escolares, administradores de propiedades, contratistas de
mantenimiento paisajístico y gestores de riego.
Q *2̓QVFEFHFTUJPOBSUBOUPTJUJPTDPOVOTPMPDPOUSPMBEPSDPNPHSBOEFTTJUJPTDPO
múltiples controladores
Q -PTDBSUVDIPT*2/$$̓TPODPNQBUJCMFTDPOMPTDPOUSPMBEPSFT&41-9.&
cableados de forma tradicional con capacidad para entre 1 y 48 estaciones y los
DPOUSPMBEPSFT&41-9%EFDBCMFTDPODBQBDJEBEQBSBFOUSFZFTUBDJPOFT
Satélites directos
t-PTTJUJPTDPOVOTPMPDPOUSPMBEPSVUJMJ[BSÓBOVODBSUVDIP*2/$$
configurado como satélite directo. Un satélite directo tiene una conexión de
DPNVOJDBDJPOFTDPOMBDPNQVUBEPSBDFOUSBMEF*2̓QFSPOPDPOFYJPOFTEFSFE
con otros satélites del sistema
Satélites servidores y clientes
Cartucho Wi-Fi IQ-NCC-WF
t*ODMVZFVONØEFNEFSFEJOBMÈNCSJDB8J'JJOUFHSBEPDPODPOFDUPSEF
antena y una antena interna para cajas de controlador de plástico (requiere
dirección IP estática para red LAN; antena externa opcional para cajas de
controlador metálicas)
t$PNQBUJCMFDPODJGSBEP81"81"
Cartucho RS232 IQ NCC-RS
t*ODMVZFVOQVFSUP34QBSBMBDPOFYJØOEFDPNVOJDBDJPOFTEFMNØEFN
FYUFSOPPDBCMFEJSFDUPEF*2DPOMBDPNQVUBEPSBDFOUSBMEF*2ZVODBCMF
QBSBFMNØEFNFYUFSOPTFTVNJOJTUSBVODBCMFEJSFDUP*2DPOFMQBRVFUFEF
TPGUXBSF*2
t4FVUJMJ[BQBSBBQMJDBDJPOFTEFTBUÏMJUFTEJSFDUPTPTFSWJEPSFTRVFSFRVJFSFO
comunicación a través de una conexión por cable directo o un módem
FYUFSOPSBEJPVPUSPEJTQPTJUJWPFYUFSOP
DPOMBDPNQVUBEPSBDFOUSBMEF*2
y para aplicaciones de satélites clientes que requieren comunicación a través
EFVODBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUPSBEJPDPOFMTBUÏMJUFTFSWJEPS
Módulo de conexión inteligente de caudal IQ-FSCM-LXME
t1SPQPSDJPOBDPOFYJPOFTQPSDBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUQBSBFM
controlador ESP-LXME
t-PTTJUJPTDPONÞMUJQMFTDPOUSPMBEPSFTVUJMJ[BSÓBOVODBSUVDIP*2/$$
configurado como satélite servidor y los demás cartuchos NCC configurados
como satélites clientes. El satélite servidor tiene una conexión de
DPNVOJDBDJPOFTDPOFMPSEFOBEPSDFOUSBMEF*2ZDPNQBSUFFTUBDPOFYJØO
de comunicaciones con los satélites clientes a través de cables de datos de
alta velocidad o radios. La conexión de comunicaciones entre los satélites
TFSWJEPSFTZDMJFOUFTSFDJCFFMOPNCSFEF*2/FU™
Módulo de conexión IQ-CM-LXD
t-PTTBUÏMJUFTEFVOB*2/FUDPNÞODPNQBSUFOMPTTFOTPSFTNFUFPSPMØHJDPTZMBT
válvulas maestras
Módem de radio IQ SS-Radio
Sistemas de control
centralizado
t-PTTBUÏMJUFTTFSWJEPSFTZDMJFOUFTRVFVUJMJ[BODBCMFEFEBUPTEFBMUBWFMPDJEBE
QBSBMBDPNVOJDBDJØOFO*2/FUSFRVJFSFOMBJOTUBMBDJØOEFVONØEVMPEF
DPNVOJDBDJPOFT*2$.-PTTBUÏMJUFTTFSWJEPSFTZDMJFOUFTRVFVUJMJ[BOMB
DPNVOJDBDJØOQPSSBEJPFO*2/FUSFRVJFSFOMBJOTUBMBDJØOEFVOBSBEJP
*2443"%*0$BEBLJUEFDBSUVDIPJODMVZFMPTDBCMFTQBSBDPOFDUBSFMDBSUVDIP
NCC al módulo de conexión y/o la radio
Cartucho telefónico IQ-NCC-PH
t*ODMVZFGVODJPOFTEFNØEVMPJOUFMJHFOUFZNØEVMPCÈTJDPEFDBVEBM
t4VTUJUVZFBMNØEVMPCÈTJDP&41-9.&FTUÈOEBS
t1SPQPSDJPOBDPOFYJPOFTQPSDBCMFEFEBUPTEFBMUBWFMPDJEBE*2/FUQBSBFM
DPOUSPMBEPS&41-9%
t4FJOTUBMBFOMBSBOVSBQBSBFMNØEVMP&41-9%̓DFSP
t1SPQPSDJPOBDPNVOJDBDJØOQPSSBEJPJOBMÈNCSJDB*2/FUFOUSFMPT
controladores de satélites servidores y clientes
t5BNCJÏOTFQVFEFVUJMJ[BSDPOFMDBSUVDIP*2/$$3434QBSBMB
DPNVOJDBDJØOEFMBDPNQVUBEPSBDFOUSBMEF*2DPOMBSBEJPEFMPTTBUÏMJUFT
directos o servidores
t*ODMVZFGVFOUFEFBMJNFOUBDJØOZBOUFOBFYUFSOBFM̓TPGUXBSFEF
programación y el cable se suministran por separado)
t*ODMVZFVONØEFNUFMFGØOJDPBOBMØHJDPEF̓,̓JOUFHSBEPDPOQVFSUP3+
t*ODMVZFDBCMFEFUFMÏGPOPNPEVMBS3+SFRVJFSFMÓOFBUFMFGØOJDBBOBMØHJDB
Cartucho GPRS/móvil IQ-NCC-GP
t*ODMVZFVONØEFNEFEBUPT(134NØWJMJOUFHSBEPDPODPOFDUPSEFBOUFOB
t*ODMVZFVOBBOUFOBJOUFSOBQBSBDBKBTEFDPOUSPMBEPSEFQMÈTUJDPBOUFOB
externa opcional disponible para cajas de controlador metálicas)
t3FRVJFSFVOQMBOEFTFSWJDJPEFEBUPT(134NØWJMDPOEJSFDDJØO*1FTUÈUJDBEFM
proveedor de servicios de telefonía móvil
t%JTQPOJCMFDPOFMQSJNFSB×PEFMTFSWJDJPEFDPNVOJDBDJØOJODMVJEP&MDBSUVDIP
con el servicio de comunicación incluido no está disponible en todas la áreas
NOTA: Los dispositivos con comunicación inalámbrica requieren un estudio del terreno
para el uso del servicio inalámbrico (Modelos: IQNCC-GP, IQNCCWF, IQSSRADIO)
Cartucho Ethernet IQ-NCC-EN
t*ODMVZFVONØEFNEFSFE&UIFSOFUJOUFHSBEPDPOQVFSUP3+
t*ODMVZFDBCMFEFDPOFYJØO3+FSFRVJFSFEJSFDDJØO*1FTUÈUJDBEFSFE-"/
Cartucho de
comunicaciones
de red IQ NCC
146
El uso inteligente del agua.™
Sistemas de control centralizado
SiteControl
www.rainbird.com/centralcontrols
SiteControl
Sistema de control centralizado completo para aplicaciones de un
solo sitio
Q Software interactivo basado en mapas fácil de utilizar, que proporciona
la posibilidad de tomar decisiones en tiempo real
Q 'MFYJCJMJEBEEFDPNVOJDBDJPOFTJOJHVBMBCMFDPOEFDPEJGJDBEPSFTZP
satélites
Q Las características de administración de agua avanzadas maximizan las
condiciones del terreno y el ahorro de agua
Características básicas de control
t%FTEFFMDPOUSPMBEPSDFOUSBM4JUF$POUSPMFMTJTUFNBEFSJFHPQVFEF
programarse para los días de riego, tiempos de riego, horarios de enlace,
arranques del sensor, horarios Cycle+Soak™ (de ciclo/remojo), programación
sensibilizada a la evapotranspiración, etc.
t&MNBQBJOUFSBDUJWPQFSNJUFFMNÈYJNPDPOUSPMZBVOBTÓTJNQMJGJDB
el mapa interactivo permite el máximo control, y aun así, simplifica
t7FSJGJRVFMBQSPHSBNBDJØOIBTUBFMOJWFMEFMBFTUBDJØOVUJMJ[BOEPMB
DBSBDUFSÓTUJDB*OUVJUJWF%SZ3VOGVODJPOBNJFOUPJOUVJUJWPFOTFDP
t0QFSBDJØONBOVBMEFMTJTUFNBEFTEFMBDPNQVUBEPSBDFOUSBMNFEJBOUF
BDDFTPNBOVBMEJSFDUP%."
t0QFSBDJØOEFBQMJDBDJPOFTRVFOPFTUÈOSFMBDJPOBEBTDPOFMSJFHPFOTÓUBMFT
como iluminación, portones de seguridad, fuentes, bombas, sensores, etc.
Características adicionales
Mapeo gráfico avanzado
t-PTNBQBTHFOFSBEPTDPOUFDOPMPHÓB(14TJTUFNBEFQPTJDJPOBNJFOUP
HMPCBM
"VUP$"%PGPUPHSBGÓBBÏSFBSFDSFBOTVTJUJP
SiteControl
Sistemas de control
centralizado
t&MNBQFPJOUFSBDUJWPZMPTHSÈGJDPTFOQBOUBMMBNVFTUSBOFM
sitio completo y permiten localizar los aspersores y las válvulas individuales.
Genera informes de estado exhaustivos con sólo presionar un botón
t&MNØEVMPEFTPGUXBSF.BQ6UJMJUJFTVUJMJEBEFTEFNBQFP
QFSNJUFNFEJSMBT
distancias y las áreas a partir de su propio mapa
Sistema híbrido
t"NQMÓFFMTJTUFNBDPOFMNØEVMPEFTPGUXBSFIÓCSJEP
t&MNJTNPTJTUFNBQVFEFPQFSBSTBUÏMJUFT&414"5ZPEFTDPEJGJDBEPSFTEFMB
TFSJF'%
Smart Weather™
t%JTF×BEPQBSBBQSPWFDIBSBMNÈYJNPMBMÓOFBNÈTBWBO[BEBEFFTUBDJPOFT
meteorológicas de RainBird
t3BTUSFBMPTÓOEJDFTEFFWBQPUSBOTQJSBDJØO&5
DPOVOBFTUBDJØO
meteorológica y reacciona frente a las condiciones climáticas actuales
mediante pasos secuenciales lógicos
t&MVTVBSJPQVFEFEFGJOJSMPTVNCSBMFTEFMTFOTPSQBSBFMTJTUFNBBWBO[BEP
de advertencias. El operador del sistema puede recibir una alerta
inmediatamente si se exceden los umbrales
Las funciones Smart Weather y RainWatch de SiteControl permiten al operador configurar condiciones climáticas predefinidas y las correspondientes
reacciones del sistema para ahorrar agua con las funciones automáticas de arranque, pausa, reanudación o cancelación del programa según el
viento, la temperatura, la lluvia, la radiación solar y la humedad.
El uso inteligente del agua.™
147
Sistemas de control centralizado
SiteControl
SiteControl (continuación)
Características de ET automáticas
t"KVTUBMPTUJFNQPTEFSJFHPBVUPNÈUJDBNFOUFFOSFMBDJØODPOMBT
fluctuaciones en los valores de evapotranspiración
t-BFWBQPUSBOTQJSBDJØONÓOJNBQBUFOUFFOUSÈNJUF
QFSNJUFFTUBCMFDFSFM
umbral para que comience el riego, lo que contribuye a un riego profundo
Otras características
t)BTUBQVOUPTEFDPOFYJØO
t)BTUBTFOTPSFTEFQVMTPT
t3FHJTUSPTEFMVTPEFBHVB
t3FHJTUSPTEFMUJFNQPEFSJFHPEFDBEBFTUBDJØO
t3FHJTUSPTBOUJDJQBEPTBDUVBMFTEFGVODJPOBNJFOUPFOTFDPQPTUFEESZSVO
logs)
RainWatch™ (Patente en trámite)
t)PKBEFDÈMDVMPEFFWBQPUSBOTQJSBDJØO
t1SPQPSDJPOBMBDBSBDUFSÓTUJDBEFBQBHBEPQPSMMVWJBZMVFHPBKVTUBMPTUJFNQPT
de riego según las mediciones de precipitación
t*ODMVZFB×PEF1MBOEFBTJTUFODJBHMPCBM
Modelos
Función expandida del sistema
t4$0/1$EFFTDSJUPSJPDPOTPGUXBSF4JUF$POUSPMJODMVZFFM1MBOEFBTJTUFODJB
global durante 1 año.
t6UJMJ[BMBTIFSSBNJFOUBTEFEFTBSSPMMPEFTPGUXBSFNÈTBWBO[BEBTEF
la industria. SiteControl ofrece el mejor rendimiento y una excelente
compatibilidad de software y hardware
Opciones de módulos de software
t&MTJTUFNBFTNPEVMBS$PNQSFTØMPMPRVFOFDFTJUBZBNQMÓFMPNÈTBEFMBOUF
t4NBSU8FBUIFS
tVCJDBDJPOFTBEJDJPOBMFT
t1VFEFBNQMJBSMBDBQBDJEBEEFUSB[BEPTEFDBCMFDPOOVFWPTNØEVMPT
t.FTTFOHFSEF3BJO#JSE
(para Smart Weather)
t5SB[BEPEFDBCMFBEJDJPOBMEB
Control remoto del sistema
t"VUPNBUJD&5&WBQPUSBOTQJSBDJØO
automática)
t$POUSPMFTVTJTUFNBZPQFSFFM4JUF$POUSPMEFTEFDVBMRVJFSVCJDBDJØOFOFM
TJUJPVUJMJ[BOEPFMTJTUFNB'3&&%0.EF3BJO#JSE%JTQPOJCMFQPSUFMÏGPOP
UFMÏGPOPDFMVMBSPSBEJP6)'
t-BJOUFSGB[.*.PCJMFPGSFDFDPOUSPMEFSJFHPSFNPUPQPSUFMÏGPOPDFMVMBS
con conexión a Internet. Se requiere código clave de software. El cliente
proporciona el teléfono inteligente
t.ØEVMPIÓCSJEP
t4NBSU4FOTPSTFOTPSJOUFMJHFOUF
t6UJMJEBEFTEFNBQFP
t5SB[BEPEFDBCMFBEJDJPOBMSB
t5SB[BEPEFDBCMFBEJDJPOBMUB
t4JUF$POUSPM1MVT
t#PNCFPJOUFMJHFOUF4NBSU1VNQ
t.**OUFSGB[NØWJM
t'SFFEPN
Características de GSP
Monitoreo y programación superiores
t"TJTUFODJBBUSBWÏTEFMÓOFBUFMFGØOJDBHSBUVJUBDPOTVMUFMBQÈHJOB
t'MP(SBQI™ proporciona gráficos en tiempo real con cuadros de información
a color sobre cada una de las estaciones
t%JBHOØTUJDPTEFTJTUFNBSFNPUP
t&YUFOTJØOEFMBHBSBOUÓB
Sistemas de control
centralizado
t-BGVODJØO'MP.BOBHFS™ (administración de flujo) equilibra las demandas
del sistema y las capacidades máximas de modo eficaz, lo cual contribuye a
disminuir la demanda de agua, a reducir el desgaste y las roturas del sistema
y a ahorrar energía
t%FTDVFOUPTEFDBQBDJUBDJØOZFOUSFOBNJFOUPFOFMMVHBS
t&MTJTUFNB$ZDMF4PBL™ mejora el control de la aplicación de agua en
pendientes y áreas con drenaje irregular
t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP
t3FFNQMB[PEFIBSEXBSFFMTJHVJFOUFEÓBIÈCJM
t"DUVBMJ[BDJPOFTGVUVSBTHSBUVJUBTEFMTPGUXBSFEF4JUF$POUSPM
t"TJTUFODJBFODBTPEFJODJEFOUFTZPUSPT
t-BTGVODJPOFT2VJDL*33™ and SimpleIRR™ proporcionan métodos fáciles y
rápidos para crear horarios y programas de riego en base a sus parámetros
t-BDBSBDUFSÓTUJDB1SJOU0GGJDFJNQSJNFUPEPTMPTSFHJTUSPTEFNPOJUPSFPF
información del sitio en un formato claro y conciso, para controlar fácilmente
el sitio y llevar a cabo el diagnóstico y solución de problemas
t-BGVODJØO4NBSU4FOTPST™ permite el monitoreo del flujo y otras condiciones,
además de la configuración de reacciones específicas seleccionadas por el
usuario
148
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
*OUFSGB[TBUFMJUBM58**OUFSGB[QBSBEFDPEJGJDBEPSEFEPT
DBCMFT-%*4%*
Interfaz satelital TWI
Interfaz satelital para SiteControl solamente
Interfaz para decodificador de dos
cables LDI/SDI
Q Permite una comunicación bidireccional en tiempo real entre los
Interfaz para decodificador para SiteControl solamente
satélites de campo y el controlador central de SiteControl
Q Permite una comunicación bidireccional en tiempo real entre los
Q Permite el uso de funciones avanzadas en campo de las versiones
&414"5EFEPTDBCMFTPEF&/-"$&
decodificadores y el controlador central de SiteControl
Q Conecta las características eficaces de SiteControl con una fácil
Q La capacidad modular puede desarrollarse con el sitio
instalación y seguridad de un sistema decodificador de dos cables
Características
Q El sistema puede configurarse y ampliarse según las necesidades del
t-B58*PQFSBIBTUBTBUÏMJUFTNÈYJNPEFIBTUBFTUBDJPOFTEFTBUÏMJUF
decodificadores de sensores o de pulsos por trazado de cable
Características
t4FQVFEFFYUFOEFSIBTUB&414"5NÈYJNPEFIBTUBFTUBDJPOFTEF
satélite), decodificadores de sensores o de pulsos en un sistema SiteControl
t'VODJPOBDPOMPTEFDPEJGJDBEPSFTEFTFOTPSFTZDBNQP5VSGEF3BJO
#JSE'%563''%563''%563''%563''%563'
4%563'
t-B58*TFPGSFDFFTUÈOEBSDPOVOUSB[BEPEFDBCMFRVFTFQVFEFBDUVBMJ[BSB
4 trazados de cable con la compra del módulo de trazados de cable adicional
t4JUF$POUSPMTFQVFEFDPOGJHVSBSQBSBPQFSBSJOUFSGBDFTUPUBMFTNØEVMPEF
software híbrido requerido)
t"QSPCBEPQPS6-6TPFOJOUFSJPSFT
t.POUBKFFOQBSFEHBCJOFUFEFBDFSPMBNJOBEPTJOTPMEBEVSBTDPOQBOFM
frontal con bisagras
t4FDVFODJBEFEBUPTEFMBDPNQVUBEPSB$BCMFEFTFSJF34
Especificaciones eléctricas
Conexión con cables TWI
t&OUSBEBSFRVFSJEB7$"œB")[P7$"œ
10% a 0.5A 50/60Hz
proyecto
t-BSVUBEFDPNVOJDBDJØOEFEPTDBCMFTDVFOUBUBNCJÏODPOMBTDBSBDUFSÓTUJDBT
de diagnóstico avanzado y de sensor para el controlador central
t-BJOUFSGB[QFRVF×BQBSBEFDPEJGJDBEPSFT4%*
QVFEFDPOFDUBSTFDPOIBTUB
200 direcciones de decodificadores y puede activar hasta 400 solenoides
t-BJOUFSGB[HSBOEFQBSBEFDPEJGJDBEPSFT-%*
QVFEFDPOFDUBSTFDPOIBTUB
500 direcciones de decodificadores y puede activar hasta 1000 solenoides
Requiere el módulo de software SiteControl Plus
t-BTJOUFSGBDFT-%*Z4%*TFJODMVZFOEFNBOFSBFTUÈOEBSDPOUSB[BEPTEF
hasta 4 cables
t&MTJTUFNB4JUF$POUSPMTFQVFEFDPOGJHVSBSQBSBPQFSBSIBTUBJOUFSGBDFT
totales (SiteControl Plus y/o módulos de software híbrido requeridos)
t4FDVFODJBEFEBUPTEFMBDPNQVUBEPSB$BCMFEFTFSJF34
t4BMJEBY7$"B")[PY7$"B")[
t4FDVFODJBEFEBUPTEFMEFDPEJGJDBEPS$BCMF.BYJEFEPTDBCMFT
t$PSUBDJSDVJUPT/%SFDPOGJHVSBDJØOBVUPNÈUJDB
t.POUBKFFOQBSFE(BCJOFUFEFQMÈTUJDPEFHSBOSFTJTUFODJBDPOQVFSUBDPO
llave
t&OUSBEBSFRVFSJEB7$"œB")[P7$"œ
10% a 0.5A 50/60Hz
Especificaciones eléctricas
t4BMJEB/%
t"NÏSJDBEFM/PSUF
SDI
Sistemas de control
centralizado
TWI Link
- Entrada: 120 VCA +/- 10%, 60Hz
t$PSUBDJSDVJUPT/%
- Salida: 24 VCA +/- 10% 50 VA
Descarga a tierra
t5PEBTMBTJOUFSGBDFTEFEPTDBCMFT58*
EFCFSÈOUFOFSVOBEFTDBSHBBUJFSSB
de 10 ohmios o menos
t*OUFSOBDJPOBM
- Entrada: 220/230/240 VCA +/- 10% 60Hz
- Salida: 24 VCA +/- 10% 50 VA
Dimensiones
LDI
t"ODIP1⁄2" (39.4 cm)
t"NÏSJDBEFM/PSUF
t"MUVSB1⁄2" (31.7 cm)
- Entrada: 120 VCA +/- 10%, 60Hz
t1SPGVOEJEBEDN
- Salida: 24 VCA +/- 10% 75 VA
t*OUFSOBDJPOBM
Modelos
t58*4"5%PTDBCMFTDPOFYJØODPODBCMFT
- Entrada: 220/230/240 VCA +/- 10% 60Hz
t58*4"5-&OMBDFSBEJP
- Salida: 24 VCA +/- 10% 75 VA
Interfaz SDI
(no se muestra
MB-%*
Dimensiones (LDI y SDI)
t"ODIP1⁄2" (24.1 cm); Altura: 101⁄4" (26 cm); Profundidad: 43⁄8" (11.1 cm)
Modelos
t4%*563'DUSBOTGPSNBEPS
$POUSPMBEJSFDDJPOFT
t-%*563'DUSBOTGPSNBEPS
$POUSPMBEJSFDDJPOFT
Interfaz de dos
cables (TWI)
El uso inteligente del agua.™
149
Sistemas de control centralizado
Maxicom2®
Maxicom2®
Control centralizado para múltiples sitios ideal
para grandes sistemas
Q Sistema de Control centralizado para múltiples sitios y aplicaciones de
riego industrial o comercial
Q Conserva el agua por medio de características avanzadas de riego
basadas en la evapotranspiración
Q La programación flexible permite al sistema reaccionar a los sensores y
trabajar dentro de las restricciones de riego
Características del sistema
t&MQBRVFUFEFMDPOUSPMBEPSDFOUSBM.BYJDPN2® incluye el software Maxicom2,
la computadora preconfigurada, el Plan de asistencia global (GSP) y la
capacitación
t$POUSPMBODJFOUPTEFTBUÏMJUFT&414*5&4"5TJUJPTQBSBVOTPMPDPOUSPMBEPS
y Cluster Control Units - CCU (unidades de control de grupo) que pueden
DPOUSPMBSIBTUBDPOUSPMBEPSFTEFTBUÏMJUF&414"5JOEJWJEVBMFTDBEBVOPFO
sitios para múltiples controladores
t.POJUPSFBOEPDFOBTEFGVFOUFTNFUFPSPMØHJDBTDPNPFTUBDJPOFT
NFUFPSPMØHJDBT84130&5.BOBHFSTPTFOTPSFTEFNFEJDJØOEFMMVWJB
(medidor de lluvia)
t&MDPOUSPMSFNPUP'SFFEPNQFSNJUFMBPQFSBDJØONBOVBMEFMTJTUFNBBUSBWÏT
de un teléfono celular o radio
t-PTNÞMUJQMFTSFHJTUSPTFJOGPSNFTEFMDPOTVNPEFBHVBTFHFOFSBO
automáticamente para realizar un seguimiento del funcionamiento del
sistema y del ahorro de agua
Características de administración de agua
Sistemas de control
centralizado
t0QFSBDJØOEFIPSBSJPTEFDPNVOJDBDJØOFOUSFTBUÏMJUFTIPSBSJPT
separados por CCU proporcionan precisión en el riego de áreas y microclimas
t-BGVODJØO&5$IFDLCPPL™BENJOJTUSBMBFWBQPUSBOTQJSBDJØO&5
ZBKVTUB
automáticamente el tiempo de riego de cada estación del controlador de
satélite y los intervalos de ciclo diario para que coincidan con los requisitos
de riego paisajístico
t-BGVODJØO'MP.BOBHFS™BENJOJTUSBMBEFNBOEBEFGMVKPUPUBMVCJDBEBFO
la(s) fuente(s) de agua, optimizando tanto la ventana de riego como la
disponibilidad de agua
t-BGVODJØO'MP8BUDI™NPOJUPSFBMPTTFOTPSFTEFGMVKPFODBEBGVFOUFEF
agua, registra el flujo y reacciona automáticamente a los problemas de flujo
apagando la parte afectada del sistema (la válvula individual o línea principal)
t-BGVODJØO3BJO8BUDI™NPOJUPSFBMPTTFOTPSFTEFNFEJDJØOEFMMVWJBSFHJTUSB
los valores de precipitación y reacciona automáticamente interrumpiendo
el riego para verificar la cantidad de agua que cayó y determinar si el riego
debe reanudarse o cancelarse
t&MTJTUFNB$ZDMF4PBL™PQUJNJ[BMBBQMJDBDJØOEFBHVBTFHÞOFMÓOEJDFEF
penetración en el suelo, lo cual reduce la erosión y el encharcamiento
t$POUSPMBGVODJPOFTRVFOPFTUÈOSFMBDJPOBEBTDPOFMSJFHPFOTÓDPNPMB
iluminación, las fuentes, los cierres de puertas y los portones
Maxicom2 Opciones de comunicaciones
t$POUSPMBEPSDFOUSBMB$$65FMÏGPOPDPOFYJØOEJSFDUBSBEJPUFMÏGPOPDFMVMBS
SFE&UIFSOFU8J'JGJCSBØQUJDB
t%F$$6B&414"55SB[BEPEFEPTDBCMFT
t%F$$6B&414"5-3BEJP.BTUFS-JOLSFE&UIFSOFU8J'JGJCSBØQUJDB
Características del Plan de asistencia global (GSP) (consulte la
página 159)
t"TJTUFODJBBUSBWÏTEFMÓOFBUFMFGØOJDBHSBUVJUB
t%JBHOØTUJDPTEFTJTUFNBTSFNPUPT
t1PMÓUJDBEFTBUJTGBDDJØOEFMDMJFOUFTPCSFMPTDPNQPOFOUFTEFMTJTUFNBEF
control centralizado y reemplazo de hardware el siguiente día hábil.
t1BRVFUFTEFTFSWJDJPEFTPGUXBSFHSBUVJUP
t%FTDVFOUPEFDBQBDJUBDJØOZFOUSFOBNJFOUPFOFMMVHBS
t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP
Modelos
t.$(0-%OVFWPTJTUFNB1$EFFTDSJUPSJPDPOTPGUXBSF.BYJDPNJODMVZF
el Plan de asistencia global durante 1 año.
t(41.$1-TVTDSJQUPSFTBDUVBMFTPBOUJHVPTEF(411$EFFTDSJUPSJPDPO
software Maxicom; incluye el Plan de asistencia global (GSP) de nivel
Platinum Plus durante 3 años.
t(41.911$*"TVTDSJQUPSFTBDUVBMFTEF(411$EFFTDSJUPSJPDPOTPGUXBSF
Maxicom; basado en el Plan de asistencia global (GSP) de nivel Platinum Plus
de 3 años; incluye 1 año de GSP; requiere la compra de GSP el 2do y 3er año
(M95543A2).
t(41.911$*.TVTDSJQUPSFTBDUVBMFTEF(411$EFFTDSJUPSJPDPOTPGUXBSF
Maxicom; basado en el Plan de asistencia global (GSP) de nivel Platinum Plus
de 3 años; incluye 1 mes de GSP; requiere la compra de GSP desde el mes 2 al
36 (M95544M2).
t(41.911/*"TVTDSJQUPSFTOVFWPTPBOUJHVPTEF(411$EFFTDSJUPSJPDPO
software Maxicom; basado en el Plan de asistencia global (GSP) de nivel
Platinum Plus de 3 años; incluye 1 año de GSP; requiere la compra de GSP el
2do y 3er año (M95541A2).
t(41.911/*.TVTDSJQUPSFTOVFWPTPBOUJHVPTEF(141$EFFTDSJUPSJPDPO
software Maxicom; basado en el Plan de asistencia global (GSP) de nivel
Platinum Plus de 3 años; incluye 1 mes de GSP; requiere la compra de GSP
desde el mes 2 al 36 (M95542M2).
t.$61(TPGUXBSFEFBDUVBMJ[BDJØOEF.BYJDPNTPMP$%BDUVBMJ[BDJØOEF
Maxicom 1.X, 2.X y 3.X a la última versión.
Características operativas
t&MNFDBOJTNPEFDPOUSPMEFDPNVOJDBDJPOFTFOWÓBBVUPNÈUJDBNFOUFMB
programación actualizada a los sitios antes del inicio del riego y recupera
los registros luego de la finalización del riego; se puede llevar a cabo una
operación manual en cualquier momento
t$JDMPTEJBSJPTEFBSSBORVF$VTUPNQFSTPOBMJ[BEP
EÓBEFMBTFNBOB
"Odd/Even/Odd31" (días impares/días pares/días impares excepto los días
P$ZDMJDBMDÓDMJDP
FJODMVZFIPSBSJPTDBMFOEBSJPEF&WFOU%BZ0GG
(apagado por día de evento)
t5JFNQPTEFSJFHPEFMBFTUBDJØOQSPHSBNBCMFTEFTEFNJOVUPBIPSBT
Maxicom2
Maxicom2&5$IFDLCPPLBENJOJTUSBMBIVNFEBEEFMTVFMPEFMBNJTNBGPSNBRVFVTUFEBENJOJTUSBFMEJOFSPEFTVDVFOUBEFDIFRVFT-BQÏSEJEB
diaria de agua por evapotranspiración representa un retiro, mientras que el riego y la precipitación son depósitos de humedad en el suelo.
150
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
interfaz Cluster Control Unit - CCU (unidad de control de grupo)
Interfaz Cluster Control Unit - CCU
(unidad de control de grupo)
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7"$œ!")[P
œ!")[
Interfaz CCU para Maxicom2® Solamente
t4BMJEB7"$)[P)["
Q Ejecuta operaciones en tiempo real de un sitio con hasta 28 satélites
t$PSUBDJSDVJUPT/%
Q Adapta la secuencia de estaciones a las condiciones cambiantes para
t*OUFSSVQUPSEFQPMJFUJMFOPEFSFDPOGJHVSBDJØOBVUPNÈUJDB"BCJFSUPFTUBEP
regular) 1.3A abierto (descarga)
lograr una máxima eficacia
Q Responde de manera instantánea a las condiciones inesperadas y las
entradas de sensor
t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP
Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE
Características
- Ancho: 115⁄16" (28.7 cm)
t"ENJOJTUSBMBTDPOFYJPOFTEFDPNVOJDBDJØODPOFMDPOUSPMBEPSDFOUSBM
Maxicom2
- Altura: 111⁄2" (29.2 cm)
t"ENJOJTUSBIBTUBDPOUSPMBEPSFTEFTBUÏMJUFFTUBDJPOFT
ZFOUSBEBT
de sensor como un solo sistema de control dinámico
- Profundidad: 61⁄2" (16.5 cm)
t1FEFTUBMEFBDFSPJOPYJEBCMF
t"MNBDFOBZFKFDVUBMBTJOTUSVDDJPOFTEFMPTIPSBSJPTEFSJFHPEFTEFFM
controlador central Maxicom2
- Ancho: 111⁄2" (29.2 cm)
t1FSNJUFUPNBSEFDJTJPOFTFOUJFNQPSFBMQBSBSFBDDJPOBSBOUFDPOEJDJPOFT
inesperadas como tuberías rotas, válvulas obstruidas, precipitaciones, etc.
- Profundidad: 111⁄2" (29.2 cm)
- Altura: 30" (76.2 cm)
Características de administración de agua
t0QFSBDJØOEFIPSBSJPTEFDPNVOJDBDJØOFOUSFTBUÏMJUFTIPSBSJPT
separados por CCU proporcionan precisión en el riego de áreas y microclimas
Modelos
Canales
De metal,
(satélites de 24 montaje sobre
estaciones)
pared
6
28
t-BGVODJØO'MP.BOBHFS™BENJOJTUSBMBEFNBOEBEFGMVKPUPUBMVCJDBEBFO
la(s) fuente(s) de agua, optimizando tanto la ventana de riego como la
disponibilidad de agua
t-BGVODJØO'MP8BUDI™NPOJUPSFBMPTTFOTPSFTEFGMVKPFODBEBGVFOUFEF
agua, registra el flujo y reacciona automáticamente a los problemas de flujo
apagando la parte afectada del sistema (la válvula individual o línea principal)
t-BGVODJØO3BJO8BUDI™NPOJUPSFBMPTTFOTPSFTEFNFEJDJØOEFMMVWJBSFHJTUSB
los valores de precipitación y reacciona automáticamente interrumpiendo
el riego para verificar la cantidad de agua que cayó y determinar si el riego
debe reanudarse o cancelarse
CCU6W
CCU28W
Pedestal de
acero
inoxidable
Estaciones de
satélite
máximas
Entradas de
sensor
máximas
CCU6S
CCU28S
144
672
12
56
Notas:
t -PTTBUÏMJUFTDPOFTUBDJPOFTPNFOPTSFRVJFSFODBOBM
t -PTTBUÏMJUFTDPOFTUBDJPOFTPNÈTSFRVJFSFODBOBMFT
t -BDBQBDJEBEEFFOUSBEBEFMTFOTPSEFVOB$$6WBSÓBMB$$6FOMBPQDJØOEF
comunicación satelital
Sistemas de control
centralizado
t3FHJTUSBFMUJFNQPEFSJFHPEFMBFTUBDJØOEFMDPOUSPMBEPSEFTBUÏMJUFZMB
actividad del sensor reales
t .PEFMPTEFNFUBMNPOUBEPTTPCSFQBSFEEJTQPOJCMFTFO7$"Z7$");
Maxicom2 Opciones de comunicación
t$POUSPMBEPSDFOUSBMB$$65FMÏGPOPDPOFYJØOEJSFDUBSBEJPUFMÏGPOPDFMVMBS
SFE&UIFSOFU8J'JGJCSBØQUJDB
t%F$$6B&414"55SB[BEPEFEPTDBCMFT
t%F$$6B&414"5-3BEJPSFE&UIFSOFU8J'JGJCSBØQUJDB
Cómo especificar
CCU - 28 - W
Montaje
W: Montaje sobre pared
S: Pedestal de acero
inoxidable
Canales
6: 6 canales
28: 28 canales
Modelo
CCU
CCU-6-W CCU-28-W
El uso inteligente del agua.™
El ejemplo especifica una CCU con 28 canales,
en un gabinete montado sobre la pared.
151
Sistemas de control centralizado
$POUSPMBEPSEFTBUÏMJUF&414"5
Controlador de satélite ESP-SAT
2
Controlador de satélite de 12, 24, 40 estaciones para Maxicom ® y
SiteControl
Q Controlador de satélite de campo para los sistemas de control de
Maxicom2 o los sistemas de control centralizado de SiteControl
Q El poder de una herramienta de administración de agua avanzada, en
un paquete fácil de usar
Q 5PEBTMBTDBSBDUFSÓTUJDBTZMBTGVODJPOFTJOEFQFOEJFOUFTEFMBMÓOFBEF
controladores ESP-MC de Rain Bird
t.FNPSJBOPWPMÈUJMQBSBB×PTRVFBMCFSHBFMQSPHSBNBMBGFDIB
y la hora durante los cortes de energía
t3FTQBMEPDPOQJMBQJMBEF7$$EFOÓRVFMDBENJPSFDBSHBCMFQBSB
programación con pila y para mantener activo el programa en
funcionamiento durante los cortes de energía
t1SPUFDDJØODPOUSBEFTDBSHBTFMÏDUSJDBTEFHSBOSFTJTUFODJB
t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP
Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE
- Ancho: 115⁄16" (28.7 cm)
- Altura: 111⁄2" (29.2 cm)
Características
t&414"5TFDPOUSPMBBUSBWÏTEFMB$$6QBSB.BYJDPN2PMB58*QBSB
SiteControl
t&KFDVUBJOTUSVDDJPOFTFNJUJEBTEFTEFFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEP
t-PTNPEFMPT&414"5-JODPSQPSBOEPTFOUSBEBTEFTFOTPS
t$POTVMUF4JTUFNBEFDPOUSPMDFOUSBMJ[BEP.BYJDPN2 (página 150) o
4JUF$POUSPMQÈHJOB
QBSBWFSMBTDBSBDUFSÓTUJDBTEF&414"5DPODPOUSPM
centralizado
t&MDPOUSPMBEPS&414"5UBNCJÏOQVFEFGVODJPOBSDPNPVODPOUSPMBEPS
independiente, con las mismas características que el ESP-MC
- Profundidad: 61⁄2" (16.5 cm)
t1FEFTUBMEFBDFSPJOPYJEBCMF
- Ancho: 111⁄2" (29.2 cm)
- Altura: 30" (76.2 cm)
- Profundidad: 111⁄2" (29.2 cm)
Modelos
Estación
Dos cables,
de metal,
montaje sobre
pared
Opciones
Enlace,
Enlace, de metal,
Dos cables,
montaje sobre pedestal de acero
pedestal de
inoxidable
pared
acero inoxidable
t.PEFMPTEFZFTUBDJPOFT
12
&414"58
&414"54
&414"5-8
&414"5-4
t$PNVOJDBDJØOTFDVOEBSJBEFFOMBDF4"5-
PEFEPTDBCMFT4"5
24
&414"58
&414"54
&414"5-8
&414"5-4
t1FEFTUBMEFNFUBM
40
&414"58
&414"54
&414"5-8
&414"5-4
t%FNFUBMDPODBKBEFNPOUBKFTPCSFQBSFE
t1FEFTUBMEFBDFSPJOPYJEBCMF
Maxicom2 Opciones de comunicación
t%F$$6B&414"55SB[BEPEFEPTDBCMFT
Notas:
t 4JTFVUJMJ[BSÈDPNVOJDBDJØOEFSBEJPEFFOMBDFFOUSFMB$$6VOJEBEEFDPOUSPMEFHSVQP
PMBJOUFSGB[EFEPTDBCMFT58*
ZMPTTBUÏMJUFTEFCFFTQFDJGJDBSTFUBNCJÏOVOLJUSBEJP
módem
Sistemas de control
centralizado
t%F$$6B&414"5-3BEJP.BTUFS-JOLSFE&UIFSOFU8J'JGJCSBØQUJDB
t -PTDPOUSPMBEPSFTEFTBUÏMJUFEFDBNQP&414"5SFRVJFSFOVOB$$6QBSBDPOFDUBSTFDPO
el sistema Maxicom2
Especificaciones eléctricas
t -PTDPOUSPMBEPSFTEFTBUÏMJUFEFDBNQP&414"5SFRVJFSFOVOBJOUFSGB[EFEPTDBCMFT
(TWI) para conectarse con el sistema SiteControl
t&OUSBEBSFRVFSJEB7"$œ)[
(Modelos internacionales: 230 VCA ± 10%, 50 Hz)
t &MUSB[BEPEFEPTDBCMFTFTVOUSB[BEPEFDPNVOJDBDJØOEFDPOFYJØODPODBCMFTRVF
conecta la CCU o la TWI con los satélites
t4BMJEB7$""
t &MSBEJPEFFOMBDFFTVOBDPNVOJDBDJØOQPSSBEJPJOBMÈNCSJDBRVFDPOFDUBMB$$6PMB
TWI con los satélites
t$BQBDJEBEEFDBSHBEFFTUBDJØO)BTUBEPTWÈMWVMBTTPMFOPJEFTEF7$"
VA por estación, más una válvula maestra o relé de arranque de bomba
t%JBHOØTUJDPEFDPSUBDJSDVJUPTRVFFWJUBFJOEJDBMBTFTUBDJPOFT
con circuitos sobrecargados
t -PTTBUÏMJUFTEFZFTUBDJPOFTPDVQBODBOBMFOMB$$6PMB58*-PTTBUÏMJUFTEF
estaciones ocupan 2 canales en la CCU o la TWI.
t -PTTBUÏMJUFTEFDPNVOJDBDJØOEFSBEJPEFFOMBDFUJFOFOFOUSBEBTEFTFOTPSFT
Cómo especificar
ESP - 24SAT - 2W
Cantidad de
Estaciones
4"5FTUBDJPOFT
4"5FTUBDJPOFT
4"5FTUBDJPOFT
Modelo
ESP (120VAC)
Montaje
W: de metal,
montaje sobre
pared
S: Acero
Inoxidable
Secuencia de datos
del satélite
2: Radios
L: MAXILink™ de
dos cables
Satélite ESP-40SAT-2W
152
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
$POUSPMBEPSEFTBUÏMJUF&414J5&4"5
Controlador de satélite ESP-SITE-SAT
Controlador de satélite de 12, 24, 40 estaciones para Maxicom2®
Solamente
Q Combina la energía de una Cluster Control Unit -CCU (unidad de
control de grupo) con funciones de un único controlador de satélite
ESP para sitios pequeños con Maxicom2
Q Herramienta de administración de agua avanzada en un paquete fácil
de utilizar
Q 5PEBTMBTDBSBDUFSÓTUJDBTZMBTGVODJPOFTJOEFQFOEJFOUFTEFMBMÓOFBEF
controladores ESP-MC de Rain Bird
Dimensiones
t%FNFUBMDPOSFDVCSJNJFOUPEFQJOUVSBFOQPMWPQBSBNPOUBSFOMBQBSFE
- Ancho: 115⁄16" (28.7 cm)
- Altura: 111⁄2" (29.2 cm)
- Profundidad: 61⁄2" (16.5 cm)
t1FEFTUBMEFBDFSPJOPYJEBCMF
- Ancho: 111⁄2" (29.2 cm)
- Altura: 30" (76.2 cm)
- Profundidad: 111⁄2" (29.2 cm)
Modelos
Características
t$PNCJOBMBGVODJØOEFVOB$MVTUFS$POUSPM6OJU$$6VOJEBEEFDPOUSPMEF
HSVQP
ZEFVODPOUSPMBEPSEFTBUÏMJUF&414"5FOVOTPMPEJTF×PEFDBKB
Estaciones
12
24
40
t"MNBDFOBZFKFDVUBMBTJOTUSVDDJPOFTEFMPTIPSBSJPTEFSJFHPEFTEFFM
controlador central Maxicom2
t*ODPSQPSBEPTFOUSBEBTEFTFOTPS.BYJDPN2
t$POTVMUF4JTUFNBEFDPOUSPMDFOUSBMJ[BEP.BYJDPN2 (página 150) para ver las
DBSBDUFSÓTUJDBTEF&414*5&4"5DPODPOUSPMDFOUSBMJ[BEP
De metal
Montaje sobre pared
&414*5&8
&414*5&8
&414*5&8
Pedestal de acero
inoxidable
&414*5&4
&414*5&4
&414*5&4
Nota: No requiere una CCU para conectarse con Maxicom2
t&MDPOUSPMBEPS&414*5&4"5UBNCJÏOQVFEFGVODJPOBSDPNPVODPOUSPMBEPS
independiente, con las mismas características que el ESP-MC
Opciones
tNPEFMPTEFZFTUBDJPOFT
t%FNFUBMDPODBKBEFNPOUBKFTPCSFQBSFE
t1FEFTUBMEFBDFSPJOPYJEBCMF
Maxicom2 Opciones de comunicación
t$POUSPMBEPSDFOUSBMB&414*5&4"55FMÏGPOPDPOFYJØOEJSFDUBSBEJPUFMÏGPOP
DFMVMBSSFE&UIFSOFU8J'JGJCSBØQUJDB
Satélite de sitio
ESP-24SITE-W
Sistemas de control
centralizado
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7$"œ)[NPEFMPTJOUFSOBDJPOBMFT
230 VAC y 240 VAC ± 10%, 50Hz)
t4BMJEB7$""
t$BQBDJEBEEFDBSHBEFFTUBDJØO)BTUBEPTWÈMWVMBTTPMFOPJEFTEF7$"
7VA por estación, un máximo de 4 estaciones, más una válvula maestra o relé
de arranque de bomba
t%JBHOØTUJDPEFDPSUBDJSDVJUPTRVFFWJUBFJOEJDBMBTFTUBDJPOFTDPODJSDVJUPT
sobrecargados
t3FTQBMEPDPOQJMBQJMBEF7$$EFOÓRVFMDBENJPSFDBSHBCMF
para programación con pila y para mantener activo el programa
en funcionamiento durante los cortes de energía
t1SPUFDDJØODPOUSBEFTDBSHBTFMÏDUSJDBTEFHSBOSFTJTUFODJB
t#BSSBDPMFDUPSBEFEFTDBSHBBUJFSSBEFVOTPMPQVOUP
Cómo especificar
ESP-24SITE-W
Montaje
8%FNFUBMNPOUBKF
sobre pared
S: Acero inoxidable
Pedestal de
acero inoxidable
El uso inteligente del agua.™
Cantidad de estaciones
4*5&FTUBDJPOFT
4*5&FTUBDJPOFT
4*5&FTUBDJPOFT
Modelo
ESP (120VAC)
153
Sistemas de control centralizado
Sistemas en paquete para el control de riego
Sistemas en paquete para control
de riego
Rain Bird, la empresa líder en productos para control centralizado
de riego, ofrece sus Sistemas de Control en Paquete para ayudar a
satisfacer sus necesidades de hardware en control centralizado y
controladores independientes.
Q Un sistema de control en paquete de Rain Bird le permite almacenar
todo su equipo de control de riego en un montaje de tipo caja que se
coloca en la pared o en un pedestal personalizado para su aplicación
FTQFDÓGJDB5BNCJÏOFYJTUFOEJWFSTPTNPOUBKFTEJTQPOJCMFTDPOQBOFMFT
que se abren por la parte posterior (sin caja) y que pueden instalarse
en una caja existente o montarse en la pared.
Q Los sistemas de control en paquete son sencillos de especificar,
fáciles de instalar y están diseñados para mantener sus componentes
Montaje en pared con CCU y
Controladores 3 ESP-SAT y
monitor de caudal
protegidos del clima, el vandalismo, los insectos y otros peligros
ambientales.
Q 5PEPTMPTTJTUFNBTEFDPOUSPMFOQBRVFUFEF3BJO#JSETFDPOTUSVZFO
en un taller de paneles aprobado por UL. Usted tiene la opción de
decidir si su sistema esté aprobado por UL o no. Si necesita una opción
específica, nosotros la analizamos y trabajamos con nuestro equipo
de ingenieros para encontrar la solución que mejor se ajuste a sus
necesidades.
Q Cada sistema de control en paquete viene preensamblado, probado y
listo para su instalación. Cada unidad se pone en funcionamiento en
la fábrica y pasa por una prueba completa para verificar que todos sus
componentes funcionen correctamente. El contratista que la instala
solamente debe montar la caja, suministrar energía y cablear el terreno
a los puntos de conexión con las etiquetas de fábrica.
Características
Sistemas de control
centralizado
Pedestal con
Controlador ESP-SAT
tDiseños estándar y personalizados Rain Bird diseñará, ensamblará y enviará
cada sistema de control en paquete de manera que se cumplan cabalmente sus
requisitos.
t$POGJHVSBDJPOFTEFSolución "al instante” para reducir el tiempo de instalación a
través de precableado y preinstalación de componentes
tCajas UL con certificación NEMA seleccionadas para cada servicio y ambiente
específico (las cajas “P1” y “P7” no están aprobadas por UL)
t&YJTUFOcajas aprobadas por UL y no aprobadas por ULEJTQPOJCMFT5PEBTMBT
cajas se construyen en un taller de paneles aprobado por UL
tSupresores de sobretensión para la energía entrante, teléfono, sensor y vía de
dos cables (según corresponda)
tCaja de servicios*$'$5
tInterruptores de desconexión de circuitos eléctricos: garantiza que se pueda
desconectar la corriente de manera segura al acceder a los componentes con
energía eléctrica
tBloque de terminales para todos los cableados de terreno con conexiones de
presión
t4FSFBMJ[BOpruebas de funcionamiento e inspecciones de calidad para cada
unidad, antes del envío
tGarantía: la Política de satisfacción del cliente profesional de Rain Bird brinda
cobertura a todos los componentes de los sistemas de control en paquete por un
período de 5 años
Pedestal con controlador serie LX
154
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
Sistemas de control en paquete, Radio de espectro ensanchado
Opciones disponibles
t0QDJPOFTEFDBKBTDPOQFEFTUBM
Radio de espectro ensanchado
Maxicom2®4JUF$POUSPMP*2™
- Pedestal de acero con recubrimiento de pintura en polvo
t0QDJPOFTEFDBKBTQBSBNPOUBSFOMBQBSFE
- Caja de acero con recubrimiento de pintura en polvo para montar en la
pared
- Caja de acero inoxidable para montar en la pared
t0QDJPOFTÞOJDBNFOUFDPOQBOFMQPTUFSJPS
ÁOJDBNFOUFDPOQBOFMQPTUFSJPSEFVOBQJF[BRVFFODBKBFOVOQFEFTUBM
estándar
ÁOJDBNFOUFDPOQBOFMQPTUFSJPSQBSBNPOUBSFOMBQBSFE
Características
t4BMUPEFGSFDVFODJBQBSBFWJUBSJOUFSGFSFODJB
t$PTUFSFEVDJEPEFQSPQJFEBEOPTFSFRVJFSFMJDFODJB'$$
t/PIBZSFTUSJDDJPOFTEFMB'$$TPCSFMBBMUVSBEFMBBOUFOBFMVTVBSJPEFCF
consultar las leyes locales)
t-PTSBEJPTQVFEFODPOGJHVSBSTFDPNPSFQFUJEPSFTQBSBBMDBO[BSEJTUBODJBT
mayores y superar obstáculos
Requisitos de instalación
Dispositivos con comunicación
t"OUFTEFIBDFSFMQFEJEPEFCFIBDFSVOFTUVEJPEFMUFSSFOPZFOWJBSMPKVOUP
con su pedido
tControl centralizado Maxicom
t3"%5/.*#Z3"%5/58*TFNPOUBOEJSFDUBNFOUFFOFMUBCMFSP&414"5.*#
- La vía principal (de la computadora al CCU/Site Sat) puede utilizar
dispositivos Ethernet, radios de 900 MHz, módems telefónicos y módems
de teléfonos celulares, además de una conexión directa por cable
- La vía secundaria (de la CCU al Sat) puede utilizar dispositivos Ethernet,
radios de 450-470 MHz y 900 MHz o una conexión de dos cables
tControl centralizado de SiteControl
-BWÓBQSJODJQBMEFMBDPNQVUBEPSBBM58*4%*-%*
QVFEFVUJMJ[BS
dispositivos Ethernet y radios de 900 MHz, además de una conexión directa
por cable
-BWÓBTFDVOEBSJBEF58*BM4BU
QVFEFVUJMJ[BSEJTQPTJUJWPT&UIFSOFUSBEJPT
de 450-470 MHz y 900 MHz o una conexión de dos cables
t4PGUXBSFEFDPOUSPMDFOUSBMIQ™
- La vía principal (de la computadora al satélite servidor) puede utilizar
DPOFYJØOEJSFDUBUFMÏGPOP&UIFSOFUQPSDBCMF&UIFSOFUQPS8J'JNØEFN
por teléfono celular, además de comunicación por radio de 900 MHz de
espectro ensanchado
- La vía secundaria (del satélite servidor al satélite cliente) puede utilizar
conexión directa o comunicación por radio de 900 MHz de espectro
ensanchado
tDispositivos de supresión de sobretensión específicos para minimizar
el daño causado por rayos y sobretensión. Hay soluciones disponibles
para vías de dos cables, descodificadores, líneas telefónicas y otras vías de
comunicación.
tCamCluster: la opción CamCluster está disponible para los sistemas de radio
Link (450-470MHz) y permite que un radio común pueda compartirse por
medio de los controladores locales.
tEntradas de sensores, caudal y clima: los monitores de caudal,
descodificadores de pulsos, descodificadores de sensores y dispositivos
meteorológicos como los interruptores de lluvia pueden integrarse
fácilmente a los diseños de los sistemas de control en paquete, según el
sistema de control específico.
tVentilación del panel: hay disponibles opciones de ventilación enfriadas por
ventilador con persianas para varios tipos de cajas.
tEntradas y salidas adicionales: los sistemas de control de iluminación y
de entrada y salidas de relé se pueden monitorear, encender y apagar, o
integrar a los diseños de sistemas de control en paquete, según el sistema de
control. Par obtener más información sobre las aplicaciones específicas de las
soluciones ingenieriles para clientes, póngase en contacto con nosotros.
t4FSFRVJFSFMBBOUFOBZFMDBCMFEFMBBOUFOBTFWFOEFOQPSTFQBSBEP
Modelos
tRadios: para las comunicaciones principal y secundaria IQ y para las
comunicaciones secundarias Maxicom y Site Control
*2443"%*03BEJPEF.)[EFFTQFDUSPFOTBODIBEPQFSNJUFMB
DPNVOJDBDJØOFOUSFMBDPNQVUBEPSBDFOUSBMZFMTBUÏMJUFEJSFDUP*2PFM
TBUÏMJUFTFSWJEPS*25BNCJÏOQVFEFVUJMJ[BSTFQBSBMBDPNVOJDBDJØOFOUSF
la computadora central Maxicom y la CCU o el satélite del sitio, entre la
DPNQVUBEPSBDFOUSBMEFDPOUSPMEFMTJUJPZ58*4%*P-%*
t3BEJPTQBSBMBDPNVOJDBDJØOTFDVOEBSJBFOUSF.BYJDPNZ4JUF$POUSPM
3"%5/.*#3BEJP5SBOT/&5QFSNJUFMBDPNVOJDBDJØOTJODBCMFTFOUSF
la CCU y los controladores de satélite
3"%5/58*3BEJP5SBOT/&5QFSNJUFMBDPNVOJDBDJØOTJODBCMFTFOUSF
MB58*ZMPTDPOUSPMBEPSFTEFTBUÏMJUF
t"OUFOBT
"/54)05%#"OUFOB4IPU(MBTTEFE#JODMVZFQMBDBEFUJFSSBZDBCMF
de 3 pies (0.9 m)
"/5#"4&%#"OUFOBPNOJEJSFDDJPOBMDPOCBTFEFE#
"/5%*3&%#"OUFOBEJSFDDJPOBM:BHJE#
t$BCMFTZBDDFTPSJPTQBSBBOUFOB
$"##"4&'$BCMFEFQJFTN
QBSBBOUFOBPNOJEJSFDDJPOBMDPO
CBTFQVOUBTNBDIP5/$ZIFNCSB/
$"##"4&'$BCMFEFQJFTN
QBSBBOUFOBPNOJEJSFDDJPOBMDPO
CBTFQVOUBTNBDIP5/$ZIFNCSB/
$"#%*3&'$BCMFEFQJFTN
QBSBBOUFOBEJSFDDJPOBM:BHJQVOUBT
NBDIP5/$ZIFNCSB/
$"#%*3&'$BCMFEFQJFTN
QBSBBOUFOBEJSFDDJPOBM:BHJQVOUBT
NBDIP5/$ZIFNCSB/
"/5463(&1SPUFDUPSEFTPCSFDBSHBTQBSBBOUFOBDPOQVOUBTEFNBDIP/
a hembra N
"/5$"#"%15"EBQUBEPSQBSBDBCMFEFBOUFOBDPOQVOUBTEFNBDIP5/$
a hembra N
Rain Bird puede trabajar directamente con usted para dar
a su cliente una solución sin problemas en su próximo proyecto de
control centralizado o controlador independiente.
El uso inteligente del agua.™
155
Sistemas de control
centralizado
- Pedestal de acero inoxidable
Sistemas de control centralizado
'SFFEPNQBSBDPOUSPMDFOUSBMJ[BEPTUBDJPOFT
meteorológicas WS-PRO
Freedom para control centralizado
Estaciones meteorológicas WS-PRO
Maxicom,2® o SiteControl
Maxicom2® 84130TPMBNFOUF
4JUF$POUSPM*2™ (WS-PRO2 y
84130-5
Características
t&NQMFBMBJOUFSGB[EFUFMÏGPOPFTUÈOEBSPVOBSFQFUJEPSBEFSBEJPFOMB
computadora
t6OÞOJDPUFMÏGPOPDFMVMBSPVOBÞOJDBSBEJPQVFEFODPOUSPMBSUPEPFMTJTUFNBEF
control centralizado
t$PNVOJDBDJØOEFDPOWFSTBDJØOCJEJSFDDJPOBMEJTQPOJCMFDPOFMTJTUFNBEFSBEJP
t&MTJTUFNBUBNCJÏOTFQVFEFDPOUSPMBSEFTEFUFMÏGPOPTFTUÈOEBSEFMÓOFB
terrestre
t1SPUFHJEPDPODPOUSBTF×BEFTFHVSJEBE
t"SSBORVFZEFUFODJØOEFFTUBDJPOFTIPSBSJPTPTJUJPBQBHBEPQPSMMVWJB
Hardware
t4JTUFNBEFSBEJPSFQFUJEPSBVOJEBEQPSUÈUJMBOUFOBDBCMFT
t4JTUFNBUFMFGØOJDPNØEVMP%5.'TVNJOJTUSPEFFOFSHÓBDBCMF
Características
t4FOTPSFTEFQSFDJTJØODJFOUÓGJDBVCJDBEPTBUSFTNFUSPTTPCSFFMTVFMPQBSBVOB
mayor resistencia al vandalismo
t1PUFOUFNJDSPSSFHJTUSBEPSJOUFSOPQBSBSFDPMFDDJØOSFHJTUSPZBOÈMJTJTEFEBUPT
meteorológicos, comunicación continua con los sensores meteorológicos y
almacenamiento de 30 días de datos
t&TUSVDUVSBEFNFUBMSFTJTUFOUFZMJWJBOBBMBWF[
t.FDBOJTNPTEFQSVFCBEFBVUPEJBHOØTUJDPIVNFEBEJOUFSOBOJWFMEF
voltaje de la pila, puerto de prueba para control del sensor local, y sensores y
componentes internos fáciles de reparar
t&MTPGUXBSFNFUFPSPMØHJDPEFÞMUJNBHFOFSBDJØODBMDVMBWBMPSFTEF
&5BMNBDFOBEBUPTEJBSJPTFIJTUØSJDPTEF&5NPOJUPSFBZNVFTUSBMBT
condiciones meteorológicas actuales y muestra en forma gráfica los
parámetros del clima
Especificaciones eléctricas
Características de SiteControl
t&OUSBEBSFRVFSJEB7"$)[
t4JTUFNBUFMFGØOJDPMÓOFBUFMFGØOJDBEFNBSDBDJØOEFEJDBEB
t-BDPNQBUJCJMJEBEEFMBTFTUBDJPOFTNFUFPSPMØHJDBT84130Z84130-5FT
estándar para SiteControl v3.0 o software posteriores
Requisitos de la licencia
t4JUF$POUSPMQVFEFGVODJPOBSFODPOKVOUPDPOIBTUBFTUBDJPOFT
meteorológicas
t4JTUFNBUFMFGØOJDPOJOHVOP
t4JTUFNBEFSBEJP4FSFRVJFSFMJDFODJBQBSBGSFDVFODJBEFMB'$$
Dimensiones
t4JTUFNBUFMFGØOJDP.ØEVMP%5.'YYNNYNN
x 51 mm)
t-BDPNVOJDBDJØOBVUPNÈUJDBFOUSFFMDPOUSPMBEPSDFOUSBMZMBFTUBDJØO
NFUFPSPMØHJDBSFRVJFSFFMNØEVMPEFTPGUXBSFEF&5BVUPNÈUJDPEF
SiteControl
t&MNØEVMPEFTPGUXBSF4NBSU8FBUIFSEF4JUF$POUSPMQFSNJUFSFBDDJPOFT
automáticas, definidas por el usuario, ante eventos meteorológicos (lluvia,
helada, viento fuerte, etc.)
t4JTUFNBEFSBEJP
- Repetidora: 16.38" x 9.63" x 4.50" (416 mm x 245 mm x 114 mm)
Sistemas de control
centralizado
- Portátil: 3.0" x 8.0" x 1.5" (76 mm x 203 mm x 38 mm)
Modelos
t'3&&%0.'03 (teléfono)
t'3&&3"%/41SBEJPGSFDVFODJBFTQFDJBM
Freedom para sistemas de control
centralizado: radio
WS-PRO2
156
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/centralcontrols
Estaciones meteorológicas WS-PRO, escodificadores de
sensores de pulsos
Características IQ v2.0
t-BTFTUBDJPOFTNFUFPSPMØHJDBT84130P84130-5TPODPNQBUJCMFT
DPO*2WPWFSTJPOFTEFTPGUXBSFQPTUFSJPSFTDPO1BRVFUFEFGVODJPOFT
BWBO[BEBTEF&5*2"&5'1
t-BDPNVOJDBDJØOBVUPNÈUJDBFOUSFMBDFOUSBM*2WZMBFTUBDJØO
meteorológica requiere el Paquete de funciones de comunicación
*2"$0.'1
t3FDVQFSBDJØOEFMPTEBUPTNFUFPSPMØHJDPTQPSIPSBPSFDVQFSBDJØO
personalizada de hasta 5 veces por día
Descodificadores de sensores de pulsos
Para los sistemas de satélite de dos cables Maxicom2® o SiteControl
Características
t4JTUFNBDPNQMFUPEFSFUSPBMJNFOUBDJØO
t&YUJFOEFMBWFSTBUJMJEBEEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEP
t$BCMFTDPOEVDUPSFTDPEJGJDBEPTQPSDPMPSQBSBGBDJMJUBSMBJOTUBMBDJØO
t$ØEJHPTEFEJSFDDJØOQSPHSBNBCMFTQBSBPQFSBDJØOJOEJWJEVBM
t*2QVFEFGVODJPOBSFODPOKVOUPDPOFTUBDJPOFTNFUFPSPMØHJDBT
t&ODBQTVMBEPFODVCJFSUBSFTJTUFOUFBMBIVNFEBEZMPTSBZPT67QBSBVUJMJ[BSFO
exteriores
Características de Maxicom2® (WS-PRO2 solamente)
Funciones
t-BDPNQBUJCJMJEBEEFMBFTUBDJØONFUFPSPMØHJDB84130FTFTUÈOEBSQBSB
Maxicom2® v3.6 o software posteriores
t%FDPEJGJDBEPSEFTFOTPS.POJUPSFBMPTJOUFSSVQUPSFTEFDPOUBDUPFOTFDP
(sensor de humedad, interruptor de presión, sistemas de seguridad, etc.) para
condiciones de abierto o cerrado, e informa al sistema sobre el estado del
interruptor
t$BEBTJUJPQVFEFUFOFSTVQSPQJBFTUBDJØONFUFPSPMØHJDBPQVFEFO
compartirla
t/JWFMFTUÈOEBSEFDPNVOJDBDJØOBVUPNÈUJDB
t1VFEFODPOGJHVSBSTFIBTUBSFDVQFSBDJPOFTBVUPNÈUJDBTEFEBUPT
meteorológicos por día
Sensores de estación meteorológica
t5FNQFSBUVSBEFMBJSF
t3BEJBDJØOTPMBS
t)VNFEBESFMBUJWB
t7FMPDJEBEEFMWJFOUP
t%JSFDDJØOEFMWJFOUP
t1SFDJQJUBDJØO
t%FDPEJGJDBEPSEFQVMTPT-FFMPTQVMTPTEFTEFMPTEJTQPTJUJWPTEFNPOJUPSFP
como sensores de flujo y medidor de lluvia, y envía la información al sistema
para analizarla y realizar la acción correspondiente
Especificaciones eléctricas
t&OUSBEBSFRVFSJEB7"$QSPQPSDJPOBEPTQPSFM
trazado de comunicación de dos cables. No se requiere
suministro de energía por separado)
Dimensiones
t1BSUFTVQFSJPS1⁄4" (8.3 cm) de diámetro; Altura: 8” (20.3 cm);
Parte inferior: 21⁄2" (6.4 cm) de diámetro
Modelos
Compatibilidad del sistema
t%FDPEJGJDBEPSEFTFOTPSFT%&$4&/-3QBSBTFOTPSEFJOUFSSVQUPS
t.BYJDPN2 (WS-PRO2 solamente)
t%FDPEJGJDBEPSEFQVMTPT%&$16--3QBSBTFOTPSEFQVMTPT
t4PGUXBSFEFMTFSWJEPS8FBUIFS3FBDIQBSB&5.BOBHFS
Nota: Todos los decodificadores funcionan solamente con la ruta de comunicación de dos
cables del satélite. No se requieren para la ruta de comunicación MAXILink™ o los satélites
ESP-SITE
Sistemas de control
centralizado
t4JUF$POUSPMSFRVJFSFFMNØEVMPEFTPGUXBSFEF&5BVUPNÈUJDP
t*2WDPO1BRVFUFEFGVODJPOFTBWBO[BEBTEF&5
Modelos
t.PEFMPEFDPOFYJØOEJSFDUB84130%$DPOFYJØOEFDBCMFQBSDPO
controlador central vía módem local
t.PEFMPEFDPOFYJØOUFMFGØOJDB841301)NØEFNEFEJTDBEPUFMFGØOJDP
para comunicaciones telefónicas con controlador central
t.PEFMPEFDPOFYJØO841301)4NPEFMPEFFOFSHÓBTPMBSNØEFNEF
discado telefónico para comunicaciones telefónicas con controlador central, a
energía solar
t.PEFMPEFDPOFYJØOMPDBM84130-54)DPOFYJØOEFDBCMFQBSDPO
controlador central vía módem local
t.PEFMPJOBMÈNCSJDP84130-58-DPOFYJØOJOBMÈNCSJDBDPODPOUSPMBEPS
central vía radio de 916 MHz (sólo disponible en EE. UU. y Canadá)
t.PEFMPJOBMÈNCSJDP84130-58-4DPOFYJØOJOBMÈNCSJDBDPODPOUSPMBEPS
central vía radio de 916 MHz, a energía solar (sólo disponible en EE. UU. y
Canadá)
DEC-SEN-LR
El uso inteligente del agua.™
DEC-PUL-LR
157
Sistemas de control centralizado
Sensores meteorológicos, Accesorios, kits de actualización
Sensor de lluvia
RAINGAUGE
Sensor de viento
ANEMOMETER
Maxicom2® o SiteControl
Maxicom2®4JUF$POUSPM*2™,
&41-9.&&41-9%
Características
t1SFDJTPJOUFSSVQUPSNFEJEPSEF
lluvia que mide las precipitaciones
en incrementos de 1/100 de
pulgada
t&TUSVDUVSBEFNFUBMEFHSBO
resistencia
t.ÏOTVMBEFNPOUBKF
t.BMMBQSPUFDUPSBDPOUSBMBTVDJFEBE
tEJÈNFUSPEFhh
Modelo
t3"*/("6(&
Características
t.FEJDJØOQSFDJTBEFMBWFMPDJEBE
del viento para apagado o
interrupción de programas de
riego por viento excesivo
Tableros de interfaz Maxi
Actualiza cualquier controlador ESP-MC a un controlador de
satélite de sistema de control centralizado Maxicom2® o SiteControl
Características del kit de actualización
t"DUVBMJ[BVODPOUSPMBEPS&41.$NPOUBKFTPCSFQBSFEPQFEFTUBM
BVO
DPOUSPMBEPSEFTBUÏMJUF&414"5P&414*5&
t/PTFSFRVJFSFODBKBTPDBCMFBEPFYUFSOPBEJDJPOBMFT
t*OTUBMBDJØOFOTFQBSBEPSFTTPCSFFMUBCMFSPEFTBMJEBEFMDPOUSPMBEPS
t-PTLJUTEFFOMBDFZTJUJPJODMVZFOUSBOTGPSNBEPSFTEFSFQVFTUP
t.ÏOTVMBEFNPOUBKFEFNFUBMEF
gran resistencia
t&MLJUEFBDUVBMJ[BDJØOJODMVZFDBCMFTEFDPOFYJØOZNBOVBMFT
t3FRVJFSFVOUSBOTNJTPSEFQVMTPT
15P15QBSBVUJMJ[BSDPOFM
sistema Maxicom2
Modelos
t3FRVJFSFVO5SBOTNJTPSEF
QVMTPT15QBSBVUJMJ[BSDPO
4JUF$POUSPM4JTUFNBT*2&41-9.&
&41-9%
t4BUÏMJUFEFTJUJP&414*5&6.BYJDPN2 solamente)
t$PNVOJDBDJØOTFDVOEBSJBEFEPTDBCMFT41.*#
t$PNVOJDBDJØOTFDVOEBSJBEFFOMBDF&41.*#-
Modelo
t"/&.».&530
ESP-MIB-TW
Sistemas de control
centralizado
RAINGAUGE
ANEMOMETER
Protección contra sobretensiones MSP-1
Placa de descarga a tierra MGP-1
Protección contra sobretensiones Maxicom2® o SiteControl para
sistemas descodificadores y sistemas satelitales de dos cables
Protección contra sobretensiones Maxicom2® o SiteControl para
sistemas descodificadores y sistemas satelitales de dos cables
Características
Características
t1SPUFHFMPTDPNQPOFOUFTEFMTJTUFNBEFDPOUSPMDFOUSBMJ[BEPDPOUSB
descargas eléctricas en una ruta de comunicación de dos cables
t1SPQPSDJPOBVOBVCJDBDJØOEFNPOUBKFQBSB.41VPUSPTDBCMFTEF
descarga a tierra directamente en una varilla o tubo de descarga a tierra
t1VFEFJOTUBMBSTFFOVOQFEFTUBMQBSBTBUÏMJUFFOVOB$$6PFOVOBDBKBEF
válvulas junto con MGP-1 (placa de descarga a tierra Maxicom2®)
t*OTUBMBEPTPCSFWBSJMMBPUVCPEFEFTDBSHBBUJFSSB
Modelo
Modelo
t.(1
t.41
MSP-1
MGP-1
158
El uso inteligente del agua.™
Sistemas de control centralizado
www.rainbird.com/gsp
Planes de asistencia global para los sistemas
de control centralizado
Planes de asistencia global para los
sistemas de control centralizado
Paquetes de servicios con posibilidad de ampliación para su
sistema de control centralizado
Q Los miembros del Plan de asistencia global disfrutan de una gran
cantidad de beneficios, tales como descuentos especiales en servicios
de GSP como el Programa de intercambio de tablero, costos de
mantenimiento más bajos para su Sistema de control centralizado de
Rain Bird con nuestra característica de asistencia técnica de hardware
de nivel Platinum, y asistencia técnica remota brindada por expertos
de nuestro grupo de ingenieros GSP para solucionar problemas
técnicos o como asistencia durante el aprendizaje acerca de cómo
maximizar el rendimiento de su sistema
Q Los paquetes de servicios con posibilidad de ampliación le brindan
más opciones al decidir qué plan es mejor en función de sus
necesidades y su presupuesto. Elija entre:
t 1MBUJOVN1MVTB×PT
t1MBUJOVNPB×PT
t (PMEPB×PT
t*2Z&41-9%B×PT
t1MBOFTEFTFSWJDJP.BYJDPN2® y SiteControl
- Plan de asistencia de nivel Gold
t %JBHOØTUJDPZTPMVDJØOEFQSPCMFNBTEFTPGUXBSFZIBSEXBSF
- Asistencia a través de línea telefónica gratuita, de 8 am a 5 pm, horarios
de oficina locales, días hábiles normales
t"TJTUFODJBSFNPUBEFTPGUXBSF
&MTPGUXBSF4ZNBOUFDQD"OZXIFSF¥P(P5P"TTJTU™QFSNJUFBMPT
ingenieros de asistencia acceder en forma remota a su sistema de
control centralizado cuando no es posible resolver los inconvenientes
por teléfono
t%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJPEFUBCMFSP
- Le brinda la oportunidad de obtener un hardware de repuesto
seleccionado a un precio de descuento.
t"DUVBMJ[BDJPOFTNFOPSFTEFTPGUXBSF
- Le proporciona los paquetes de servicio para sistemas de control
centralizado más nuevos para su nivel de servicio sin cargo adicional
- Plan de asistencia de nivel Platinum
5PEBTMBTDBSBDUFSÓTUJDBTEFMQMBOEFTFSWJDJP(PMEBEFNÈTEF
t.FKPSBTEFTPGUXBSFZOVFWPTMBO[BNJFOUPTJNQPSUBOUFT
- Reduce el gasto de la adición de nuevas características, funciones y
actualizaciones de su sistema a versiones más nuevas de su software del
sistema de control centralizado
Planes de asistencia global comercial
Platinum
Platinum
Plus
Programa de reemplazo de hardware
el siguiente día hábil.
t
t
t
Servicio de respaldo de
base de datos con seguridad remota
t
t
t
t
t
t
t
t
t
t
t
t
t
t
t
t
Rain Bird Services Corporation descuentos para la academia de Rain Bird
t
t
t
%FTDVFOUPTFOFMTFSWJDJPEFDPOWFSTJØO
EFCBTFEFEBUPT.%$TPMPDPOFMQMBO
independiente Gold)
t
Características
Gold
Nueva computadora de riego de Rain Bird
Actualizaciones menores gratuitas
de software
Soporte técnico remoto a través de una
línea telefónica gratuita
%JBHOØTUJDPTEFTJTUFNBBEJTUBODJB
%FTDVFOUPTEFM1SPHSBNBEFJOUFSDBNCJP
de tablero
Nuevos lanzamientos importantes
de software
t1SPHSBNBEFQSÏTUBNPEFIBSEXBSF
- Asegura que, en caso de que un componente de hardware del sistema
de control centralizado de Rain Bird cubierto por el plan de asistencia
global deje de funcionar, recibirá uno en préstamo por medio de
VOTFSWJDJPEFFOUSFHBBEPNJDJMJPFMTJHVJFOUFEÓBIÈCJM`TJODBSHPT
BEJDJPOBMFT
- Plan de asistencia de nivel Platinum Plus
5PEBTMBTDBSBDUFSÓTUJDBTEFMQMBOEFTFSWJDJP1MBUJOVNBEFNÈTEF
tr"DUVBMJ[BDJØOEF1$
- Reduce el gasto de actualización de su sistema a la última versión del
sistema computarizado para los sistemas de control centralizado de
Rain Bird
El uso inteligente del agua.™
159
Sistemas de control
centralizado
Características
Sistemas de control centralizado
Planes de asistencia global para los sistemas
de control centralizado
Planes de asistencia global para los sistemas de control
centralizado (cont.)
Opciones de renovación (Planes de suma fija)
t1MBOFTEFTFSWJDJP*2Z&41-9%
Maxicom2® Platinum/ Platinum Plus
Estándar
Estándar
Plus: estándar + computadora
Maxicom2® Gold
Prueba
Estándar
Estándar
Platinum/ Platinum Plus de SiteControl
Estándar
Estándar
Plus: estándar + computadora
Gold de SiteControl
Prueba
Estándar
Estándar
ESP-LXD
Estándar
IQ™
Estándar
Modelo
1SPHSBNBEFQSÏTUBNPEFIBSEXBSF
- Mejoras de software y nuevos lanzamientos importantes
- Actualizaciones menores de software
%JBHOØTUJDPZTPMVDJØOEFQSPCMFNBTEFTPGUXBSFZIBSEXBSFEF(41
t"TJTUFODJBFODBTPEFJODJEFOUFTZPUSPT
- Para los clientes sin GSP, Rain Bird ofrece servicios de asistencia por teléfono
RVFTFDPCSBOQPSJODJEFOUF-MÈNFOPTBM(419135QBSBPCUFOFSNÈT
información
* Nota: El programa de préstamo de hardware requiere que obtenga una inspección
de verificación de la instalación del sistema de control centralizado de Rain Bird. Los
Programas de préstamo Platinum y Platinum Plus se limitan a 5 sitios registrados (en
base a los números seriales CCU, Site-SAT, TWI, LDI o SDI). Se pueden comprar privilegios
de préstamo para sitios adicionales con una tarifa adicional.
Si desea obtener más información acerca de nuestros Planes de
asistencia global sobre control centralizado, contáctese con su
distribuidor de control central de Rain Bird local o comuníquese
con GSP al (866) GSP – XPRT.
N.º de pieza
2 años
3 años
3 años
M95520
M95530
M95540
1 años
2 años
3 años
M95560
M95570
M95580
2 años
3 años
3 años
M97520
M97530
M97540
1 años
2 años
3 años
M97560
M97570
M97580
2 años
M001351
2 años
I95200
Opciones de renovación (Planes de pago)
Modelo
Maxicom Platinum Plus
Suscriptores nuevos o antiguos
Suscriptores actuales
Maxicom Platinum
Suscriptores actuales
SiteControl Platinum Plus
Suscriptores nuevos o antiguos
Sistemas de control
centralizado
Suscriptores actuales
SiteControl Platinum
Suscriptores actuales
160
Suscripción
Pago
Frecuencia
Suscripción
N.º de pieza
Anual
Mensual
Anual
Mensual
3 años
3 años
3 años
3 años
M95541A1
M95542M1
M95543A1
M95544M1
Anual
Mensual
Anual
Mensual
2 años
2 años
3 años
3 años
M95520A1
M95520M1
M95530A1
M95530M1
Anual
Mensual
Anual
Mensual
3 años
3 años
3 años
3 años
M97541A1
M97542M1
M97543A1
M97544M1
Anual
Mensual
Anual
Mensual
2 años
2 años
3 años
3 años
M97520A1
M97520M1
M97530A1
M97530M1
El uso inteligente del agua.™
Impactos
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Cuerpos de difusores
Xerigation® / Riego por goteo
Programadores
Accesorios
Válvulas
“Crecí en Tucson, así que ahorrar agua es mi
pasión. Me interesé en ‘Drip-in-Turf’ después
de ver el éxito que tenía en un edificio
corporativo en Del Mar y en una Universidad
de San Diego. Quise experimentarlo yo misma
y readapté mi propio jardín. Mi jardín tiene
una forma irregular y el riego excesivo era un
gran problema. Aplicar agua directamente
a la zona de la raíz fue una solución muy
eficiente. El jardín se ve fantástico y yo
ahorro agua. Ahora soy una firme creyente y
especifico ‘Drip-in-Turf’ cada vez que puedo.”
Bombas
Xerigation®
Sistemas de control
centralizado
Marian Marum, ASLA, LEED AP
Marum Partnership Landscape Architecture
San Diego, California
El uso inteligente del agua.™
t Utilice el riego por goteo para
eliminar el riego excesivo y el
desperdicio. Elimine también las
antiestéticas manchas de agua en
FEJGJDJPTZDFSDBT:MBFSPTJØOEFM
suelo, el escurrimiento de agua y los
posibles litigios. Mantenga secos los
caminos, las calles y los vehículos.
t Pregúntele a su asesor fiscal acerca de
los gastos de amortización al calcular
el retorno de la inversión en un
sistema de riego por goteo. Ahorre
agua y dinero a la vez.
Recursos
agua directamente a la zona de la raíz. Utilice
líneas de riego por goteo en plantaciones
densas donde es más costeable distribuir bajos
volúmenes de agua de manera uniforme. Utilice
un sistema de dispositivos de emisión precisa
para plantas con mayor espaciamiento donde es
más factible regar cada planta por separado.
Referencia
t Los productos de riego por goteo proporcionan
Drenaje
Sugerencias para ahorrar agua
161
Xerigation®/Riego por goteo
Panorama general del sistema Xerigation
Panorama general de un sistema de Riego por goteo/Xerigation®
Riego localizado con Xerigation®/Riego por goteo
La línea de productos más amplia en la industria
Los productos de Xerigation o riego por goteo de Rain Bird están especialmente
diseñados para sistemas de riego por goteo. Al regar las raíces de las plantas o las
zonas cercanas, los productos Xerigation de
Rain Bird proporcionan un riego localizado con las siguientes ventajas:
Con más de 150 productos, Rain Bird posee los productos necesarios para su
aplicación. Los sistemas se pueden diseñar para cumplir con todos los requisitos del
sitio y ofrecer muchos avances exclusivos de Rain Bird que incluyen:
t$POTFSWBDJØOEFMBHVB
t.BZPSFGJDBDJBSJFHPMPDBMJ[BEPFODBEBQMBOUB
t%JTF×PGMFYJCMFFTUSVDUVSBTJNQMFZGÈDJMNFOUFFYQBOTJCMF
t1MBOUBTNÈTTBMVEBCMFT
t.FOPTSJFTHPTTFFWJUBOFMSPDJBEPFYDFTJWPZFMFTDVSSJNJFOUP
t.FOPSÓOEJDFEFDSFDJNJFOUPEFNBMF[BT
t"IPSSPFODPTUPT
t4JTUFNBEFSJFHPQPSHPUFPGMFYJCMFTFSJF9FSJ'MFYDPOQPMÓNFSPTBWBO[BEPT
que brindan resistencia al pliegue y memoria de rollo reducida para una
instalación más sencilla.
t;POBTEFDPOUSPMDPNQBDUPDPOGJMUSPZSFHVMBEPSEFQSFTJØODPNCJOBEPTQBSB
reducir la cantidad de piezas y los problemas de fugas potenciales, e insertar
más zonas de control en una caja de válvulas.
t#PRVJMMBTBTQFSTPSBTEFQSFDJTJØO42EFCBKPWPMVNFORVFPGSFDFOVOQBUSØO
de riego cuadrado y se ajustan a distancias de alcance de 2.5’ ó 4’ (0.76 ó 1.2 m).
t&NJTPSFTEFGVFOUFEFQVOUBRVFCSJOEBODPNQFOTBDJØOEFQSFTJØODPOVOB
amplia selección de índices de caudal y tres opciones de entrada (con conector
de punta, roscada 1032 y rosca hembra para tubería de 1/2" [1.3 cm]).
t-ÓOFBEFSJFHPQPSHPUFPTVCUFSSÈOFPTFSJF9'4DPOUFDOPMPHÓB$PQQFS
Shield™ para usar en aplicaciones subterráneas debajo de césped o zonas
de arbustos y cubiertas vegetales. La tecnología Copper Shield™ protege al
emisor con eficacia frente a la invasión de raíces.
Xerigation®
NUEVO
37
,JUTEFDPOUSPMEF[POBQÈH
1a. Válvula para caudal bajo (pág. 198)
C'JMUSPSFHVMBEPSEFQSFTJØOQÈH
"EBQUBEPSIFNCSB&BTZ'JUQÈH
"DPQMF&BTZ'JUQÈH
4. Herramienta Xeriman (pág. 189)
5VCFSÓBEFSBZBTOFHSBT9FSJ#MBDL4USJQF
(pág. 185)
162
6. Emisor Xeri-Bug (pág. 164)
7. Estaca para tubería de 1/4” (6.3 mm) (pág. 176)
5VCFSÓBEFEJTUSJCVDJØO92EFhhNN
(pág. 184)
$POFDUPSEFQVOUBFO5EFNN
QÈH
10. Estaca para sujetar (pág. 188)
$PEP&BTZ'JUQÈH
12. Cubierta aspersora contra insectos (pág. 176)
13. Cubierta aspersora para emisores con compensación
de presión (pág. 176)
14. Módulo de compensación de presión - 1032 (pág. 168)
&OTBNCMFEFUVCFSÓBEFFMFWBDJØOEF1PMZ'MFYQÈH
&NJTPS9FSJ#VH3PTDBIFNCSBQBSBUVCFSÓBEF›w
(1.3 cm) (pág. 164)
$POFDUPSBVUPQFSGPSBOUFEFžwNN
QÈH
#PRVJMMBDVBESBEBTFSJF42BOUFSJPSNFOUFEFOPNJOBEB
XPCN) (pág. 170)
19. Xeri-Pop (pág. 172)
9FSJ#VCCMFS41:,QÈH
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Panorama general del sistema Xerigation
Xerigation®
NUEVO
NUEVO
,JUEFWÈMWVMBEFBMJWJPEFBJSF"37QÈH
22. Caja de válvulas para emisor SEB-7X (pág. 188)
-ÓOFBEFSJFHPQPSHPUFP9'%QÈH
24. Cortador de tubería (pág. 188)
25. Xeri-Bird 8 (pág. 167)
26. Regulador de presión en línea (pág. 204)
27. Maneral de 6 salidas (pág. 166)
"EBQUBEPSEFCPRVJMMBTFSJF42QÈH
El uso inteligente del agua.™
5&BTZ'JUQÈH
5BQØOEFESFOBKF&BTZ'JUQÈH
31. Línea de riego por goteo violeta (pág. 178)
32. Emisor Xeri-Bug - 1032 ((pág. 164)
5VCFSÓBEFEJTUSJCVDJØO95QÈH
34. Conector de punta de 1/4" (6.3 mm) (pág. 188)
35. Xeri-Bug de salidas múltiples (pág. 166)
4JTUFNBEFSJFHPQBJTBKÓTUJDPQPSHPUFPWJPMFUBEFž
(6.3 mm) (pág. 187)
-ÓOFBEFSJFHPQPSHPUFPTVCUFSSÈOFPTFSJF9'4DPO
tecnología Copper Shield (pág. 180)
,JUEFSFFNQMB[PEFSPDJBEPBSJFHP3&530
(pág. 189)
39. Accesorio de transferencia gris con conectores en
QVOUBYSPTDBIFNCSBQBSBUVCFSÓBEF›wDN
NUEVO
95QÈH
163
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Entrada
Salida
Emisores Xeri-Bug™
Emisores de caudal bajo de fuente de punta para regar la zona de
las raíces de plantas, árboles y plantas de macetas
Q Los únicos emisores con conectores autoperforantes que permiten una
instalación más fácil con la herramienta Xeriman™
Q La más amplia selección de emisores con compensación de presión, con
3 índices de caudal y 3 opciones de entrada
XB-05PC, XB-10PC, XB-20PC
Q Emisores más compactos y ocultos
Características
NUEVO
Codificación por
color Ahora en
Entrada
Entrada
Salida
XB-05PC-1032, XB-10PC-1032, XB-20PC-1032
Los modelos roscados 1032 están
específicamente diseñados para usar con
UVCFSÓBTEFFMFWBDJØOEF1PMZ'MFYBEBQUBEPSFT
de rosca 1032 (1032-A) o el adaptador
Xeri-Bubbler 1800 (XBA-1800)
Salida
t¶OEJDFTEFDBVEBMEFZHQIZMI
- El diseño del compensador de presión proporciona un caudal uniforme a
través de un amplio rango de presión (15 a 50 psi; 1 a 3.5 bares)
t%JTQPOJCMFDPOFOUSBEBTEJGFSFOUFTNPEFMPTZ
- Conector autoperforante para una rápida inserción, de un solo paso, en la
tubería de riego por goteo de 1/2" (1.3 cm) ó 3/4" (1.9 cm)
- Entrada roscada 10-32 que se enrosca fácilmente a una tubería de elevación
EF1PMZ'MFYDPOTVMUFMBQÈH
BEBQUBEPSEFSPTDBQÈH
P
adaptador Xeri-Bubbler 1800 (pág. 177)
- Entrada de rosca hembra para tubería de 1/2” (1.3 cm) que se enrosca
fácilmente a una tubería de elevación de PVC de 1/2” (1.3 cm) (modelos de
1 y 2 gph [3.8 y 7.6 l/h])
t&MDPOFDUPSEFQVOUBEFMBTBMJEBTVKFUBEFGPSNBTFHVSBMBUVCFSÓBEF
EJTUSJCVDJØO92
EF1/4" (6.3 mm)
t&MEJTF×PIBDFRVFMBJOTUBMBDJØOZFMNBOUFOJNJFOUPTFBOGÈDJMFT
- La acción de limpieza automática reduce las obstrucciones
%JTF×PGVFSUFIFDIPDPONBUFSJBMFTBMUBNFOUFJOFSUFTSFTJTUFOUFT
a los productos químicos
- La estructura de plástico duradero es resistente a los rayos ultravioleta
t$PEJGJDBEPTQPSDPMPSQBSBJEFOUJGJDBSFMÓOEJDFEFDBVEBM
Rango operativo
Rosca hembra para tubería
de 1⁄2" (14 cm) Entrada
t$BVEBMEFBHQIEFBMI
t1SFTJØOEFBQTJEFBCBSFT
t'JMUSBDJØOSFRVFSJEBNBMMBØØNJDSPOFT
Modelos: Conectores de punta con entrada x salida
XBT-10, XBT-20
Xerigation®
t9#1$B[VMHQIMI
t9#1$OFHSPHQIMI
t9#1$SPKPHQIMI
Modelos: entrada de rosca 10-32 x salida del conector de punta
Cómo especificar
XB - T - 05 - PC - 1032
Característica
entrada
roscada 1032
Compensación de presión
Caudal
HQIMI
HQIMI
HQIMI
t9#1$B[VMHQIMI
t9#1$OFHSPHQIMI
t9#1$SPKPHQIMI
Modelos: Entrada de rosca hembra para tubería de 1/2" (1.3 cm)
t9#5OFHSPHQIMI
t9#5SPKPHQIMI
Característica
Entrada de rosca hembra para
1
Modelo tubería de ⁄2" (14 cm)
Xeri-Bug
Use un emisor roscado 1032 en una tubería de elevación de Polyflex cortado justo sobre el nivel del terreno para áreas de mucho tráfico. Esta
configuración asegura una alineación adecuada del emisor y sus plantas estarán saludables, a pesar del tránsito a pie.
164
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
XB-05PC
XB-10PC
XB-20PC
9#1$
9#1$
9#1$
9#51$
9#51$
Tipo de entrada/
Color
Nominal Filtración
Caudal
requerido
gph
malla
Conector de punta/azul
Conector de punta/negro
Conector de punta/rojo
5B[VM
5OFHSP
5SPKP
'151⁄2" (14 cm)/negro
'151⁄2" (14 cm)/negro
0.5
1.0
2.0
1.0
2.0
200
150
150
150
150
4*45.²53*$0
2.5
10.0
2.0
XB-20
9#5
1.5
1.0
XB-10
9#5
XB-05
0.5
0.0
0
10
20 30 40
Presión (psi)
50
60
Nominal
Caudal
l/h
Filtración
requerido
micrones
XB-05PC
XB-10PC
XB-20PC
9#1$
9#1$
9#1$
9#51$
9#51$
Conector de punta/azul
Conector de punta/negro
Conector de punta/rojo
5B[VM
5OFHSP
5SPKP
'151⁄2" (14 cm)/negro
'151⁄2" (14 cm)/negro
1.89
3.79
7.57
3.79
7.57
75
100
100
100
100
6.0
4.0
XB-20
9#5
XB-10
9#5
XB-05
2.0
0.0
0 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0
Presión (bares)
Opción de instalación 1
66
Tipo de entrada/
Color
8.0
(Para los números de referencia a continuación, consulte la
página 162 de información general del sistema Xerigation.)
Modelos y especificaciones de los emisores Xeri-Bug SIST. MÉTRICO
Modelo
Índice de caudal (l/h)
Modelo
Datos de rendimiento de los emisores Xeri-Bug
Índice de caudal (gph)
Modelos y especificaciones de los emisores Xeri-Bug
12
Con una herramienta Xeriman, inserte un
emisor directamente en una tubería de
goteo de ½” o entre los emisores del
sistema de goteo, según corresponda.
Opción de instalación 2
8
Para una distribución de agua más
precisa, utilice una tubería de
distribución de ¼”, una estaca de tubería
de ¼” y una cubierta contra insectos.
7
6
66
Opción de instalación 3
Para una distribución de agua precisa, se
puede perforar un conector de punta en la
tubería de distribución. Después, el emisor se
coloca en el extremo de la tubería de
distribución de ¼”. NOTA: si se sale el emisor,
se producirá un caudal irregular.
7
88
9
25
25
12
12
77
26
26
88
35
El Xeri-Bird 8 proporciona una ubicación
centralizada para ocho emisores como
máximo. Se puede utilizar una mezcla de
emisores Xeri-Bug y/o PC para proporcionar
los índices de caudal necesarios para
distintos materiales vegetales. Los
tentáculos de la tubería de distribución de
¼”, las estacas de la tubería de ¼” y las
cubiertas contra insectos permiten una
distribución de agua más precisa.
Opción de instalación 5
8
8
66
27
27
77
Emisor Xeri-Bug™, estaca TS025-1/4” (6.3 mm) y cubierta aspersora
contra insectos DBC025
El uso inteligente del agua.™
El maneral de 6 salidas proporciona una
conexión de distribución de agua
centralizada para seis dispositivos de
emisión como máximo. Conecte la tubería
de distribución de ¼” a una de las salidas.
Utilice la estaca de la tubería de ¼” para
garantizar una distribución de agua
precisa. El emisor se coloca en el extremo
de la tubería de distribución de 1/4” para
regular el caudal de agua. NOTA: si se sale
el emisor, se producirá un caudal irregular.
165
Xerigation®
Opción de instalación 4
5
17
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Xeri-Bug™de varias salidas
Características
t&MEJTF×PEFMDPNQFOTBEPSEFQSFTJØOQSPQPSDJPOBVODBVEBMVOJGPSNF
a través de un amplio rango de presión (15 a 50 psi; 1 a 3.5 bares)
t&NJTPSEFTFJTTBMJEBTQSPQPSDJPOBEPDPOVOBTBMJEBBCJFSUB4JNQMFNFOUF
recorte las puntas de las salidas para abrirlas usando tijeras o un cortador,
a fin de habilitar orificios operativos adicionales
t-BTTBMJEBTDPODPOFDUPSFTEFQVOUBSFUJFOFOMBUVCFSÓBEFEJTUSJCVDJØO92
EF
1
/4" (6.3 mm)
t-BBDDJØOEFMJNQJF[BBVUPNÈUJDBSFEVDFMBTPCTUSVDDJPOFT
t$BSDBTBEFQMÈTUJDPEVSBEFSPZSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUBDPEJGJDBEBQPS
color
XB-05-6, XB-10-6, XB-20-6
Rango operativo
t$BVEBMØHQIØMI
t1SFTJØOEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
Modelos: Entrada de rosca hembra para tubería de 1/2" (1.3 cm)
t9#5B[VMHQIMI
t9#5OFHSPHQIMI
t9#5SPKPHQIMI
Conector de 6 salidas - EMT-6XERI
Características
Xerigation®
t-BFOUSBEBEFSPTDBIFNCSBQBSBUVCFSÓBEF1/2” (1.3 cm) se enrosca en la
tubería de elevación de 1/2” (1.3 cm) y proporciona un maneral con seis
salidas de conectores de punta de caudal libre de 1/4” (6.3 mm)
t$BEBTBMJEBEFDPOFDUPSEFQVOUBFTUÈTFMMBEBDPOVOBDVCJFSUBEFQMÈTUJDP
duradera
t-BTDVCJFSUBTEFQMÈTUJDPTFRVJUBOGÈDJMNFOUFZQFSNJUFODSFBSVOÈSFBEF
riego por goteo que puede personalizarse con hasta seis dispositivos de
emisión diferentes
t$POFDUFVOBUVCFSÓBEFEJTUSJCVDJØO92
EF1⁄4" en cada salida para usar con:
Xeri-Bugs, módulos compensadores de presión, Xeri-Sprays y Xeri-Bubblers
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Modelo
t&.59&3*
SIST. MÉTRICO
2.5
2
1.5
XB-10-6, XBT -10-6
1
XB-05-6, XBT -05-6
0.5
0
0
10
20
30
Pressure (psi)
40
50
Conector
autoperforante de
1
⁄4" (6.3 mm)
Características
t6TBEPQBSBDPOFDUBSMBUVCFSÓBEF
distribución de 1/4” (6.3 mm) a una
tubería de distribución de 1/2” ó 3/4”
(1.3 ó 1.9 cm)
t&MDPOFDUPSBVUPQFSGPSBOUFTF
inserta fácilmente en la tubería
de distribución de 1/2” (1.3 cm) ó
3
/4” (1.9 cm) con una herramienta
Xeriman™9.5PPM
t&MDPOFDUPSEFQVOUBEFMBTBMJEB
es compatible con la tubería de
EJTUSJCVDJØO92
EF1/4" (6.3 mm) El
conector de punta gris de la salida
indica que la unidad tiene caudal
sin restricciones
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Modelo
EMT-6XERI
t41#
SPB-025
166
9.46
XB-20-6, XBT -20-6
Flow Rate (l/h)
t9#B[VMHQIMI
t9#OFHSPHQIMI
t9#SPKPHQIMI
Rendimiento del emisor Xeri-Bug de varias salidas
Flow Rate (gph)
Modelos: Conectores de punta con entrada x salida
XBT-05-6, XBT-10-6, XBT-20-6
XB-20-6, XBT -20-6
7.57
5.68
XB-10-6, XBT -10-6
3.79
XB-05-6, XBT -05-6
1.89
0
0
0.7
1.4
2.1
Pressure (bar)
2.8
3.5
Accesorio de
NUEVO
transferencia
gris con conectores
en punta x rosca
hembra para tubería
de ½” (1.27 cm)
Características
t4BMJEBHSJTQBSBEFTJHOBSFMGMVKP
abierto
t-BFOUSBEBEFSPTDBIFNCSBQBSB
UVCFSÓBEF›TFQVFEFDPOFDUBS
fácilmente a un elevador Schedule
80 o a la parte superior de un Retro
1800.
Salida con conectores de punta para
que la tubería de distribución de
žPMBUVCFSÓBEFHPUFPEFžwTF
puedan conectar de forma segura.
Rango operativo
t1SFTJØOEFBQTJ
(de 0 a 3.5 bares)
Modelo
Entrada
t95
Salida
XT025
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
Dispositivo de emisión de varias salidas
Xeri-Bird™ 8
Desenrosque para acceder al
filtro de malla 200 (75 micrones)
El dispositivo de varias salidas más flexible y con más funciones
en el mercado, ideal para proyectos nuevos y aplicaciones de
retroadaptación
Desenrosque para acceder a los
orificios de caudal independiente
Q El único dispositivo de varias salidas en el mercado con 8 orificios
configurables y 10 opciones de caudal para cada orificio a fin de lograr la
mayor flexibilidad
La tuerca de la base de unión
permite quitarla de la tubería de
elevación sin enredar las tuberías
de 14SDSq (6.3 mm)
Q -PTNPEFMPT9#%Z9#%DPOUJFOFOVOGJMUSPJODPSQPSBEPDBEBVOP
Hace que la retroadaptación sea fácil cuando se instala con el regulador de
presión opcional en el vástago (PRS-050, pág. 204)
Q 'ÈDJMEFNBOUFOFSQPSRVFFMDVFSQPTFQVFEFRVJUBSGÈDJMNFOUFEFMBUVCFSÓB
Regulador de presión PRS-05030
opcional en el vástago
de elevación
Características
t4FFOSPTDBFODVBMRVJFSUVCFSÓBEFFMFWBDJØOEF1/2” (1.3 cm) y proporciona
agua a múltiples ubicaciones para obtener una mayor flexibilidad del sistema
t$BEBPSJGJDJPBENJUFVOFNJTPS9FSJ#VH™ o un módulo compensador de
presión para caudales independientes desde 0.5 hasta 24 gph (1.89 a 90.84
l/h), o bien puede utilizar un conector autoperforante (SPB-025) para caudal no
restringido
t-PTNPEFMPT9#%Z9#%DVFOUBODBEBVOPDPOVOGJMUSPEFNBMMBJOUFHSBM
200 (75 micrones) que es fácil de mantener desde la parte superior
t0DIPTBMJEBTDPODPOFDUPSFTEFQVOUBEFBHBSSFTFHVSPZNPOUBEPTFOMB
QBSUFJOGFSJPSSFUJFOFOMBUVCFSÓBEFEJTUSJCVDJØO92
EF
1
/4" (6.3 mm) de forma segura
t-BUVFSDBÞOJDBEFMBCBTFEFVOJØOQFSNJUFRVJUBSFMDVFSQPEFM9FSJ#JSEEF
la tubería de elevación para una instalación y un mantenimiento sin problemas
t-PTFNJTPSFTTFEFCFOJOTUBMBSEFOUSPEFM9FSJ#JSEQBSBQSFWFOJSMB
contrapresión excesiva.
XBD-80
Rango operativo
Modelos
t9#%VOJEBE9FSJ#JSEJODMVZFUBQPOFTFYUSBÓCMFTQBSBMPTPSJGJDJPTZVO
filtro)
t9#%VOJEBE9FSJ#JSEJODMVZFPDIPFNJTPSFT9FSJ#VHEFHQI<MI>
instalados en fábrica y un filtro)
XBD-80 con 8 Xeri-Bugs y un
regulador en el vástago que se
muestra instalado (Xeri-Bugs y el
regulador de presión en el vástago
se solicitan por separado)
Xerigation®
t$BVEBMEFBHQIEFBMI
QPSTBMJEB
t1SFTJØOEFBQTJEFBCBSFT
Piezas de repuesto:
t9#%4$3/NBMMBEFSFQVFTUPZEPTKVOUBTUØSJDBT
Consejo útil: siempre instale los emisores
con el extremo en punta (conector de
punta de entrada) o el extremo roscado
hacia arriba, como se muestra
Use una mezcla de emisores Xeri-Bug y el módulo de compensación de presión en un Xeri-Bird 8 para satisfacer las necesidades de riego de los
diferentes materiales de las plantas. Al mezclar emisores, asegúrese de ver el tiempo de riego del sistema para evitar el riego excesivo o escaso.
El uso inteligente del agua.™
167
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Módulos compensadores de presión
Emisores de punta y caudal medio para regar arbustos grandes y
árboles
Q Los únicos emisores con conectores autoperforantes que permiten una
PC-05, PC-07, PC-10
instalación más fácil con la herramienta Xeriman™
Q La más amplia selección de emisores con compensación de presión, con 6
índices de caudal y 3 opciones de entrada
Entrada
Salida
PC-12, PC-18, PC-24
Q Emisores más compactos y ocultos
Características
t¶OEJDFTEFDBVEBMEFBHQIEFBMI
t&MEJTF×PEFMDPNQFOTBEPSEFQSFTJØOQSPQPSDJPOBVODBVEBMVOJGPSNFB
través de un amplio rango de presión (15 a 50 psi; 0.7 a 3.5 bares)
t%JTQPOJCMFDPOFOUSBEBTEJGFSFOUFT
- Conectores autoperforantes para una rápida inserción de un solo paso en la
UVCFSÓBEFSJFHPQPSHPUFPEF›DN
Ø£DN
- Entrada roscada 10-32 que se enrosca fácilmente a una tubería de
FMFWBDJØOEF1PMZ'MFYDPOTVMUFMBQÈH
BEBQUBEPSEFSPTDBQÈH
177) o adaptador Xeri-Bubbler 1800 (pág. 177)
&OUSBEBEFSPTDBIFNCSBQBSBUVCFSÓBEF›DN
RVFTFFOSPTDB
GÈDJMNFOUFBVOBUVCFSÓBEFFMFWBDJØOEF17$EF›DN
PC-05-1032, PC-07-1032, PC-10-1032
Los modelos roscados 1032 están específicamente diseñados para usar con
UVCFSÓBTEFFMFWBDJØOEF1PMZ'MFYBEBQUBEPSFTEFSPTDB"
PFM
adaptador Xeri-Bubbler 1800 (XBA-1800)
t%JTF×PGVFSUFMBFTUSVDUVSBEFQMÈTUJDPEVSBEFSPFTSFTJTUFOUFBMPTSBZPT
ultravioleta y está codificada por color para identificar el índice de caudal
Rango Operativo*
t$BVEBMEFBHQIEFBMI
t1SFTJØOEFBQTJEFBCBSFT
t'JMUSBDJØOSFRVFSJEBNBMMBNJDSPOFT
NUEVO
* Nota: use una cubierta aspersora con compensación de presión para eliminar la
aspersión del agua al usar un módulo compensador de presión estacado en el extremo
EFMBUVCFSÓBEFEJTUSJCVDJØO15
EFNN
PFOVOBUVCFSÓBEFFMFWBDJØOEF
1PMZ'MFY1'3'3"
Modelos: Conectores de punta con entrada x salida
Xerigation®
PCT-05, PCT-07, PCT-10
Entrada de rosca hembra para tubería de 1⁄2" (1.3 cm)
que se enrosca fácilmente a una tubería de elevación
de PVC de 1⁄2" (1.3 cm)
t1$NBSSØODMBSPHQIMI
t1$WJPMFUBHQIMI
t1$WFSEFHQIMI
t1$NBSSØOPTDVSPHQIMI
t1$CMBODPHQIMI
t1$OBSBOKBHQIMI
Modelos: entrada de rosca 10-32 x salida del conector de punta
t1$NBSSØODMBSPHQIMI
t1$WJPMFUBHQIMI
t1$WFSEFHQIMI
Modelos: Entrada de rosca hembra para tubería de 1/2" (1.3 cm)
Cómo especificar
t1$5NBSSØODMBSPHQIMI
t1$5WJPMFUBHQIMI
t1$5WFSEFHQIMI
PC - T - 05 - 1032
Característica
Entrada roscada 1032
Caudal
5 gph (18.93 l/h)
Entrada de rosca hembra para
tubería de 1/2" (1.3 cm)
Modelo
PC: Compensación de presión
168
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
Modulos compensadores de presión
Modelos de módulos compensadores de presión
Modelos de módulos compensadores de presión SISTEMA MÉTRICO
Modelo
Tipo de entrada/
Salida/Color
Nominal Filtración
Caudal
requerido
gph
malla
Modelo
Tipo de entrada/
Salida/Color
PC-05
PC-07
PC-10
PC-12
PC-18
PC-24
1$
1$
1$
1$5
1$5
1$5
Conector de punta/marrón claro
Conector de punta/violeta
Conector de punta/verde
Conector de punta/marrón oscuro
Conector de punta/blanco
Conector de punta/naranja
5NBSSØODMBSP
5WJPMFUB
5WFSEF
/15NBSSØODMBSP
/15WJPMFUB
/15WFSEF
5
7
10
12
18
24
PC-05
PC-07
PC-10
PC-12
PC-18
PC-24
1$
1$
1$
1$5
1$5
1$5
Conector de punta/marrón claro
Conector de punta/violeta
Conector de punta/verde
Conector de punta/marrón oscuro
Conector de punta/blanco
Conector de punta/naranja
5NBSSØODMBSP
5WJPMFUB
5WFSEF
/15NBSSØODMBSP
/15WJPMFUB
/15WFSEF
100
100
100
100
100
100
Nominal
Caudal
l/h
18.93
26.50
37.85
45.42
68.13
90.84
Filtración
requerido
micrones
150
150
150
150
150
150
Rendimiento de los módulos y burbujeadores compensadores de presión
28
24
20
16
12
8
4
0
105.98
90.84
75.70
60.56
45.42
30.28
15.14
0
Rango de flujo (l/h)
Rango de flujo (gph)
SIST. MÉTRICO
PC-24
PC-18
PC-12
PC-10 & PCT-10
PC-07 & PCT-07
0 10
20
30
40
PC-05 & PCT-05
50
60
Presión (psi)
PC-24
PC-18
PC-12
PC-10 & PCT-10
PC-07 & PCT-07
0
1.0
2.0
2.5
PC-05 & PCT-05
3.5
4.0
Presión (bar)
Xerigation®
Tapas difusoras con compensación de presión
Difusor con compensación
de presión
Las cubiertas aspersoras de compensación de presión están diseñadas para
encajar en la salida de los módulos de riego por goteo con compensación
de presión
Modelos: (para ver información más detallada, consulte la página 175)
t"TQFSTPSDPODPNQFOTBDJØOEFQSFTJØOOFHSP
Módulo compensador de presión
con cubierta aspersora con
compensación de presión en la
tubería de elevación de PolyFlex
(las tuberías de elevación de
PolyFlex están disponibles en los
modelos de 12" y 24")
t1$%*''11-WJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF
El uso inteligente del agua.™
169
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Boquillas de patrón cuadrado, serie SQ
La solución de rociado de bajo volumen más precisa y eficiente
para el riego de áreas pequeñas con plantas poco espaciadas
Q El patrón de rociado cuadrado y la compensación de presión ofrecen
mayor eficiencia y control, y así se reducen el rociado excesivo y las
probabilidades de daño a la propiedad y situaciones riesgosas
Q Las exclusivas capacidades de extremo a extremo para aplicaciones sin
césped reducen la cantidad de boquillas necesarias, lo cual disminuye los
costos y reduce el tiempo de instalación drásticamente
Q %JTF×PFJOTUBMBDJØOTJNQMJGJDBEPTDPOMBGMFYJCJMJEBEEFMBTBQMJDBDJPOFT
una boquilla alcanza 2.5' ó 4' (0.8 m ó 1.2 m) y se puede utilizar en diversos
cuerpos de aspersores y tuberías de elevación
Boquilla SQ instalada en la tubería
de elevación de PolyFlex con
adaptador de boquilla
Q Cumple con los requisitos del sistema de microrriego por menos del índice
de caudal de 26 gph (98.4 l/h) a 30 psi (2 bares)
Características
t&MQBUSØOEFSPDJBEPDVBESBEPDPODPCFSUVSBEFFYUSFNPBFYUSFNPMF
permite hacer diseños e instalaciones fácilmente en espacios pequeños
t&MEJTF×PEFDPNQFOTBDJØOEFQSFTJØOCSJOEBVODBVEBMVOJGPSNFTPCSFFM
rango de presión
t%JTQPOJCMFFONPEFMPTQBUSPOFTEFVODVBSUPNFEJPZDPNQMFUPDPO
índice de caudal proporcional a la superficie a regar
- Rendimiento virtual que no produce neblina desde 20 psi (1.4 bares) a 50
psi (3.4 bares)
%PTEJTUBODJBTEFBMDBODFFODBEBCPRVJMMB$POVOTJNQMFDMJDTFBKVTUBB
2.5’ o 4’ (0.8 m ó 1.2 m)
Boquillas SQ con mallas
- Se envían con filtro de malla azul (0.02” x 0.02” [0.5 mm x 0.5 mm]) para
mantener una distancia de caudal precisa y evitar obstrucciones
Una boquilla... Dos alcances
Con sólo girar la boquilla hacia el siguiente
QVOUPEFCMPRVFPQSFGJKBEPMBCPRVJMMB42
de Rain Bird se ajusta de un alcance de 2.5
pies (0.8 m) a un alcance de 4 pies (1.2 m). Es
como tener dos boquillas en una.
t$PNQBUJCMFDPOUPEBTMBTUVCFSÓBTEFFMFWBDJØO4QSBZT9FSJ1PQTFM
OVFWPBEBQUBEPSEFUVCFSÓBEFFMFWBDJØOEF1PMZ'MFY6/*4QSBZZUVCFSÓBT
de elevación SCH 80
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t¶OEJDFTEFDBVEBMZHQIZMI
t'JMUSBDJØOSFRVFSJEBNBMMB
Se puede usar con…
Xerigation®
-B#PRVJMMB42FTVOBTPMVDJØOJEFBMQBSBEJWFSTBTÈSFBTEJGÓDJMFTEFEJTF×BS
gracias a su compatibilidad con los productos de riego populares.
Modelos
t42253#PRVJMMB42QBUSØOEFVODVBSUP
t42)-'#PRVJMMB42QBUSØOEFNFEJP
t42'6-#PRVJMMB42QBUSØODPNQMFUP
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSÓBEFFMFWBDJØOEFw
DN
EF1PMZ'MFY
t42"%1"EBQUBEPSEFCPRVJMMB42DPOUVCFSÓBEFFMFWBDJØOEFw
DN
EF1PMZ'MFY
t42"%1TØMPFMBEBQUBEPS42EFUVCFSÓBEFFMFWBDJØOEF1PMZ'MFY
* Nota: se necesita un adaptador para arbustos de plástico PA-8S (consulte la página 18) cuando se
utiliza una boquilla serie SQ montada en una tubería de elevación SCH 80.
Cabezales
aspersores
p
serie
se
ser
ie 1800®
ie
Xeri-Pop
Cuerpos de
difusores
Polyflex Programación
Tuberías de 80 Tuberías
elevación de elevación
-BTCPRVJMMBT4FSJF42CSJOEBOVOQSFDJTPQBUSØOEFSJFHPDVBESBEPZVOBDPMPDBDJØOFGJDB[EFMBHVBDPODPNQFOTBDJØOEFQSFTJØOMPRVFUJFOFDPNP
resultado hasta un 65% en ahorro de agua. Son ideales para canteros estrechos, islas de estacionamientos y divisores de caminos, carreteras y calles.
170
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
Rendimiento de la boquilla SQ
Rendimiento de la boquilla SQ
Alcance de 2.5 pies (0.76 m) a una altura de 6" (15.2 cm) sobre el terreno
Presión
psi
Q
20
30
40
50
20
30
40
50
20
30
40
50
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
2.5
2.5
3.0
3.0
H
F
Alcance de 0.8 m a una altura de 0.15 m sobre el nivel del terreno
Caudal
gph
Caudal
gpm
Índice de precip.
sin superposición
pulg./h
6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3
0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46
1.64
1.90
1.32
1.32
1.31
1.57
1.22
1.22
1.28
1.55
1.22
1.22
Q
H
F
Alcance de 2.5 pies (121.92 cm) a una altura de 6" (15.2 cm) sobre el terreno
Boquilla
Presión
psi
Q
20
30
40
50
20
30
40
50
20
30
40
50
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
4.0
4.0
4.5
4.5
H
F
Alcance
Presión
bares
Radio
m.
Caudal
l/h
Caudal
l/m
Índice de precip.
sin superposición
mm/h
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
0.8
0.8
0.9
0.9
24
28
28
28
39
46
52
52
76
92
103
103
0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72
42
48
34
34
33
40
31
31
33
39
31
31
Rendimiento de la boquilla SQ
Rendimiento de la boquilla SQ
Alcance
Radio
pies
Boquilla
Caudal
gph
Caudal
gpm
Índice de precip.
sin superposición
pulg./h
6.4
7.4
7.4
7.4
10.2
12.2
13.7
13.7
20.0
24.2
27.3
27.3
0.11
0.12
0.12
0.12
0.17
0.20
0.23
0.23
0.33
0.40
0.46
0.46
0.64
0.74
0.59
0.59
0.51
0.61
0.54
0.54
0.50
0.61
0.54
0.54
SIST. MÉTRICO
Alcance de 1.2 m a una altura de 0.15 m sobre el nivel del terreno
Boquilla
Q
H
F
Alcance
Presión
bares
Radio
m.
Caudal
l/h
Caudal
l/m
Índice de precip.
sin superposición
mm/h
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.4
2.1
2.8
3.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
1.2
1.2
1.4
1.4
24
28
28
28
39
46
52
52
76
92
103
103
0.40
0.47
0.47
0.47
0.65
0.77
0.87
0.87
1.27
1.53
1.72
1.72
16
19
15
15
13
16
14
14
13
15
14
14
Xerigation®
Boquilla
Alcance
Radio
pies
SIST. MÉTRICO
Los datos de rendimiento se tomaron en condiciones de cero viento.
Rendimiento de la boquilla SQ
Modelo de medio
SIST. MÉTRICO
Modelo completo
Rango de flujo (gph)
Modelo de un cuarto
28
24
20
16
12
8
4
0
Full
Half
Quarter
0 10
20
30
40
Presión (psi)
50
60
105.98
90.84
75.70
60.56
45.42
30.28
15.14
0
Rango de flujo (l/h)
Boquillas SQ
Full
Half
Quarter
0
1.0
2.0
2.5
3.5
4.0
Presión (bar)
5'
4'
4'
2.5'
2.5'
4'
2.5'
5'
5'
8'
8'
8'
El uso inteligente del agua.™
171
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Microaspersor Xeri-Pop™
Modelos
™
El microaspersor Xeri-Pop facilita la integración de un
microaspersor duradero en un diseño de riego por goteo
Q Es el único aspersor de vástago retráctil que funciona en aplicaciones
de bajo volumen y baja presión, y la solución perfecta para las áreas
propensas al vandalismo
Q Los Xeri-Pops se pueden instalar en casi cualquier ubicación y son ideales
para pequeños canteros de formas irregulares; la versión de 12" (30.5 cm)
es ideal para canteros de flores anuales
t919WÈTUBHPSFUSÈDUJMEFDN
t919WÈTUBHPSFUSÈDUJMEFDN
t919WÈTUBHPSFUSÈDUJMEFDN
Opciones de boquilla
t#PRVJMMBTTFSJF42QÈH
t#PRVJMMB.13TFSJFUPEBTMBTDPOGJHVSBDJPOFT
t#VSCVKFBEPSEFQMÈTUJDPTFSJF
t#PRVJMMB.13TFSJF)5Z2
Q Los Xeri-Pop funcionan con las boquillas MPR de 5’ y 8’ (1.5 y 2.4 m) de
3BJO#JSEZDPOMBTCPRVJMMBTTFSJF42CPRVJMMBTDPOQBUSPOFTEFSPDJBEP
cuadrado y alcances ajustables de 2.5’ y 4’ [76.2 cm y 1.2 m])
Características
t-PT9FSJ1PQQVFEFOGVODJPOBSDPOVOBQSFTJØOCBTFEFBQTJEFB
3.4 bares) cuando el agua se suministra mediante una tubería de distribución
de 1/4NN
92
t-BGMFYJCJMJEBEEFMBUVCFSÓBEF1/4" (6.3 mm) permite que los Xeri-Pop se
ubiquen y reubiquen con facilidad según lo requiera la disposición de las
plantas determinada
t6ODPMMBSÓOBQSFTJØOEFQMÈTUJDPEVSBEFSPFOMPTNPEFMPTEFZ<Z
15.2 cm]) asegura la tubería de 1/4” (6.3 mm) al exterior de la caja del Xeri-Pop
t-BUVCFSÓBEFEJTUSJCVDJØOEF1/4" (6.3 mm) del Xeri-Pop puede conectarse
fácilmente a la tubería de polietileno de 1/2" (1.3 cm) o de 3/4" (1.9 cm) o
BVONBOFSBMEFWBSJBTTBMJEBT&.59&3*
-BTDPOFYJPOFTBMBUVCFSÓBEF
polietileno se realizan con un conector autoperforante SPB-025 de 1/4” (6.3
NN
PVODPOFDUPSBVUPQFSGPSBOUF9#'$0//EF1/4” (6.3 mm)
t-BTQJF[BTFYUFSOBTTPOSFTJTUFOUFTBMPTSBZPTVMUSBWJPMFUBZFTUÈOEJTQPOJCMFT
con alturas del vástago retráctil de 4”, 6” y 12” (10.2; 15.2 y 30.5 cm)
Xeri-Pop de 12" (30.5 cm) en
canteros
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t'JMUSBDJØOEFQFOEFEFMBCPRVJMMBVUJMJ[BEBDPOFM9FSJ1PQ
Xerigation®
Collarín a presión
de la tubería de
distribución de ž"
(6.3 cm)
Cómo especificar
XP-400X
XP - 600X
XP-1200X
XP - 600X
Modelo
Xeri-Pop
Altura del vástago retráctil
9WÈTUBHPSFUSÈDUJMEFwDN
9WÈTUBHPSFUSÈDUJMEFDN
9WÈTUBHPSFUSÈDUJMEFwDN
Entrada de tubería
de distribución de
ž" (6.3 cm)
Instale siempre una malla compensadora de presión
PCS-010, -020, 030 ó -040 si instala una boquilla
burbujeadora 5B en un Xeri-Pop.
172
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
Xeri-Bubblers™
Modelos
Ideal para plantaciones de arbustos, árboles, contenedores y
canteros de flores
t49#TFNJDÓSDVMPDIPSSPTFTUBDBEFDN
t49#TFNJDÓSDVMPDIPSSPTFTUBDBEF1/4" (0.6 cm)
t49#41:,TFNJDÓSDVMPDIPSSPTFTUBDBEFDN
incluye un acoplamiento de conector de punta x conector de punta
t49#DÓSDVMPDPNQMFUPDIPSSPTSPTDB
t49#DÓSDVMPDPNQMFUPDIPSSPTDPOFDUPSEFQVOUBEF1/4" (0.6 cm)
t49#41:,DÓSDVMPDPNQMFUPDIPSSPTFTUBDBEFDN
incluye un acoplamiento de conector de punta x conector de punta
t69#DÓSDVMPDPNQMFUPDPOPSPTDB
t69#DÓSDVMPDPNQMFUPDPOPDPOFDUPSEFQVOUBEF1/4" (0.6 cm)
t69#41:,DÓSDVMPDPNQMFUPDPOPFTUBDBEFDN
incluye un acoplamiento de conector de punta x conector de punta
Características
t&MDBVEBMZFMSBEJPTFBKVTUBOHJSBOEPMBDVCJFSUBFYUFSOB
t4FMJNQJBEFTBUPSOJMMBOEPDPNQMFUBNFOUFMBDVCJFSUBEFMBVOJEBECBTF
t5SFTQSÈDUJDBTDPOFYJPOFTEFJOTUBMBDJØOQBSBEBSGMFYJCJMJEBEBMEJTF×PSPTDB
autorroscante 10-32, conector de punta de 1⁄4" (6.3 mm) y estaca de 5" (12.7 cm)
Rango operativo
t$BVEBMEFMBTFSJF49#EFBHQIEFBMI
t$BVEBMEFMBTFSJF69#EFBHQIEFBMI
t1SFTJØOEFBQTJEFBCBSFT
Índice de caudal de SXB de 360º y 180º
Índice de caudal de SXB de 360º y 180º
50
z 200 kPa
z 20 psi
z 15 psi
40
z 150 kPa
z 100 kPa
30
20
10
2
4
6
8
10
12
14
16
18
20
0
22
0
2
4
6
8
10
Diámetro de alcance de 360º de SXB SIST. MÉTRICO
Diámetro de alcance de 360º de SXB
z 20 psi
z 15 psi
1.0
1.5
z 20 psi
z 15 psi
1.0
0 10
12
14
16
18
20
22
0.6
z 150 kPa
0.4
z 100 kPa
0.2
0.5
0
z 200 kPa
0.8
Diámetro (m)
Diámetro
(pies)
Descarga (gph)
2.0
2.0
z 30 psi
Radio (pies)
Descarga
(gph)
z 30 psi
3.0
0 8
14
16
18
20
22
10
12
14
16
18
20
22
Radio de alcance de 180º de SXB° SIST. MÉTRICO
z 200 kPa
0.6
z 150 kPa
z 100 kPa
0.4
0.2
0
0
0 10
12
Número de clics
14
16
18
20
22
Número de clics
0 8
10
12
14
16
18
20
22
Número de clics
Xerigation®
Número de clics
12
Número de clics
Radio (m)
0
Número de clics
0
SIST. MÉTRICO
z 30 psi
Descarga (l/h)
Descarga (gph)
14
12
10
8
6
4
2
0
SXB-180
SXB-360
UXB-360
SXB-180
SXB-360
UXB-360
Cómo especificar
SXB - 180 - 1032
SXB-180-025 SXB-360-025 UXB-360-025
$0/&$503%&16/5"
Conexión
1032: rosca autorroscante
10-32
025: conector de punta de
1⁄4" (20 mm)
41:,FTUBDBEFDN
Patrón
TFNJDÓSDVMP
DÓSDVMPDPNQMFUP
SXB-180-1032 SXB-360-1032 UXB-360-1032
roscas 10-32
El uso inteligente del agua.™
SXB-180-SPYK SXB-360-SPYK UXB-360-SPYK
&45"$"
Modelo
SXB: boquilla burbujeadora
UXB: burbujeador de cono
173
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØO
Índice de caudal de UXB
40
35
30
25
20
15
10
5
0
Descarga (gph)
30 psi
z 20 psi
z 15 psi
0
2
4
6
8
10
12
14
16
18
20
z 200 kPa
z 150 kPa
z 100 kPa
22
0
2
4
6
8
Número de clics
10
12
14
16
18
20
22
Número de clics
Diámetro de alcance de UXB
Diámetro de alcance de UXB
2.0
z 15 psi
0.5
Diámetro (m)
Diámetro
(pies)
Descarga (gph)
z 20 psi
1.0
SIST. MÉTRICO
0.5
z 30 psi
1.5
0
SIST. MÉTRICO
140
120
100
80
60
40
20
0
Descarga(gph)
(l/h)
Descarga
Índice de caudal de UXB
z 200 kPa
0.4
0.3
z 150 kPa
0.2
z 100 kPa
0.1
0
0
2
4
6
8
10
12
14
16
18
20
22
0
2
4
6
Número de clics
8
10
12
14
16
18
20
22
Número de clics
Xeri-Sprays™ y vaporizadores
Xeri-Spray™ 360° True Spray
Ideal para plantaciones masivas, cubiertas vegetales, canteros de
flores anuales y macetas
Ideal para plantaciones masivas, cubiertas vegetales, canteros de
flores anuales y macetas
Características
Características
t&MDBVEBMZFMSBEJPTFQVFEFOBKVTUBSHJSBOEPMBWÈMWVMBEFCPMBJOUFHSBM
t&MQBUSØOEFFNJTJØOVOJGPSNFQSPQPSDJPOBVOBFYDFMFOUFEJTUSJCVDJØO
t3PTDBTBVUPSSPTDBOUFTRVFDBCFOFOFMBEBQUBEPSEF1/2" (1.3 cm) x
10-32 (10-32A); el adaptador 1800 Xeri-Bubbler™ (XBA-1800); y la tubería de
FMFWBDJØOEF1PMZ'MFY1'3
t.JDSPBTQFSTPSDPOSPDJBEPFOBCBOJDPZQBUSØOEFDÓSDVMPDPNQMFUP
t&MDBVEBMZFMSBEJPTFBKVTUBOHJSBOEPMBUBQBFYUFSOB
t5SFTQSÈDUJDBTDPOFYJPOFTEFJOTUBMBDJØOQBSBEBSGMFYJCJMJEBEBMEJTF×P
rosca autorroscante 10-32, conector de punta de 1⁄4" (6.3 mm) y estaca de 5"
(12.7 cm)
t4FMJNQJBGÈDJMNFOUFEFTFOSPTDBOEPDPNQMFUBNFOUFMBDVCJFSUBEFMBVOJEBE
base
Rango operativo
t$BVEBMEFBHQIEFBMI
t1SFTJØOEFBQTJEFBCBSFT
t3BEJPDÓSDVMPDPNQMFUPEFBQJFTBN
VODVBSUPEFDÓSDVMPZ
semicírculo de 0 a 10.6 pies (0 a 3.2 m)
Modelos
Xerigation®
XS-090
174
XS-180
XS-180
t$BVEBMEFBHQIEFBMI
t1SFTJØOEFBQTJEFBCBSFT
t3BEJPEFBQJFTEFBN
Modelos
t94VODVBSUPEFDÓSDVMPSPDJBEP
t94TFNJDÓSDVMPSPDJBEP
t94DÓSDVMPDPNQMFUPSPDJBEPEFDBVEBM
t9"%+.45DÓSDVMPDPNQMFUPOFCVMJ[BDJØO
XS-090
Rango operativo
t9454SPTDBT
t9454DPOFDUPSEFQVOUBEF1⁄4" (6.3 mm)
t945441:,FTUBDBEFDN
JODMVZFVOBDPQMBNJFOUP
de conector de punta x conector de punta
XS-360
XS-360
XS-360TS
360 ADJMST
XS-360TS-025
XS-360TS-1032
XS-360TS-SPYK
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
%JTQPTJUJWPTEFFNJTJØO
Rendimiento de los Xeri-Spray™ y los vaporizadores
Presión
psi
Caudal
gph
XS-90
Radio de
Alcance pies
XS-180
Radio de
Alcance pies
XS-360
Radio de
Alcance pies
Vaporizador 360
Radio de
Alcance pies
10
15
20
25
30
0-16.7
0-21.0
0-24.5
0-28.0
0-31.0
0-6.4
0-8.1
0-9.4
0-9.8
0-10.3
0-6.7
0-8.1
0-9.5
0-10.1
0-10.6
0-9.2
0-11.3
0-12.9
0-13.2
0-13.4
0-1.5
0-1.3
0-1.5
0-1.4
0-1.3
Rendimiento de los Xeri-Spray™ y los vaporizadores
SIST. MÉTRICO
Presión
bares
Caudal
l/h
XS-90
Radio de
Alcance m.
XS-180
Radio de
Alcance m.
XS-360
Radio de
Alcance m.
Vaporizador 360
Radio de
Alcance m.
0.7
1.0
1.4
1.7
2.1
0-63.21
0-79.49
0-92.73
0-105.98
0-117.34
0-2.0
0-2.5
0-2.9
0-3.0
0-3.1
0-2.0
0-2.5
0-2.9
0-3.1
0-3.2
0-2.8
0-3.4
0-3.9
0-4.0
0-4.1
0-0.46
0-0.40
0-0.44
0-0.43
0-0.40
Índice de caudal de Xeri-Spray 360° True Spray SIST. MÉTRICO
z 30 psi
z 20 psi
z 15 psi
Descarga (gph)
24
20
16
12
8
4
0
z 200 kPa
Descarga (l/h)
Índice de caudal de Xeri-Spray 360° True Spray
80
z 150 kPa
z 100 kPa
60
40
20
0
0
2
4
6
8
10
12
14
16
18
20
22
0
2
4
6
8
Número de clics
12
14
16
18
20
22
Diámetro de alcance de Xeri-Spray 360° True Spray SIST. MÉTRICO
Diámetro
(pies)
Descarga (gph)
z 30 psi
z 20 psi
z 15 psi
4.0
z 200 kPa
z 150 kPa
z 100 kPa
Diámetro(gph)
(m)
Descarga
Diámetro de alcance de Xeri-Spray 360° True Spray
3.0
2.0
Xerigation®
14
12
10
8
6
4
2
0
10
Número de clics
1.0
0
2
4
6
8
10
12
Número de clics
El uso inteligente del agua.™
14
16
18
20
22
0
0
2
4
6
8
10
12
14
16
18
20
22
Número de clics
175
Xerigation®/Riego por goteo
%JTQPTJUJWPTEFFNJTJØOZDPNQPOFOUFTEFEJTUSJCVDJØO
Tapa difusora contra insectos
Tapa difusora con compensación de presión
Características
Características
t&WJUBRVFJOTFDUPTZQBSUÓDVMBTEFTVDJFEBEPCTUSVZBOMBUVCFSÓBEFEJTUSJCVDJØO
de 1/4" (6.3 mm)
t-BFOUSBEBDPODPOFDUPSEFQVOUBTFBEBQUBBMBUVCFSÓBEFEJTUSJCVDJØO92
EF
1
/4" (6.3 mm)
t&MQSPUFDUPSFNCSJEBEPQSPQBHBFMBHVBQBSBNJOJNJ[BSMB
erosión del suelo en el punto de emisión
t-BDVCJFSUBTFBTFHVSBBQSFTJØOFOMBTBMJEBEFMNØEVMPDPNQFOTBEPSEF
presión y del emisor XB para generar un efecto de burbuja y evitar una
inundación.
t%JTF×BEPQBSBVOBJOTUBMBDJØOSÈQJEBZGÈDJM
t$POTUSVJEBDPOQPMJFUJMFOPSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUB
Rango operativo
Modelos
t"TQFSTPSDPODPNQFOTBDJØOEFQSFTJØOOFHSP
t1$%*''11-WJPMFUBQBSBJEFOUJGJDBSFMBHVBOPQPUBCMF
t1SFTJØOEFBQTJEFBCBSFT
Modelos
t%#$OFHSP
Salida
Entrada
Difusor con
compensación
de presión
DBC-025
Aplicaciones sugeridas
Xerigation®
A. Tubería de 1/4" (6.3 mm), estaca de 1/4" (6.3 mm),
módulo compensador de presión, cubierta aspersora
contra insectos. Usado para riegos mayores a 5 pies
(1.5 m) desde la línea principal
B. Tubería de 1/4" (6.3 mm), estaca de 1/4" (6.3 mm),
cubierta aspersora contra insectos. Usado para riegos
de hasta 5 pies (1.5 m) desde la línea principal
(No se muestra el emisor de riego. Se instala
directamente en la línea lateral)
PC-DIFF-PPL
Estaca para tubería
universal de 1⁄4"
(6.3 mm)
Estaca para tubería
de 1⁄4SDSq (6.3 mm)
con cubierta
Características
Características
t.BOUJFOFMBUVCFSÓBEFEJTUSJCVDJØO
de 1/4” (6.3 mm) y el emisor o la
cubierta aspersora contra insectos
en su lugar en la zona de las raíces
de las plantas
t%JTF×BEPQBSBTVKFUBSEFNBOFSB
segura la tubería de distribución
de 1/4” (6.3 mm) de Rain Bird y
otros fabricantes: diámetro interior
de 0.16” a 0.18” (4.1 a 4.6 mm) y
diámetro exterior de 0.22” a 0.25”
(5.6 a 6.4 mm)
t&TUBDBSÓHJEBRVFDVFOUBDPOVO
cabezal plano agrandado
diseñado para soportar el
martilleo contra el suelo
duro
tMBUBQBDPOTFHVSPNBOUJFOF
la tubería en su lugar
t4FVUJMJ[BQBSBTVKFUBSMBUVCFSÓBEF
EJTUSJCVDJØO92
EF1/4” (6.3 mm) en
su lugar en la zona de las raíces de
las plantas
t"ENJUFUVCFSÓBTEFEJTUSJCVDJØO
de 1/4" (6.3 mm) con un diámetro
exterior de 0.19 a 0.256 (4.8 a 6.5 mm)
t*ODMVZFDVCJFSUBDPOUSBJOTFDUPT
t$POTUSVJEBDPONBUFSJBMQMÈTUJDP
resistente a los rayos ultravioleta
Nota: Si el emisor está instalado
en la entrada de la tubería de
distribución, use una cubierta
aspersora contra insectos (DBC025) en la salida de la tubería
para evitar que los insectos
obstruyan la tubería y para
ayudar a mantener la
tubería en su lugar
Modelo
Modelo
t548$"1
TS-025WCAP
TS-025
t54
176
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de distribución
Tubería de
elevación PolyFlex
de 12" (30.5 cm)
Conjunto de tubería de elevación de
PolyFlex y adaptador
Características
t5VCFSÓBEFFMFWBDJØOEFwØwØDN
QSFFOTBNCMBEBDPOVOBCBTF
macho roscada de 1/2” (1.3 cm) que simplifica la instalación
t6TFDPODVBMRVJFSEJTQPTJUJWPEFFNJTJØOSPTDBEPQBSBTVNJOJTUSBSBHVB
directamente a una planta. Estos incluyen Xeri-Bugs, módulos compensadores de
presión, Xeri-Bubblers y Xeri-Sprays
t"EBQUBEPSDPOVOOVFWPEJTF×PRVFJODMVZFMFOHàFUBTNÈTHSBOEFT
y hace que la instalación sea más fácil y rápida. Se puede usar en laterales de
PVC o con cualquier adaptador hembra roscado de 1/2” (1.3 cm)
t"EBQUBEPSSFBMJ[BEPEF.BSMFY® de alta resistencia, que no requiere cinta de
5FGMPO® y ahorra tiempo en la instalación
t5VCFSÓBEFFMFWBDJØOEF1PMZ'MFYEFHSBOSFTJTUFODJBZDPOGJBCMF
construida de polietileno de paredes gruesas y alta densidad
t5VCFSÓBEFFMFWBDJØOEF
cm) que se utiliza con cualquier
dispositivo de emisión roscado
10-32 para suministrar agua
directamente a una planta. Estos
incluyen Xeri-Bugs, módulos
compensadores de presión,
Xeri-Bubblers y Xeri-Sprays
t%FHSBOSFTJTUFODJBZDPOGJBCMF
construida de polietileno de
paredes gruesas y alta densidad
t4FQVFEFVUJMJ[BSDPOVOB
estaca para tubo de elevación
345
Características
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Rango operativo
Modelos
t1SFTJØOEFBQTJ
(de 1 a 3.5 bares)
t1'3'3"UVCFSÓBEFFMFWBDJØOEF1PMZ'MFYEFDN
ZBEBQUBEPS
t1'3'3"UVCFSÓBEFFMFWBDJØOEF1PMZ'MFYEFDN
ZBEBQUBEPS
Modelo
t1'3
Conjunto de tubería
de elevación de
PolyFlex y estaca
Estaca roscada para
tubería de elevación
Adaptador de rosca
10-32
Adaptador
1800 Xeri-Bubbler
Características
Características
Características
Características
t&TUBDBSFTJTUFOUFEFDN
para usar con tuberías de elevación
EF1PMZ'MFY
t$POTUSVJEBDPONBUFSJBMQMÈTUJDP
resistente a los rayos ultravioleta
t-BFOUSBEBMBUFSBMDPODPOFDUPSEF
punta es compatible con la tubería
EFEJTUSJCVDJØO92
EF1/4" (6.3 mm)
t-BTBMJEBSPTDBEB
permite enroscar fácilmente
MBUVCFSÓBEFFMFWBDJØOEF1PMZ'MFY
EFDN
1'3
t&OUSBEBSPTDBIFNCSBQBSBUVCFSÓB
de 1/2” (1.3 cm) que se atornilla a
cualquier tubería de elevación con
rosca macho para tubería de 1/2”
(1.3 cm)
t4BMJEBSPTDBTRVFBENJUFO
Xeri-Bugs, módulos compensadores
de presión, Xeri-Bubblers y XeriSprays con roscas 10-32
t$POTUSVJEBDPONBUFSJBMQMÈTUJDP
resistente a los rayos ultravioleta
t1SFTJØOEFBQTJ
(de 1 a 3.5 bares)
t&OUSBEBSPTDBTIFNCSBEF1/2”
(1.3 cm) que se enroscan en los
adaptadores serie 1800 o UNI-Spray
o en los adaptadores para arbustos
de Rain Bird
t4BMJEBSPTDBTRVFBENJUFO
cualquier dispositivo de emisión con
roscas 10-32, incluidos emisores
Xeri-Bug, módulos compensadores
de presión, adaptadores
Xeri-Bubbler y Xeri-Spray
t4FBQPZBEFGPSNBOJWFMBEBFO
el terreno cuando se instala en
un cabezal para una instalación
resistente
Modelo
Rango operativo
t"
t1SFTJØOEFBQTJ
(de 1 a 3.5 bares)
t5VCFSÓBEFFMFWBDJØOEF
cm) preensamblada con una estaca
de 7" (17.8 cm)
t6TFDPODVBMRVJFSEJTQPTJUJWP
de emisión roscado 10-32 para
suministrar agua directamente a
una planta. Estos incluyen Xeri-Bugs,
módulos compensadores de presión,
Xeri-Bubblers y Xeri-Sprays
t"IPSSBUJFNQPZEJOFSPDVBOEP
se instala un sistema de riego
por goteo
t5VCFSÓBEFFMFWBDJØOEF1PMZ'MFY
de gran resistencia y confiable
construida de polietileno de
paredes gruesas y alta densidad
Rango operativo
Rango operativo
t1SFTJØOEFBQTJ
(de 1 a 3.5 bares)
Modelo
Rango operativo
t345
Modelo
t1SFTJØOEFBQTJ
(de 1 a 3.5 bares)
PFR-RS
t9#"
Modelo
t1'334UVCFSÓBEFFMFWBDJØO
EF1PMZ'MFYEFDN
y estaca de 7" (30.5 cm)
El uso inteligente del agua.™
RS-025T
10-32A
XBA-1800
177
Xerigation®
PFR-FRA
PFR-12
Xerigation®/Riego por goteo
-ÓOFBEFSJFHPQPSHPUFPFOTVQFSGJDJF9'%
Línea de riego por goteo en superficie XFD
Línea de riego por
goteo XFD
La línea de tubería emisora con compensación de presión
más flexible en el mercado para regar cubierta vegetal,
plantaciones densas y setos, entre otras cosas.
Q 5VCFSÓBFYUSBGMFYJCMFQBSBVOBJOTUBMBDJØOSÈQJEBZTFODJMMB
Q La tubería con doble laminado (marrón sobre negro o violeta sobre negro)
brinda una resistencia incomparable a los químicos, al daño de los rayos
ultravioletas y al crecimiento de algas
Q El diseño del emisor con patente en trámite brinda mayor confiabilidad
Q Riegos laterales más prolongados que los de la competencia
Características
t&MNBUFSJBMFYDMVTJWPPGSFDFVOBGMFYJCJMJEBEDPOTJEFSBCMFNFOUFNBZPSMPDVBM
permite giros más ajustados con menos codos para una instalación más sencilla
t-BFMFDDJØOEFÓOEJDFTEFDBVEBMFTQBDJBNJFOUPZMPOHJUVEFTEFSPMMP
proporciona flexibilidad de diseño para una variedad de aplicaciones que no
sean en césped
t"ENJUFBDDFTPSJPTEFDPNQSFTJØO&BTZ'JUEF3BJO#JSEBDDFTPSJPTEFJOTFSDJØO
QBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFYZBDDFTPSJPTEFJOTFSDJØOEFNN
t6TFVOLJUEFWÈMWVMBEFBMJWJPEFBJSFWBDÓPDVBOEPMBJOTUBMBDJØOFTQPSEFCBKP
del suelo
Disponible en violeta para
identificar el agua no
potable
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t¶OEJDFTEFDBVEBMHQIZHQIMIZMI
t5FNQFSBUVSB"HVBIBTUB¡'¡$
BNCJFOUFIBTUB¡'¡$
t'JMUSBDJØOSFRVFSJEBNBMMB
Especificaciones
Xerigation®
La línea de riego por goteo XFD
ofrece mayor flexibilidad para
brindar resistencia al pliegue y
facilitar la instalación
Cómo especificar
XFD - P - 09 - 12 - 100
Modelo
9'%
Línea de
riego por
goteo
Característica
Violeta
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
t&TQFTPSEFMBQBSFENN
t&TQBDJBNJFOUPwwØwØDN
t-BSHPTSPMMPTEFhN
ZhN
t6TFDPOBDDFTPSJPTEFJOTFSDJØOQBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFY
DPOTVMUFMBQÈH
BDDFTPSJPTEFDPNQSFTJØO&BTZ'JUEF3BJO#JSEDPOTVMUF
la pág. 186) y accesorios de inserción de 17 mm
Self-dispensing Dripline
Longitud de la
tubería
hN
hN
hN
Espaciamiento del emisor
DN
DN
DN
Índice de flujo
HQIMI
HQIMI
La bobina autodispensadora reduce el tiempo
de disposición y facilita la instalación.
Línea de riego por
goteo XFD
&MTJTUFNBEFSJFHPQPSHPUFP9'%PGSFDFIBTUBVOEFBIPSSPEFBHVBEFCJEPBRVFOPIBZQÏSEJEBBDBVTBEFMWJFOUP4FQVFEFJOTUBMBS
al nivel del terreno, justo debajo del nivel del terreno o debajo del mantillo.
178
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
-ÓOFBEFSJFHPQPSHPUFPFOTVQFSGJDJF9'%
los de línea de riego por goteo en superficie XFD
los de línea de riego por goteo en superficie XFD SIST. MÉTRICO
Modelo
Caudal Espaciamiento Largo de rollo
gph
pulg.
pies
Modelo
Caudal
l/h
Espaciamiento Largo de rollo
cm
m
XFD-06-12-100
XFD-06-12-250
XFD-06-12-500
XFD-06-18-100
XFD-06-18-250
XFD-06-18-500
XFD-06-24-500
XFD-09-12-100
XFD-09-12-250
XFD-09-12-500
XFD-09-18-100
XFD-09-18-250
XFD-09-18-500
XFD-09-24-500
XFDP-06-12-500 (violeta)
XFDP-06-18-500 (violeta)
XFDP-09-12-500 (violeta)
XFDP-09-18-500 (violeta)
0.60
0.60
0.60
0.60
0.60
0.60
0.60
0.90
0.90
0.90
0.90
0.90
0.90
0.90
0.60
0.60
0.90
0.90
XFD-06-12-100
XFD-06-12-250
XFD-06-12-500
XFD-06-18-100
XFD-06-18-250
XFD-06-18-500
XFD-06-24-500
XFD-09-12-100
XFD-09-12-250
XFD-09-12-500
XFD-09-18-100
XFD-09-18-250
XFD-09-18-500
XFD-09-24-500
XFDP-06-12-500 (violeta)
XFDP-06-18-500 (violeta)
XFDP-09-12-500 (violeta)
XFDP-09-18-500 (violeta)
2.30
2.30
2.30
2.30
2.30
2.30
2.30
3.50
3.50
3.50
3.50
3.50
3.50
3.50
2.30
2.30
3.50
3.50
30.5
30.5
30.5
45.7
45.7
45.7
61.0
30.5
30.5
30.5
45.7
45.7
45.7
61.0
30.5
45.7
30.5
45.7
12
12
12
18
18
18
24
12
12
12
18
18
18
24
12
18
12
18
100
250
500
100
250
500
500
100
250
500
100
250
500
500
500
500
500
500
30.5
76.5
152.9
30.5
76.5
152.9
152.9
30.5
76.5
152.9
30.5
76.5
152.9
152.9
152.9
152.9
152.9
152.9
Longitudes laterales máximas de la línea de riego por goteo en superficie XFD (en pies)
Presión de
entrada
(psi)
Longitud lateral máxima (pies)
Espaciamiento de 12"
Caudal nominal (gph):
0.6
0.9
Espaciamiento de 18"
Caudal nominal (gph):
0.6
0.9
Espaciamiento de 24"
Caudal nominal (gph):
0.6
0.9
15
20
30
40
50
60
273
318
360
395
417
460
314
353
413
465
528
596
424
508
586
652
720
780
250
294
350
402
420
455
Longitudes laterales máximas de la línea de riego por goteo en superficie XFD (en metros)
322
368
414
474
488
514
SIST. MÉTRICO
Presión de
entrada
(bares)
Longitud lateral máxima (metros)
30.5 cm
Flujo nominal (l/h):
2.3
3.41
45.7 cm
Flujo nominal (l/h):
2.3
3.41
61.0 cm
Flujo nominal (l/h):
2.3
3.41
1.0
1.4
2.1
2.8
3.5
4.1
83.2
96.9
109.7
120.4
127.1
140.2
95.7
107.6
125.9
141.7
160.9
181.7
129.2
154.8
178.6
198.7
219.5
237.7
47.2
51.5
70.1
77.7
86.9
88.4
76.2
89.6
106.7
122.5
128.0
138.7
Xerigation®
155
169
230
255
285
290
98.2
112.2
123.2
144.5
148.7
156.7
Caudal de la línea de riego por goteo en superficie XFD (por 30.48 m de tubo)
Caudal de la línea de riego por goteo en superficie XFD (por 100 m de tubo)
Espaciamiento del emisor
0.6 gph emisor
0.9 gph emisor
Espaciamiento del emisor 2.3 l/h emisor
3.41 l/h emisor
12"
18"
24"
61.0 gph 1.02 gpm
41.0 gph 0.68 gpm
31.0 gph 0.51 gpm
92.0 gph 1.53 gpm
61.0 gph 1.02 gpm
46 gph 0.77 gpm
0.30 metro
0.46 metro
0.61 metro
1,136.7 l/h
741.3 l/h
559.0 l/h
El uso inteligente del agua.™
757.9 l/h
502.2 l/h
378.7 l/h
12.6 l/m
8.4 l/m
6.3 l/m
18.9 l/m
12.4 l/m
9.3 l/m
179
Xerigation®/Riego por goteo
-ÓOFBEFSJFHPQPSHPUFPTVCUFSSÈOFPTFSJF9'4DPO
tecnología Copper Shield™
Línea de riego por goteo subterráneo XFS
con tecnología Copper Shield™
3JFHPQPSHPUFPTVCUFSSÈOFP4%*
JEFBMQBSBKBSEJOFTQFRVF×PTFTUSFDIPT
y apretados, esquinas pronunciadas y todos los terrenos de césped
Q -BMÓOFBEFSJFHPQPSHPUFPTVCUFSSÈOFP3BJO#JSE¥9'4DPOUFDOPMPHÓB
Ganadora de la
exhibición de la
Asociación de
riego
Línea de riego por goteo
subterráneo XFS
Copper Shield™ es la última innovación de la gama Rain Bird Xerigation®. La
tecnología Copper Shield de Rain Bird, con patente en trámite, protege al
emisor frente a la invasión de raíces y crea un sistema subterráneo duradero y
de bajo mantenimiento que se puede utilizar debajo de césped o en zonas de
arbustos y cubiertas vegetales
Q Un material de tubería patentado hace que el sistema de riego por goteo
TVCUFSSÈOFP9'4DPOUFDOPMPHÓB$PQQFS4IJFMETFBMBUVCFSÓBNÈTGMFYJCMFEFMB
industria y la línea de goteo subterránea más fácil de diseñar e instalar.
Q "ENJUFBDDFTPSJPTEFDPNQSFTJØO&BTZ'JUEF3BJO#JSEBDDFTPSJPTEFJOTFSDJØO
EFOUBEPTQBSBMÓOFBTEFSJFHPQPSHPUFP9'ZPUSPTBDDFTPSJPTEFJOTFSDJØO
dentados de 17 mm
Características
La línea de riego por goteo XFS
ofrece mayor flexibilidad para
facilitar la instalación
Tubería de color cobre
Xerigation®
Simple
t&MEJTF×PEFFNJTPSEFCBKPQFSGJMEF3BJO#JSESFEVDFMBQÏSEJEBEFQSFTJØO
en la línea y permite trazados laterales más largos, simplificando el diseño y
reduciendo el tiempo de
t-PTEJWFSTPTÓOEJDFTEFDBVEBMZFTQBDJBNJFOUPTEFMPTFNJTPSFTZMBTMPOHJUVEFT
de la bobina proporcionan flexibilidad de diseño para aplicaciones subterráneas
tanto para césped como para arbustos y cubiertas vegetales
Confiable
t-PTFNJTPSFTEFMBTMÓOFBTEFSJFHPQPSHPUFPTVCUFSSÈOFP9'4FTUÈOQSPUFHJEPT
frente a invasiones de raíces mediante la tecnología de Rain Bird Copper Shield™,
con patente en trámite, que da como resultado un sistema que no requiere
mantenimiento ni reemplazo de químicos para impedir la invasión de raíces
t&MEJTF×PEFMFNJTPSDPODPNQFOTBDJØOEFQSFTJØOQSPQPSDJPOBVODBVEBM
uniforme en toda la longitud lateral, lo cual asegura una mayor uniformidad para
aumentar la fiabilidad en el rango de presión de 8.5 a 60 psi
Duradera
t-BUVCFSÓBEFEPCMFDBQBDPCSFTPCSFOFHSP
QSPQPSDJPOBVOBSFTJTUFODJBTJO
igual a los daños ocasionados por productos químicos, crecimiento de algas y
radiación UV
t5PMFSBOUFBMBUJFSSBFMEJTF×PQBUFOUBEPEFMFNJTPSEF3BJO#JSESFTJTUFMBT
obstrucciones al utilizar una vía de caudal extra-ancha en combinación con un
sistema de autopurgado
Rango operativo
Línea de riego por goteo subterráneo serie
XFS con tecnología Copper Shield™
Cómo especificar
XFS - P - 09 - 12 - 100
Característica
11ÞSQVSB
sobre negro
Modelo
9'4
subterránea
Línea de riego
por goteo
180
Longitud de la tubería
hN
hN
Espaciamiento del emisor
DN
DN
DN
t1SFTJØOEFBQTJEFBCBSFT
t¶OEJDFTEFDBVEBMZHQIMIZMI
t5FNQFSBUVSB
"HVBIBTUB'$
"NCJFOUFIBTUB'$
t'JMUSBDJØOSFRVFSJEBNBMMB
Especificaciones
t%JNFOTJPOFT%JÈNFUSPFYUFSOPNN
EJÈNFUSPJOUFSOP
mm); Espesor: 0.049" (1.2mm)
tDNDNDN
EFFTQBDJBEP
t%JTQPOJCMFFOCPCJOBTEFhZhNZN
t$PMPSEFMBCPCJOBDPCSF
Índice de flujo
HQIMI
HQIMI
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
-ÓOFBEFSJFHPQPSHPUFPTVCUFSSÈOFPTFSJF9'4DPO
tecnología Copper Shield™
Modelos de línea de riego por goteo subterráneo XFS
Modelos de línea de riego por goteo subterráneo XFS SIST. MÉTRICO
Modelo
Caudal
gph
Espaciamiento Largo de rollo
pulg.
pies
Modelo
Caudal
l/h
Espaciamiento Largo de rollo
cm
m
XFS-06-12-100
XFS-06-12-500
XFS-06-18-100
XFS-06-18-500
XFS-06-24-500
XFS-09-12-100
XFS-09-12-500
XFS-09-18-100
XFS-09-18-500
XFS-09-24-500
XFSP-06-12-500 (violeta)
XFSP-06-18-500 (violeta)
XFSP-06-24-500 (violeta)
XFSP-09-12-500 (violeta)
XFSP-09-18-500 (violeta)
XFSP-09-24-500 (violeta)
0.60
0.60
0.60
0.60
0.60
0.90
0.90
0.90
0.90
0.90
0.60
0.60
0.60
0.90
0.90
0.90
12
12
18
18
24
12
12
18
18
24
12
18
24
12
18
24
XFS-06-12-100
XFS-06-12-500
XFS-06-18-100
XFS-06-18-500
XFS-06-24-500
XFS-09-12-100
XFS-09-12-500
XFS-09-18-100
XFS-09-18-500
XFS-09-24-500
XFSP-06-12-500 (violeta)
XFSP-06-18-500 (violeta)
XFSP-06-24-500 (violeta)
XFSP-09-12-500 (violeta)
XFSP-09-18-500 (violeta)
XFSP-09-24-500 (violeta)
2.30
2.30
2.30
2.30
2.30
3.50
3.50
3.50
3.50
3.50
2.30
2.30
2.30
3.50
3.50
3.50
30.5
30.5
45.7
45.7
61.0
30.5
30.5
45.7
45.7
61.0
30.5
45.7
61.0
30.5
45.7
61.0
100
500
100
500
500
100
500
100
500
500
500
500
500
500
500
500
30.5
152.9
30.5
152.9
152.9
30.5
152.9
30.5
152.9
152.9
152.9
152.9
152.9
152.9
152.9
152.9
Longitudes laterales máximas de la línea de riego por goteo subterráneo XFS (en pies)
Presión de
entrada
(psi)
Longitud lateral máxima (pies)
Espaciamiento de 12"
Caudal nominal (gph):
0.6
0.9
Espaciamiento de 18"
Caudal nominal (gph):
0.6
0.9
Espaciamiento de 24"
Caudal nominal (gph):
0.6
0.9
15
20
30
40
50
60
273
318
360
395
417
460
314
353
413
465
528
596
424
508
586
652
720
780
250
294
350
402
420
455
Longitudes laterales máximas de la línea de goteo subterránea XFS (en metros)
322
368
414
474
488
514
SIST. MÉTRICO
Presión de
entrada
(bares)
Longitud lateral máxima (metros)
30.5 cm
Flujo nominal (l/h):
2.3
3.41
45.7 cm
Flujo nominal (l/h):
2.3
3.41
61.0 cm
Flujo nominal (l/h):
2.3
3.41
1.0
1.4
2.1
2.8
3.5
4.1
83.2
96.9
109.7
120.4
127.1
140.2
95.7
107.6
125.9
141.7
160.9
181.7
129.2
154.8
178.6
198.7
219.5
237.7
47.2
51.5
70.1
77.7
86.9
88.4
76.2
89.6
106.7
122.5
128.0
138.7
Xerigation®
155
169
230
255
285
290
98.2
112.2
123.2
144.5
148.7
156.7
Caudal de la línea de riego por goteo subterráneo XFS (por 100 m de tubo)
Caudal de la línea de goteo subterránea XFS (por 100 m de tubo)
Espaciamiento del emisor
0.6 gph emisor
Espaciamiento del emisor 2.3 l/h emisor
12"
18"
24"
61.0 gph 1.02 gpm 92.0 gph 1.53 gpm
41.0 gph 0.68 gpm 61.0 gph 1.02 gpm
31.0 gph 0.51 gpm 46 gph 0.77 gpm
El uso inteligente del agua.™
0.9 gph emisor
0.30 metro
0.46 metro
0.61 metro
3.41 l/h emisor
757.9 l/h 12.6 l/m 1,136.7 l/h 18.9 l/m
502.2 l/h 8.4 l/m 741.3 l/h 12.4 l/m
378.7 l/h 6.3 l/m 559.0 l/h 9.3 l/m
181
Xerigation®/Riego por goteo
Componentes de distribución
Tubería serie XF
Características de pérdida por fricción de la tubería
Características:
Diám. ext. 0.634" Diám. int. 0.536"
Diám. ext. 16.1mm Diám. int. 13.6mm
SIST. MÉTRICO
Caudal
gpm
Velocidad Pérdida
pps
psi
Caudal
l/h
Velocidad Pérdida
m/s
bares
0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00
0.70
1.40
2.10
2.80
3.50
4.20
4.90
5.60
6.30
7.00
7.70
8.40
113.56
227.12
340.69
454.25
567.81
681.37
794.94
908.50
1022.06
1135.62
1249.19
1362.75
0.21
0.43
0.64
0.85
1.07
1.28
1.49
1.71
1.92
2.13
2.35
2.56
t.BZPSGMFYJCJMJEBEGÈDJMEFJOTUBMBSZBIPSSBEJOFSP
t&MDPMPSNBSSØODPNCJOBDPOFMQBJTBKFZTFNF[DMBDPOFMNBOUJMMP$PNCJOB
DPOMBUVCFSÓBEFMFNJTPSFOMÓOFBEFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'
t$PNQBUJCMFDPOFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'EJÈNFUSPJOUFSOPEF
0.536” [13.6 mm] x diámetro externo de 0.634” [16.1 mm])
t"ENJUFBDDFTPSJPTEFDPNQSFTJØO&BTZ'JUEF3BJO#JSEBDDFTPSJPTEFJOTFSDJØO
QBSBTJTUFNBTEFSJFHPQPSHPUFP9FSJ'MFYZBDDFTPSJPTEFJOTFSDJØOEFNN
t/PFTDPNQBUJCMFDPOBDDFTPSJPTEFNN
Especificaciones
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
t&TQFTPSEFMBQBSFENN
Modelos:
t9'%SPMMPEFQJFTN
t9'%SPMMPEFQJFTN
t9'%SPMMPEFQJFTN
XFD100
0.27
0.97
2.06
3.50
5.29
7.42
9.87
2.64
15.72
19.11
22.80
26.78
Pérdida en psi por cada 100 pies de tubo
QTJQJFT
0.06
0.22
0.46
0.79
1.20
1.68
2.23
2.86
3.56
4.32
5.16
6.06
Pérdida en bares por cada 100 metros de
UVCFSÓBCBSFTN
Nota: No se recomienda el uso de tubería para los caudales indicados en las áreas con
TPNCSFBEPPTDVSPZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTTNT
Accesorios de inserción para sistemas de
riego por goteo Xeri-Flex
Características
Modelos
t-ÓOFBDPNQMFUBEFBDDFTPSJPTEFJOTFSDJØOEFNNQBSBTJNQMJGJDBSMB
JOTUBMBDJØOEFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'
t$POFDUPSFTEFQVOUBEFBMUBDBMJEBERVFTPTUJFOFOMBUVCFSÓBQBSBVO
acople seguro
t%JTF×PÞOJDPEFQVOUBQBSBSFEVDJSMBGVFS[BEFJOTFSDJØOZBÞOBTÓ
mantener un acople seguro
t"DDFTPSJPTEFDPMPSFTOPJOUFOTJWPTQBSBNF[DMBSTFDPOMPTUPOPTEFMB
naturaleza
t9''$061$POFDUPSEFQVOUBEFNNYBDPQMFEFMDPOFDUPSEFQVOUB
t9''&-#08$POFDUPSEFQVOUBYDPEPDPODPOFDUPSEFQVOUBEFNN
t9''."$POFDUPSEFQVOUBEFNNYBEBQUBEPSEFSPTDBNBDIPQBSB
tubería de 1/2”
t9''5&&$POFDUPSEFQVOUBEFNNYDPOFDUPSEFQVOUBYDPOFDUPSEF
QVOUBFO5
t9''5."$POFDUPSEFQVOUBEFNNYSPTDBNBDIPQBSBUVCFSÓB
EFwYBEBQUBEPSEFQVOUBFO5NBDIPEFNN
t9''."$POFDUPSEFQVOUBEFNNYBEBQUBEPSEFSPTDBNBDIPQBSB
tubería de 3/4”
t9'%$3044$POFDUPSEFQVOUBFODSV[EFNNYNNYNNYNN
t9'%5'""EBQUBEPSIFNCSBFO5'15EFNNYcYNN
t'*5*/4500-)FSSBNJFOUBEFBDDFTPSJPEFJOTFSDJØO9'$PNQBUJCMFDPO9''
$0619''&-#08Z9''5&&
Rango operativo
Xerigation®
t1SFTJØOEFBQTJEFBCBSFT
TJTFVTBEFQTJCBSFT
TF
necesitarán abrazaderas)
9''."
9''."
9''5."
NUEVO
9''5'"
NUEVO
9''5&&
9'%$3044
'*5*/4500-
9'%'"
9''COUP
9''ELBOW
182
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de distribución
Adaptador de inserción para línea de goteo
serie XF y PVC de 1" (2.5 cm), 1½" (3.8 cm) o
más grande
t$POFDUBFMTJTUFNBEFSJFHPQPSHPUFPTFSJF9'ZMBUVCFSÓBBMBTMÓOFBT
principales de PVC a bajas presiones.
t&TUBCJMJ[BEPDPO67QBSBVOBMBSHBWJEBÞUJM
t"CSB[BEFSBEFUSJORVFUFGÈDJMEFVTBSRVFBTFHVSBMBUVCFSÓBBMBEBQUBEPS
Modelo
Perfore un orificio con
una sierra perforadora
de 5/8".* Utilice un
taladro de velocidad
lenta. Quite las virutas
del orificio.
t9'17$"%1"EBQUBEPSQBSBVUJMJ[BSDPOUVCPEF17$EFDN
t9'17$#*5#SPDBQBSBVTBSDPOFMBEBQUBEPS9'17$"%1EF NUEVO
t9'%*/17$"EBQUBEPSQBSBVUJMJ[BSDPOUVCPEF17$EFDN
NUEVO
o más grande
Quite las partículas y
coloque la arandela
aislante adecuada con
firmeza en el orificio,
con la pestaña de frente
y hacia afuera.
Presione el adaptador
de inserción del sistema
de riego por goteo
serie XF en la arandela
hasta que la pestaña
y la arandela queden
alineadas.
NUEVO
XFD-INPVC
XFDPVCBIT
* Se debería utilizar la broca XFPVCBIT para perforar
orificios para el adaptador XFPVCADP de 1" (2.5 cm).
Se debe utilizar sólo con tubos de PVC o PE. No es
adecuada para ningún otro material.
Kit de válvula de
alivio de aire/vacío
Características
Longitud máxima del sistema de riego por goteo que se
puede usar con las válvulas ARV
Espaciamiento del emisor
tÁTFMPDPOMBUVCFSÓBEFMFNJTPSFO
MÓOFBEFMBTFSJF9'PEFMTJTUFNB
de riego paisajístico por goteo de
Rain Bird cuando la instalación es
QPSEFCBKPEFMTVFMP
t)FDIBDPONBUFSJBMFTEFDBMJEBE
resistentes a la corrosión.
t$BCFEFOUSPEFMBDBKBEFVO
emisor SEB 7XB.
*Rain Bird recomienda XFS líneas
de riego con Copper Shield™ para
instalaciones subterráneas, incluidas
las instalaciones debajo del césped.
12"
18"
24"
639'
958'
1278'
Capacidad de las válvulas ARV
Caudal total (GPM)
Caudal total (GPH)
424'
636'
848'
6.5
390
Longitud máxima del sistema de riego por goteo que se
puede usar con las válvulas ARV
SIST. MÉTRICO
Espaciamiento del emisor
0.30 m
0.46 m
0.61 m
Modelo
t"377ÈMWVMBEFBMJWJPEFBJSF
EF›DN
ARV de 1/2" (1.9 cm)
0.61 GPH
0.92 GPH
Capacidad de las válvulas ARV
Caudal total (l/min)
Caudal total (l/h)
ARV de 1/2" (1.9 cm)
2.3 l/h
3.4 l/h
195
292
390
129
194
258
24.6
1476
Indicador de
funcionamiento para
sistemas de riego por
goteo
Características
t&MWÈTUBHPTFFMFWBQBSBVOB
mejor visibilidad
t$VBOEPFMWÈTUBHPFTUÈFYUFOEJEPFM
sistema de riego por goteo se carga
a 20 psi como mínimo
t-BCPRVJMMB7"/TFBKVTUBQBSBOP
dejar pasar el flujo pero se puede
abrir para observar el patrón de
riego.
t*ODMVZFwDN
YžDN
de tubería de distribución con
accesorio de conexión preinstalado.
Modelo
NUEVO
t01&3*/%
NUEVO
Instale las válvulas de alivio de aire/vacío
correctamente, para ello:
Localice el punto más alto de la zona de la línea de riego por goteo. Coloque
la válvula en una cabeza de escape o en una línea que funcione de forma
perpendicular a las filas laterales para garantizar que todas las filas de la línea
de riego por goteo puedan aprovechar la válvula de alivio de aire/vacío
OPERIND
ARV050
El uso inteligente del agua.™
183
Xerigation®
XFPVCADP
Xerigation®/Riego por goteo
Componentes de distribución
Tubería de distribución XQ de 1/4'' (6.3 mm)
-BUVCFSÓBEFEJTUSJCVDJØOEFžNÈTGVFSUFZGMFYJCMF
disponible para extender las salidas del emisor a los lugares de
descarga deseados
Q Mezcla única de polímeros que proporciona la flexibilidad del vinilo y el
agarre del polietileno.
Q Nuevo acabado texturado que mejora la maniobra
Q Característica de rollo autoextraíble que facilita el uso, el almacenamiento
y la eliminación de desperdicios.
Q #BMEF92DPOQBUFOUFFOUSÈNJUFQBSBVOVTPZBMNBDFOBNJFOUPGÈDJMZ
rápido de rollos largos.
Características
t$BCFFOMPTPSJGJDJPTEFTBMJEBDPODPOFDUPSEFQVOUBZUPEPTMPTEJTQPTJUJWPT
de emisión y accesorios de transferencia de 1/4” (6.3 mm) de Xerigation
t.ÏUPEPEFFOSPMMBEPFYDMVTJWPRVFQFSNJUFRVFMBUVCFSÓBQFSNBOF[DB
enrollada a medida que se extrae.
t&YUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOPSFTJTUFOUFTBMPTSBZPT
ultravioleta
t&MÓOEJDFEFQTJTVQFSBMBTFTQFDJGJDBDJPOFTEFMBDPNQFUFODJB
Especificaciones
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
t&TQFTPSEFMBQBSFENN
t-BSHPTSPMMPTEFhN
ZhN
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Modelos
Características de pérdida por fricción de la tubería de
distribución XQ de 1/4'' (6.3 mm)
Diám. ext. 0.25" Diám. int. 0.17"
Diám. ext. 6.3 mm Diám. int. 4.3 mm
SIST. MÉTRICO
Caudal
gph
Velocidad Pérdida
pps
psi
Caudal Caudal
m3⁄h
l/h
Velocidad Pérdida
m/s
bares
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
25
30
0.27
0.53
0.80
1.06
1.33
1.59
1.86
2.13
2.39
2.66
2.92
3.19
3.45
3.72
3.98
4.25
4.52
4.78
5.05
5.31
6.64
7.97
0.00
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.05
0.05
0.06
0.06
0.06
0.07
0.07
0.08
0.09
0.11
0.08
0.16
0.24
0.32
0.41
0.48
0.57
0.65
0.73
0.81
0.89
0.97
1.05
1.13
1.21
1.30
1.38
1.46
1.54
1.62
2.03
2.43
0.16
0.59
1.24
2.12
3.20
4.49
5.97
7.64
9.50
11.54
13.79
16.17
18.75
21.50
24.43
27.53
30.80
34.23
37.83
41.60
62.86
88.08
Pérdida en psi por cada 100 pies de
tubería; C=150
3.79
7.58
11.6
15.14
18.92
22.71
26.50
30.28
34.07
37.85
41.64
45.42
49.21
52.99
56.78
60.56
64.35
68.13
71.92
75.70
94.63
113.55
0.01
0.04
0.09
0.15
0.22
0.31
0.41
0.53
0.66
0.80
0.95
1.12
1.29
1.48
1.69
1.90
2.13
2.36
2.61
2.87
4.34
6.08
Pérdida en bares por cada 100 metros de tubería
Nota: No se recomienda el uso de tubería para los caudales indicados en las áreas con sombreado
PTDVSPZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTTNT
t92SPMMPEFQJFTN
EFUVCFSÓBEFEJTUSJCVDJØOEFž
t92SPMMPEFQJFTN
EFUVCFSÓBEFEJTUSJCVDJØOEFž
t92#SPMMPEFQJFTN
EFUVCFSÓBEFEJTUSJCVDJØOEFž
en balde
Xerigation®
Tubería XQ-100 y
XQ-1000 de ¼"
Tubería XQ-1000-B
de ¼"
184
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de distribución
Características de pérdida por fricción de la tubería XT-700
La tubería de distribución duradera y de paredes gruesas resiste
las condiciones difíciles y funciona bien en todos los climas
Diám. ext. 0.700" Diám. int. .580"
D.E. 18 mm D.I. 15 mm SIST. MÉTRICO
Características
Caudal
gph
Velocidad Pérdida
pps
psi
Caudal Caudal
m3⁄h
l/h
Velocidad Pérdida
m/s
bares
0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00
0.61
1.21
1.82
2.43
3.03
3.64
4.24
4.85
5.46
6.06
6.67
7.28
0.11
0.23
0.34
0.45
0.57
0.68
0.79
0.91
1.02
1.14
1.25
1.36
0.19
0.37
0.56
0.74
0.92
1.11
1.29
1.48
1.67
1.85
2.03
2.22
t-BUVCFSÓBGMFYJCMFEFQBSFEFTHSVFTBTSFTJTUFMPTQMJFHVFTZFMEB×PDBVTBEP
por las actividades rutinarias de mantenimiento del terreno
t&YUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOPSFTJTUFOUFTBMPTSBZPT
ultravioleta
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
t&TQFTPSEFMBQBSFENN
Modelos
t95SPMMPEFQJFTN
t95SPMMPEFQJFTN
XT-700-100
Nota: en pos de la conservación del agua y la apariencia, se recomienda colocar una
cubierta de mantillo de 2" a 3" (5 a 8 cm) sobre la tubería
Tubería de rayas negras XBS
5VCFSÓBGMFYJCMFEFBMUBDBMJEBEQBSBVTBSFOVOTJTUFNBEF
riego por goteo
„ 5VCFSÓBEF›DN
FYUSVEJEBDPONBUFSJBMFTEFSFTJOBEFQPMJFUJMFOP
para una durabilidad consistente
„ %JTQPOJCMFDPOSBZBTEFDPMPSFTQBSBMBTEJGFSFOUFT[POBT
„ Resistente a los rayos ultravioleta para instalaciones al nivel del terreno o
por debajo
Características
t3PMMPTDPNQBDUPTQBSBGÈDJMBMNBDFOBNJFOUPZUSBTMBEP
Especificaciones
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
Rango operativo
t&TQFTPSEFMBQBSFENN
t-BSHPTSPMMPTEFhN
Zh
(152.4 m)
t1SFTJØOEFBQTJEFBCBSFT
Modelos
XBS100: rollo de 100 pies (30 m) con rayas verdes
XBS500: rollo de 500 pies (152 m) con rayas verdes
XBS100B: rollo de 100 pies (30 m) con rayas negras
XBS500B: rollo de 500 pies (152 m) con rayas negras
XBS100R: rollo de 100 pies (30 m) con rayas rojas
XBS500R: rollo de 500 pies (152 m) con rayas rojas
XBS500P: rollo de 500 pies (152 m) con rayas violetas
9#4:SPMMPEFQJFTN
DPOSBZBTBNBSJMMBT
0.19
0.69
1.45
2.47
3.74
5.24
6.97
8.93
11.10
13.50
16.10
18.92
Pérdida en psi por cada 100 pies de
UVCPQTJQJFT
0.03
0.06
0.09
0.13
0.16
0.19
0.22
0.25
0.28
0.32
0.35
0.38
0.01
0.05
0.10
0.17
0.26
0.36
0.48
0.62
0.77
0.93
1.11
1.31
Pérdida en bares por cada 100 metros de tubería
CBSFTN
Nota: No se recomienda el uso de tubería para los caudales indicados en las áreas con sombreado
PTDVSPZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTTNT
XBS: características de pérdida por fricción de la tubería
Diám. ext. 0.705" Diám. int. .615"
D.E. 18 mm D.I. 15.5 mm
Caudal
gph
Velocidad Pérdida
pps
psi
Caudal Caudal
m3⁄h
l/h
Velocidad Pérdida
m/s
bares
0.50
1.00
1.50
2.00
2.50
3.00
3.50
4.00
4.50
5.00
5.50
6.00
0.54
1.08
1.62
2.16
2.70
3.24
3.78
4.31
4.85
5.39
5.93
6.47
0.11
0.23
0.34
0.45
0.57
0.68
0.79
0.91
1.02
1.14
1.25
1.36
0.16
0.33
0.49
0.66
0.82
0.99
1.15
1.32
1.48
1.64
1.81
1.97
0.14
0.52
1.09
1.86
2.81
3.94
5.24
6.71
8.35
10.15
12.11
14.22
113.6
227.1
340.7
454.3
567.8
681.4
794.9
908.5
1022.1
1135.6
1249.2
1362.8
SIST. MÉTRICO
0.03
0.12
0.25
0.42
0.64
0.89
1.19
1.52
1.89
2.30
2.74
3.22
Pérdida en psi por cada 100 pies de
UVCPQTJQJFT
Pérdida en bares por cada 100 metros de tubería
CBSFTN
Nota: No se recomienda el uso de tubería para los caudales indicados en las áreas con sombreado
PTDVSPZBRVFMBTWFMPDJEBEFTTVQFSBOMPTQJFTTNT
Rojo
Violeta
Amarillo
Negro
Verde
Tubería de rayas negras
El uso inteligente del agua.™
185
Xerigation®
Tubería de distribución XT-700
Xerigation®/Riego por goteo
Componentes de distribución
Sistema de accesorios de compresión Easy Fit
Sistema completo de accesorios de compresión y adaptadores
para todas las necesidades de conexión de tubería en un sistema
de bajo volumen
Q Reduce los costos de inventario: los accesorios de compresión para
diversos diámetros admiten un amplio rango de tamaños de tuberías de
polietileno de 1/2DN
%JÈNFUSPFYUFSOPEFBØNNB
17 mm)
Q Ahorra tiempo y esfuerzo: se requiere un 50% menos de fuerza para
conectar la tubería y los accesorios en comparación con los accesorios de
compresión de la competencia. Los adaptadores giran para una instalación
sencilla
Q #SJOEBNÈTGMFYJCJMJEBETFOFDFTJUBOTØMPUSFTBDDFTPSJPT&BTZ'JUZDJODP
Pérdida por fricción por cada accesorio
Caudal
gpm
Pérdida
psi
SIST. MÉTRICO
Caudal
l/h
Pérdida
bares
0.00
1.00
2.00
3.00
4.00
5.00
6.00
0.00
0.39
0.64
0.82
1.45
1.90
2.57
0.00
227.1
454.3
681.4
908.5
1135.6
1362.8
0.00
0.03
0.04
0.06
0.10
0.13
0.18
Nota: no se recomienda el uso de accesorios con los caudales indicados en el área con
sombreado oscuro. (La pérdida por fricción se muestra con la tubería XBS)
BEBQUBEPSFT&BTZ'JUQBSBIBDFSNÈTEFDPNCJOBDJPOFTEFDPOFYJPOFT
y se adapta a incontables situaciones de instalación y mantenimiento
Características
t'VODJPOBDPOUPEBTMBTUVCFSÓBTEFQPMJFUJMFOPEF1⁄2" (15 mm) de un diámetro
FYUFSOPEFNNJODMVTPFMTJTUFNBEFSJFHPQPSHPUFP9'%
9'4MBUVCFSÓBEFNNZPUSBTUVCFSÓBTZTJTUFNBTEFSJFHP
por goteo de 17 mm de Rain Bird
MDCFTEE
t-PTBDDFTPSJPTZBEBQUBEPSFTQBUFOUBEPTFTUÈONPMEFBEPT
en materiales de ABS duradero y resistentes a los rayos ultravioleta
t-PTUBQPOFTEFESFOBKFSFNPWJCMFTTFQVFEFOVTBSQBSBMBWBSFMFYUSFNP
de la línea y para tapar las líneas temporalmente a fin de expandirlas más
adelante
MDCFCOUP
MDCF75FHT
MDCF50MPT
MDCF75FPT
MDCFPCAP
Rango operativo
t1SFTJØOEFBQTJEFBCBSFT
t"ENJUFUVCFSÓBTDPOVOEJÈNFUSPFYUFSOPEFB
16 mm a 17 mm)
Modelos
t"DDFTPSJPT&BTZ'JU
MDCFCAP
MDCFEL
MDCF75MPT
MDCF50FPT
.%$'$061BDPQMBNJFOUP
.%$'&-DPEP
.%$'5&&5
t"EBQUBEPSFT&BTZ'JU
Xerigation®
.%$'.15BEBQUBEPSEFSPTDBNBDIPQBSBUVCFSÓBEF1/2" (1.9 cm)
.%$'.15BEBQUBEPSEFSPTDBNBDIPQBSBUVCFSÓBEF3/4" (1.9 cm)
.%$''15BEBQUBEPSEFSPTDBIFNCSBQBSBUVCFSÓBEF1/2" (1.9 cm)
.%$''15BEBQUBEPSEFSPTDBIFNCSBQBSBUVCFSÓBEF3/4" (1.9 cm)
.%$'')5BEBQUBEPSEFSPTDBIFNCSBQBSBNBOHVFSBEF3/4" (1.9 cm)
.%$'$"1UBQØOEFESFOBKFSFNPWJCMFQBSBBDDFTPSJPT&BTZ'JUOFHSP
.%$'1$"1UBQØOEFESFOBKFSFNPWJCMFQBSBBDDFTPSJPT&BTZ'JUWJPMFUB
para identificar el agua no potable)
Nota: Los adaptadores Easy Fit no son accesorios con conectores de punta.
Se deben usar solo con accesorios de compresión Easy Fit
186
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de distribución
Características
t4JNQMFEFVTBSHSBDJBTBMBUVCFSÓBGMFYJCMFRVFGBDJMJUBMBUBSFBEFSFHBSMBT
macetas y los jardines con macetas
- El tamaño de la tubería de 1/4” (6.3 mm) complementa la estética de
cualquier jardín
- Resistencia a las obstrucciones a través de la filtración incorporada y
dos orificios de salida, a 180 grados de distancia
t-BUVCFSÓBNBSSØODPNQMFNFOUBFMTJTUFNBEFSJFHPQPSHPUFP9'EF3BJO#JSE
- El tamaño discreto y la flexibilidad brindan un perfil bajo y medios
estéticamente agradables para regar las plantas
t'VODJPOBDPOMPTBDDFTPSJPTDPODPOFDUPSFTEFQVOUBEF1/4” (6.3 mm) de
Rain Bird.
t7JFOFFOFTQBDJBNJFOUPTwZw<BDN>
ZVOBMPOHJUVEEFSPMMP
de 100’ (30.5 m) para brindar flexibilidad de diseño
Características de caudal
Modelo
Caudal a 30 psi Espaciamiento
Largo de rollo
(gph) (l/h)
(pulg.) (cm)
(pies)
(m)
-%2 -%2 Rendimiento del sistema de riego paisajístico por goteo de ž" (6.3 mm)
SIST. MÉTRICO
Índice de caudal (l/h)
El sistema de riego por goteo de 1/4" (6.3 mm) de Rain Bird es la
opción perfecta para las áreas pequeñas como cajas para plantas,
jardines con macetas, el recorrido alrededor de los árboles, jardines
vegetales y arbustos
Índice de caudal (gph)
Sistema de riego paisajístico por goteo de
ž" (6.3 mm)
1.2
1.0
0.8
0.6
0.4
0.2
0.0
0 10 15
20 25 30
Presión (psi)
35
40
4.0
3.5
3.0
2.5
2.0
1.5
1.0
0.5
0.0
0
0.5
1.0 1.5 2.0 2.5
Presión (bares)
3.0
Rango operativo
tEFBQTJEFBCBSFT
t¶OEJDFEFDBVEBMBQTJCBSFT
HQIMI
t'JMUSBDJØOSFRVFSJEBNBMMBNJDSPOFT
Máxima longitud de riego (pies)
Especificaciones
t%JÈNFUSPFYUFSOPNN
t%JÈNFUSPJOUFSOPNN
t&TQFTPSEFMBQBSFENN
t&TQBDJBNJFOUPØDNZDN
t-BSHPCPCJOBTEFhN
Emisor
Espaciamiento
Máximo
Longitud del riego
Caudal por metro
a 15 psi
6"
12"
579.12 cm
1,005.84 cm
1 gph/pie
0.5 gph/pie
Modelos
Xerigation®
t-%2
t-%2
LDQ-08-06-100
Riego paisajístico por goteo de ž" (6.3
mm) para plantas en macetas
Ahorre agua y tiempo usando el sistema de riego paisajístico por goteo de 1/4" (6.3 mm) en canastas colgantes y plantas en macetas.
El uso inteligente del agua.™
187
Xerigation®/Riego por goteo
Herramientas y componentes de distribución
Accesorios transferencia de ¼” (6.3 mm)
Caja subterránea para emisor
Características
Características
t4FVTBQBSBDPOFDUBSMBUVCFSÓBEFEJTUSJCVDJØO92EF1⁄4" (6.3 mm) en
diferentes configuraciones o para sujetar la tubería de 1⁄4" (6.3 mm) a una
tubería de 1⁄2" (1.3 cm) ó 3⁄4" (1.9 cm)
t-PTDPOFDUPSFTEFOVFWPEJTF×PQPTFFODPOFDUPSFTBVUPQFSGPSBOUFTRVF
perforan fácilmente la tubería de 1/2” (1.3 cm) ó 3/4” (1.9 cm)
t&MEJTF×PEFMPTBDDFTPSJPTQFSNJUFVOBJOTUBMBDJØOTJNQMFZSÈQJEBDPOMB
herramienta Xeriman™9.500-
t&TUSVDUVSBEFQMÈTUJDPSFTJTUFOUF
t1SPQPSDJPOBVOBDDFTPDØNPEPBMFNJTPSTVCUFSSÈOFPZBMNJTNPUJFNQP
lo protege contra el vandalismo. Ideal para dispositivos de salidas múltiples
(como Xeri-Bird 8) y el kit de válvula de alivio de aire/vacío
t&MOVFWPDVFSQPNÈTHSBOEFQFSNJUFNÈTFTQBDJPQBSBMPTDPNQPOFOUFTZ
las tuberías de distribución
t&TUSVDUVSBUFSNPQMÈTUJDBGVFSUFSFTJTUFOUFBMPTSBZPTVMUSBWJPMFUB
t%JTQPOJCMFDPOUBQBOFHSB
Rango Operativo*
t"MUVSBDN
t%JÈNFUSPTVQFSJPSDN
t%JÈNFUSPEFMBCBTFDN
t1SFTJØOEFBQTJEFBCBSFT
* con tubería de polietileno
Modelos
t9#'$0//DPOFDUPSEFQVOUBEF1⁄4" (6.3 mm)
t9#'&-DPOFDUPSEFQVOUBYDPEPDPODPOFDUPSEFQVOUBEF1⁄4" (6.3 mm)
t9#'5&&DPOFDUPSEFQVOUBYDPOFDUPSEFQVOUBYDPOFDUPSEFQVOUBFO5EF
1
⁄4" (6.3 mm)
XBF1CONN
Dimensiones
XBF2EL
Modelo
t4&#9#
SEB 7XB
XBF3TEE
Xerigation®
Estaca galvanizada
para sujetar
Tapón para tubería
Cortador de tubería
Características
Características
Características
t6TBEPQBSBUBQBSMPTPSJGJDJPTOP
deseados en la tubería
t/VFWPEJTF×PRVFGVODJPOBDPOMB
herramienta Xeriman™9.500-
para una instalación rápida y fácil
t&MDPSUBEPSEFUVCFSÓBSFEJTF×BEP9FSJHBUJPOQFSNJUFDPSUFTNÈTMJNQJPTZ
fáciles de todas las tuberías de bajo volumen
t&MEJTF×PFYDMVTJWPQSPQPSDJPOBEPTSBOVSBTEFEJGFSFOUFUBNB×PVOPQBSB
una tubería de 1/2” (1.3 cm) - 3/4” (1.9 cm) y uno para una tubería de 1/4” (6.3
mm), para ejercer mayor presión, de manera que se necesite menos fuerza
para cortar cualquier tubería
t&MDPSUBEPSEFMBUVCFSÓBFTMJWJBOPDPOIPKBTEFBDFSPJOPYJEBCMF)BZIPKBT
EFSFQVFTUPEJTQPOJCMF11$9#-%
t6OBWBSJMMBEFBDFSPHBMWBOJ[BEP
calibre 12 viene previamente
doblada para grapar la tubería de
distribución, el sistema de riego
QPSHPUFPTFSJF9'PMBUVCFSÓB9#4
al nivel de la terminación
t-PTMBUFSBMFTDPOSBOVSBTBZVEBOB
asegurar la estaca al suelo
t'VFSUFEVSBEFSPZSFTJTUFOUFBMB
corrosión
Modelo
t&."(19
Modelo
t11$9$PSUBEPSEFUVCFSÓB
t11$9#-%IPKBEFSFQVFTUP
Modelo
t5%4DPODPEP
Diseño mejorado de dos
ranuras que permite
cortes limpios
TDS-050 con codo
EMA-GPX
PPC-200X
188
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Herramientas y componentes de conversión
Herramienta Xeriman™
Xeri-Caps™ para aspersores
Características
Características
t1PTJCJMJUBVOBJOTUBMBDJØOSÈQJEBGÈDJMZFOVOTPMPQBTPEFMPTNØEVMPT
compensadores de presión y los emisores Xeri-Bug™ directamente en
las tuberías de riego por goteo de 1/2” (1.3 cm) ó 3/4” (1.9 cm), el sistema de
SJFHPQPSHPUFPTFSJF9'PFMTJTUFNBEFSJFHPQBJTBKÓTUJDPQPSHPUFP
t3FEVDFFMUJFNQPEFJOTUBMBDJØOEFMFNJTPSFOVO
t-BIFSSBNJFOUB5PEPFOVOPJOTFSUBZSFUJSBFNJTPSFTDPMPDBBDDFTPSJPTDPO
conectores de punta de
1
/4” (6.3 mm) e instala tapones
t"ZVEBBSFUSPBEBQUBSVOTJTUFNBEFBTQFSTPSFTBVOTJTUFNBEFSJFHPQPSHPUFP
tapando los cabezales en desuso
Rango operativo
t1SFTJØOIBTUBQTJCBSFT
Dimensiones
t"ODIP1⁄4" (5.7 cm)
Modelo
Modelos
t9.500-
t9$DBCFFODVBMRVJFSDVFSQPEFBTQFSTPSEFMBTFSJFEF3BJO#JSE
Inserción de
Xeri-Bug™
en un solo paso
Remoción de
Xeri-Bug™
Inserción
para tapón
Rain Bird® XC-1800
XM-TOOL
Dimensiones
,JUTJNQMFRVFDPOWJFSUFGÈDJMNFOUFVOB[POBEFBTQFSTPSFT
convencional en una zona de riego por goteo
Características
t$VFSQPEFBTQFSTPSFTTFSJFRVFDPOUJFOFVOGJMUSPVOSFHVMBEPSEF
presión y una salida macho roscada de 1/2” (1.3 cm)
t1FSNJUFMBDPOWFSTJØODPOWFOJFOUFBMBUVCFSÓBEFSJFHPQPSHPUFPDVBOEPTF
VTBOMPTBDDFTPSJPT&BTZ'JUZVOBEBQUBEPSIFNCSB
- Se puede instalar por encima o por debajo del nivel de terreno
t&MFOTBNCMFJOUFSOPTFQVFEFRVJUBSZQBTBSGÈDJMNFOUFQPSFMDVFSQPEF
cualquier aspersor 1804, 1806 ó 1812 para retroadaptar el sistema existente a
los productos Xerigation
t1SPQPSDJPOBVOBSFHVMBDJØOEFQSFTJØOEFQTJCBSFT
Z
un filtro de malla 200 (75 micrones)
MDCF 50FPT
t4JFMDBVEBMEFSFUSPBEBQUBDJØOFTJOGFSJPSBHQNSFNQMBDF
la válvula electrónica por la válvula de caudal bajo de Rain Bird
t&OUSBEBIFNCSBSPTDBEBEF1/2” (1.3 cm)
t4BMJEBHJSBUPSJBEFSPTDBNBDIPEF
1
/2” (1.3 cm)
t"MUVSBDN
t"ODIPDN
Regulador de
presión de 30 psi
(2.1 bares)
Modelo
t3&530
Filtro de malla
200
T MDCF
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t1SFTJØOSFHVMBEBQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
Salida giratoria
de rosca macho
para tubería de
1
⁄2" (1.3 cm)
Cuerpo 1800
fuerte, resistente
a los rayos
ultravioleta
RETRO-1800
Convierte los cuerpos de
aspersores 1800 en un sistema
de riego por goteo
%JTF×BEPFTQFDÓGJDBNFOUFQBSBÈSFBTDPOSFTUSJDDJPOFTEFSJFHPOVFTUSPLJUEFSFFNQMB[PEFBTQFSTPSFTBSJFHPQPSHPUFPQFSNJUFFMVTPEF
los cuerpos de aspersores serie 1800 existentes como puntos de conexión para el riego por goteo.
El uso inteligente del agua.™
189
Xerigation®
Kit de reemplazo para convertir a riego
por goteo
Xerigation®/Riego por goteo
Guías de selección de la pirámide del kit de control de zona
Guía de selección para el kit de control de zona
Esta herramienta de selección fácil de usar está disponible en XXXSBJOCJSEDPN$;, y le ayudará a identificar el kit de control de
zona más adecuado para la aplicación.
XCZ-150-PRB-COM
CAUDAL: 15 - 40 gpm
CAUDAL:
XCZ-100-PRB-COM
CAUDAL: 3 - 20 gpm
CAUDAL:
CAUDAL: 3 - 15 gpm
CAUDAL: 3 - 20 gpm
XCZ-100-PRBR
CAUDAL: 3 - 20 gpm
Páginas
195 - 196
XCZF-100-PRF
CAUDAL: 3 - 15 gpm
XACZ-100-PRF
CAUDAL: 3 - 15 gpm
3 - 15 gpm
Xerigation®
XCZ-075-PRF
CAUDAL: 0.2 - 5 gpm
CAUDAL:
XCZ-100-PRB-LC
3 - 20 gpm
XCZ-100-PRF
CAUDAL:
Página
197
15 - 40 gpm
XCZF-175-PRF
CAUDAL: 3 - 15 gpm
3 - 10 gpm
XCZ-LF-100-PRF
CAUDAL: 0.2 - 5 gpm
Páginas
193 - 194
XACZ-075-PRF
CAUDAL: 0.2 - 5 gpm
Páginas
192 - 193
0.2 - 5 gpm
Guía de selección en línea para el kit de
control de zona
Los kits de control de zona de Rain Bird brindan todos los componentes necesarios
para el control de encendido y apagado, la filtración y la regulación de presión en
VOBTPMB[POBEFSJFHPQPSHPUFP%FFTUBNBOFSBFMFODBSHPFTNÈTTJNQMFZMB
instalación, más fácil.
Esta rápida herramienta de selección lo ayudará a encontrar el kit de control de
[POBBEFDVBEPQBSBTVBQMJDBDJØO%FTQVÏTEFSFTQPOEFSVOBTQPDBTQSFHVOUBT
sencillas, la guía de selección le ofrecerá los kits de control de zona recomendados
que mejor se adapten a su aplicación. Simplemente haga clic en la imagen del kit
para ver la información detallada y las especificaciones del mismo.
190
Características
t*ODMVZFEJCVKPTEFUBMMBEPTZ
especificaciones para cada kit
t%JTQPOJCMFFO
XXXSBJOCJSEDPN$;,
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Kits de control de zona
Los kits de control de zona de Rain Bird brindan todos los
componentes necesarios para el control de encendido y apagado,
MBGJMUSBDJØOZMBSFHVMBDJØOEFQSFTJØOFOVOTPMPQBRVFUF%FFTUB
manera, el encargo es más simple y la instalación, más fácil.
t-PTLJUTEFDPOUSPMEF[POBEF3BJO#JSETPOMPTLJUTNÈTDPOGJBCMFTZ
contienen productos revolucionarios como la válvula de bajo caudal, el filtro
DPOSFHVMBDJØOEFQSFTJØO13
FMGJMUSPDBOBTUB2VJDL$IFDLZFMGJMUSPDBOBTUB
2VJDL$IFDLDPOSFHVMBDJØOEFQSFTJØO13
t5PEPTMPTLJUTFOUPEBTMBTDBUFHPSÓBTFNQMFBOFMJOOPWBEPSGJMUSP13
que combina el filtro y el regulador de presión en una unidad. Este filtro
elimina un componente por separado para ayudar a evitar fugas durante la
instalación o durante la vida del kit en el campo. La mayoría de los kits de
filtros con regulación de presión vienen ensamblados para ahorrar tiempo de
instalación y evitar errores en campo
t3BJO#JSEPGSFDFMBMÓOFBNÈTDPNQMFUBEFLJUTEFDPOUSPMEF[POBQBSBRVFMPT
contratistas y especificadores tengan la flexibilidad de encontrar una solución
para cada caso en particular, de 0.2 a 40 gpm. Elija entre:
t"CFSUVSBEFFOUSBEBEF3⁄4", 1" ó 11⁄2" (1.9 cm; 2.5 cm ó 3.8 cm)
t7ÈMWVMBEFDBVEBMCBKPWÈMWVMBBOUJTJGØOWÈMWVMB%7PWÈMWVMB1&4#
t'JMUSP3#:SFHVMBEPSEFQSFTJØOGJMUSPDBOBTUB2VJDL$IFDLDPOSFHVMBDJØOEF
QSFTJØOPGJMUSPDBOBTUB2VJDL$IFDL
Use el siguiente cuadro para identificar el kit más adecuado o consulte las páginas 198 a 208 para obtener información detallada específica sobre estos kits y sus
DPNQPOFOUFTJOEJWJEVBMFT5BNCJÏOFTUÈEJTQPOJCMFMB(VÓBJOUFSBDUJWBEFTFMFDDJØOEFMBQJSÈNJEFEFMLJUEFDPOUSPMEF[POBDPOPSJFOUBDJØOQBSBSFBMJ[BSMBTFMFDDJØO
de productos e información de especificación detallada, que se encuentra en XXXSBJOCJSEDPN$;,
Cuadro de selección de zonas de control
Tamaño
Modelo
(Entrada x salida)
Caudal
Rango
Presión de entrada
Rango
Válvula
Filtro
Salida
Presión
CAUDAL ALTO PARA APLICACIONES COMERCIALES: 15-40 gpm
9$;13#$0.
›YB
HQN
QTJ
1&4#
'DBOBTUB132VJDL$IFDLEF
QTJ
CAUDAL MEDIO PARA APLICACIONES COMERCIALES: 3–20 gpm
9$;13#$0.
Y
HQN
QTJ
1&4#
'DBOBTUB132VJDL$IFDLEF
QTJ
9$;13#3
Y
HQN
QTJ
1&4#3
'JMUSPDBOBTUB13EF
QTJ
9$;13#-$
Y
HQN
QTJ
1("
'JMUSPDBOBTUB13EF
QTJ
9$;'13'
Y
HQN
QTJ
%7'
'JMUSP133#:EF
QTJ
9$;'13'
Y£
HQN
QTJ
%7'
'JMUSP133#:EF
QTJ
9$;13'
Y
HQN
QTJ
%7
'JMUSP133#:EF
QTJ
9"$;13'
Y
HQN
QTJ
"47'
'JMUSP133#:EF
QTJ
CAUDAL BAJO PARA APLICACIONES COMERCIALES LIVIANAS/RESIDENCIALES: 0.2–5 gpm
9$;-'13'
Y£
HQN
QTJ
-'7
'JMUSP133#:EF
QTJ
9$;13'
Y£
HQN
QTJ
-'7
'JMUSP133#:EF
QTJ
9"$;13'
Y£
HQN
QTJ
"47-'7
'JMUSP133#:EF
QTJ
*Disponible con roscas BSP
Combine un kit de control de zona de Xerigation con un producto controlador de Rain Bird para regular los tiempos de riego de la zona
con precisión.
El uso inteligente del agua.™
191
Xerigation®
CAUDAL MEDIO PARA APLICACIONES COMERCIALES LIVIANAS/RESIDENCIALES: 3-15 gpm
Xerigation®/Riego por goteo
Componentes de control de zona
Kits de control de zona de caudal bajo
con filtro PR
Presión de entrada mínima para una presión de salida de 30 psi
Q ,JUTEFDPOUSPMEF[POBDPOGJBCMFTRVFJODMVZFOMBWÈMWVMBEFDBVEBMCBKPMB
única válvula en el mercado que puede manejar caudales bajos (menos de
3 gpm) sin goteo
Q ,JUTNÈTQFRVF×PTDPOTØMPEPTDPNQPOFOUFTWÈMWVMBNÈTGJMUSPDPO
regulación de presión), que permite adaptar más kits de control de zona en
una caja de válvula, lo cual permite ahorrar tiempo y dinero
Caudal (gpm)
Presión de entrada (psi)
XCZ-075-PRF
XCZ-LF-100-PRF
0.2
1.0
3.0
5.0
34.4
36.1
38.1
43.4
34.6
36.5
38.1
42.0
Q Estos kits de filtros con regulación de presión (PR) proporcionan el control
de encendido y apagado, la filtración y la regulación de presión con menos
componentes, para que haya menos posibilidades de pérdida en las
conexiones, tanto durante la instalación como durante la vida útil del sistema
Presión de entrada mínima para una presión de salida de 2.1 bares
Rango operativo
Caudal (l/min)
Presión de entrada (bares)
XCZ-075-PRF
XCZ-LF-100-PRF
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t1SFTJØOSFHVMBEBQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
0.8
3.8
11.4
18.9
2.4
2.5
2.6
3.0
2.4
2.5
2.6
2.9
Modelos
t9$;13'WÈMWVMBEFDBVEBMCBKPEF3/4wDN
DPOGJMUSP133#:EF
3
/4” (1.9 cm) (ensamblada)
t9$;-'13'7ÈMWVMBEFDBVEBMCBKPEFDN
DPOGJMUSP133#:EF
3
⁄4" (1.9 cm)
Malla de repuesto
t3#:44.9NBMMBEFBDFSPJOPYJEBCMF
¡Viene do!
bla
s
n
e am
Malla de
acero
inoxidable
Cuatro kits de control
de zona en una
caja de válvulas
estándar
Xerigation®
CZ-075-PRF
Malla de
acero
inoxidable
CZ-LF-100-PRF
192
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Kits de control de zona de caudal bajo
con válvula antisifón y filtro PR
Kits de control de zona de caudal medio
con válvula antisifón y filtro PR
Q ,JUTEFDPOUSPMEF[POBDPOGJBCMFTRVFJODMVZFOMBWÈMWVMBEFDBVEBMCBKP
Q Los kits de control de zona completos de dos piezas incluyen la válvula
la única válvula en el mercado que puede manejar caudales bajos (menos
de 3 gpm) sin goteo
Q Los kits de control de zona completos de dos piezas incluyen la válvula
antisifón de caudal bajo, probada en campo, que posee una válvula vacuo
reguladora para prevenir el retrocaudal y una clasificación de IAPMO
Q Estos kits de filtros PR proporcionan el control de encendido y apagado,
la filtración y la regulación de presión con sólo dos piezas, para que haya
menos posibilidades de pérdida en las conexiones, en la instalación y
durante la vida útil del sistema
Rango operativo
"47'QSPCBEBFODBNQPRVFQPTFFVOBWÈMWVMBWBDVPSFHVMBEPSBQBSB
prevenir el retrocaudal y una clasificación de IAPMO
Q Estos kits de filtros PR proporcionan el control de encendido y apagado,
la filtración y la regulación de presión con sólo dos piezas, para que haya
menos posibilidades de pérdida en las conexiones, en la instalación y
durante la vida útil del sistema
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJØOSFHVMBEBQTJCBSFT
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJØOSFHVMBEBQTJCBSFT
Modelos
Modelos
Malla de repuesto
t9"$;13'"47'EFDN
DPOGJMUSP133#:EFDN
t9"$;13'WÈMWVMBBOUJTJGØOEFDBVEBMCBKPEF3⁄4" (1.9 cm) con filtro
133#:EF3⁄4" (1.9 cm)
t3#:44.9NBMMB
de acero inoxidable)
Malla de repuesto
Malla de
acero
inoxidable
t3#:44.9NBMMBEFBDFSP
inoxidable)
ACZ-100-PRF
ACZ-075-PRF
Presión de entrada mínima para una presión de salida de 30 psi
Caudal (gpm)
Presión de entrada (psi)
XACZ-075-PRF
0.2
1.0
3.0
5.0
37.4
39.1
40.0
49.7
Presión de entrada mínima para una presión de salida de 2.1 bares
Caudal (l/min)
Presión de entrada (bares)
XACZ-075-PRF
0.8
3.8
11.4
18.9
2.6
2.7
2.8
3.4
El uso inteligente del agua.™
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
Presión de entrada (psi)
XACZ-100-PRF
3.0
5.0
7.0
9.0
11.0
13.0
15.0
43.3
44.7
46.2
47.3
50.8
55.4
59.7
Xerigation®
Malla de
acero
inoxidable
Presión de entrada mínima para una presión de salida de 2.8 bares
Caudal (l/min)
Presión de entrada (bares)
XACZ-100-PRF
11.4
18.9
26.5
34.1
41.6
49.2
56.8
3.0
3.1
3.2
3.3
3.5
3.8
4.1
193
Xerigation®/Riego por goteo
Componentes de control de zona
Kits de control de zona de caudal medio
con filtro PR, control de caudal
Kits de control de zona de caudal medio
con filtro PR
Q ,JUEFDPOUSPMEF[POBDPOGJBCMFRVFJODMVZFVOBWÈMWVMB%7DPODPOUSPMEF
Q ,JUTNÈTQFRVF×PTDPOTØMPEPTDPNQPOFOUFTWÈMWVMBNÈTGJMUSPDPO
caudal para una sintonización del sistema más fácil
Q Estos kits de filtros PR proporcionan el control de encendido y apagado,
la filtración y la regulación de presión con sólo dos piezas, para que haya
menos posibilidades de pérdida en las conexiones, en la instalación y
durante la vida útil del sistema
Rango operativo
regulación de presión), que permite adaptar más kits de control de zona
en una caja de válvula, lo cual permite ahorrar tiempo y dinero
Q Estos kits de filtros PR proporcionan el control de encendido y apagado,
la filtración y la regulación de presión con sólo dos piezas, para que haya
menos posibilidades de pérdida en las conexiones, en la instalación y
durante la vida útil del sistema
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJØOSFHVMBEBQTJCBSFT
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t1SFTJØOSFHVMBEBQTJCBSFT
Modelos
t9$;'13'WÈMWVMB%7'EFwDPOGJMUSP13EFwZBDDFTPSJPT.%$'
(tubería de 16-17 mm)
Malla de repuesto
t3#:44.9NBMMBEFBDFSPJOPYJEBCMF
Modelos
t9$;13'7ÈMWVMB%7EFDN
DPOGJMUSP133#:EFDN
FOTBNCMBEB
t9$;'13'WÈMWVMB%7EFwDPOGJMUSP13EFwZBDDFTPSJPT.%$'
UVCFSÓBEFNN
*Disponible con roscas BSP
Malla de repuesto
t3#:44.9NBMMBEFBDFSPJOPYJEBCMF
Malla de
acero
inoxidable
vienen
Ambasadas.
arm
Malla de
acero
inoxidable
CZ-100-PRF
Xerigation®
CZF-175-PRF
CZF-100-PRF
Presión de entrada mínima para una presión de salida de 30 psi
Caudal (gpm)
3.0
5.0
10.0
15.0
Presión de entrada (psi)
XCZF-175-PRF
32.7
36.4
56.7
75.5
Presión de entrada mínima para una presión de salida de 2.1 bares
Caudal (l/min)
11.4
18.9
37.9
56.8
194
Presión de entrada (bares)
XCZF-175-PRF
2.3
2.5
3.9
5.2
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
3.0
5.0
10.0
15.0
Presión de entrada (psi)
XCZ-100-PRF
42.9
44.1
48.5
55.5
Presión de entrada (psi)
XCZF-100-PRF
40.3
42.1
54.2
68.6
Presión de entrada mínima para una presión de salida de 2.8 bares
Caudal (l/min)
11.4
18.9
37.9
56.8
Presión de entrada (bares)
XCZ-100-PRF
3.0
3.0
3.3
3.8
Presión de entrada (bares)
XCZF-100-PRF
2.8
2.9
3.7
4.7
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Kits de control de zona para aplicaciones NUEVO
comerciales pequeñas de caudal medio con
filtro canasta y regulación de presión
Q El kit completo es el kit de control de zona más simple y confiable para
aplicaciones comerciales de entre 5 y 20 gpm (11 y 76 l/min)
Q Contiene la válvula PGA confiable, flexible y probada con el resistente filtro
canasta regulador de presión
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
Presión de entrada (psi)
XCZ-100-PRB-LC
5.0
10.0
15.0
20.0
43.0
48.0
56.0
65.0
Q Este kit de filtros PR proporciona el control de encendido y apagado, la
filtración y la regulación de presión con sólo dos piezas, para que haya
menos posibilidades de pérdida en las conexiones, en la instalación y
durante la vida útil del sistema
Q La característica antiderrame de la canasta asegura que la suciedad no
caiga de nuevo en el filtro durante la operación de limpieza. La punta
roscada con junta tórica facilita el trabajo de quitar y limpiar la malla de
acero inoxidable
Rango operativo
Presión de entrada mínima para una presión de salida de 2.8 bares
Caudal (l/min)
Presión de entrada (bares)
XCZ-100-PRB-LC
18.9
37.9
56.8
75.7
2.9
3.3
3.8
4.5
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t3FHVMBEPSEFQSFTJØOQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB'$
Modelo
t9$;13#-$WÈMWVMB1("EFDN
DPOGJMUSPDBOBTUBSFHVMBEPSEF
presión de 1" (2.5 cm) y 40 psi (2.8 bares)
Mallas de filtro de repuesto
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFSPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFWFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFCMBODP
Cubierta de repuesto
Xerigation®
t#'$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
Malla de
acero
inoxidable
CZ-100-PRB-LC
El uso inteligente del agua.™
195
Xerigation®/Riego por goteo
Componentes de control de zona
Kit de control de zona para aplicaciones
comerciales de caudal medio con filtro
canasta regulador de presión
NUEVO
Q El kit completo es el kit de control de zona más simple y confiable para
aplicaciones comerciales de entre 3 y 20 gpm (11 y 76 l/min)
Q Contiene la confiable y probada válvula PESB que brinda una acción
de cepillado patentada. Esto hace que el kit sea ideal para aplicaciones
comerciales con agua sucia
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
3
5
10
15
20
Presión de entrada (psi)
XCZ-PRB-100-COM
42.0
44.0
47.3
53.0
62.5
Presión de entrada (psi)
XCZ-100-PRBR
—
45.0
49.0
57.0
—
Q *ODMVZFFMGJMUSPDBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJØODPOVOJOEJDBEPS
claro que va del verde al rojo para avisar cuándo es necesario limpiar el
filtro. Esto reduce el mantenimiento y ya no habrá que adivinar cuándo
hay que limpiar el filtro. Además, la punta roscada facilita el trabajo de
quitar y limpiar la malla de acero inoxidable
Q El filtro canasta y el regulador de presión se han combinado en un filtro
DBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJØOVONÈTQFRVF×PRVFMB
unidad anterior
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t3FHVMBEPSEFQSFTJØOQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB¡'¡$
Presión de entrada mínima para una presión de salida de 2.8 bares
Caudal (l/min)
11.4
18.9
37.9
56.8
75.7
Presión de entrada (bares)
XCZ-PRB-100-COM
2.9
3.0
3.3
3.6
4.3
Presión de entrada (bares)
XCZ-100-PRBR
—
3.1
3.4
3.9
—
Modelos
t9$;13#$0.WÈMWVMBEFCPMBEFDN
DPOWÈMWVMB1&4#EF
DN
ZGJMUSPDBOBTUBSFHVMBEPSEFQSFTJØO2VJDL$IFDLEFDN
ZQTJ
(2.8 bares)
t9$;13#3WÈMWVMB1&4#3EFwDN
ZGJMUSPDBOBTUBSFHVMBEPSEF
presión de 40 psi (2.8 bares)
Malla de repuesto
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
Cubierta de repuesto
Xerigation®
t2,$),$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
XCZ-100-PRBR
Malla de
acero
inoxidable
CZ-PRB-100-COM
196
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
NUEVO
Kit de control de zona de caudal alto
para aplicaciones comerciales con 2 filtros
canasta reguladores de presión
Q El kit de control de zona de mayor caudal en el mercado para grandes zonas
comerciales de riego por goteo de 15 a 40 gpm (de 56.8 a 151.4 l/m)
Q $POUJFOFMBDPOGJBCMFZQSPCBEBWÈMWVMB1&4#EF›DN
RVFCSJOEBVOB
acción de cepillado patentada. Esto hace que el kit sea ideal para aplicaciones
comerciales con agua sucia
Q *ODMVZFGJMUSPTDBOBTUB2VJDL$IFDLSFHVMBEPSFTEFQSFTJØODPOVOJOEJDBEPS
claro que va del verde al rojo para avisar cuándo es necesario limpiar el filtro.
Esto reduce el mantenimiento y ya no habrá que adivinar cuándo hay que
limpiar el filtro. Además, la punta roscada facilita el trabajo de quitar y limpiar
la malla de acero inoxidable
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
Presión de entrada (psi)
XCZ-PRB-150-COM
15.0
20.0
25.0
30.0
35.0
40.0
40.0
49.0
50.2
53.5
56.1
60.7
Presión de entrada mínima para una presión de salida de 2.8 bares
Q El filtro canasta y el regulador de presión se han combinado en un filtro
DBOBTUB2VJDL$IFDLSFHVMBEPSEFQSFTJØOVONÈTQFRVF×PRVFMB
unidad anterior
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t3FHVMBEPSEFQSFTJØOQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB¡'¡$
Caudal (l/min)
Presión de entrada (bares)
XCZ-PRB-150-COM
56.8
75.7
94.7
113.6
132.5
151.4
2.8
3.4
3.5
3.7
3.9
4.2
Modelos
t9$;13#$0.WÈMWVMB1&4#EFDN
DPOGJMUSPTDBOBTUB2VJDL
Check reguladores de presión de 1" (2.5 cm) y 40 psi (2.8 bares)
Malla de repuesto
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
t2,$),.NBMMBEFBDFSPJOPYJEBCMF
Cubierta de repuesto
Malla de
acero
inoxidable
Xerigation®
t2,$),$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
Malla de
acero
inoxidable
CZ-PRB-150-COM
El uso inteligente del agua.™
197
Xerigation®/Riego por goteo
Componentes de control de zona
Válvulas de caudal bajo
Características de pérdida de presión:
Válvulas diseñadas exclusivamente para los índices de caudal bajo
de un sistema de riego por goteo (0.2 a 8 gpm; 0.6 a 30 l/m)
Q Las únicas válvulas en la industria realizadas específicamente para los
sistemas de riego por goteo, lo cual las convierte en las únicas válvulas
RVFQVFEFONBOFKBSEFGPSNBFGJDB[MPTÓOEJDFTEFDBVEBMCBKP%JTF×P
patentado
Q Estas válvulas contienen todas las características de las confiables válvulas
%7P"47'EF3BJO#JSEKVOUPDPOVOEJTF×PEFEJBGSBHNBÞOJDPRVF
permite que las partículas circulen a índices de caudal extremadamente
bajos, y así se evita que la válvula gotee
Q Permite colocar el filtro de forma segura a corriente descendente de la
válvula ya que estas válvulas manejan todos los tamaños de partículas
Características
1
t%JBGSBHNBÞOJDPEFiEPCMFDVDIJMMBwDPOBTJFOUPEF /2" (1.3 cm) de diámetro
para lograr un funcionamiento perfecto a bajos índices de caudal
t-BWÈMWVMBEFDBVEBMCBKPFTUÈEJTQPOJCMFFOVONPEFMPFOMÓOFBEF3/4” (1.9
cm) y la válvula antisifón de 3/4” (1.9 cm)
t%JTF×PEFDBVEBMQJMPUPDPOEPCMFGJMUSBDJØOQBSBVOBNÈYJNBDPOGJBCJMJEBE
t1VSHBFYUFSOBQBSBMJNQJBSFMTJTUFNBNBOVBMNFOUFZRVJUBSMBTQBSUÓDVMBTEF
suciedad durante la instalación y la puesta en marcha del sistema
t1VSHBJOUFSOBQBSBVOBPQFSBDJØONBOVBMFOTFDP
Caudal
gpm
LFV-075
psi
LFV-100
psi
ASV-LF-075
psi
0.2
1.0
2.0
4.0
6.0
8.0
3.0
3.2
3.3
3.6
4.2
5.1
3.0
3.2
3.3
3.6
4.2
5.1
2.5
3.1
3.7
4.6
5.3
5.7
Características de pérdida de presión
SIST. MÉTRICO
Caudal
l/m
LFV-075
bares
LFV-100
bares
ASV-LF-075
bares
0.6
3.6
7.8
15.0
22.8
30.0
0.21
0.22
0.23
0.25
0.28
0.35
0.21
0.22
0.23
0.25
0.28
0.35
0.17
0.22
0.27
0.31
0.35
0.39
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFBQTJEFBCBSFT
Especificaciones eléctricas
t4PMFOPJEFEF7$"B)[DJDMPTTFH
t$PSSJFOUFEFFOUSBEB7"
B)[
t$PSSJFOUFEFSFUFODJØO"7"
Modelos
t-'77ÈMWVMB%7EFDBVEBMCBKPEF3⁄4" (20 mm)
t-'7WÈMWVMB%7EFDBVEBMCBKPEFDN
ASV-LF-075
Xerigation®
t"47-'7ÈMWVMBBOUJTJGØOEFDBVEBMCBKPEF3⁄4" (20 mm)
*Disponible con roscas BSP
Diafragma de repuesto
t-'7%*"1)3.QJF[BEFSFQVFTUPEFM
diafragma de la válvula de caudal bajo
Diseño de diafragma único
LFV-075
198
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Filtro regulador de presión (RBY)
La exclusiva unidad compacta que combina filtración y regulación
de presión en una pieza para la protección de los componentes de
corriente descendente en los sistemas de riego por goteo
Q Reduce la cantidad de componentes en una zona de control. Así, es más
pequeña y más fácil de instalar. Se pueden adaptar más zonas de control
a una caja de válvulas
Q La unidad de combinación reduce la cantidad de conexiones, lo cual hace
que la instalación sea más sencilla y rápida
Q Mayor confiabilidad: menos piezas y menos conexiones roscadas para
que haya menos posibilidades de que se produzca una pérdida en la
instalación y durante la vida útil del sistema
Características de pérdida de presión:
Caudal
gpm
PRF-075-RBY
psi
PRF-100-RBY
psi
3.0
5.0
6.1
10.0
/%
/%
/%
/%
/%
0.8
2.0
Características de pérdida de presión:
SIST. MÉTRICO
Características
t&MGJMUSPFTUÈUJDP3#:SFHVMBMBQSFTJØOBVOBOPNJOBMEFØQTJØ
bares)
-BDVCJFSUBEFMGJMUSP133#:UJFOFVOFNQBMNFEFKVOUBUØSJDBZTF
desenrosca para proporcionar acceso al filtro, a fin de facilitar la limpieza
t&MSFHVMBEPSEFQSFTJØOEFØQTJØCBSFT
FTUÈJOUFHSBEPFOFM
cuerpo del filtro
t&MDVFSQPSFTJTUFOUFZMBDVCJFSUBFTUÈOIFDIPTEFQPMJQSPQJMFOPDPOGJCSBEF
vidrio y brindan un índice de presión de 150 psi (10.3 bares)
t'VODJPOBDPOUPEBTMBTWÈMWVMBTQBSBDSFBSVOB[POBEFDPOUSPMTJNQMFZ
eficiente
Caudal
l/m
PRF-075-RBY
bares
PRF-100-RBY
bares
11.4
18.9
0.42
0.69
/%
/%
/%
/%
/%
0.06
0.14
Nota: pérdida de presión correspondiente a un filtro de malla 200
t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMBEFBDFSPJOPYJEBCMF
micrones) (los elementos de repuesto del filtro están disponibles sólo para el
GJMUSP3#:
Rango operativo
t$BVEBM
- unidades de 3⁄4" (14.6 cm): de 0.20 a 5 GPM (de 0.8 a 18.9 l/m)
Malla de
acero
inoxidable
- unidades de 1" (2.5 cm): de 3 a 15 GPM (de 11.4 a 56.8 l/m)
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t1SFTJØOSFHVMBEB
- unidades de 3⁄4" (14.6 cm): 30 psi (2.1 bares)
Xerigation®
- unidades de 1" (2.5 cm): 40 psi (2.8 bares)
t'JMUSBDJØONBMMBNJDSPOFT
Modelos
t13'3#:'133#:EF3/4" (20 mm)
t13'3#:GJMUSP133#:EFDN
*Disponible con roscas BSP
Malla de repuesto
t3#:44.9NBMMBEFBDFSPJOPYJEBCMF
El uso inteligente del agua.™
RF-075-RBY y PRF-100-RBY
Componentes
de los kits de
control de zona
en las páginas
192-198
199
Xerigation®/Riego por goteo
Componentes de control de zona
Filtro RBY en línea
Características de pérdida de presión:
El filtro estático ayuda a evitar las obstrucciones en un sistema de
riego por goteo
Q Un filtro simple y confiable para los sistemas de riego por goteo
Q 'ÈDJMEFMJNQJBSZBRVFMBDVCJFSUBUJFOFVOFNQBMNFEFKVOUBUØSJDBZTF
desenrosca para proporcionar acceso al filtro
Q 'VFSUFZDPOGJBCMFEFCJEPBTVEJTF×PSFTJTUFOUFZFTUSVDUVSBEF
polipropileno con fibra de vidrio
Características
t$POFYJPOFTEFSPTDBNBDIPYNBDIPQBSBDPOFDUBSEJSFDUBNFOUFDPOMBT
válvulas y los reguladores de presión
t-PTFMFNFOUPTEFSFQVFTUPEFMGJMUSPFTUÈOEJTQPOJCMFFOVOBNBMMB
(75 micrones)
Índice de caudal
gpm
RBY075MPTX
psi
RBY100MPTX
psi
1.00
3.00
5.0
7.0
9.0
12.0
14.0
16.0
18.0
0.1
0.4
1.1
1.6
2.7
4.5
----
0.1
0.3
0.5
0.8
1.4
2.2
3.0
3.8
4.7
Características de pérdida de presión:
SIST. MÉTRICO
Rango operativo
t$BVEBM
- unidades de 3⁄4" (14.6 cm): de 0.20 a 12.0 gpm (de 0.8 a 45.4 l/m)
- unidades de 1" (2.5 cm): de 0.20 a 18 gpm (de 0.8 a 68.1 l/m)
t1SFTJØOEFBQTJEFBCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
Modelos
t3#:.159GJMUSP3#:FOMÓOFBEF3/4" (20 mm) con malla 200:
t3#:.159GJMUSP3#:FOMÓOFBEFwDN
DPONBMMB
* Disponible con roscas BSP
Malla de repuesto:
t3#:44.9NBMMBEFBDFSPJOPYJEBCMF
Índice de caudal
l/m
RBY075MPTX
bares
RBY100MPTX
bares
0.8
3.8
11.4
18.9
26.5
34.1
45.4
53.0
60.6
68.1
0.00
0.01
0.03
0.08
0.11
0.19
0.31
----
0.00
0.01
0.02
0.03
0.06
0.10
0.15
0.21
0.26
0.32
Nota: pérdida de presión correspondiente a un filtro de malla 200
Xerigation®
RBY075MPTX
200
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Filtro canasta Quick Check
Características de pérdida de presión - QKCHK-075
El único filtro de uso comercial con un indicador de sucio o limpio
para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: el indicador le
avisa cuándo se debe limpiar el filtro, sin tener que adivinar cuál es el
momento de hacerlo
Q Brinda mayor confiabilidad: la característica antiderrame asegura que la
suciedad no caiga de nuevo en el filtro durante la operación de limpieza
Q Simplifica la instalación y el mantenimiento: la parte superior roscada con
empalme de junta tórica hace que sea fácil quitar y limpiar la malla
Índice de caudal
gpm
filtro de malla 200/150 psi
psi
0.20
2.00
4.00
6.0
8.0
10.0
12.0
0.0
0.0
0.1
0.4
0.9
1.3
2.0
Características
Características de pérdida de presión - QKCHK-075 SIST. MÉTRICO
t%JTQPOJCMFFONPEFMPTEF3/4" (1.9 cm) y 1" (2.5 cm)
t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMBNJDSPOFT
EFBDFSP
inoxidable (también hay otros tamaños disponibles)
t5BNCJÏOEJTQPOJCMFFOLJUTEFDPOUSPMEF[POBEFBQMJDBDJØODPNFSDJBM9$;
13#$0.Z9$;13#$0.
Índice de caudal
l/m
malla 75/100 micrones
bares
0.8
7.6
15.1
22.7
30.3
37.9
45.4
0.00
0.00
0.01
0.03
0.06
0.09
0.14
Rango operativo
t$BVEBM
- filtro canasta de 3/4" (20 mm): de 0.20 a 12.0 gpm (de 0.8 a 45.4 l/m)
'JMUSPDBOBTUBEFDN
EFBHQNEFBMN
t1SFTJØOEFBQTJEFBCBSFT
Modelos
*Disponible con roscas BSP
Mallas de filtro de repuesto
t2,$),.GJMUSPEFNBMMBSPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFCMBODP
Cubierta de repuesto
t2,$),$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
Características de pérdida de presión - QKCHK-100
Índice de caudal
gpm
filtro de malla 200/150 psi
psi
3.0
5.0
7.0
9.0
11.0
14.0
17.0
20.0
0.0
0.0
0.4
0.7
1.1
1.6
2.3
3.2
Xerigation®
t2,$),GJMUSPDBOBTUBEF3/4" (20 mm) con malla 200:
t2,$),GJMUSPDBOBTUBEFDN
DPONBMMBEFBDFSPJOPYJEBCMF
Características de pérdida de presión - QKCHK-100 SIST. MÉTRICO
Malla de
acero
inoxidable
Índice de caudal
l/m
malla 75/100 micrones
bares
11.4
18.9
26.5
34.1
41.6
53.0
64.4
75.7
0.01
0.01
0.03
0.05
0.08
0.11
0.16
0.22
Nota: pérdida de presión correspondiente a un filtro de malla 200
KCHK-075
El uso inteligente del agua.™
201
Xerigation®/Riego por goteo
Componentes de control de zona
Filtros canasta reguladores de presión
NUEVO
Presión de entrada mínima para una presión de salida de 40 psi
El único filtro de uso comercial con regulador de presión
incorporado para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: su superficie
es un 40% más grande que la de los filtros estándar, lo cual implica una
menor frecuencia de limpieza
Q Brinda mayor confiabilidad: la característica antiderrame asegura que la
suciedad no caiga de nuevo en el filtro durante la operación de limpieza
Caudal (gpm)
Presión de entrada (psi)
PRB-100
3.0
5.0
10.0
15.0
20.0
40.0
40.0
42.6
48.2
60.0
Q Simplifica la instalación y el mantenimiento: la parte superior roscada con
empalme de junta tórica hace que sea fácil quitar y limpiar la malla de
acero inoxidable
Presión de entrada mínima para una presión de salida de 2.8 bares
Q %JTF×PFGJDJFOUFDPNCJOBGJMUSBDJØOZSFHVMBDJØOFOVOBTPMBVOJEBE
Caudal (l/min)
Presión de entrada (bares)
PRB-100
11.4
18.9
37.9
56.8
75.7
2.8
2.8
2.9
3.3
4.1
compacta con menos conexiones
Características
t%JTQPOJCMFFOFMNPEFMPEFDN
t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMBNJDSPOFT
EFBDFSP
inoxidable (también hay otros tamaños disponibles)
t3FHVMBEPSEFQSFTJØOJODPSQPSBEPEFQTJCBSFT
t5BNCJÏOFTUÈEJTQPOJCMFFOMPTLJUTEFDPOUSPMEF[POBQBSBBQMJDBDJPOFT
DPNFSDJBMFTMJWJBOBT9$;13#-$
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t3FHVMBEPSEFQSFTJØOQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB'$
Modelos
t13#GJMUSPDBOBTUBEFDN
DPOSFHVMBEPSEF
presión incorporado (40 psi) y malla 200 (75 micrones)
de acero inoxidable
Componentes
de los kits de
control de zona
en las páginas
192-198
Malla de
acero
inoxidable
Mallas de filtro de repuesto
Xerigation®
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFSPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFWFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFCMBODP
Cubierta de repuesto
t#'$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
PRB-100
BFCAP
202
El uso inteligente del agua.™
Xerigation®/Riego por goteo
www.rainbird.com/drip
Componentes de control de zona
Filtros canasta Quick-Check
reguladores de presión
NUEVO
El único filtro comercial con regulador de presión incorporado e
indicador de sucio o limpio para las zonas de riego por goteo
Q Reduce el mantenimiento y los costos de mano de obra: el indicador le
avisa cuándo se debe limpiar el filtro, sin tener que adivinar cuál es el
momento de hacerlo
Q Brinda mayor confiabilidad: la característica antiderrame asegura que la
Presión de entrada mínima para una presión de salida de 40 psi
Caudal (gpm)
Presión de entrada (psi)
PRB-QKCHK-100
3.0
5.0
10.0
15.0
20.0
40.0
40.0
42.6
48.2
56.4
suciedad no caiga de nuevo en el filtro durante la operación de limpieza
Q Simplifica la instalación y el mantenimiento: la parte superior roscada con
empalme de junta tórica hace que sea fácil quitar y limpiar la malla de
acero inoxidable
Q %JTF×PFGJDJFOUFDPNCJOBGJMUSBDJØOZSFHVMBDJØOFOVOBTPMBVOJEBE
compacta con menos conexiones
Características
t%JTQPOJCMFFOFMNPEFMPEFDN
t7JFOFQSFFOTBNCMBEPDPOVOGJMUSPEFNBMMBNJDSPOFT
EFBDFSP
inoxidable (también hay otros tamaños disponibles)
t3FHVMBEPSEFQSFTJØOJODPSQPSBEPEFQTJCBSFT
t5BNCJÏOEJTQPOJCMFFOLJUTEFDPOUSPMEF[POBEFBQMJDBDJØODPNFSDJBM9$;
13#$0.Z9$;13#$0.
Presión de entrada mínima para una presión de salida de 2.8 bares
Caudal (l/min)
Presión de entrada (bares)
PRB-QKCHK-100
11.4
18.9
37.9
56.8
75.7
2.8
2.8
2.9
3.3
3.9
Rango operativo
t$BVEBMEFBHQNEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
t3FHVMBEPSEFQSFTJØOQTJCBSFT
t'JMUSBDJØONBMMBNJDSPOFT
EFBDFSPJOPYJEBCMF
t5FNQFSBUVSBIBTUB¡'¡$
Componentes
de los kits de
control de zona
en las páginas
192-198
Modelos
t13#2,$),GJMUSPDBOBTUBEFDN
DPOSFHVMBEPSEFQSFTJØO
incorporado (40 psi) y malla 200 (75 micrones) de acero inoxidable
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFSPKP
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFWFSEF
t2,$),.GJMUSPEFNBMMBEFBDFSPJOPYJEBCMFCMBODP
Xerigation®
Malla de
acero
inoxidable
Mallas de filtro de repuesto
Cubierta de repuesto
t2,$),$"1$VCJFSUBDPNQMFUBDPOKVOUBUØSJDB
RB-QKCHK-100
El uso inteligente del agua.™
203
Xerigation®/Riego por goteo
Componentes de control de zona
Reguladores de presión en línea
Regulador de presión de retroadaptación
Características
Características
t4FQVFEFJOTUBMBSQPSFODJNBPQPSEFCBKPEFMOJWFMEFUFSSFOP
t1SFTJPOFTEFTBMJEBQSFFTUBCMFDJEBTQTJCBSFT
ZQTJCBSFT
t&OUSBEBZTBMJEBIFNCSBSPTDBEBDPONBDIPEFSPTDBQBSBUVCFSÓBTEF3⁄4"
(1.9 cm) o 1" (2.5 cm)
t1SPQPSDJPOBVOBDPOWFOJFOUFSFHVMBDJØOEFQSFTJØOEFQTJCBSFT
en la tubería de elevación para cualquier dispositivo de emisión con rosca
hembra para tubería de 1/2” (1.3 cm) o adaptador de compresión
t4FQVFEFJOTUBMBSQPSFODJNBPQPSEFCBKPEFMOJWFMEFUFSSFOP
t4FQVFEFVTBSDPOFMEJTQPTJUJWPEFFNJTJØOEFTBMJEBTNÞMUJQMFT9FSJ#JSE™ 8
(consulte la pág. 167)
Rango operativo
t$BVEBM
- PSI-L30X-075: de 0.10 a 5 gpm; de 6 a 300 gph (de 0.4 a 18.9 l/m)
- PSI-M30X-075, psi-M40X-075: de 2 a 10 gpm; de 120 a 600 gph
(de 7.8 a 37.9 l/m)
- PSI-M40X-100: de 2 a 20 gpm; de 120 a 900 gph (de 7.8 a 56.8 l/m)
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
Modelos
t14*ű-X-075: regulador de 3/4" (1.9 cm), 30 psi (2.1 bares) para caudal
bajo (etiqueta roja)
t14*ű.X-075: regulador de 3/4" (1.9 cm), 30 psi (2.1 bares) para caudal
bajo (etiqueta roja)
t14*ű.9-075: regulador de 3/4" (1.9 cm), 40 psi (2.8 bares) para caudal
bajo (etiqueta roja)
t14*ű.40X-100: regulador de 1" (2.5 cm) y 40 psi (2.8 bares) para caudal
medio
Rango operativo
t$BVEBMEFBHQNEFBHQIEFBMN
t1SFTJØOEFFOUSBEBEFBQTJEFBCBSFT
Dimensiones
t&OUSBEBIFNCSBSPTDBEBEF1/2” (1.3 cm)
t"MUVSBDN
Modelo
t134
Xerigation®
PSI-L30X-075, PSI-M40X-075, PSI-M40X-100
204
PRS-050-30
El uso inteligente del agua.™
Bombas
Xerigation®
Sistemas de control
centralizado
Programadores
Accesorios
Válvulas
Impactos
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Cuerpos de difusores
Estaciones de bombeo
Sugerencias para ahorrar agua
Las estaciones de bombeo de
transmisión de frecuencia variable
7'%
EF3BJO#JSEBIPSSBOFOFSHÓB
y al mismo tiempo brindan la
presión de agua necesaria para
garantizar la máxima eficiencia en
el uso del agua.
t
Rain Bird diseña estaciones de bombeo
específicamente para cada aplicación, lo cual
garantiza que la bomba funcione en su máxima
eficiencia. Al brindar la presión adecuada
requerida por el sistema, garantiza un sistema de
riego eficiente y efectivo. Para obtener asistencia,
llame al 520-806-5620 o envíe un mensaje de
DPSSFPFMFDUSØOJDPBQVNQT!SBJOCJSEDPN
Drenaje
t
Recursos
Los motores más nuevos de alta
eficiencia son capaces de
convertir un mayor porcentaje
del suministro eléctrico en
trabajo mecánico útil, lo que
permite ahorrar costos y energía.
Referencia
t
El uso inteligente del agua.™
205
Estaciones de bombeo
Serie LC
Serie LC de Rain Bird®
NUEVO
Especificaciones eléctricas
EF£BIQIBTUBQTJCBSFT
IBTUBHQNEFN /h)
t Energía monofásica, 60 Hz: 208 V, 230 V
Q Revolucionario paquete completo de bomba que incluye una bomba
de nivel profesional, protección de la más alta calidad para la bomba y
accesorios de fácil instalación y uso, todo en una caja única diseñada
especialmente para una bomba
Aplicaciones
3
t Incremento o amplificación de la succión
t Suministro de agua potable o reciclada
t Para uso residencial, comercial liviano, recreativo o para parques
Q #PNCBEFVTPQFTBEPEJTQPOJCMFFO£›ZIQDPOJNQVMTPSFT
de latón, caja de hierro fundido, pernos y postes de acero inoxidable para
resistir la presión, medidor de temperatura e imprimación
Q 1SPUFDDJØOEFBQBHBEP143151SPQPSDJPOBQSPUFDDJØOTJMBCPNCB
experimenta pérdida de presión o situaciones de alta temperatura. El
14315FTUÈVCJDBEPFOVOBDBKBEFBDFSPSFDVCJFSUPEFQJOUVSBFOQPMWP
Q Caja con pintura en polvo estéticamente agradable. Con una caja para
seguridad y protección contra el vandalismo para la bomba y los controles
Características
t Caja con apertura de concha de acero inoxidable pintada con pintura en
polvo. Ofrece completa accesibilidad a la bomba y a los controles eléctricos
t El acoplamiento de rápida desconexión en caso de descarga y succión
proporciona conexiones simples de encendido-apagado para acelerar los
procesos de conexión y preparación para el invierno
Capacidad de gpm US en base a un incremento de succión de 5 pies
HP
Descarga en psi
35 40 45
20
25
30
50
55
60
1
73
65
57
47
35
18
-
-
-
1.5
75
70
68
60
48
35
-
-
-
2
102
98
92
82
74
61
52
40
-
3
115
114 112 105 100
88
72
56
30
t Rejillas de enfriamiento que proporcionan suficiente aire para evitar que el
motor y la bomba se sobrecalienten
t El adaptador de 1.5” y el recipiente de drenaje de PVC descargan la línea a
través de la parte inferior de la caja, lo cual es un seguro contra robo
t Opción de descarga a través de la parte inferior o lateral de la caja
t Cable flexible de energía de rápida desconexión que brinda seguridad a la
bomba
t Conector principal de corriente de 230 V
t Candado de seguridad
Curvas de rendimiento de las bombas de la Serie LC
Bombas
Serie LC
206
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Estación de bombeo de perfil bajo (LP)
Estación de bombeo de perfil bajo (LP)
de 5, 7.5 y 10 hp; hasta 120 psi (8.2 bares); hasta 235 gpm (53 m3/h)
Q "IPSSPEFFOFSHÓBMBUSBOTNJTJØOEFGSFDVFODJBWBSJBCMF7'%
NBOUJFOFMB
presión constante ante una demanda de caudal variable.
Q 3FOUBCMFFMTJTUFNBEFCPNCFPBDDJPOBEPQPS7'%CSJOEBVOBMUP
rendimiento con mínima inversión.
Q Perfil bajo: caja de aluminio compacto de calidad naval con tuberías y
patín recubiertos de pintura en polvo.
Q Confiabilidad: diseño estándar simple, fácil instalación y mantenimiento.
Características
t Bombas de succión final horizontal (5; 7.5; y 10 hp)
t Caja de aluminio compacto de calidad naval
t Caja NEMA 3R separada para controles eléctricos
t 5VCFSÓBTEFBDFSPFOUPEPFMTJTUFNBDPOQFTUB×BPBDPQMBNJFOUPTEF7JDUBVMJD
t Recubrimiento de pintura en polvo resistente a la corrosión en los patines, las
tuberías y las pestañas
t Relé de arranque de bombas o arranque a presión opcional
t 5SBOTNJTJØOEFGSFDVFODJBWBSJBCMF7'%
QBSBVOBNÈYJNBFGJDJFODJB
t 1BOUBMMBUÈDUJMDPOUFYUP(5QBSBFMPQFSBEPS
Estación de bombeo de perfil bajo (LP)
con caja NEMA 3R
t Protección de motor con disyuntor
t Protección contra descargas
t Interruptor térmico de la bomba para el apagado de seguridad
t Enfriamiento por ventilador y boca de entrada de aire
t Manómetros de entrada y salida rellenos con glicerina
t Interruptor de caudal
t Maneral de bypass de la bomba
Opciones
t Paquete ambiental: aislamiento y calentador
t Montaje de la malla de entrada y la válvula de pie: Para aplicaciones de
succión /compresión negativa
Especificaciones eléctricas
t Energía trifásica, 60 Hz: 208V, 230V, 460V
t Energía monofásica, 60 Hz: 208 V, 230 V
Interior de la estación de bombeo de
perfil bajo (LP)
Aplicación
Bombas
t Escoja la estación de bombeo de perfil bajo para aplicaciones de
amplificación de presión pequeña a mediana, compresión positiva y succión/
impulso tales como parques y edificios urbanos, campos deportivos, edificios
comerciales, asociaciones pequeñas de propietarios y sitios residenciales
grandes.
35"
38"
53"
El uso inteligente del agua.™
207
Estaciones de bombeo
&TUBDJPOFTEFCPNCFP4FSJF%%1Z%19
Estaciones de bombeo Serie "D"
Estaciones de bombeo Serie D, DP y DPX
Caudales de hasta 300 gpm (68 m3/h) y mayor, presión de descarga de
hasta 150 psi (10.3 bares)
Q Confiabilidad: las estaciones de conexión integrada de bomba (hasta
300 gpm) brindan responsabilidad de fuente única para todo el sistema
de bombeo, lo cual garantiza una instalación y un funcionamiento sin
complicaciones
Q Compre sin problemas: adquiera todos los componentes del sistema de
SJFHPFOMBTJOTUBMBDJPOFT3BJO#JSEEF5VDTPO"SJ[POB
Q %FGÈDJMBSSBORVFTFSFBMJ[BOQSVFCBTEFIVNFEBEBUPEBTMBTFTUBDJPOFT
Especificaciones eléctricas
t Energía trifásica, 60 Hz: 208 V, 230 V, 460 V, 575 V
t Energía trifásica, 50 Hz: 190 V, 380 V, 415 V
t Energía monofásica, 60 Hz: 208 V, 230 V (hasta 10 hp por bomba)
Nota:$POTVMUFMB(VÓBEFFTQFDJGJDBDJØOEFFTUBDJPOFTEFCPNCFPQBSBCPNCBTEF
perfil bajo y de la serie D" en la página 233
Características de la Serie D
t El sistema de bombeo accionado por una bomba única ofrece un buen
rendimiento, práctico y funcional, a un precio conveniente
Aplicaciones de la Serie D
Características
t Cualquier aplicación de riego de compresión positiva, de aumento de presión
y de succión/impulso requiere una estación de bombeo confiable, práctica y
funcional, que proporcione la presión y el índice de caudal necesarios para el
sistema de riego
t Bomba vertical de múltiples fases para aplicaciones de compresión positiva o
aumento de presión
Características de la Serie DP
previo al envío
t Bomba de succión extrema horizontal para aplicaciones de compresión
positiva, aumento de presión o de succión/impulso
t5SBOTNJTJØOEFGSFDVFODJBWBSJBCMF7'%
QBSBVOBNÈYJNBFGJDJFODJBEF
energía
t La interfaz de operador con pantalla táctil con luz de fondo monocromática
facilita el entrenamiento para el operador
t El reinicio automático para cortes de energía garantiza un funcionamiento
fluido en caso de corte o recuperación de la energía eléctrica
t Caja resistente al vandalismo en colores verde césped PGS8-C0651
PIBCBOPPTDVSP'4
t El controlador lógico programable (PLC), además de controlar la presión y
el caudal, cuenta con otras características, como controles de nivel de lagos,
filtración de acción automática y la capacidad de modificar los puntos de
configuración de la presión basados en el tiempo (parámetros variables de
presión)
Aplicación de la Serie DP
t Cualquier aplicación de riego de compresión positiva, de aumento de presión
y de succión/impulso de hasta 300 gpm, con una presión de hasta 150 psi
(10.34 bares) que requiere controles lógicos programables
Opciones
t Paquete ambiental: aislamiento y calentador
t Alarma sonora y visual
t Válvula de alivio de presión (PRV)
t 5VCFSÓBTFO;
t5BORVFEFFYQBOTJØOFJOUFSSVQUPSEFDBVEBMTJMBTF×BMEFBSSBORVFEFMB
bomba no está disponible
t Válvula de pie: para aplicaciones de succión/impulso
Serie D
t Maneral de bypass de la bomba
t Medidor del caudal: entrada/descarga a través de la pared de la caja solo si
está seleccionado el medidor del caudal
Bombas
Serie DP
208
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
&TUBDJPOFTEFCPNCFP4FSJF%%1Z%19
Características de la Serie DPX
t Integración fluida del sistema con software de SiteControl de Rain Bird
(requiere pantalla táctil a todo color, opcional)
t El panel eléctrico enfriado por líquido NEMA 3R garantiza confiabilidad y
duración en los climas cálidos
t El controlador lógico programable (PLC), además de controlar la presión y
el caudal, cuenta con otras características, como controles de nivel de lagos,
filtración de acción automática y puntos de configuración de la presión
basados en el tiempo (parámetros variables de presión)
Características de la bomba Serie D
SE
SE
NO SE
REQUIERE REQUIERE REQUIERE
PLC
PLC
PLC
DPX
DP
D
Artículo
Emisión confiable de la presión y el caudal
requeridos
Monitoreo remoto del bombeo
(utilice el administrador de bomba)
Aplicaciones de bombas múltiples
Controles de nivel de lagos
Presión o caudal (parámetros máx. o mín.)
Opción de pantalla táctil a todo color
Controles de filtración
Malla de entrada de limpieza automática
Comunicación entre la estación de bombeo
y el sistema de control centralizado
t Cuando desee obtener comunicación entre la estación de bombeo y el
sistema SiteControl de Rain Bird
Intercambiador de calor en climas más
cálidos
Opciones de la Serie DPX
Control lógico programable (PLC)
t Pantalla táctil para el operador a todo color con pantallas en inglés y en
español. Esta opción es necesaria para obtener comunicación entre la estación
de bombeo y la computadora del sistema de control centralizado
Interruptor de seguridad térmica
de la bomba
t Selección de pantalla táctil a todo color y opciones de módem que brindan
comunicación entre la estación de bombeo y la computadora del sistema de
control centralizado
t El reinicio automático para cortes de energía garantiza un funcionamiento
fluido en caso de corte o recuperación de la energía eléctrica
Aplicación de la Serie DPX
t Aplicaciones de riego de compresión positiva, de aumento de presión y de
succión/impulso en clima cálido de hasta 300 gpm, con una presión de hasta
150 psi (10.34 bares) que requiere una tecnología electrónica enfriada por
líquido
t Módems de comunicación por radio o conexión por cable
t 1SPUFDUPSFOi:wPEFGJMUSBDJØODPOMJNQJF[BBVUPNÈUJDB
t Malla de entrada de limpieza automática
t t3FMÏEFBSSBORVFEFCPNCBT
t5VCFSÓBFOi;w
t Controles de nivel de lagos
t Bypass de la bomba
t Paquete ambiental: aislamiento y calentador
t Ensamble de succión/impulso
Bombas
Pantalla táctil a color
(opcional en las series D, DP y DPX)
Serie DPX
El uso inteligente del agua.™
Bomba de estación de succión
extrema horizontal
209
Estaciones de bombeo
Estaciones de bombeo de flujo intermedio
Estaciones de bombeo de caudal intermedio
Caudales de hasta 750 gpm (170 m3/h) y mayor, presiones de descarga de
hasta 120 psi (8.2 bares)
Q 'VODJPOBCJMJEBENFKPSBEBEJTF×PFMÏDUSJDPZNPEFSOPRVFVUJMJ[BVOB
protección de motor con interruptor industrial en lugar de -fusibles, que
son una pérdida de tiempo. Los cortacircuitos industriales se restablecen
rápidamente y están diseñados para una duración prolongada
Q 'ÈDJMFOUSFOBNJFOUPQBSBFMPQFSBEPSQBOUBMMBUÈDUJMEFGÈDJMOBWFHBDJØO
Q Costo reducido: el recubrimiento de pintura en polvo le otorga un índice
QFSGFDUPFOMBQSVFCBTEFDPSSPTJØOEF"45..FOPSDPSSPTJØORVF
equivale a una mayor duración de la tubería, el patín y el maneral, lo cual
permite reducir los costos.
Características
t 5PEPMPRVFOFDFTJUBQBSBMBDPOTUSVDDJØOPSFOPWBDJØOEFTVTJTUFNBEFSJFHP
del único fabricante dedicado al riego durante ocho décadas
t %FGÈDJMJOTUBMBDJØOZBSSBORVF
t Protección contra funcionamiento en seco sin caudal e interruptor térmico
Aplicación
Proyectos medianos a grandes, como parques, transferencia de lagos, campos
deportivos, viveros, granjas de césped y otros proyectos agrícolas y de
recreación
Pantalla táctil de estaciones
de bombeo de caudal
intermedio (opcional)
Opciones
t Enfriamiento de paneles eléctricos con aire acondicionado
t Cajas: aluminio, acero pintado (colores especificados por el gobierno)
t Pantalla táctil a todo color en varios idiomas
t Medidor de caudal magnético
t Comunicación vía Ethernet, radio o conexión por cable
t Motor enfriado por ventilador completamente cubierto (5&'$)
t 1SPUFDUPSFO:DPOSFUSPMBWBEPBVUPNÈUJDP
t 5VCFSÓBEFEFTDBSHBFO;
t Configuraciones para múltiples bombas disponibles
Especificaciones eléctricas
t Energía trifásica, 60 Hz:208 V, 230 V (hasta 60 hp por bomba), 460 V, 575 V
t Energía trifásica, 50 Hz: 190 V (hasta 60 hp por bomba), 380 V, 415 V
t Energía monofásica, 60 Hz: 208 V, 230 V (hasta 30 hp por bomba)
Bombas
Estación de bombeo de caudal
intermedio
210
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Estaciones de bombeo de riego principal
Estaciones de bombeo principales
Opciones
Caudales de hasta 10,000 gpm (2271 m3/h) y mayor, de hasta 150 psi
(10.3 bares)
t Sistema de enfriamiento de paneles eléctricos con aire acondicionado
Q 'VODJPOBCJMJEBENFKPSBEBEJTF×PFMÏDUSJDPZNPEFSOPRVFVUJMJ[BVOB
t Cajas: aluminio, acero pintado (colores especificados por el gobierno)
t Controles personalizados
t 5VCFSÓBTZNBOFSBMFTQFSTPOBMJ[BEPT
protección de motor con interruptor industrial en lugar de -fusibles, que
son una pérdida de tiempo. Los cortacircuitos industriales se restablecen
rápidamente y están diseñados para una duración prolongada
Q Reducción del tiempo de inactividad: diseño eléctrico y moderno que
utiliza una protección de motor con cortocircuito industrial en lugar de
fusibles, que son una pérdida de tiempo. Los cortacircuitos industriales son
buenos para una variedad de dispositivos interruptores
Q 'ÈDJMDBQBDJUBDJØOQBSBFMPQFSBEPSQBOUBMMBUÈDUJMBDPMPSFOWBSJPTJEJPNBT
fácil de aprender a usar
t Aspersores de descarga fabricados
t Sistemas de fertirrigación
t 'JMUSBDJØOGJMUSPTEFNBMMBDPOSFUSPMBWBEPZGJMUSPTDPOFTDÈOFSEFTVDDJØO
(hidráulicos o eléctricos)
t $BMFOUBEPSNPOUBEPFOQBUÓO,8
t Pantalla de caja de entrada con 3 mallas de acero inoxidable
t Control de nivel de lagos: interruptor flotante y sensor de nivel de lagos
sumergible
t Medidor de caudal magnético
t Comunicación vía Ethernet, radio o conexión por cable
Características
t Costo reducido: el recubrimiento de pintura en polvo le otorga el índice
NÈTBMUPFOMBQSVFCBTEFDPSSPTJØOEF"45..FOPSDPSSPTJØORVFFRVJWBMFB
una mayor duración de la tubería, el patín y el maneral, lo cual permite reducir
los costos.
t ;POBTEFQPUFODJBP,7"
t .PUPSFTFOGSJBEPTQPSWFOUJMBEPSDPNQMFUBNFOUFDVCJFSUPT5&'$
t 1SPUFDUPSFO:DPOSFUSPMBWBEPBVUPNÈUJDP
t 5VCFSÓBEFEFTDBSHBFO;
t Compre-sin problemas: todo lo que necesita para la construcción o
renovación de su sistema de riego del único fabricante dedicado al riego
t 5VCFSÓB)%1&
t Comunicación en tiempo real entre la estación de bombeo y
el sistema de control centralizado de Rain Bird
t Energía trifásica, 60 Hz: 208 V, 230 V (hasta 60 hp por bomba), 460 V, 575 V
Especificaciones eléctricas
t Energía trifásica, 50 Hz: 190 V (hasta 60 hp por bomba), 380 V, 415 V
Aplicación
t Energía monofásica, 60 Hz: 230 V (hasta 30 hp por bomba)
Estaciones de bombeo con transmisión de frecuencia variable confiables
diseñadas para actuar como la estación de bombeo de riego principal para
grandes proyectos y sitios comerciales. Los sistemas de bombeo de Rain Bird
están diseñados para los proyectos de construcción nuevos y también se
pueden construir por encargo para proyectos de renovación más complejos.
5BNCJÏOFTBEFDVBEPQBSBMBTGVODJPOFTEFSJFHP
tDisponible en las siguientes configuraciones:
- Estaciones de bombeo de turbina vertical y sumergible para aplicaciones
con agua de pozos
- Succión de extremo horizontal para aplicaciones de compresión positiva, de
succión/impulso y de aumento de presión
Bombas
- Bombas de múltiples fases para aplicaciones de compresión positiva y
aumento de presión donde se necesite una
presión diferencial mayor que 130 psi (9 bares)
Estación de bombeo de riego principal
El uso inteligente del agua.™
211
Estaciones de bombeo
Administrador de bombas con SmartPump™,
y servicio de estación de bombeo de Rain Bird
Administrador de bombas con SmartPump™
Combina una estación de bombeo de Rain Bird y un software del sistema
de control centralizado a fin de integrar completamente el funcionamiento
de la estación de bombeo con el sistema de control centralizado utilizando
comunicación en tiempo real.
Administrador de bombas con SmartPump™
t Ajusta el funcionamiento del sistema de riego a la capacidad real de la
estación de bombeo, lo cual reduce la ventana de riego y disminuye el
consumo de energía
Servicio para estaciones de bombeo
Rain Bird presenta una red nacional de proveedores de servicio autorizados
para garantizar que su estación de bombeo permanezca en funcionamiento.
Además, Rain Bird brinda Asistencia telefónica, planes de mantenimiento
preventivo y cobertura de servicio completo durante y después de que se
complete la Política de satisfacción del cliente. Agregue estos servicios a su
compra para obtener el paquete completo. Comuníquese con su distribuidor
autorizado de Rain Bird para obtener información detallada.
t Alerta al encargado en tiempo real sobre los problemas de riego y las
estaciones de bombeo a través de mensajes de texto por teléfono celular
t Brinda una respuesta a los problemas en el sistema de riego y el sistema de
bombas en tiempo real. Otros sistemas pueden perder una hora del tiempo
de riego al intentar recuperarse de una falla
El administrador de bombas con SmartPump™ ofrece funciones de control de
la estación de bombeo y de monitoreo total a cargo del sistema de control
centralizado
Bombas
212
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Relés de arranque de bombas PSR, PSRP y PSRPL
Relés de arranque de bombas
PSR, PSRP y PSRPL
NUEVO
Para un rendimiento y protección de la bomba óptimos
Q Los relés universales de arranque de bombas de Rain Bird (PSR) ofrecen
un rendimiento sin preocupaciones para su sistema de riego y son
compatibles con todos los controladores de Rain Bird y de otras marcas
confiables
Q Escoja el PSRP para la protección de funcionamiento en seco. Un
interruptor de presión agregado garantiza protección adicional en caso de
que se pierda la presión de agua de la fuente de abastecimiento
Q El PSRPL es ideal para sistemas que operan mediante un sistema de
fuentes de abastecimiento o alguna otra fuente que requiere control de
nivel. Esta función de control evita que la bomba permanezca encendida si
la fuente de abastecimiento de agua está vacía
Funciones de relé universal de arranque de bombas PSR
t'VODJPOBDPOFMDPNBOEPEFFODFOEJEPBQBHBEPEFVODPOUSPMBEPSEFSJFHP
para facilitar la ruta eléctrica desde la caja del disyuntor hasta el motor de la
bomba
t1SPQPSDJPOBVOBPQFSBDJØODPNQSPCBEBQPSFOTBZPZFSSPSQBSBUPEPTMPT
tipos de equipos de bombas eléctricas con voltajes de 24, 110 y 220 VCA
t3FMÏEF"DFSUJGJDBEP
t5FSNJOBMFTEFDPOFYJØOSÈQJEBDPOUVFSDBTQBSBDBCMFT
t4VNJOJTUSPEFDPOFYJØOBUJFSSB
t$PNQBUJCMFDPODPOUSPMBEPSFTEFSJFHPEFUJFNQPEF7$"
t$PNQBUJCMFDPOCPNCBTNPOPGÈTJDBTEFØ7$"EFIBTUBIQ
t$BQBEFQJOUVSBFOQPMWPIPSOFBEBQBSBVOBMBSHBWJEBFOBNCJFOUFT
difíciles
t6-MJTUBEPDPNPQBOFMFTEFDPOUSPMJOEVTUSJBMFTFODBKBSFTQBMEBEPTQPSVOB
garantía limitada de dos años
t$BCMFBEPDPODØEJHPEFDPMPSFTQBSBVOBGÈDJMJOTUBMBDJØO
t4VNJOJTUSPEFDPOFYJØOBUJFSSB
t1SPUFDDJØOEFMBCPNCBUPUBMNFOUFBVUPNÈUJDB
t5JFNQPEFSFUSBTPBKVTUBCMF
t3FEVDFMBEJGFSFODJBFOUSFMPTDPOUSPMBEPSFTEFSJFHPEF7$"ZMPTNPUPSFT
de bomba de 110/220V
t6ONPEFMPGVODJPOBDPOUPEBTMBCPNCBTEFTEFEFIQIBTUBIQ
t4FOTPSEFCBKBQSFTJØORVFQSPUFHFMBCPNCBTJFMGMVKPEFFOUSBEBEFBHVB
se detiene, reduce o bloquea totalmente
t1SPUFHJEBTFODBKB/&."3SFTJTUFOUFTBMBHVBQJOUBEBTDPOQJOUVSBFO
polvo "horneada" para una larga duración en ambientes difíciles
Funciones de control de la bomba de recolección de agua de
lluvia PSRPL
t.POJUPSFBFMCBMBODFEJTQPOJCMFEFBHVBFOMPTTJTUFNBTEFSFDPMFDDJØOEF
agua de lluvia y los compara con el nivel de agua necesario para asegurar el
funcionamiento adecuado de la bomba.
t.FEJBOUFFMVTPEFTJNQMFTDPOUSPMFTEFGMPUBDJØOFM1431-EF3BJO#JSE
proporciona un control eficiente de la bomba para recolección de agua de
lluvia mediante la sincronización la fuente de agua con los requerimientos
de la bomba. Si el agua de lluvia está disponible, el PSRPL de Rain Bird usa
primero el agua almacenada, si no hay agua de lluvia disponible, el PSRPL
de Rain Bird usa una alternativa doméstica o fuente alterna para suministrar
agua a la bomba durante el ciclo de riego. El control de flotación (inferior) se
usa para verificar que haya agua disponible durante el ciclo de riego de la
bomba.
t&MDPOUSPMEFGMPUBDJØOTVQFSJPS
TFVTBQBSBBHSFHBSBHVBBMTVNJOJTUSPEF
agua de lluvia recogida usando una válvula solenoide doméstica de 24 VCA.
(El solenoide debe ser suministrado por otros).
t4FOTPSEFCBKBQSFTJØORVFQSPUFHFMBCPNCBTJFMGMVKPEFFOUSBEBEFBHVB
se detiene, reduce o bloquea totalmente.
t1SPUFHJEPTFODPNQBDUBTDBKBT/&."3SFTJTUFOUFTBMBHVB
t4FOTPSEFUFNQFSBUVSBBMUBRVFQSPUFHFMBCPNCBTJMBEFTDBSHBTFDJFSSBP
bloquea.
Funciones de relé de arranque de bomba PSR
t1SPUFDDJØOEFMBCPNCBUPUBMNFOUFBVUPNÈUJDB
t.POJUPSFBFMTJTUFNBEFSJFHPNFEJBOUFFMVTPEFVOTFOTPSEFQSFTJØOVCJDBEP
a un lado de descarga de la bomba para protegerla de daños debido a baja
presión. Si la presión no se ha recuperado durante el ciclo del controlador, la
bomba se apaga para protegerse antes de que ocurra un daño.
t3FEVDFMBEJGFSFODJBFOUSFMPTDPOUSPMBEPSFTEFDÏTQFEEF7$"ZMPT
motores de bomba de 110/220 V.
t5PEPTMPTTFOTPSFTZGMPUBEPSFTFOFMUBORVFVTBOFOFSHÓBTFHVSBEF7$"
t'VODJPOBDPNPVOSFMÏEFBSSBORVFEFCPNCBTZPGSFDFQSPUFDDJØOEF
desconexión de la bomba si la fuente de agua no está disponible.
t3FTUBCMFDJNJFOUPBVUPNÈUJDPEFMTFOTPSEFQSFTJØO
t6ONPEFMPGVODJPOBDPOUPEBTMBCPNCBTEFTEFEFIQIBTUBIQ
t3FMÏEF"DFSUJGJDBEP
t$BCMFBEPBMCMPRVFEFUFSNJOBMFTQBSBVOBGÈDJMJOTUBMBDJØO
Bombas
t4FOTPSEFQSFTJØOCBKBGJKPBQTJ
t4FOTPSEFUFNQFSBUVSBBMUBGJKPB¡
t1SPUFHJEPTFODBKBT/&."3SFTJTUFOUFTBMBHVB
t$BQBEFQJOUVSBFOQPMWPIPSOFBEBQBSBVOBMBSHBWJEBFOBNCJFOUFT
difíciles
t6-MJTUBEPDPNPQBOFMFTEFDPOUSPMJOEVTUSJBMFTFODBKBSFTQBMEBEPTQPSVOB
garantía limitada de dos años.
*cuando hay protección térmica
Relés de arranque de bombas
PSR, PSRP y PSRPL
El uso inteligente del agua.™
213
Estaciones de bombeo
Malla de filtración y succión hidráulica de la "Serie G"
Malla de filtración y succión
hidráulica de la "Serie G"
'"#3*$"%0&/&&̓66
t 'JMUSBEPFMSFUSPMBWBEPEFBHVBMJNQJBJOJDJBBVUPNÈUJDBNFOUFQPSUJFNQPP
diferencial de presión mediante un controlador integrado de Rain Bird
t Entrada y salida bridadas estándar excepto en las configuraciones de los
NPEFMPTEFGJMUSPT)47Z)4(MBTDVBMFTFTUÈOSPTDBEBT5BNCJÏO
hay disponible de modo opcional una configuración de entrada y salida
acanalada.
Ahorro y valor con volúmenes menores de retrolavado
Características
t Proporciona un índice medio de flujo de agua filtrada de calidad 300
micrones (estándar)
t Activado por la presión de la línea de entrada de la fuente de agua, el sistema
de retrolavado de filtro produce un flujo concentrado de alta velocidad y bajo
volumen de agua en reversa para limpiar sistemáticamente la malla del filtro
de cualquier contaminante atrapado.
t Los modelos están disponibles como un solo filtro o como ensambles de
filtros que incluye la invalidación del bombeo y válvulas para una rápida y
fácil instalación en el lugar
t El elemento de filtración de la malla de tela metálica SS con soporte de
PVC de gran resistencia y duradero se surte de manera estándar. Otras
construcciones de malla, como el SS multicapa sinterizado y de alambre a
presión también son opcionales y están disponibles sobre pedido.
t Las mallas estándar de tela metálica se suministran en 300 micrones. Los
tamaños de malla de tela metálica SS opcionales están disponibles en 50, 80,
100, 150 o 200 micrones
t Las tazas de caudal estándar van de 25 a 3500 GPM
t La presión de operación máxima estándar es de 150 psi (hay disponibles
presiones más altas)
Diseño económico con ensamble
de invalidación integrado para
instalación rápida y fácil.
Datos de rendimiento de la malla de los filtros de escáner de succión hidráulica de la "Serie G"
Bombas
Pintado con pintura
en polvo
Acero al carbón
Número de modelo
acero inoxidable
Número de modelo
HS-V-01-LE-M
HS-G-02-LE-M
HS-G-03-LE-M
HS-G-04-LS-M
HS-G-04-LE-M
HS-G-06-LS-M
HS-G-06-LE-M
HS-G-08-LS-M
HS-G-10-LS-M
HS-V-01-LE-S-M
HS-G-02-LE-S-M
HS-G-03-LE-S-M
HS-G-04-LS-S-M
HS-G-04-LE-S-M
HS-G-06-LS-S-M
HS-G-06-LE-S-M
HS-G-08-LS-S-M
HS-G-10-LS-S-M
HS-V-01-LE-B-M
HS-G-02-LE-B-M
HS-G-03-LE-B-M
HS-G-04-LS-B-M
HS-G-04-LE-B-M
HS-G-06-LS-B-M
HS-G-06-LE-B-M
HS-G-08-LS-B-M
HS-G-10-LS-B-M
%4(-&#.
%4(-4#.
%4(-4#.
HS-V-01-LE-S-B-M
HS-G-02-LE-S-B-M
HS-G-03-LE-S-B-M
HS-G-04-LS-S-B-M
HS-G-04-LE-S-B-M
HS-G-06-LS-S-B-M
HS-G-06-LE-S-B-M
HS-G-08-LS-S-B-M
HS-G-10-LS-S-B-M
%4(-&4#.
%4(-44#.
%4(-44#.
-M indica el número de modelo comercial.
Entrada/salida
Tamaño de la brida
(pulg.)
Línea de
purga
Tamaño
(pulg.)
Presión mínima de
entrada durante el
ciclo de enjuagado
(psi)
2
2
3
4
4
6
6
8
10
2
2
2
2
3
3
3
3
3
30
30
30
30
30
30
30
30
30
2
2
3
4
4
6
6
8
10
10
10
12
2
2
2
2
3
3
3
3
3
3
3
3
30
30
30
30
30
30
30
30
30
30
30
30
Máxima
Presión (psi)
m3/hora
Solo filtro
25
5.7
150
100
22.7
150
200
45.4
150
300
68.1
150
400
90.9
150
650
147.6
150
850
193.1
150
1300
295.3
150
1750
397.5
150
Ensamble del filtro con colector de invalidación
25
5.7
150
100
22.7
150
200
45.4
150
300
68.1
150
400
90.9
150
650
147.6
150
850
193.1
150
1300
295.3
150
1750
397.5
150
1700
386.2
150
2600
590.6
150
3500
795.0
150
Caudal máximo
GPM US
Póngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos.
El flujo del filtro está basado en la filtración de 200 micrones o más de agua de riego limpia. Se requiere una devaluación apropiada del flujo por cargas excesivas de desechos (limo, restos orgánicos, algas, etc.),
agua reciclada y mallas más finas. Póngase en contacto con Rain Bird para obtener ayuda en la selección de filtros para estas aplicaciones.
214
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Malla de filtración y succión hidráulica de la "Serie I"
Malla de filtración y succión
hidráulica de la "Serie I"
'"#3*$"%0&/&&̓66
t 'JMUSBEPFMSFUSPMBWBEPEFBHVBMJNQJBJOJDJBBVUPNÈUJDBNFOUFQPSUJFNQPP
diferencial de presión mediante un controlador integrado de Rain Bird
t &OUSBEBZTBMJEBFNCSJEBEBFTUÈOEBS5BNCJÏOIBZEJTQPOJCMFEFNPEP
opcional una configuración de entrada y salida acanalada
El estándar de alto rendimiento en mallas de filtración
Características
t Proporciona un elevado índice de flujo de agua filtrada de calidad sin
preocupaciones
t Activado por la presión de la línea de entrada de la fuente de agua, el sistema
de retrolavado de filtro produce un flujo concentrado de alta velocidad de
agua en reversa para limpiar sistemáticamente el filtro de malla de cualquier
contaminante atrapado.
t Los modelos están disponibles como un solo filtro o como ensambles de
filtros que incluye la invalidación del bombeo y válvulas para una rápida y
fácil instalación en el lugar
t %JTQPOJCMFDPNPVOTPMPGJMUSPTJOJOWBMJEBDJØOEFCPNCFP
PDPNPVO
ensamble completo con invalidación de bombeo y válvulas para una fácil
instalación
t El elemento de filtración de la malla de tela metálica SS con soporte de
PVC de gran resistencia y duradero se surte de manera estándar. Otras
construcciones de malla, como el SS multicapa sinterizado y de alambre a
presión también son opcionales y están disponibles sobre pedido.
t Las mallas estándar de tela metálica se suministran en 300 micrones. Los
tamaños de malla de tela metálica SS opcionales están disponibles en 50, 80,
100, 150 o 200 micrones
t Las tazas de caudal estándar van de 400 a 5,000 GPM
t La presión de operación máxima estándar es de 150 psi (hay disponibles
presiones más altas)
Serie I
Datos de rendimiento de la malla de los filtros de escáner de succión hidráulica de la "Serie I"
acero inoxidable
Número de modelo
HS-I-04-PE-M
HS-I-06-PE-M
HS-I-08-PS-M
HS-I-08-PE-M
HS-I-10-PS-M
HS-I-10-PE-M
HS-I-12-PS-M
HS-I-04-PE-S-M
HS-I-06-PE-S-M
HS-I-08-PS-S-M
HS-I-08-PE-S-M
HS-I-10-PS-S-M
HS-I-10-PE-S-M
HS-I-12-PS-S-M
HS-I-04-PE-B-M
HS-I-06-PE-B-M
HS-I-08-PS-B-M
HS-I-08-PE-B-M
HS-I-10-PS-B-M
HS-I-10-PE-B-M
HS-I-12-PS-B-M
%4*1&#.
%4*14#.
%4*1&#.
%4*14#.
HS-I-04-PE-S-B-M
HS-I-06-PE-S-B-M
HS-I-08-PS-S-B-M
HS-I-08-PE-S-B-M
HS-I-10-PS-S-B-M
HS-I-10-PE-S-B-M
HS-I-12-PS-S-B-M
%4*1&4#.
%4*144#.
%4*1&4#.
%4*144#.
Caudal máximo
GPM US
Entrada/salida
Tamaño de la brida
(pulg.)
Línea de
purga
Tamaño
(pulg.)
Presión mínima de
entrada durante el
ciclo de enjuagado
(psi)
4
6
8
8
10
10
12
4
4
4
4
4
4
4
30
30
30
30
30
30
30
4
6
8
8
10
10
12
12
12
14
14
4
4
4
4
4
4
4
4
4
4
4
30
30
30
30
30
30
30
30
30
30
30
Máxima
m3/hora
Presión (psi)
Solo filtro
400
90.9
150
650
147.6
150
1200
272.6
150
1500
340.7
150
1750
397.5
150
2000
454.3
150
2500
567.9
150
Ensamble del filtro con colector de invalidación
400
90.9
150
650
147.6
150
1200
272.6
150
1500
340.7
150
1750
397.5
150
2000
454.3
150
2500
567.9
150
3000
681.5
150
3500
795.0
150
4000
908.6
150
5000
1135.8
150
Bombas
Pintado con pintura
en polvo
Acero al carbón
Número de modelo
* El flujo del filtro está basado en la filtración de 200 micrones de agua de riego limpia. Se requiere una devaluación apropiada del flujo por cargas excesivas de desechos (limo, restos orgánicos, algas, etc.), agua reciclada y mallas más
finas. Póngase en contacto con Rain Bird para obtener ayuda en la selección de filtros para estas aplicaciones.
-M significa Número de modelo comercial
Póngase en contacto con Rain Bird para ver los planos o visite www.
rainbird.com para descargarlos
El uso inteligente del agua.™
215
Estaciones de bombeo
'JMUSPEFBSFOB
Filtro de arena
'"#3*$"%0&/&&̓66
Proceso de retrolavado
t El drenaje inferior de Rain Bird requiere menos agua para el retrolavado y
requiere un retrolavado menos frecuente.
Para las condiciones más desafiantes de abastecimiento de agua
Características
t 0GSFDFDPOGJBCJMJEBEFGJDJFODJBZBIPSSPBMBSHPQMB[P'BCSJDBEPFOMPT
Estados Unidos, estos filtros están diseñados y fabricados según estándares
precisos, para que pueda disfrutar de muchos años del más alto rendimiento.
Proceso de filtración
t Profundidad uniforme para cama de arena de 14” para capturar las partículas
de manera más óptima
t La filtración se logra mediante el flujo del colector de entrada (superior) al
colector de salida (abajo)
t El retrolavado limpia un tanque a la vez, de manera que usted puede
continuar regando durante el ciclo de retrolavado
t El sistema hace el retrolavado con agua filtrada limpia
t Operación de una sola válvula, ya sea manualmente, en forma
semiautomática o automática, asegura una adecuada eficiencia y secuencia
de retrolavado
t El flujo uniforme a través de la cama de arena asegura una limpieza total
del sistema, a la vez que produce una cama plana y uniforme después de la
limpieza
t Aspersor de entrada de 2 fases
t Alta resistencia, drenaje inferior de acero inoxidable tipo 304 hidráulicamente
balanceado para un retrolavado completo
Cómo especificar
t Goteo de baja presión y flujo de dispersión uniforme
SM1816 - 2 B - M
Modelo comercial
SM1816
SM2416
SM3016
Designación
Uso comercial
Fusión
#MBODP/ÞNFSPEF*%0%
*4PMP*%
#*%Z0%
N.º de tanques
2
SM4816 - 6 B - G
Designación
Golf
Fusión
#MBODP/ÞNFSPEF*%0%
*4PMP*%
#*%Z0%
Modelo para
golf
SM4816
Nº de tanques
de 2 a 10
Los filtros de arena de Rain Bird protegerán su sistema de riego
de contaminantes sólidos incluyendo algas, arena y desechos.
Datos de rendimiento de los filtros de arena
Número de modelo del filtro
Bombas
Número de ID / OD
Fusión
Revestimiento
de epoxi
adherido
Solo ID
Fusión
Revestimiento
de epoxi
adherido
ID y OD
Fusión
Revestimiento
de epoxi
adherido
N.º de
tanques
(psi)
GPM US
m3/hora
GPM US
SM1816-2-M
SM2416-2-M
SM3016-2-M
SM3616-2-M
SM4816-2-M
SM4816-3-M
SM4816-4-M
SM4816-5-M
SM4816-6-M
SM4816-7-M
SM4816-8-M
SM4816-9-M
SM4816-10-M
SM1816-2I-M
SM2416-2I-M
SM3016-2I-M
SM3616-2I-M
SM4816-2I-M
SM4816-3I-M
SM4816-4I-M
SM4816-5I-M
SM4816-6I-M
SM4816-7I-M
SM4816-8I-M
SM4816-9I-M
SM4816-10I-M
SM1816-2B-M
SM2416-2B-M
SM3016-2B-M
SM3616-2B-M
SM4816-2B-M
SM4816-3B-M
SM4816-4B-M
SM4816-5B-M
SM4816-6B-M
SM4816-7B-M
SM4816-8B-M
SM4816-9B-M
SM4816-10B-M
2
2
2
2
2
3
4
5
6
7
8
9
10
150
150
125
125
125
125
125
125
125
125
125
125
125
60
107
170
238
425
638
850
1063
1275
1488
1700
1913
2125
13.6
24.3
38.6
54.1
96.5
144.9
193.1
241.5
289.6
338.0
386.2
434.5
482.7
88
158
250
350
625
938
1250
1563
1875
2188
2500
2813
3125
-M significa Número de modelo comercial
Filtración
Requisitos
del material
Índice de
caudal
del
retrolavado
m3/hora
Área (pies 2)
(Bolsas 100#)
GPM US
20.0
35.9
56.8
79.5
142.0
213.1
283.9
355.0
425.9
497.0
567.9
639.0
709.8
3.5
6.3
10.0
14.0
25.0
37.5
50.0
62.5
75.0
87.5
100.0
112.5
125.0
4
8
10
16
26
39
52
65
78
91
104
117
130
25
50
80
110
190
190
190
190
190
190
190
190
190
Rangos de caudal de riego
Presión
máxima
Flujo mínimo
Caudal máximo
Póngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos
El flujo del filtro está basado en la filtración de 200 micrones o más de agua de riego limpia. Se requiere una devaluación apropiada del flujo por cargas excesivas de desechos (limo, restos orgánicos, algas, etc.),
agua reciclada y mallas más finas. Póngase en contacto con Rain Bird para obtener ayuda en la selección de filtros para estas aplicaciones.
216
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Malla de Succión de bomba con limpieza automática
Malla de Succión de bomba con
limpieza automática
Conexiones de unión
estándar – otros
adaptadores también
son disponibles
'"#3*$"%0&/&&̓66
Mantiene la sociedad fuera de su sistema de bombeo y riego
Hacia la tubería principal
de succión de bomba
Entrada para suministro
de agua hacia los
chorros de limpieza
Características
t La malla galvanizada autolimpiable de la bomba de succión elimina partículas
grandes de basura y suciedad de las fuentes de agua, lo cual permite ahorrar
tiempo y dinero en energía, además logra eficiencia en el bombeo y reduce
los costos de mantenimiento.
Soporte de alta
resistencia para
una larga vida
t La malla de acero inoxidable de uso pesado 12 ó 30 incrementa la eficiencia
de bombeo por muchos años
t 5PEBFMBHVBEFCFQBTBSBUSBWÏTEFMBNBMMBEFMBCPNCBEFTVDDJØO
colocada al final de la línea de succión de la bomba antes de entrar al
tubo de alimentación de la bomba. Un pequeño chorro lateral de la
tubería de descarga de la bomba impulsa dos barras aspersoras que giran
continuamente, lanzando chorros de agua a la malla para eliminan la
suciedad
Malla pesada de
12-mesh ( o 30 mesh)
con tejido de acero
inoxidable
Acero galvanizado de alta
resistencia- canasta exterior
removible para servicio
Barras rotativas dobles
con fuertes chorros
continuamente
funcionando para
eliminar las partículas
de suciedad de la malla
Número de modelo
Caudal
GPM US
Caudal
m3/hora
Malla
Longitud
(pulg.)
PSS200-M
PSS400-M
PSS600-M
PSS800-M
PSS1000-M
PSS1400-M
PSS1700-M
PSS2000-M
PSS2400-M
PSS3000-M
PSS3500-M
PSS4000-M
325
550
750
950
1350
1650
1950
2350
2600
3000
3500
4000
73.8
124.9
170.3
215.7
306.5
374.6
442.7
533.5
590.2
681.0
794.5
908.0
11
15
16
18
23
26
28
32
35
40
40
40
PSS20030-M
PSS40030-M
PSS60030-M
PSS80030-M
PSS100030-M
PSS140030-M
PSS170030-M
PSS200030-M
PSS240030-M
PSS300030-M
PSS350030-M
PSS400030-M
225
400
525
700
950
1200
1400
1650
1800
2075
2420
2765
51.1
90.8
119.2
158.9
215.7
272.4
317.8
374.6
408.6
471.0
549.3
627.7
11
15
16
18
23
26
28
32
35
40
40
40
-M significa Número de modelo comercial
Total
Longitud
(pulg.)
Malla
Diámetro
(pulg.)
Filtro de malla 12
25
16
28.8
16
32.5
24
34.5
24
39.5
24
42.5
24
44.5
26
48.5
26
52.5
30
57.5
30
59.5
36
63.5
42
Filtro de malla 30
25
16
28.8
16
32.5
24
34.5
24
39.5
24
42.5
24
44.5
26
48.5
26
52.5
30
57.5
30
59.5
36
63.5
42
Brida
Tamaño
(pulg.)
Retorno de
entrada
Tamaño del
tubo (pulg.)
Presión
operativa
(psi mínima máxima)
Peso
Libras
Limpieza
Aspersor
(GPM)
4
6
8
10
10
12
12
14
16
16
18
18
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
35-100
40-100
40-100
45-100
50-100
55-100
55-100
60-100
65-100
40-65
40-65
40-65
38
57
101
108
116
128
148
160
223
236
283
358
20
20
20
20
24
24
24
24
28
44
44
44
4
6
8
10
10
12
12
14
16
16
18
18
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
1.5
35-100
40-100
40-100
45-100
50-100
55-100
55-100
60-100
65-100
40-65
40-65
40-65
38
57
101
108
116
128
148
160
223
236
283
358
20
20
20
20
24
24
24
24
28
44
44
44
Póngase en contacto con Rain Bird para ver los planos o visite www.rainbird.com para descargarlos
El uso inteligente del agua.™
217
Bombas
Datos del rendimiento de la malla de bomba de succión que se limpia automáticamente
Estaciones de bombeo
Separadores centrífugos de arena
Separadores centrífugos de arena
'"#3*$"%0&/&&̓66
Elimina contaminantes para minimizar el mantenimiento
necesario e incrementar la eficiencia
Características
t Capacidades de 4 a 8300 gpm
t Instalación simple (no se requiere electricidad)
t 'JMUSBDJØOQSFWJBFGJDJFOUFQBSBSFEVDJSMBDBSHBEFBSFOBFOMPTDPNQPOFOUFT
en el flujo de corriente
t Los separadores centrífugos de arena de Rain Bird están diseñados para
separar partículas abrasivas antes de que estas entren en el sistema de
riego, manteniendo el equipo limpio y libre de desechos, lo cual minimiza
la cantidad de mantenimiento que se requiere e incrementa la eficiencia
operativa
t El separador elimina la arena y partículas que son más pesadas que el agua
(material con gravedad específica de 2 o superior
t Los líquidos y sólidos entran en la unidad y comienzan a viajar en un flujo
circular. Esta acción centrífuga arroja las partículas más pesadas hacia las
paredes del filtro y finalmente hacia abajo en un movimiento en espiral hacia
la cámara de separación. Las partículas se recogen en la cámara de separación
y se eliminan manualmente del sistema. El agua filtrada es entonces atraída al
vórtice del separador y hacia la salida
Separador centrífugo de arena
t Se puede usar un controlador de purga automático y una válvula en todas
las aplicaciones para automatizar el proceso de purga, lo cual elimina la
necesidad de un enjuague manual. Se pueden montar pequeños separadores
verticales en la pared o en el sistema de tuberías
Datos de rendimiento de los separadores centrífugos de arena
Bombas
Número de modelo
Flujo*
GPM US
Flujo
m3/Hora
VCS-R5V-M
VCS-R7V-M
VCS-R10V-M
VCS-R12V-M
VCS-R15V-M
VCS-R20V-M
VCS-R25V-M
VCS-R30V-M
VCS-R40V-M
4 -10
10 - 20
18 - 38
26 - 52
38 - 79
63 - 120
100 - 180
125 - 260
190 - 345
0.9 - 2.3
2.3 - 4.6
4 - 8.7
6 - 12
8.7 - 18
14.5 - 27.6
23 - 41.4
28.8 - 59.8
43.7 - 79.4
ACS-R40LA-M
ACS-R60LA-M
ACS-R80LA-M
ACS-R100LA-M
ACS-R120LA-M
ACS-R140LA-M
ACS-R160LA-M
ACS-R180LA-M
200 - 525
365 - 960
800 - 1600
1300 - 2300
2025 - 3400
2975 - 5000
4000 - 6200
5100 - 8300
46 - 120
84 - 220
184 - 369
299 - 529
465 - 782
684 - 1150
920 - 1426
1173 - 1909
Entrada / Salida
Tamaño de la
Longitud
línea (pulg.)
(pulg.)
(cm)
Separadores verticales
0.5
20
50.8
0.75
20
50.8
1
30.5
77.5
1.25
30.5
77.5
1.5
30.5
77.5
2
36
91.4
2.5
44
111.8
3
48
121.9
4
52
132.1
Separadores angulares
4
80
221
6
106.25
293.4
8
114
316.9
10
123.5
342.9
12
139
396.2
14
148
424.2
16
160
462.3
18
177
462.3
Peso
Libras
Tamaño
máximo de la
partícula (pulg.)
Tamaño de
la válvula de
purga (pulg.)
13
15
26
26
26
44
55
75
120
0.625
0.375
0.5
0.5
0.5
0.5
0.5
0.5
0.5
1
1
1
1
1
2
2
2
2
280
493
722
840
1400
1550
1850
2400
1.5
1.5
1.5
1.5
1.5
2
2
2
2
2
2
2
2
2
2
3
El flujo del filtro está basado en la filtración de 200 micrones o más de agua de riego limpia. Se requiere una devaluación apropiada del flujo por cargas excesivas de desechos (limo, restos orgánicos, algas, etc.),
agua reciclada y mallas más finas. Póngase en contacto con Rain Bird para obtener ayuda en la selección de filtros para estas aplicaciones.
218
El uso inteligente del agua.™
Estaciones de bombeo
www.rainbird.com/pumps
Aireadores para mantenimiento de lagos
Serie LM
Aireadores de patrón simple para mantenimiento de lagos
Q Mantienen el atractivo de lagos y estanques estimulando la circulación
vertical y agregando oxígeno disuelto al agua
Modelos
LM10: la característica principal es un patrón de rociado de un surtidor,
similar a un géiser que se eleva por el aire
Q Mantienen la calidad del agua necesaria para evitar la acumulación
no deseada de algas, el crecimiento excesivo de malezas, los olores
desagradables y la disminución de poblaciones de peces
LM11: rociado bien proporcionado, en forma de abanico; el equilibrio
perfecto entre forma y función
Q 5SBCBKBOEFGPSNBFGJDB[QBSBNBOUFOFSFMFRVJMJCSJPFDPMØHJDPFOMBHPTP
estanques de menos de 15 pies (5 m) de profundidad
LM20: las populares opciones con patrón de rociado doble benefician
el aspecto estético mientras mantienen la calidad del agua en forma
efectiva
Características
t%JTQPOJCMFFOCPNCBTEFB)177NPOPGÈTJDBTZUSJGÈTJDBT
t5PEBTMBTVOJEBEFT-.WJFOFOBSNBEBTEFGÈCSJDBZTFFOUSFHBOMJTUBTQBSBTFS
instaladas
t#SB[PTEFBDFSPJOPYJEBCMFSFTJTUFOUFRVFTPTUJFOFOVOGMPUBEPSSFMMFOP
con espuma de celdillas cerradas aprobada por la guardia costera de los
EE.UU., para lograr una máxima flotabilidad
t$BSDBTBEFBDFSPJOPYJEBCMFRVFDPOUJFOFVONPUPSFMÏDUSJDPGBCSJDBEPQPS
encargo, diseñado para mover altos volúmenes de agua y proporcionar años
de servicio confiable
LM30: la característica que lo diferencia es su diseño
multidimensional de tres surtidores
Características opcionales
t4JTUFNBTDPOKVFHPTEFMVDFTRVFGVODJPOBODPOWPMUJPTEJTQPOJCMFTDPO
bombillas halógenas de 65 vatios
t$SJTUBMFTFODPMPSSPKPB[VMWFSEFZBNBSJMMP
t-BNBMMBEFFOUSBEBFTPQDJPOBMQBSBFMNPEFMP-.
t&YDMVTJWBDÈNBSBEFCPNCFPFOMBDBSDBTBEFMNPUPSRVFQFSNJUFBMDBO[BS
altos índices de bombeo para maximizar la circulación
t1MBDBEFGMFDUPSBRVFQSPQPSDJPOBVOBWJTJØOBUSBDUJWB
t'JMUSPEFNBMMBGJOBRVFFWJUBMBFOUSBEBEFTVDJFEBEQBSBQFSNJUJSFMDBVEBM
continuo de agua entrante y garantizar patrones de rociado completos y
simétricos cuando está en funcionamiento
t4ØMP-.QSPQVMTPSFTUJMPIFMJDØQUFSPEFBDFSPJOPYJEBCMFQSÈDUJDBNFOUF
irrompible
t"OJMMPTGMPUBEPSFTEJTF×BEPTFTQFDJBMNFOUFQBSBQFSNJUJSRVFMBVOJEBE
permanezca a nivel del agua
Especificaciones
t6OJEBEGBCSJDBEBFOBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJØOZ
plásticos térmicos de alta densidad. La resistencia a la corrosión permite que
la unidad sea instalada en casi todos los tipos de fuentes de agua
LM11
t'MPUBEPSDBSDBTBFYUFSJPSOFHSBGBCSJDBEBDPOQPMJFUJMFOPQMÈTUJDPUÏSNJDPEF
alta densidad. El interior del flotador es de polietileno de celdillas cerradas
t.PUPSNPUPSFMÏDUSJDPGBCSJDBEPQPSFODBSHPDPOSPUPSFTFOFRVJMJCSJP
dinámico. Empotrado en una carcasa de acero inoxidable totalmente oculto a
la vista
Bombas
t$BCMFUPEBTMBTVOJEBEFTTFFOWÓBODPODBCMFTVCBDVÈUJDPRVFTFPSEFOB
por separado, con un mínimo de 50 pies (15.2 m), con incrementos de 25 pies
N
t.BMMBGJMUSPEFFOUSBEBEFBHVBEFNBMMBGJOBGBCSJDBEPFOOZMPOEF1⁄4" (0.6
cm) (solo en los modelos LM10, LM20 y LM30)
t$FOUSPEFDPOUSPMEFFOFSHÓBFMDFOUSPEFDPOUSPMDPODFSUJGJDBDJØO3
de NEMA) incluye interruptor por fallas con descarga a tierra, arrancador
magnético, disipador de descargas, desconexión de energía, temporizador de
encendido y apagado de 24 horas
t1SVFCBEFTFHVSJEBEDPNQPOFOUFTBQSPCBEPTQPS6-Z$4"QSPCBEPTFOFM
FOTBNCMBEPZBQSPCBEPTQPS&5-&5-$Z$&
* Cable subacuático calibre 10 que se ordena por separado con incrementos de 25 pies (7.6 metros)
Ejemplo de un LM20 en uso
El uso inteligente del agua.™
219
Estaciones de bombeo
Aireadores para mantenimiento de lagos
Serie LMM
Especificaciones
Aireadores de patrón múltiple para mantenimiento de lagos
t6OJEBEGBCSJDBEBFOBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJØOZ
plásticos térmicos de alta densidad. La resistencia a la corrosión permite que
la unidad sea instalada en casi todos los tipos de fuentes de agua
Q 5SBCBKBOEFGPSNBFGJDB[QBSBNBOUFOFSFMFRVJMJCSJPFDPMØHJDPFOMBHPTP
estanques de menos de 15 pies (5 m) de profundidad
Q Mantienen el atractivo de lagos y estanques estimulando la circulación
vertical y agregando oxígeno disuelto al agua
t'MPUBEPSDBSDBTBFYUFSJPSOFHSBGBCSJDBEBDPOQPMJFUJMFOPQMÈTUJDPUÏSNJDPEF
alta densidad. El interior del flotador es de polietileno de celdillas cerradas.
Cada flotador consta de anillos flotadores especialmente diseñados, que
hacen que la unidad permanezca a nivel del agua
Q Mantienen la calidad del agua necesaria para evitar la acumulación
no deseada de algas, el crecimiento excesivo de malezas, los olores
desagradables y la disminución de poblaciones de peces
t.PUPSNPUPSEFBDFSPJOPYJEBCMFGBCSJDBEPQPSFODBSHPTVNFSHJCMF
enfriado por agua y resistente a la corrosión. Construido para funcionamiento
continuo y disponible en 60 Hz a 3450 RPM
Características
t*NQVMTPSFTQSPQVMTPSFTGBCSJDBEPTFOØYJEPEFQPMJGFOJMFOPNPEJGJDBEP&M
material es resistente a la corrosión para casi todo tipo de agua, soluciones
salinas y ácidos
t%JTQPOJCMFFOCPNCBTNPOPGÈTJDBTEF›Z£IQ77
t5PEBTMBTVOJEBEFT-..WJFOFOBSNBEBTEFGÈCSJDBZTFFOUSFHBOMJTUBTQBSB
ser instaladas
t'BCSJDBEPUPUBMNFOUFFOBDFSPJOPYJEBCMFZQMÈTUJDPTUÏSNJDPTQBSB
proporcionar años de servicio confiable
t.BMMBQBSBTVDJFEBEEFBDFSPJOPYJEBCMFRVFFWJUBMBFOUSBEBEFPCKFUPT
extraños para permitir el caudal continuo de agua entrante y garantizar
patrones de rociado estéticamente agradables
t.JOJDFOUSPEFFOFSHÓBFNQPUSBEPFOVOBDVCJFSUBEFHSBEPJOEVTUSJBM
resistente a la corrosión que garantiza confiabilidad
t&MQBUSØOEFSPDJBEPTFQVFEFNPEJGJDBSBMEFM-.-.P-.
t"OJMMPBTQFSTPSRVFQFSNJUFRVFFMQBUSØOEFSPDJBEPTFBEFBMUVSBZEJÈNFUSP
variables (LMM solo con patrones LM10 y LM11)
t$BCMFUPEBTMBTVOJEBEFTTFFOWÓBODPODBCMFTVCBDVÈUJDPRVFTFPSEFOBQPS
separado, con un mínimo de 50 pies (15.2 m), con incrementos de 25 pies
N
t.JOJDFOUSPEFFOFSHÓBDPOUSPMFTEFMBVOJEBEEF7EFOUSPEFVOB
cubierta de 5" x 5" x 4" (12.7 cm x 12.7 cm x 10.2 cm) de grado industrial,
completamente de plástico y resistente a la corrosión. Los controles de 115 V
constan de temporizador de encendido y apagado de 24 horas e interruptor
QPSGBMMBTFOEFTDBSHBBUJFSSB('*
-BTVOJEBEFTEF7TFFODVFOUSBO
dentro de una cubierta de alto impacto de 11" x 11" x 6" (27.9 cm x 27.9
cm x 15.2 cm), de plástico térmico resistente a la corrosión, certificada por
NEMA como tipo 3S. Los controles de las unidades de 230 V constan de
temporizador de encendido y apagado de 24 horas, fusibles o protección de
DPSUBDJSDVJUPTFJOUFSSVQUPSQPS('*
t.BMMBNBMMBJOUBDUBEFBDFSPJOPYJEBCMFSFTJTUFOUFBMBDPSSPTJØORVF
evita las obstrucciones en forma eficaz
t1SVFCBEFTFHVSJEBETPNFUJEPBQSVFCBEFTFHVSJEBEZBQSPCBEPDPNPVO
QBRVFUFQPS&5-&5-$Z$&
* Cable subacuático calibre 12 que se ordena por separado con incrementos de 25 pies (7.6 metros)
Modelos
t*ODMVZFCPRVJMMBTJOUFSDBNCJBCMFTQBSBDBNCJBSEF-.-.-.
LM10: la característica principal es un patrón de rociado de un surtidor,
similar a un géiser que se eleva por el aire
LM11: rociado bien proporcionado, en forma de abanico; el equilibrio
perfecto entre forma y función
Bombas
LM20: las populares opciones con patrón de rociado doble benefician
el aspecto estético mientras mantienen la calidad del agua en forma
efectiva
Características opcionales
t4JTUFNBTDPOKVFHPTEFMVDFTRVFGVODJPOBODPOWPMUJPTEJTQPOJCMFTDPO
bombillas halógenas de 20 vatios. Ménsulas de montaje de acero inoxidable
que facilitan la instalación para lograr diversos efectos de iluminación
t$SJTUBMFTFODPMPSSPKPB[VMWFSEFZBNBSJMMP
LMM se muestra con el patrón de LM20 seleccionado
220
El uso inteligente del agua.™
Impactos
Rotores
Boquillas aspersoras
Cuerpos de
aspersores
Introducción
Cuerpos de difusores
Productos de drenaje
Válvulas
La marca más actual en drenaje es
aquélla en la que usted ya confía.
Xerigation®
Sistemas de control
centralizado
Programadores
Accesorios
Durante décadas hemos estado buscando nuevas
formas de usar el agua de manera más inteligente.
Estamos orgullosos de presentar algunas más:
Productos de drenaje de Rain Bird. Fuertemente
construidos y diseñados para trabajar en conjunto,
estas grandes cuencas y accesorios le pueden
ayudar a manejar eficientemente el escurrimiento
de agua en casi cualquier sitio residencial,
comercial o municipal. Colóquelos en el terreno.
Verá por qué son los primeros productos de drenaje
dignos del nombre Rain Bird.
t
Un sistema de drenaje instalado
adecuadamente puede eliminar
problemas en el lugar causados por agua
corriente o estancada que puede resultar
en la erosión del suelo, daño a las plantas
o a la estructura.
t
Recuerde, el agua siempre corre hacia
abajo. Asegúrese de que haya cuando
menos una diferencia de elevación del 2%
entre la parte más alta y la más baja del
sistema de drenaje.
el daño a las estructuras al dirigir el agua
lejos de los cimientos de construcción a
un área más deseable del lugar.
t 6OBWÈMWVMBSFUSÈDUJMQBSBESFOBKF%167
de Rain Bird se puede instalar en el
punto más bajo de la red de tubería para
permitir que el agua recolectada se filtre
lentamente en el suelo para recuperar
los niveles de agua en el subsuelo.
Drenaje
El agua recolectada puede dirigirse
posteriormente a un tanque de
almacenamiento en el lugar, tratarse
(si se requiere) y bombearse según
sea necesario para alimentar un
sistema eficiente de riego de
Rain Bird.
t Los sistemas de drenaje pueden reducir
Referencia
t
La instalación de un sistema de
drenaje bien diseñado resultará en
la recolección y captura de lluvia,
agua de lluvia y agua estancada en
el lugar.
Recursos
t
Bombas
Sugerencias para ahorrar agua
El uso inteligente del agua.™
221
Productos de drenaje
Introducción
Nueva categoría de productos. La misma
resistencia.
Color, tamaño y estilo son opcionales.
Los acoples sueltos no lo son.
Aquí no hay atajos. Nuestras rejillas, cuencas y accesorios de drenaje
fueron diseñados con la misma ingeniería y los mismos estándares de
precisión que los aspersores, válvulas y controladores de Rain Bird.
Sin importar el trabajo, usted tendrá el equipo que necesita para hacerlo
bien. Ofrecemos rejillas y cuencas de diferentes dimensiones, formas y
colores: todos ellos planeados para que ajusten perfectamente, sin tener que
preocuparse por las conexiones.
Confiabilidad comprobada
5FOFNPTVOBSFQVUBDJØORVFQSPUFHFS-PTQSPEVDUPTEFESFOBKFEF
Rain Bird se construyen usando los materiales de la más alta calidad y se
someten a rigurosas pruebas de durabilidad.
Garantía de tres años
Usted necesita productos que duren mucho tiempo después de que
se hace el trabajo. Esa es la razón por la que respaldamos nuestros
productos de drenaje con la garantía más alta en la categoría de
productos de drenaje.
Cuatro colores
/BEJFOPUBSÈRVFFTUÈOBIÓ%JTQPOJCMFTFOWFSEFOFHSPBSFOBZHSJT
nuestras rejillas se mezclan fácilmente con cualquier paisaje, pasando
inadvertidas y protegiendo la estética general.
Compatibilidad total
No importa cómo las combine, nuestras rejillas y cuencas se adaptarán de la
mejor manera. Para mejoras fáciles y remplazos rápidos, nuestros productos
son compatibles con los componentes de la mayoría de los fabricantes de
drenaje.
Cuenca recolectora redonda
Cuenca de bajo perfil
Rejilla universal
cuadrada de 7" (17.8 cm)
Rejilla redonda atrio de
6" (15.2 cm) (pág. 223)
Rejilla cuadrada
atrio (pág. 224)
(pág. 224)
Rejilla cuadrada plana
(pág. 224)
Acople de 6" (15.2 cm),
opcional
5VCFSÓBEFDN
para extender la altura
de la cuenca, opcional
Rejilla redonda
plana de 6" (15.2 cm)
(15.2 cm) (pág. 223)
Cuenca cuadrada de
perfil bajo (pág. 227)
Adaptador de cuenca,
para tubería de 3" (7.6 cm) o 4" (10.2 cm) (pág. 229)
Cuencas recolectoras
redondas de
6" (15.2 cm) (pág. 225)
Cuenca recolectora cuadrada
Tubería de drenaje compatible
Rejilla cuadrada
atrio (pág. 224)
(no fabricada por Rain Bird)
5VCFSÓBEFBMDBOUBSJMMBZESFOBKFEFDN
DN
PDN
(tubería de 6" (15.2 cm) solo para las cuencas recolectoras cuadradas)
Elevador de cuenca:
opcional (pág. 229)
Drenaje
Adaptador de cuenca, para tubería de
3" (7.6 cm) o 4" (10.2 cm) (pág. 229)
Adaptador de compensación
para cuenca, para tubería de
3" (7.6 cm) o 4" (10.2 cm) (pág. 229)
Adaptador de cuenca,
para tubería de 6" (15.2 cm)
5VCFSÓBEFQBSFEUSJQMFEF
3" (7.6 cm) o 4" (10.2 cm)
(pág. 229)
Rejilla cuadrada
plana (pág. 224)
Cuenca
recolectora cuadrada
(pág. 226)
Conexión de
cuenca
(pág. 229)
5VCFSÓBDPSSVHBEBEFDN
DN
P
6" (15.2 cm) (tubería de 6" (15.2 cm) solo para las
cuencas recolectoras cuadradas)
222
El uso inteligente del agua.™
Productos de drenaje
www.rainbird.com/drainage
Rejillas redondas de plástico
Rejillas redondas de plástico
Plano
Características
t 'BCSJDBEBTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEFBMUBEFOTJEBE)%1&
t Estabilizado con UV para proteger contra la degradación producida por el sol
t Perfiles planos y de atrio (en forma de domo)
t Rejillas planas disponibles en verde, negro, arena y gris
t Rejillas de atrio disponibles en verde, negro y arena
t Cada rejilla tiene tres diámetros superpuestos para ajustarse a la tubería de
BMDBOUBSJMMBZBMESFOBKF4Z%
ZBMPTBDDFTPSJPTUVCFSÓBEFUSJQMFQBSFEZ
tubería corrugada
3" (7.6 cm)
4" (10.2 cm)
6" (15.2 cm)
DG3RFG
DG4RFG
DG6RFG
3" (7.6 cm)
4" (10.2 cm)
6" (15.2 cm)
DG3RAG
DG4RAG
DG6RAG
Atrio
t Superficie texturizada y antideslizante 1
t Carga clasificada para tráfico peatonal 1, 2
t Carga clasificada para autos y camiones ligeros a velocidades menores que
20 mi/h (30 km/h) 1, 2
t $PODFSUJGJDBDJØO"%"1
t 'BCSJDBEPFO&&̓66
Número de
modelo
Cada diámetro es adecuado para
Color
Pequeña
Mediana
Grande
Ancho de
ranura
abierta
Área de
superficie
abierta
Índice de
caudal
máximo
Carga
máxima
3⁄16"
3 sq in
(19.35 cm²)
3 GPM
(11.4 l/m)
500 lb
(226.8 kg)
ž
5 sq in
(32.26 cm²)
6 GPM
(22.7 l/m)
750 lb
(340.2 kg)
13 sq in
(83.87 cm²)
16 GPM
(60.6 l/m)
1000 lb
(453.6 kg)
ž
9 sq in
(58.06 cm²)
12 GPM
(45.4 l/m)
/%
5⁄16"
16 sq in
(103.23 cm²)
20 GPM
(75.7 l/m)
/%
28 sq in
(180.64 cm²)
36 GPM
(136.3 l/m)
/%
Redonda plana de 3" (7.6 cm)
%(3'(
Verde
%(3'#
negro
%(3'4
Arena
%(3'$
Gris
5VCFSÓBEF
triple pared de
3" (7.6 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 3" (7.6 cm)
"45.%
5VCFSÓBDPSSVHBEBEF
3" (7.6 cm)
Accesorios de alcantarilla y
drenaje de 3" (7.6 cm)
4%3
(4.8 mm)
Redonda plana de 4" (10.2 cm)
%(3'(
Verde
%(3'#
negro
%(3'4
Arena
%(3'$
Gris
5VCFSÓBEF
triple pared de
4" (10.2 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 4" (10.2 cm)
"45.%
Accesorios de alcantarilla y
drenaje de 4" (10.2 cm)
(6.3 mm)
5VCFSÓBDPSSVHBEBEF
4" (10.2 cm)
4%3
5VCFSÓBEF
alcantarilla de
6" (15.2 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 6" (15.2 cm)
Accesorios de alcantarilla
y drenaje de 6" (15.2 cm)
"45.%
4%3
5⁄16"
"45.%
4%3
5VCFSÓBDPSSVHBEBEF
6" (15.2 cm)
Cuencas recolectoras
redondas de 6" (15.2 cm)
(10.5 mm)
Redonda plana de 6" (15.2 cm)
%(3'(
Verde
%(3'#
negro
%(3'4
Arena
%(3'$
Gris
%#3Z%#3)
%(3"(
Verde
%(3"#
negro
%(3"4
Arena
5VCFSÓBEF
triple pared de
3" (7.6 cm)
Atrio plano de 4" (10.2 cm)
%(3"(
Verde
%(3"#
negro
%(3"4
Arena
5VCFSÓBEF
triple pared de
4" (10.2 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 3" (7.6 cm)
"45.%
5VCFSÓBDPSSVHBEBEF
3" (7.6 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 4" (10.2 cm)
"45.%
Accesorios de alcantarilla y
drenaje de 3" (7.6 cm)
4%3
Accesorios de alcantarilla y
drenaje de 4" (10.2 cm)
5VCFSÓBDPSSVHBEBEF
4" (10.2 cm)
4%3
5VCFSÓBEF
alcantarilla de
6" (15.2 cm)
5VCFSÓBEFBMDBOUBSJMMBZ
drenaje de 6" (15.2 cm)
Accesorios de alcantarilla
y drenaje de 6" (15.2 cm)
"45.%
4%3
5VCFSÓBDPSSVHBEBEF
6" (15.2 cm)
(6.3 mm)
(10.5 mm)
Atrio plano de 6" (15.2 cm)
%(3"(
Verde
%(3"#
negro
%(3"4
Arena
"45.%
4%3
Cuencas recolectoras
redondas de 6" (15.2 cm)
3⁄8"
(12.6 mm)
%#3Z%#3)
1 Solo rejilla plana
2 Máxima clasificación de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla
El uso inteligente del agua.™
223
Drenaje
Atrio plano de 3" (7.6 cm)
Productos de drenaje
Rejillas cuadradas de plástico
Rejillas cuadradas de plástico
Plano
Características
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEFBMUB
EFOTJEBE)%1&
t Estabilizado con UV para proteger contra la degradación
producida por el sol
t Perfiles planos y de atrio (en forma de domo)
t Rejillas planas disponibles en verde, negro, arena y gris
t Rejillas atrio disponibles en verde y negro
t Para cuencas recolectoras cuadradas de 9" (22.9 cm), 12"
(30.5 cm) y 18" (45.7 cm)
Para cuencas cuadradas de perfil bajo de 9" (22.9 cm) y
12" (30.5 cm)
Superficie texturizada y antideslizante 1
9" (22.9 cm)
12" (30.5 cm)
DG9RFG
DG12SFG
18" (45.7 cm)
DG12SFG
Atrio
t Carga clasificada para autos y camiones ligeros a
velocidades menores a 20 mi/h (30 kmh) 1, 2
t Incluye dos orificios para tornillos para asegurar la
cuenca 3
t $PODFSUJGJDBDJØO"%"1
t 'BCSJDBEPFO&&̓66
Número de modelo
Color
9" (22.9 cm)
12" (30.5 cm)
DG9RFG
DG12SFG
Ajuste
Ancho de
ranura abierta
Área de
superficie
abierta
Índice de
caudal
máximo
Carga máxima
3⁄8"
38 sq in
245.16 cm²
50 GPM
(189.3 l/m)
2,000 lb.
(907.2 kg)
53 sq in
341.93 cm²
70 GPM
(265.0 l/m)
3,000 lb.
(1360.8 kg)
92 sq in
593.55 cm²
120 GPM
(454.2 l/m)
4,000 lb.
(1814.4 kg)
31 sq in
200.00 cm²
40 GPM
(151.4 l/m)
/%
50 sq in
322.58 cm²
65 GPM
(246.1 l/m)
/%
Cuadrada plana de 9" (22.9 cm)
%(4'(
Verde
%(4'#
negro
%(4'4
Arena
%(4'$
Gris
Cuencas recolectoras cuadradas de
9" (22.9 cm) %#3
Cuencas de perfil bajo de 9" (22.9 cm)
(12.6 mm)
%#4-1
Cuadrada plana de 12" (30.5 cm)
%(4'(
Verde
%(4'#
negro
%(4'4
Arena
%(4'$
Gris
Cuencas recolectoras cuadradas
de 12" (30.5 cm)
%#4Z%#4
Cuencas de perfil bajo de
12" (30.5 cm) %#4-1
7⁄16"
(14.7 mm)
Cuadrada plana de 18" (45.7 cm)
%(4'(
Verde
%(4'#
negro
Cuencas recolectoras cuadradas
de 18" (45.7 cm)
%(4'4
Arena
%#4Z%#4
%(4'$
Gris
15⁄32"
(15.8 mm)
Cuadrada atrio de 9" (22.9 cm)
Drenaje
%(4"(
Verde
%(4"#
negro
Cuencas recolectoras cuadradas
de 9" (22.9 cm) %#3
Cuencas de perfil bajo
de 9" (22.9 cm) %#4-1
3⁄8"
(12.6 mm)
Cuadrada atrio de 12" (30.5 cm)
%(4"(
Verde
Cuencas recolectoras cuadradas
de 12" (30.5 cm)
%(4"#
negro
Cuencas de perfil bajo
de 12" (30.5 cm) %#4-1
%#4Z%#4
7⁄16"
(14.7 mm)
1 Solo rejilla plana
2 Máxima clasificación de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla
3 Use tornillos Phillips n.º 6 de 1.5" (3.8 cm) de largo de cabeza plana de acero inoxidable
224
El uso inteligente del agua.™
Productos de drenaje
www.rainbird.com/drainage
Rejillas cuadradas universales
Rejillas cuadradas universales
Características
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPFTUSVDUVSBMEF
BMUBEFOTJEBE)%1&
t Con superficie texturizada y
antiderrapante
t Estabilizado con UV para proteger contra la
degradación producida por el sol
t Carga clasificada para tráfico peatonal 1
t %JTQPOJCMFTFOWFSEFOFHSPBSFOBZHSJT
t 'BCSJDBEPFO&&̓66
Número de
modelo
Color
t $PODFSUJGJDBDJØO"%"
DG7USG
Ajuste
Ancho de
ranura abierta
Área de
superficie
abierta
Índice de
caudal máximo
Carga
máxima
ž
13 sq in
(83.87 cm²)
11 GPM
(41.6 l/m)
250 lb.
(113.4 kg)
Plano cuadrado universal de 7" (17.8 cm)
%(64(
Verde
%(64#
negro
%(644
Arena
%(64$
Gris
tCuencas recolectoras redondas de 6" (15.2 cm) %#3Z%#3
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKFEFDN
"45.%
t5VCFSÓBDPSSVHBEBEFDN
PDN
t5VCFSÓBEFQBSFEUSJQMFEFDN
PDN
tAccesorios de alcantarilla y drenaje de 3" (7.6 cm), 4" (10.2 cm)
(6.3 mm)
o 6" (15.2 cm) 4%3
1 Máxima clasificación de carga basada en la cuenca empotrada en concreto y con el peso aplicado uniformemente sobre toda la superficie de la rejilla
Cuencas recolectoras redondas
Características
t 'BCSJDBEPDPOQPMJFUJMFOPEFBMUPJNQBDUP)*14
t Estabilizado con UV para proteger contra la degradación producida por
el sol
t %JTQPOJCMFFONPEFMPTEFVOBZEPTTBMJEBT
t Acepta rejillas planas de 6" (15.2 cm), rejillas atrio de 6" (15.2 cm) y rejillas
universales de 7" (17.8 cm)
t Las salidas universales se usan para conectar tuberías de
BMDBOUBSJMMBZESFOBKFEFDN
ZDN
"45.%
PUVCFSÓBT
corrugadas de 4" (10.2 cm) y tuberías de pared triple de 4" (10.2 cm).
t Incluye un depósito para permitir que los sedimentos se depositen en la
cuenca para reducir al mínimo la posibilidad de que se tapen las tuberías.
DB6R1
t Para extender la altura de la cuenca, use tubería de PVC de 6" (15.2 cm) y
"45.%4%3
DPNPFMFWBEPS
t 'BCSJDBEPFO&&̓66
Número de
modelo
DB6R2
Cantidad de
salidas
A la entrada (superior) le caben
A la salida (lateral) le cabe
Capacidad
Capacidad del
depósito
0.8 gal.
(3.0 l)
0.2 gal.
(0.75 l)
0.8 gal.
(3.0 l)
0.2 gal.
(0.75 l)
%#3
1
tRejillas redondas planas y de atrio de 6" (15.2 cm) t5VCFSÓBDPSSVHBEBEFDN
PDN
t5VCFSÓBEFQBSFEUSJQMFEFDN
P
tRejilla universal cuadrada de 7" (17.8 cm)
t5VCFSÓB17$EFDN
"45.%"45.% 4" (10.2 cm)
4%3
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKF"45.%
Drenaje
1 salida redonda de 6" (15.2 cm)
Redonda de 6" (15.2 cm), 2 salidas
%#3
2
tRejillas redondas planas y de atrio de 6" (15.2 cm) t5VCFSÓBDPSSVHBEBEFDN
PDN
t5VCFSÓBEFQBSFEUSJQMFEFDN
P
tRejilla universal cuadrada de 7" (17.8 cm)
t5VCFSÓB17$EFDN
"45.%"45.% 4" (10.2 cm)
4%3
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKF"45.%
El uso inteligente del agua.™
225
Productos de drenaje
Cuencas recolectoras cuadradas
Rejillas cuadradas
DB18S2
Características
t 'BCSJDBEPTDPOFTQVNBEFQPMJFUJMFOPEFBMUBEFOTJEBE)%1&
t Estabilizado con UV para proteger contra la degradación producida
por el sol
t Las cuencas de 12" (30.5 cm) y 18" (45.7 cm) tienen dos o cuarto salidas
además de una salida opcional perforada en la parte inferior de la
cuenca
t Use un adaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm) para conectar
la cuenca a la tubería corrugada de 3" (7.6 cm) y 4" (10.2 cm) y a la
tubería de triple pared de 3" (7.6 cm) y 4" (10.2 cm)
t Use un adaptador de cuenca de 6" (15.2 cm) para conectar la cuenca a
MBUVCFSÓBEF17$EFDN
"45.%Z"45.%4%3
y a la tubería corrugada de 6" (15.2 cm)
t Use un tapón de cuenca para para tapar las salidas que no se usen
t Use elevadores de cuenca cuadrada de 9" (22.9 cm) o 12" (30.5 cm)
para extender 6" (15.2 cm) la altura de las cuencas de 9" (22.9 cm) y
12" (30.5 cm) respectivamente
DB12S4
t Acepta rejillas planas de 9" (22.9 cm), 12" (30.5 cm) o 18" (45.7 cm) y
rejillas atrio cuadradas
DB18S4
t Incluye un depósito para permitir que los sedimentos se depositen
en la cuenca para reducir al mínimo la posibilidad de que se tapen las
tuberías.
DB12S2
t Incluye cuatro orificios para tornillo para permitir que las rejillas se
aseguren a la cuenca
DB9S2
t 'BCSJDBEPFO&&̓66
Número
de
modelo
Cantidad
de
salidas
A la entrada (superior) le caben
Capacidad
Capacidad
del
depósito
tConexión de cuenca %#""1
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
2.2 gal.
(8.3 l
0.5 ga.
(1.70 l)
tConexión de cuenca %#""1
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
5.1 gal.
(19.3 l)
1.3 gal.
(4.7 l)
tConexión de cuenca %#""1
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
5.1 gal.
(19.3 l)
1.3 gal.
(4.7 l)
tConexión de cuenca %#""1
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
16.7 ga.
(2.8 l)
4.9 gal.
(18.5 l)
tConexión de cuenca %#""1
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
16.7 ga.
(2.8 l)
4.9 gal.
(18.5 l)
A la salida (lateral) le cabe
Cuadrada de 9" (22.9 cm), 2 salidas
%#4
2
tRejilla cuadrada plana de 9" (22.9 cm)
tRejilla cuadrada atrio de 9" (22.9 cm)
tElevador de cuenca cuadrada de 9" (22.9 cm) %#3&
Cuadrada de 12" (30.5 cm), 2 salidas
%#4
2
tRejilla cuadrada plana de 12" (30.5 cm)
tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)
%#3&
Cuadrada de 12" (30.5 cm), 4 salidas
%#4
4
tRejilla cuadrada plana de 12" (30.5 cm)
tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)
Drenaje
%#3&
Cuadrada de 18" (45.7 cm), 2 salidas
%#4
2
tRejilla cuadrada plana de 18" (45.7 cm)
Cuadrada de 18" (45.7 cm), 4 salidas
%#4
226
4
tRejilla cuadrada plana de 18" (45.7 cm)
El uso inteligente del agua.™
Productos de drenaje
www.rainbird.com/drainage
Cuencas de perfil bajo cuadradas y kits de cuencas cuadradas
Rejillas cuadradas de bajo perfil
Características
t 'BCSJDBEPDPOQPMJFUJMFOPEFBMUPJNQBDUP)*14
t Estabilizado con UV para proteger contra la degradación producida por el sol
t Una salida inferior diseñada para aceptar todos los adaptadores de cuenca
t Use un adaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm) para conectar a la
tubería corrugada de 3" (7.6 cm) y 4" (10.2 cm) y la tubería de triple pared de
3" (7.6 cm) y 4" (10.2 cm)
t Use un adaptador de cuenca de 6" (15.2 cm) para conectar tubería de PVC de
DN
"45.%Z"45.%4%3
ZMBUVCFSÓBDPSSVHBEBEF
6" (15.2 cm)
DB9SLP
t Acepta rejillas cuadradas planas de 9" (22.9 cm) y 12" (30.5 cm)
t Acepta rejillas cuadradas atrio de 9" (22.9 cm) y 12" (30.5 cm)
t Incluye dos orificios para tornillo para permitir que las rejillas se fijen a la
cuenca de perfil bajo
t 'BCSJDBEPFO&&̓66
Número de
modelo
A la entrada (superior) le caben
A la salida (lateral) le cabe
Cuadrada de 9" (22.9 cm)
%#4-1
tRejilla cuadrada plana de 9" (22.9 cm)
tRejilla cuadrada atrio de 9" (22.9 cm)
tElevador de cuenca cuadrada de 9" (22.9 cm)
(%#3&)
DB12SLP
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
Cuadrada de 12" (30.5 cm)
%#4-1
tRejilla cuadrada plana de 12" (30.5 cm)
tRejilla cuadrada atrio de 12" (30.5 cm)
tElevador de cuenca cuadrada de 12" (30.5 cm)
%#3&
tAdaptador de cuenca de 3" (7.6 cm) y 4" (10.2 cm)
%#""P%#""0
tAdaptador de cuenca de 6" (15.2 cm) %#""
Kits de rejillas cuadradas
Para su conveniencia, están disponibles kits de cuenca con las cuencas, rejillas y los
componentes de adaptador más populares que se requieren para la mayoría de los trabajos.
Número de
modelo
Cada equipo incluye
Equipo de cuenca cuadrada de 9" (22.9 cm)
%#,*5(
tCuencas cuadradas de 9" (22.9 cm) t$POFYJØOEFDVFODB%#""1
DPOEPTTBMJEBT%#3
cuadrada plana de
t%PTBEBQUBEPSFTEFDN
Z tR9"ejilla
(22.9 cm) 7&3%&%(4'(
DN
%#""
tCuencas cuadradas de 9" (22.9 cm) t$POFYJØOEFDVFODB%#""1
DPOEPTTBMJEBT%#3
cuadrada plana de
t%PTBEBQUBEPSFTEFDN
Z tR9"ejilla
(22.9 cm) NEGRA%(4'#
Drenaje
%#,*5#
DN
%#""
Kit de cuenca cuadrada de 12" (30.5 cm) (no se muestra)
%#,*5(
tCuencas cuadradas de 12" (30.5 cm) t$POFYJØOEFDVFODB%#""1
DPOEPTTBMJEBT%#4
cuadrada plana de
t%PTBEBQUBEPSFTEFDN
Z tR12"ejilla(30.5
cm) 7&3%&%(4'(
DN
%#""
%#,*5#
tCuencas cuadradas de 12" (30.5 cm) t$POFYJØOEFDVFODB%#""1
DPOEPTTBMJEBT%#4
cuadrada plana de
t%PTBEBQUBEPSFTEFDN
Z tR12"ejilla(30.5
cm) NEGRA%(4'#
DN
%#""
El uso inteligente del agua.™
DB9KITG
227
Productos de drenaje
Válvulas retráctiles para drenaje
Válvulas retráctiles para drenaje
Características
t %JTQPOJCMFFODVBUSPDPOGJHVSBDJPOFT
t Cuerpo de válvula retráctil fabricado con espuma de polietileno estructural
EFBMUBEFOTJEBE)%1&
t Codo (donde se requiera) fabricado en PVC
t Adaptador (cuando sea necesario) fabricado con polietileno de alto impacto
(HIPS)
t Estabilizado con UV para proteger contra la degradación producida por el sol
t 6OBDPCFSUVSBBDUJWBEBQPSSFTPSUFTFFMFWB›QBSBEFTDBSHBSFMFYDFTPEF
agua en el sistema
t El resorte retrae automáticamente la cobertura a la posición cerrada después
de que se ha descargado el exceso de agua
DPUV3E
DPUV0
t Se puede usar tanto en posición horizontal como vertical
t Resorte de acero inoxidable para evitar que se oxide
t Los codos de PVC (cuando sea necesario) incluyen un orificio de drenaje de
žQBSBFMJNJOBSFMBHVBFTUBODBEB
t 'BCSJDBEPFO&&̓66
DPUV4E
DPUV4EHUB
Color
Descripción
%167
Verde
Válvula retráctil para drenaje
%167&
Verde
Válvula retráctil de drenaje con codo de PVC de 3" (7.6 cm)
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKFEFDN
"45.%
t5VCFSÓBEFQBSFEUSJQMFEFDN
%167&
Verde
Válvula retráctil de drenaje con codo de PVC de 4" (10.2 cm)
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKFEFDN
"45.%Z%
t5VCFSÓBEFQBSFEUSJQMFEFDN
%167&)6#
Verde
Válvula retráctil de drenaje con codo y adaptador de PVC
de 4" (10.2 cm) (%1"')")
Drenaje
Número de
modelo
228
Conexión con
tAccesorios de alcantarilla y drenaje de 3" (7.6 cm) o 4" (10.2 cm) 4%3
t5VCFSÓBDPSSVHBEBEFDN
PDN
t5VCFSÓBEFQBSFEUSJQMFEFDN
PDN
t5VCFSÓBEFBMDBOUBSJMMBZESFOBKFEFDN
"45.%
El uso inteligente del agua.™
Productos de drenaje
www.rainbird.com/drainage
Adaptadores y accesorios para rejillas
Adaptadores y accesorios para rejillas
Número de
modelo
Descripción
%#""1
Conexión de cuenca
%#""
Adaptador de cuenca de 3" (7.6 cm)
y 4" (10.2 cm)
%#""0
Adaptador de compensación para
cuenca de 3" (7.6 cm) y 4" (10.2 cm)
Uso
t5BQBEFDVFODBTSFDPMFDUPSBTDVBESBEBTEFDN
12" (30.5 cm) y 18" (45.7 cm)
tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),
12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubería de PVC y corrugada
de 3" (7.6 cm) o 4" (10.2 cm)
tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),
12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubería de PVC y corrugada
de 3" (7.6 cm) o 4" (10.2 cm)
tAdapta salidas laterales de cuencas cuadradas de 9" (22.9 cm),
%#""
%1"')
Adaptador de cuenca de 6" (15.2 cm)
Adaptador de ajuste
Elevador de cuenca cuadrada de 9" (22.9
cm)
%#3&
Elevador de cuenca cuadrada de
12" (30.5 cm)
tAdapta tubería de pared triple de 3" (7.6 cm) o 4" (10.2 cm) a
tubería PVC y corrugada de 3" (7.6 cm) o 4" (10.2 cm)
tAumenta 6" (15.2 cm) a la altura de la cuenca cuadrada de
9" (22.9 cm) o a la cuenca de perfil bajo de 9" (22.9 cm)
Drenaje
%#3&
12" (30.5 cm) y 18" (45.7 cm) y salidas de cuencas de bajo perfil
de 9" (22.9 cm) y 12" (30.5 cm) a la tubería de PVC y corrugada
de 6" (15.2 cm)
El uso inteligente del agua.™
tExtiende la altura de la cuenca cuadrada de 12" (30.5 cm)
o 6" (15.2 cm) a la cuenca de perfil bajo de 12" (30.5 cm)
229
www.rainbird.com/resources
Cuerpos
de difusores
Recursos
Introducción
Cuerpos de
aspersores
Boquillas aspersoras
Rotores
Impactos
Programa de recompensas Rewards
Válvulas
Accesorios
Rain Bird ofrece programas de recompensas
Rewards para agencias públicas o sin
fines de lucro y contratistas de sistemas
de riego. Con Rain Bird Rewards y Agency
Rewards, puede acumular valiosos puntos
solo por comprar la línea más extensa de
productos de riego y drenaje en jardines
disponible. Cambie los puntos del programa
de recompensas Rewards para obtener
más productos de Rain Bird, material de
marketing u otros artículos diseñados para
contribuir al éxito de su empresa.
Programadores
Sistemas de control
centralizado
Xerigation®
Bombas
Sugerencias para ahorrar agua
Drenaje
t Rain Bird Rewards ofrece
Recursos
materiales de marketing
profesional que los contratistas
pueden utilizar para informar a
sus clientes sobre los beneficios y
las ventajas de los productos para
el ahorro de agua.
t Los folletos de productos de
riego eficiente, las tarjetas
postales y los colgantes de
puerta le ayudan a mostrar los
productos Rain Bird que ofrecen
ahorro de agua.
t Una serie de informes técnicos que investigan
las causas y establecen posibles soluciones
para la creciente crisis mundial de agua;
campañas de difusión de interés público para
la televisión con sugerencias destinadas a los
propietarios sobre la reducción del
desperdicio de agua en exteriores; y planes de
estudios sobre el consumo de agua para
escuelas primarias y secundarias.
Referencia
230
El uso inteligente del agua.™
Recursos
www.rainbird.com/resources
Programas de recompensas Rewards
Programas de recompensas Rewards
Rain Bird® Rewards
Rain Bird® Agency Rewards™
Rain Bird Rewards es el programa de recompensas número 1 para los
profesionales paisajistas y de riego. Puede ganar puntos en todos los productos
EFSJFHPZESFOBKFFOKBSEJOFTEF3BJO#JSEQBSUJDJQBOUFTBTQFSTPSFTSPUPSFT
válvulas, controladores, riego por goteo, estaciones de bombeo, rejillas de
drenaje, cuencas de drenaje y accesorios.
Rain Bird sabe que las agencias deben aprovechar al máximo cada dólar que se gasta
en riego. Rain Bird Agency Rewards contribuye a que reinviertan el presupuesto de
riego en la agencia y la gente. Los premios del programa de recompensas incluyen:
Existen tres niveles de membresía en el programa de recompensas
Rewards:
Por cada $100
que usted gaste,
ganará:
Por cada $100 que usted
gaste por encima de su
objetivo básico, ganará:
Puntos básicos
Puntos de crecimiento
Rewards Contractor™
60 puntos
160 puntos
Select Contractor®
80 puntos
200 puntos
100% Select Contractor®
100 puntos
200 puntos
Nivel de programa
Puede encontrar una lista completa de requisitos en
ww2.rainbird.com/rewards
t$BQBDJUBDJØOFOSJFHP
t'POEPTQBSBEFTBSSPMMPQSPGFTJPOBM
t-JUFSBUVSBEFSFGFSFODJBEFMBJOEVTUSJBZMPTQSPEVDUPT
t$SÏEJUPQBSBFMEJTUSJCVJEPS
Cómo solicitar folletos
t3FBMJDFTVQFEJEPBUSBWÏTEFMSFQSFTFOUBOUFEFTFSWJDJPEFEJTUSJCVDJØOEF3BJO#JSE
t/ÞNFSPTEFNPEFMP
(VÓBQBSBNJFNCSPTEF3BJO#JSE3FXBSET%%
%Y'PMMFUPEFMQSPHSBNBEFSFDPNQFOTBT3BJO#JSE3FXBSET
%Y'PMMFUPEFJOTDSJQDJØOB3BJO#JSE3FXBSET
%Y'PMMFUPEFJOTDSJQDJØOB3BJO#JSE3FXBSETTPMPQBSB$BOBEÈ
%Y'PMMFUPEFJOTDSJQDJØOB3BJO#JSE"HFODZ3FXBSET
%Y'PMMFUPEFJOTDSJQDJØOB3BJO#JSE"HFODZ3FXBSETTPMPQBSB$BOBEÈ
Los contratistas pueden cambiar los puntos por los siguientes
artículos importantes:
%Y'PMMFUPEFMQSPHSBNBEFSFDPNQFOTBT3BJO#JSE"HFODZ3FXBSET
t4FSWJDJPTEFNBSLFUJOHZQVCMJDJEBE
Información sobre la inscripción al programa
t.FSDBEFSÓBRVFJODMVZFFMFDUSØOJDBJOEVNFOUBSJBZIFSSBNJFOUBT
Para inscribirse en Rain Bird Rewards o Rain Bird Agency Rewards, o para obtener más
información sobre el programa, visite www.rainbird.com/rewards o llame a la oficina del
programa de recompensas Rain Bird Rewards al +1 (888) 370-1814.
t5BSKFUBTEFSFHBMP
t$SÏEJUPQBSBFMEJTUSJCVJEPS
t$BQBDJUBDJØOFOSJFHP
t&GFDUJWP
Recursos
* Los miembros del programa acumulan puntos con la compra de productos de riego paisajístico calificados de Rain
Bird a través de distribuidores autorizados de Rain Bird. Los productos de riego paisajístico incluyen todos los productos
accesorios, comerciales, residenciales y de riego por goteo, pero no incluyen productos o piezas agrícolas, para golf, de control
centralizado o para el consumidor, o ningún otro producto que Rain Bird designe como no calificado. Rain Bird se reserva el
derecho de modificar o suspender los programas de recompensas Rain Bird Rewards o Rain Bird Agency Rewards según los
SFTQFDUJWPT"DVFSEPTEFMPTQSPHSBNBTEJTQPOJCMFTFOXXXSBJOCJSEDPNSFXBSET
El uso inteligente del agua.™
231
Recursos
1SPHSBNB'BDUPSZ5SBJOFEEF3BJO#JSE
Programa "Factory Trained" de Rain Bird
&MQSPHSBNB'BDUPSZ5SBJOFEFOUSFOBEPEFGÈCSJDB
EF3BJO#JSEFTUÈEJTF×BEP
para ofrecerle a los profesionales un profundo entrenamiento de alto nivel
sobre los productos de Rain Bird y sobre las mejores prácticas de operación e
JOTUBMBDJØO&MQSPHSBNB'BDUPSZ5SBJOFEEF3BJO#JSEMFPGSFDFUSBORVJMJEBE
al diseñador o al propietario del sistema de control centralizado a la hora de
elegir a un contratista, y el contratista recibe una designación y una marca que
puede utilizar para promover su experiencia y servicio con sus clientes.
El programa "Entrenado por la fábrica" de Rain Bird tiene designaciones en las
siguientes categorías:
Instalador entrenado de fábrica
Enfoque: Aprender los procedimientos de instalación y las mejores prácticas
para los productos y sistemas Rain Bird.
tInstalador de control centralizado: procedimientos de instalación de
hardware y mejores prácticas utilizando todos los productos de Rain Bird de
control centralizado para sitios de nivel comercial y golf.
Operador entrenado de fábrica
Enfoque: optimizar las funciones del software de control centralizado de
Rain Bird, tales como la gestión de caudal, la programación basada en la
evapotranspiración, las opciones de comunicación y muchas otras funciones.
Factory Trained
Existen designaciones para los operadores en las siguientes áreas:
t.BYJDPN2®
Your Name Here
t4JUF$POUSPM
t*2™W
t$POUSPMBEPSEFMBTFSJF&41-9
CENT
R A L CO NTROL IN S TA L L E R
Técnico entrenado de fábrica
Enfoque: aprender cómo mantener, solucionar problemas y reparar
discrepancias en el sistema de manera eficiente así como retirar y reemplazar
los componentes de hardware.
Existen designaciones para los técnicos en las siguientes áreas:
t.BYJDPN2®
Factory Trained
t4JUF$POUSPM
t4JUF4VSWFZ
CENT
t*2™ v 2.0
En 2013 habrá más designaciones disponibles para los sistemas de riego
residencial, de bombas y de golf.
R A L CO NTROL IN S TA L L E R
M A X IC OM TECHN IC IA N
M A XI CO M OPER AT O R
Recursos
Rain Bird International, Inc. -- Services
Division (División de servicios) es el
proveedor exclusivo del programa
"Entrenado por la fábrica" de Rain Bird y de
las designaciones para Rain Bird.
Para conocer los precios y registrarse en los cursos, visite nuestro sitio web.
232
El uso inteligente del agua.™
Introducción
Cuerpos de difusores
Referencia
Su recurso de información 24x7
Boquillas aspersoras
Cuerpos de
aspersores
El sitio web de Rain Bird centraliza toda la información más
reciente sobre los productos y las últimas noticias de Rain
Bird. Visítelo en cualquier momento del día o de la noche y
descargue justo lo que necesita para ser más eficaz al trabajar.
Conozca los productos más nuevos de Rain Bird, consulte
gráficos de rendimiento, descargue esquemas detallados en
$"%ZNVDIPNÈT
Impactos
Rotores
Visite www.rainbird.com hoy mismo y explore este
recurso con la tecnología más avanzada.
'BDFCPPL
www.facebook.com/RainBirdCorp
El uso inteligente del agua™
www.rainbird.com/IUOW
#JCMJPUFDBEF-&&%
XXXSBJOCJSEDPN-&&%
.BYJDPN%PMMBST
XXXSBJOCJSEDPNNBYJDPNEPMMBSTt$PSSFPFMFDUSØOJDPNBYJDPN!SBJOCJSE
com
'PUPHSBGÓBTZMPHPUJQPT
www.rainbird.com/library
Catálogo de productos
www.rainbird.com/catalog
%FNPTUSBDJPOFTEFQSPEVDUPTZHVÓBTJOUFSBDUJWBT
www.rainbird.com/landscape (Seleccione un producto de la lista en el menú de
la izquierda)
Especificaciones técnicas y literatura de productos
www.rainbird.com/landscape/support
Rain Bird Agency Rewards (agencias gubernamentales y
sin fines de lucro)
XXXSBJOCJSEDPNBHFODZt$PSSFPFMFDUSØOJDPSFXBSET!SBJOCJSEDPN
Servicios de ingeniería de Rain Bird
$PSSFPFMFDUSØOJDPSCTDFOH!SBJOCJSEDPN
Programas de recompensas Rewards
XXXSBJOCJSEDPNSFXBSETt$PSSFPFMFDUSØOJDPSFXBSET!SBJOCJSEDPN
Servicios y capacitación de Rain Bird
www.rainbirdservicescorporation.com
Museo virtual de Rain Bird
www.rainbird.com/museum
5XJUUFS
www.twitter.com/rainbirdcorp
Calculadoras de eficiencia del agua
www.rainbird.com/calculators
Cursos vía Internet
www.rainbird.com/webinars
:PV5VCF
www.youtube.com/rainbirdcorp
El uso inteligente del agua.™
Accesorios
ww2.rainbird.com/turfdistributor/newlogin.htm
Programadores
Sitio web del portal para distribuidores
Sistemas de control
centralizado
www.rainbird.com/landscape (Seleccione un producto de la lista en el menú de
la izquierda)
Xerigation®
Recursos de diseño y especificaciones
Bombas
http://bidsupport.rainbird.com
Drenaje
Soporte para cotizaciones
Recursos
Contactos/Información
Referencia
Programas y recursos de marketing
Válvulas
Lista de contactos y recursos en línea de Rain Bird
233
Referencia
Cómo usar este catálogo, pérdida de presión
a través de medidores de agua
Cómo usar este catálogo
Pérdida de presión a través de medidores de agua
Índices de precipitación
Rain Bird ha calculado por usted los índices de precipitación correspondientes
a nuestras completas líneas de impactos, aspersores y rotores. Esta
información muestra el índice aproximado en que se está aplicando el agua. A
continuación presentamos las ecuaciones utilizadas para calcular los índices de
precipitación:
Q
V
Patrón de distribución
cuadrado
EE.UU.:
Sistema métrico:
Patrón de distribución
triangular
EE.UU.:
Sistema métrico:
PR=96.3 x gpm
SxS
PR=96.3 x gpm
SxL
PR=1000 x m /h
SxS
3
PR=1000 x m /h
SxL
3
DPOTUBOUFQVMHBEBTQJFDVBESBEPIPSB
DPOTUBOUFNJMÓNFUSPNFUSPDVBESBEPIPSB
HQNHBMPOFTQPSNJOVUPBQMJDBEPTBMÈSFBDPOMPTBTQFSTPSFT
m3INFUSPTDÞCJDPTQPSIPSBDPSSFTQPOEJFOUFTBMÈSFBDPOMPTBTQFSTPSFT
4FTQBDJBNJFOUPFOUSFBTQFSTPSFT
-FTQBDJBNJFOUPFOUSFGJMBT4Y
Información de especificaciones
La información de este catálogo era exacta en el momento de su impresión y
puede utilizarse para ver las especificaciones correspondientes a cada producto.
Si desea obtener información más actualizada, visite el sitio web de Rain Bird en
www.rainbird.com.
Declaración de certificación de conformidad con la prueba ASABE
Rain Bird Corporation certifica que los datos de presión, índice de caudal y
radio de sus productos fueron determinados y aprobados de acuerdo con la
Norma ASABE S398.1, Procedimiento para prueba de aspersores e informe de
rendimiento, y que representan el rendimiento de los aspersores producidos a
la fecha de publicación. El rendimiento real de los productos puede diferir de las
especificaciones publicadas debido a las variaciones normales de fabricación y la
TFMFDDJØOEFNVFTUSBT5PEBTMBTEFNÈTFTQFDJGJDBDJPOFTDPOTUJUVZFOÞOJDBNFOUF
recomendaciones de Rain Bird Corporation.
Cuadros de referencia
La información de este catálogo está basada en fórmulas, cálculos y prácticas
del sector generalmente aceptadas. Rain Bird Corporation, y sus subsidiarias
y filiales, no serán por lo tanto responsables si se produjesen problemas,
dificultades o lesiones ocasionadas o relacionadas con el uso o la aplicación de
esta información, o si existiese algún error de tipografía u otra naturaleza en la
presente publicación.
Asistencia técnica
La asistencia técnica de Rain Bird tiene las respuestas a sus preguntas sobre
productos específicos y administración de agua. Llame a nuestros números
gratuitos de Servicio técnico o Especificaciones, o bien, para mayor comodidad,
visite el sitio web de Rain Bird. Obtendrá una opinión experta y las soluciones
adecuadas.
Servicio técnico
3"*/#*3%
(1-800-724-6247)
Referencia
234
Línea de
especificaciones
Dirección en
internet
1-800-458-3005
www.rainbird.com
Pérdida de presión: psi
5BNB×POPNJOBM
V
Caudal
gpm
5/8"
3/4"
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
22
24
26
28
30
32
34
36
38
40
42
44
46
48
50
52
54
56
58
60
65
70
75
80
90
100
110
120
130
140
150
160
170
180
190
200
220
240
260
280
300
350
400
450
500
0.2
0.3
0.4
0.6
0.9
1.3
1.8
2.3
3.0
3.7
4.4
5.1
6.1
7.2
8.3
9.4
10.7
12.0
13.4
15.0
0.1
0.2
0.3
0.5
0.6
0.7
0.8
1.0
1.3
1.6
1.9
2.2
2.6
3.1
3.6
4.1
4.6
5.2
5.8
6.5
7.9
9.5
11.2
13.0
15.0
1"
1 1/2"
2"
3"
4"
Cuadros de
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1.0
1.1
1.2
1.4
1.6
1.8
2.0
2.2
2.8
3.4
4.0
4.6
5.3
6.0
6.9
7.8
8.7
9.6
10.6
11.7
12.8
13.9
15.0
referencia
de pérdida
de presión
0.4
0.5
0.6
0.7
0.8
1.0
1.2
1.4
1.6
1.8
2.1
2.4
2.7
3.0
3.3
3.6
3.9
4.2
4.5
4.9
5.3
5.7
6.2
6.7
7.2
8.3
9.8
11.2
12.8
16.1
20.0
0.8
0.9
1.0
1.2
1.3
1.4
1.5
1.6
1.7
1.9
2.1
2.2
2.3
2.5
2.7
3.2
3.7
4.3
4.9
6.2
7.8
9.5
11.3
13.0
15.1
17.3
20.0
0.7
1.1
1.3
1.5
1.6
2.0
2.5
2.9
3.4
3.9
4.5
5.1
5.8
6.5
7.2
8.0
9.0
11.0
13.0
15.0
17.3
20.0
0.7
0.8
0.9
1.0
1.2
1.4
1.6
1.8
2.1
2.4
2.7
3.0
3.2
3.9
4.7
5.5
6.3
7.2
10.0
13.0
16.2
20.0
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
5VCPQMÈTUJDPJ14EF17$$MBTF
Tubo plástico IPS de PVC Clase 160
4%3$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
1"
1.315
1.195
0.06
Caudal
(gpm)
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
Velocidad
pps
0.29
0.57
0.86
1.14
1.43
1.72
2.00
2.29
2.57
2.86
3.15
3.43
4.00
4.58
5.15
5.72
6.29
6.87
7.44
8.01
8.58
10.01
11.44
12.87
14.30
15.73
17.16
18.59
20.02
1 1/4"
1.660
1.532
0.064
Pérdida
psi
0.02
0.06
0.14
0.23
0.35
0.49
0.66
0.84
1.04
1.27
1.51
1.78
2.36
3.02
3.76
4.57
5.45
6.40
7.43
8.52
9.68
12.87
16.48
20.49
24.90
29.70
34.89
40.45
46.40
Velocidad
pps
0.17
0.35
0.52
0.70
0.87
1.04
1.22
1.39
1.57
1.74
1.91
2.09
2.44
2.78
3.13
3.48
3.83
4.18
4.53
4.87
5.22
6.09
6.96
7.83
8.70
9.57
10.44
11.31
12.18
13.05
13.92
14.79
15.66
16.53
17.41
19.15
1 1/2"
1.900
1.754
0.073
Pérdida
psi
0.01
0.02
0.04
0.07
0.11
0.15
0.20
0.25
0.31
0.38
0.45
0.53
0.71
0.90
1.12
1.36
1.63
1.91
2.22
2.54
2.89
3.84
4.92
6.12
7.43
8.87
10.42
12.08
13.85
15.74
17.74
19.84
22.05
24.37
26.80
31.97
Velocidad
pps
0.13
0.27
0.40
0.53
0.66
0.80
0.93
1.06
1.20
1.33
1.46
1.59
1.86
2.12
2.39
2.66
2.92
3.19
3.45
3.72
3.98
4.65
5.31
5.98
6.64
7.30
7.97
8.63
9.29
9.96
10.62
11.29
11.95
12.61
13.28
14.61
15.93
17.26
18.59
19.92
V
2"
2.375
2.193
0.091
Pérdida
psi
0.00
0.01
0.02
0.04
0.05
0.08
0.10
0.13
0.16
0.20
0.23
0.27
0.37
0.47
0.58
0.71
0.84
0.99
1.15
1.32
1.50
1.99
2.55
3.17
3.85
4.59
5.39
6.25
7.17
8.15
9.18
10.27
11.42
12.62
13.87
16.55
19.44
22.54
25.85
29.37
2 1/2"
2.875
2.655
0.110
Velocidad
pps
0.08
0.17
0.25
0.34
0.42
0.51
0.59
0.68
0.76
0.85
0.93
1.02
1.19
1.36
1.53
1.70
1.87
2.04
2.21
2.38
2.55
2.97
3.40
3.82
4.25
4.67
5.10
5.52
5.95
6.37
6.80
7.22
7.64
8.07
8.49
9.34
10.19
11.04
11.89
12.74
13.59
14.44
15.29
16.14
16.99
19.11
Pérdida
psi
0.00
0.00
0.01
0.01
0.02
0.03
0.03
0.04
0.05
0.07
0.08
0.09
0.12
0.16
0.20
0.24
0.28
0.33
0.39
0.44
0.50
0.67
0.86
1.07
1.30
1.55
1.82
2.11
2.42
2.75
3.10
3.46
3.85
4.26
4.68
5.58
6.56
7.60
8.72
9.91
11.16
12.49
13.88
15.34
16.87
20.98
Velocidad
pps
0.06
0.12
0.17
0.23
0.29
0.35
0.41
0.46
0.52
0.58
0.64
0.70
0.81
0.93
1.04
1.16
1.27
1.39
1.51
1.62
1.74
2.03
2.32
2.61
2.90
3.19
3.48
3.77
4.06
4.35
4.64
4.93
5.22
5.51
5.80
6.37
6.95
7.53
8.11
8.69
9.27
9.85
10.43
11.01
11.59
13.04
14.49
15.94
17.39
18.83
3"
3.500
3.230
0.135
Pérdida
psi
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.06
0.08
0.09
0.11
0.13
0.15
0.18
0.20
0.26
0.34
0.42
0.51
0.61
0.72
0.83
0.95
1.08
1.22
1.37
1.52
1.68
1.85
2.20
2.59
3.00
3.44
3.91
4.40
4.93
5.48
6.05
6.65
8.27
10.06
11.99
14.09
16.34
Velocidad
pps
0.04
0.08
0.12
0.16
0.20
0.23
0.27
0.31
0.35
0.39
0.43
0.47
0.55
0.63
0.70
0.78
0.86
0.94
1.02
1.10
1.17
1.37
1.57
1.76
1.96
2.15
2.35
2.55
2.74
2.94
3.13
3.33
3.52
3.72
3.92
4.31
4.70
5.09
5.48
5.87
6.26
6.66
7.05
7.44
7.83
8.81
9.79
10.77
11.75
12.73
13.70
14.68
15.66
16.64
17.62
18.60
19.58
4"
4.500
4.154
0.173
Pérdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.04
0.04
0.05
0.06
0.07
0.08
0.10
0.13
0.16
0.20
0.24
0.28
0.32
0.37
0.42
0.47
0.53
0.59
0.65
0.71
0.85
1.00
1.16
1.33
1.51
1.70
1.90
2.11
2.33
2.56
3.19
3.87
4.62
5.43
6.29
7.22
8.20
9.24
10.34
11.49
12.70
13.97
Velocidad
pps
0.02
0.05
0.07
0.09
0.12
0.14
0.17
0.19
0.21
0.24
0.26
0.28
0.33
0.38
0.43
0.47
0.52
0.57
0.62
0.66
0.71
0.83
0.95
1.07
1.18
1.30
1.42
1.54
1.66
1.78
1.89
2.01
2.13
2.25
2.37
2.60
2.84
3.08
3.31
3.55
3.79
4.02
4.26
4.50
4.73
5.33
5.92
6.51
7.10
7.69
8.29
8.88
9.47
10.06
10.65
11.24
11.84
13.02
14.20
6"
6.625
6.115
0.225
Pérdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.09
0.11
0.12
0.14
0.15
0.17
0.19
0.21
0.25
0.29
0.34
0.39
0.44
0.50
0.56
0.62
0.69
0.75
0.94
1.14
1.36
1.60
1.85
2.12
2.41
2.72
3.04
3.38
3.73
4.11
4.90
5.75
Velocidad
pps
0.01
0.02
0.03
0.04
0.05
0.07
0.08
0.09
0.10
0.11
0.12
0.13
0.15
0.17
0.20
0.22
0.24
0.26
0.28
0.31
0.33
0.38
0.44
0.49
0.55
0.60
0.66
0.71
0.76
0.82
0.87
0.93
0.98
1.04
1.09
1.20
1.31
1.42
1.53
1.64
1.75
1.86
1.97
2.08
2.18
2.46
2.73
3.00
3.28
3.55
3.82
4.10
4.37
4.64
4.92
5.19
5.46
6.01
6.55
Pérdida
psi
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.08
0.09
0.09
0.10
0.11
0.14
0.17
0.21
0.24
0.28
0.32
0.37
0.41
0.46
0.51
0.57
0.63
0.75
0.88
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
( )
]
Referencia
[
El uso inteligente del agua.™
235
Referencia
5VCPQMÈTUJDPJ14EF17$$MBTF
Tubo plástico IPS de PVC Clase 200
4%3$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
3/4"
1.050
0.930
0.060
Velocidad Pérdida
pps
psi
1"
1.315
1.189
0.063
Velocidad Pérdida
pps
psi
1 1/4"
1.660
1.502
0.079
Velocidad Pérdida
pps
psi
1 1/2"
1.900
1.720
0.090
Velocidad Pérdida
pps
psi
2"
2.375
2.149
0.113
Velocidad Pérdida
pps
psi
2 1/2"
2.875
2.601
0.137
Velocidad Pérdida
pps
psi
3"
3.500
3.166
0.167
Velocidad Pérdida
pps
psi
4"
4.500
4.072
0.214
Velocidad Pérdida
pps
psi
6"
6.625
5.993
0.316
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
0.47
0.94
1.42
1.89
2.36
2.83
3.31
3.78
4.25
4.72
5.20
5.67
6.61
7.56
8.50
9.45
10.39
11.34
12.28
13.22
14.17
16.53
18.89
0.29
0.58
0.87
1.16
1.44
1.73
2.02
2.31
2.60
2.89
3.18
3.47
4.05
4.62
5.20
5.78
6.36
6.93
7.51
8.09
8.67
10.11
11.56
13.00
14.45
15.89
17.34
18.78
0.18
0.36
0.54
0.72
0.91
1.09
1.27
1.45
1.63
1.81
1.99
2.17
2.54
2.90
3.26
3.62
3.98
4.35
4.71
5.07
5.43
6.34
7.24
8.15
9.05
9.96
10.86
11.77
12.68
13.58
14.49
15.39
16.30
17.20
18.11
19.92
0.14
0.28
0.41
0.55
0.69
0.83
0.97
1.10
1.24
1.38
1.52
1.66
1.93
2.21
2.49
2.76
3.04
3.31
3.59
3.87
4.14
4.83
5.52
6.21
6.90
7.59
8.28
8.98
9.67
10.36
11.05
11.74
12.43
13.12
13.81
15.19
16.57
17.95
19.33
0.09
0.18
0.27
0.35
0.44
0.53
0.62
0.71
0.80
0.88
0.97
1.06
1.24
1.42
1.59
1.77
1.95
2.12
2.30
2.48
2.65
3.10
3.54
3.98
4.42
4.86
5.31
5.75
6.19
6.63
7.08
7.52
7.96
8.40
8.85
9.73
10.61
11.50
12.38
13.27
14.15
15.04
15.92
16.81
17.69
19.90
0.06
0.12
0.18
0.24
0.30
0.36
0.42
0.48
0.54
0.60
0.66
0.72
0.85
0.97
1.09
1.21
1.33
1.45
1.57
1.69
1.81
2.11
2.42
2.72
3.02
3.32
3.62
3.92
4.23
4.53
4.83
5.13
5.43
5.74
6.04
6.64
7.25
7.85
8.45
9.06
9.66
10.27
10.87
11.47
12.08
13.59
15.10
16.61
18.11
19.62
0.04
0.08
0.12
0.16
0.20
0.24
0.29
0.33
0.37
0.41
0.45
0.49
0.57
0.65
0.73
0.82
0.90
0.98
1.06
1.14
1.22
1.43
1.63
1.83
2.04
2.24
2.45
2.65
2.85
3.06
3.26
3.46
3.67
3.87
4.08
4.48
4.89
5.30
5.71
6.11
6.52
6.93
7.34
7.74
8.15
9.17
10.19
11.21
12.23
13.25
14.26
15.28
16.30
17.32
18.34
19.36
0.02
0.05
0.07
0.10
0.12
0.15
0.17
0.20
0.22
0.25
0.27
0.30
0.34
0.39
0.44
0.49
0.54
0.59
0.64
0.69
0.74
0.86
0.99
1.11
1.23
1.35
1.48
1.60
1.72
1.85
1.97
2.09
2.22
2.34
2.46
2.71
2.96
3.20
3.45
3.70
3.94
4.19
4.43
4.68
4.93
5.54
6.16
6.77
7.39
8.01
8.62
9.24
9.85
10.47
11.09
11.70
12.32
13.55
14.78
0.01
0.02
0.03
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.13
0.14
0.16
0.18
0.20
0.23
0.25
0.27
0.30
0.32
0.34
0.40
0.45
0.51
0.57
0.63
0.68
0.74
0.80
0.85
0.91
0.97
1.02
1.08
1.14
1.25
1.36
1.48
1.59
1.71
1.82
1.93
2.05
2.16
2.27
2.56
2.84
3.13
3.41
3.70
3.98
4.27
4.55
4.83
5.12
5.40
5.69
6.26
6.82
0.06
0.22
0.46
0.79
1.19
1.67
2.22
2.84
3.53
4.29
5.12
6.02
8.00
10.24
12.74
15.48
18.46
21.69
25.15
28.85
32.77
43.59
55.80
0.02
0.07
0.14
0.24
0.36
0.50
0.67
0.86
1.07
1.30
1.55
1.82
2.42
3.10
3.85
4.68
5.59
6.56
7.61
8.73
9.92
13.19
16.89
21.00
25.51
30.43
35.75
41.46
0.01
0.02
0.04
0.08
0.12
0.16
0.22
0.28
0.34
0.42
0.50
0.58
0.78
0.99
1.24
1.50
1.79
2.11
2.44
2.80
3.18
4.23
5.42
6.74
8.18
9.76
11.47
13.30
15.25
17.33
19.53
21.84
24.28
26.83
29.51
35.20
0.00
0.01
0.02
0.04
0.06
0.08
0.11
0.14
0.18
0.22
0.26
0.30
0.40
0.51
0.64
0.78
0.93
1.09
1.26
1.45
1.65
2.19
2.80
3.48
4.23
5.05
5.93
6.88
7.89
8.96
10.10
11.30
12.56
13.88
15.26
18.20
21.38
24.79
28.44
0.00
0.00
0.01
0.01
0.02
0.03
0.04
0.05
0.06
0.07
0.09
0.10
0.14
0.17
0.22
0.26
0.31
0.37
0.43
0.49
0.56
0.74
0.95
1.18
1.43
1.71
2.01
2.33
2.67
3.03
3.42
3.82
4.25
4.70
5.16
6.16
7.24
8.39
9.62
10.93
12.32
13.78
15.32
16.93
18.62
23.15
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.07
0.09
0.10
0.12
0.15
0.17
0.19
0.22
0.29
0.37
0.47
0.57
0.67
0.79
0.92
1.05
1.20
1.35
1.51
1.68
1.86
2.04
2.43
2.86
3.31
3.80
4.32
4.87
5.44
6.05
6.69
7.35
9.14
11.11
13.26
15.57
18.06
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.06
0.06
0.07
0.08
0.11
0.14
0.18
0.22
0.26
0.30
0.35
0.41
0.46
0.52
0.58
0.65
0.71
0.78
0.94
1.10
1.27
1.46
1.66
1.87
2.09
2.33
2.57
2.83
3.51
4.27
5.09
5.98
6.94
7.96
9.04
10.19
11.40
12.67
14.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.08
0.09
0.10
0.12
0.14
0.15
0.17
0.19
0.21
0.23
0.27
0.32
0.37
0.43
0.49
0.55
0.61
0.68
0.76
0.83
1.03
1.26
1.50
1.76
2.04
2.34
2.66
2.99
3.35
3.72
4.11
4.52
5.40
6.34
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.07
0.08
0.09
0.10
0.12
0.13
0.16
0.19
0.23
0.27
0.31
0.36
0.41
0.46
0.51
0.57
0.63
0.69
0.82
0.97
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
[
( )
]
Referencia
236
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
5VCPQMÈTUJDPJ14EF17$$MBTF
Tubo plástico IPS de PVC Clase 315
4%3$
Tubo plástico IPS de PVC Clase 315
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
1/2"
0.840
0.716
0.062
Velocidad Pérdida
pps
psi
3/4"
1"
1.050
1.315
0.894
1.121
0.078
0.097
Velocidad Pérdida Velocidad Pérdida
pps
psi
pps
psi
1 1/4"
1.660
1.414
0.123
Velocidad Pérdida
pps
psi
1 1/2"
1.900
1.618
0.141
Velocidad Pérdida
pps
psi
2"
2.375
2.023
0.176
Velocidad Pérdida
pps
psi
2 1/2"
2.875
2.449
0.213
Velocidad Pérdida
pps
psi
3"
3.500
2.982
0.259
Velocidad Pérdida
pps
psi
4"
4.500
3.834
0.333
Velocidad Pérdida
pps
psi
6"
6.625
5.643
0.491
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
0.80
1.59
2.39
3.19
3.98
4.78
5.58
6.37
7.17
7.97
8.77
9.56
11.16
12.75
14.34
15.94
17.53
19.12
0.51
1.02
1.53
2.04
2.56
3.07
3.58
4.09
4.60
5.11
5.62
6.13
7.16
8.18
9.20
10.22
11.24
12.27
13.29
14.31
15.33
17.89
0.20
0.41
0.61
0.82
1.02
1.23
1.43
1.63
1.84
2.04
2.25
2.45
2.86
3.27
3.68
4.09
4.49
4.90
5.31
5.72
6.13
7.15
8.17
9.19
10.22
11.24
12.26
13.28
14.30
15.32
16.34
17.37
18.39
19.41
0.16
0.31
0.47
0.62
0.78
0.94
1.09
1.25
1.40
1.56
1.72
1.87
2.18
2.50
2.81
3.12
3.43
3.74
4.06
4.37
4.68
5.46
6.24
7.02
7.80
8.58
9.36
10.14
10.92
11.70
12.48
13.26
14.04
14.82
15.60
17.16
18.72
0.10
0.20
0.30
0.40
0.50
0.60
0.70
0.80
0.90
1.00
1.10
1.20
1.40
1.60
1.80
2.00
2.20
2.40
2.60
2.79
2.99
3.49
3.99
4.49
4.99
5.49
5.99
6.49
6.99
7.49
7.99
8.48
8.98
9.48
9.98
10.98
11.98
12.98
13.97
14.97
15.97
16.97
17.97
18.97
19.96
0.07
0.14
0.20
0.27
0.34
0.41
0.48
0.54
0.61
0.68
0.75
0.82
0.95
1.09
1.23
1.36
1.50
1.63
1.77
1.91
2.04
2.38
2.72
3.06
3.41
3.75
4.09
4.43
4.77
5.11
5.45
5.79
6.13
6.47
6.81
7.49
8.17
8.85
9.54
10.22
10.90
11.58
12.26
12.94
13.62
15.32
17.03
18.73
0.05
0.09
0.14
0.18
0.23
0.28
0.32
0.37
0.41
0.46
0.51
0.55
0.64
0.74
0.83
0.92
1.01
1.10
1.19
1.29
1.38
1.61
1.84
2.07
2.30
2.53
2.76
2.99
3.22
3.45
3.68
3.90
4.13
4.36
4.59
5.05
5.51
5.97
6.43
6.89
7.35
7.81
8.27
8.73
9.19
10.34
11.48
12.63
13.78
14.93
16.08
17.23
18.38
19.52
0.03
0.06
0.08
0.11
0.14
0.17
0.19
0.22
0.25
0.28
0.31
0.33
0.39
0.44
0.50
0.56
0.61
0.67
0.72
0.78
0.83
0.97
1.11
1.25
1.39
1.53
1.67
1.81
1.95
2.08
2.22
2.36
2.50
2.64
2.78
3.06
3.33
3.61
3.89
4.17
4.45
4.72
5.00
5.28
5.56
6.25
6.95
7.64
8.34
9.03
9.73
10.42
11.12
11.81
12.51
13.20
13.89
15.28
16.67
0.01
0.03
0.04
0.05
0.06
0.08
0.09
0.10
0.12
0.13
0.14
0.15
0.18
0.21
0.23
0.26
0.28
0.31
0.33
0.36
0.38
0.45
0.51
0.58
0.64
0.71
0.77
0.83
0.90
0.96
1.03
1.09
1.15
1.22
1.28
1.41
1.54
1.67
1.80
1.92
2.05
2.18
2.31
2.44
2.57
2.89
3.21
3.53
3.85
4.17
4.49
4.81
5.13
5.45
5.77
6.09
6.41
7.06
7.70
0.22
0.78
1.65
2.81
4.25
5.96
7.92
10.14
12.61
15.33
18.28
21.47
28.56
36.56
45.46
55.25
65.90
77.41
0.07
0.26
0.56
0.96
1.44
2.02
2.69
3.44
4.28
5.20
6.21
7.29
9.70
12.41
15.44
18.76
22.37
26.28
30.48
34.95
39.71
52.82
0.33
0.65
0.98
1.30
1.63
1.95
2.28
2.60
2.93
3.25
3.58
3.90
4.55
5.20
5.85
6.50
7.15
7.80
8.45
9.10
9.75
11.38
13.00
14.63
16.25
17.88
19.50
0.02
0.09
0.19
0.32
0.48
0.67
0.89
1.15
1.42
1.73
2.06
2.42
3.22
4.13
5.13
6.24
7.44
8.74
10.14
11.62
13.21
17.57
22.49
27.96
33.98
40.53
47.61
0.01
0.03
0.06
0.10
0.16
0.22
0.29
0.37
0.46
0.56
0.67
0.78
1.04
1.33
1.66
2.02
2.40
2.82
3.27
3.76
4.27
5.68
7.27
9.03
10.98
13.10
15.38
17.84
20.46
23.25
26.19
29.30
32.57
36.00
0.00
0.01
0.03
0.05
0.08
0.11
0.15
0.19
0.24
0.29
0.35
0.41
0.54
0.69
0.86
1.05
1.25
1.47
1.70
1.95
2.22
2.95
3.77
4.69
5.70
6.80
7.99
9.26
10.62
12.07
13.60
15.21
16.91
18.69
20.55
24.51
28.79
0.00
0.00
0.01
0.02
0.03
0.04
0.05
0.06
0.08
0.10
0.12
0.14
0.18
0.23
0.29
0.35
0.42
0.49
0.57
0.66
0.75
0.99
1.27
1.58
1.92
2.29
2.69
3.12
3.58
4.07
4.59
5.13
5.70
6.30
6.93
8.27
9.71
11.26
12.91
14.67
16.53
18.49
20.56
22.72
24.98
0.00
0.00
0.00
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.05
0.07
0.09
0.11
0.14
0.17
0.20
0.23
0.26
0.29
0.39
0.50
0.62
0.76
0.90
1.06
1.23
1.41
1.61
1.81
2.02
2.25
2.49
2.73
3.26
3.83
4.44
5.10
5.79
6.52
7.30
8.11
8.97
9.86
12.26
14.90
17.77
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.04
0.04
0.05
0.06
0.07
0.09
0.10
0.11
0.15
0.19
0.24
0.29
0.35
0.41
0.47
0.54
0.62
0.69
0.78
0.86
0.95
1.05
1.25
1.47
1.70
1.95
2.22
2.50
2.80
3.11
3.44
3.78
4.70
5.71
6.82
8.01
9.28
10.65
12.10
13.63
15.25
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.06
0.07
0.09
0.10
0.12
0.14
0.16
0.18
0.20
0.23
0.25
0.28
0.31
0.37
0.43
0.50
0.58
0.65
0.74
0.82
0.92
1.01
1.11
1.38
1.68
2.01
2.36
2.73
3.14
3.56
4.01
4.49
4.99
5.52
6.07
7.23
8.50
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.13
0.14
0.15
0.17
0.21
0.26
0.31
0.36
0.42
0.48
0.54
0.61
0.68
0.76
0.84
0.92
1.10
1.30
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
( )
]
Referencia
[
El uso inteligente del agua.™
237
Referencia
5VCPQMÈTUJDP*14EF17$4DIFEVMF
Tubo plástico IPS de PVC Schedule 40
$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
1/2"
0.840
0.622
0.109
Velocidad Pérdida
pps
psi
3/4"
1"
1.050
1.315
0.824
1.049
0.113
0.133
Velocidad Pérdida Velocidad Pérdida
pps
psi
pps
psi
1 1/4"
1.660
1.380
0.140
Velocidad Pérdida
pps
psi
1 1/2"
1.900
1.610
0.145
Velocidad Pérdida
pps
psi
2"
2.375
2.067
0.154
Velocidad Pérdida
pps
psi
2 1/2"
2.875
2.469
0.203
Velocidad Pérdida
pps
psi
3"
3.500
3.068
0.216
Velocidad Pérdida
pps
psi
4"
4.500
4.026
0.237
Velocidad Pérdida
pps
psi
6"
6.625
6.065
0.280
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
1.06
2.11
3.17
4.22
5.28
6.34
7.39
8.45
9.50
10.56
11.61
12.67
14.78
16.89
19.01
21.12
0.60
1.20
1.80
2.41
3.01
3.61
4.21
4.81
5.41
6.02
6.62
7.22
8.42
9.63
10.83
12.03
13.24
14.44
15.64
16.85
18.05
0.21
0.43
0.64
0.86
1.07
1.29
1.50
1.72
1.93
2.15
2.36
2.57
3.00
3.43
3.86
4.29
4.72
5.15
5.58
6.01
6.44
7.51
8.58
9.65
10.73
11.80
12.87
13.94
15.02
16.09
17.16
18.23
19.31
0.16
0.32
0.48
0.64
0.80
0.96
1.12
1.28
1.44
1.60
1.76
1.91
2.23
2.55
2.87
3.19
3.51
3.83
4.15
4.47
4.79
5.58
6.38
7.18
7.98
8.78
9.57
10.37
11.17
11.97
12.77
13.56
14.36
15.16
15.96
17.55
19.15
0.10
0.19
0.29
0.38
0.48
0.57
0.67
0.76
0.86
0.96
1.05
1.15
1.34
1.53
1.72
1.91
2.10
2.29
2.49
2.68
2.87
3.35
3.82
4.30
4.78
5.26
5.74
6.21
6.69
7.17
7.65
8.13
8.61
9.08
9.56
10.52
11.47
12.43
13.39
14.34
15.30
16.25
17.21
18.17
19.12
0.07
0.13
0.20
0.26
0.33
0.40
0.46
0.53
0.59
0.66
0.73
0.79
0.92
1.06
1.19
1.32
1.45
1.58
1.71
1.85
1.98
2.31
2.64
2.97
3.30
3.63
3.96
4.29
4.62
4.95
5.28
5.60
5.93
6.26
6.59
7.25
7.91
8.57
9.23
9.89
10.55
11.21
11.87
12.53
13.19
14.84
16.48
18.13
0.04
0.09
0.13
0.17
0.22
0.26
0.30
0.35
0.39
0.43
0.48
0.52
0.61
0.69
0.78
0.87
0.95
1.04
1.13
1.22
1.30
1.52
1.74
1.95
2.17
2.39
2.60
2.82
3.04
3.25
3.47
3.69
3.91
4.12
4.34
4.77
5.21
5.64
6.08
6.51
6.94
7.38
7.81
8.25
8.68
9.76
10.85
11.93
13.02
14.10
15.19
16.27
17.36
18.44
19.53
0.03
0.05
0.08
0.10
0.13
0.15
0.18
0.20
0.23
0.25
0.28
0.30
0.35
0.40
0.45
0.50
0.55
0.60
0.66
0.71
0.76
0.88
1.01
1.13
1.26
1.39
1.51
1.64
1.76
1.89
2.02
2.14
2.27
2.39
2.52
2.77
3.02
3.28
3.53
3.78
4.03
4.28
4.54
4.79
5.04
5.67
6.30
6.93
7.56
8.19
8.82
9.45
10.08
10.71
11.34
11.97
12.60
13.86
15.12
0.01
0.02
0.03
0.04
0.06
0.07
0.08
0.09
0.10
0.11
0.12
0.13
0.16
0.18
0.20
0.22
0.24
0.27
0.29
0.31
0.33
0.39
0.44
0.50
0.56
0.61
0.67
0.72
0.78
0.83
0.89
0.94
1.00
1.06
1.11
1.22
1.33
1.44
1.55
1.67
1.78
1.89
2.00
2.11
2.22
2.50
2.78
3.05
3.33
3.61
3.89
4.16
4.44
4.72
5.00
5.28
5.55
6.11
6.66
0.43
1.55
3.28
5.58
8.43
11.81
15.71
20.12
25.01
30.40
36.26
42.59
56.64
72.52
90.17
109.58
0.11
0.39
0.83
1.42
2.15
3.01
4.00
5.12
6.37
7.74
9.23
10.84
14.42
18.46
22.95
27.89
33.27
39.08
45.32
51.98
59.05
0.37
0.74
1.11
1.48
1.86
2.23
2.60
2.97
3.34
3.71
4.08
4.45
5.20
5.94
6.68
7.42
8.17
8.91
9.65
10.39
11.14
12.99
14.85
16.71
18.56
0.03
0.12
0.26
0.44
0.66
0.93
1.24
1.58
1.97
2.39
2.85
3.35
4.45
5.70
7.09
8.62
10.28
12.07
14.00
16.06
18.24
24.26
31.06
38.62
46.94
0.01
0.03
0.07
0.12
0.17
0.24
0.33
0.42
0.52
0.63
0.75
0.88
1.17
1.50
1.87
2.27
2.71
3.18
3.69
4.23
4.80
6.39
8.18
10.17
12.36
14.74
17.32
20.08
23.03
26.17
29.49
32.99
36.67
0.00
0.02
0.03
0.06
0.09
0.12
0.16
0.20
0.25
0.31
0.37
0.43
0.57
0.73
0.91
1.10
1.32
1.55
1.79
2.06
2.34
3.11
3.98
4.95
6.02
7.18
8.43
9.78
11.21
12.74
14.36
16.06
17.85
19.73
21.69
25.88
30.40
0.00
0.00
0.01
0.02
0.02
0.03
0.05
0.06
0.07
0.09
0.11
0.12
0.16
0.21
0.26
0.32
0.38
0.45
0.52
0.59
0.67
0.89
1.15
1.42
1.73
2.06
2.43
2.81
3.23
3.66
4.13
4.62
5.14
5.68
6.24
7.44
8.74
10.14
11.63
13.21
14.89
16.65
18.51
20.46
22.50
0.00
0.00
0.00
0.01
0.01
0.01
0.02
0.02
0.03
0.04
0.04
0.05
0.07
0.09
0.11
0.13
0.15
0.18
0.21
0.24
0.27
0.36
0.46
0.58
0.70
0.84
0.98
1.14
1.31
1.48
1.67
1.87
2.08
2.30
2.53
3.01
3.54
4.11
4.71
5.35
6.03
6.74
7.50
8.29
9.11
11.33
13.77
16.42
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.09
0.10
0.13
0.17
0.21
0.25
0.30
0.36
0.41
0.47
0.54
0.60
0.68
0.75
0.83
0.91
1.09
1.28
1.48
1.70
1.93
2.18
2.44
2.71
2.99
3.29
4.09
4.98
5.94
6.97
8.09
9.27
10.54
11.87
13.28
14.76
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.04
0.06
0.07
0.08
0.09
0.11
0.13
0.14
0.16
0.18
0.20
0.22
0.24
0.29
0.34
0.40
0.45
0.52
0.58
0.65
0.72
0.80
0.88
1.09
1.33
1.58
1.86
2.16
2.47
2.81
3.16
3.54
3.93
4.35
4.78
5.70
6.70
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.05
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.12
0.15
0.18
0.22
0.25
0.29
0.34
0.38
0.43
0.48
0.54
0.59
0.65
0.78
0.91
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
[
( )
]
Referencia
238
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
5VCPQMÈTUJDP*14EF17$4DIFEVMF
Tubo plástico IPS de PVC Schedule 80
$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
1/2"
0.840
0.546
0.147
Velocidad Pérdida
pps
psi
3/4"
1"
1.050
1.315
0.742
0.957
0.154
0.179
Velocidad Pérdida Velocidad Pérdida
pps
psi
pps
psi
1 1/4"
1.660
1.278
0.191
Velocidad Pérdida
pps
psi
1 1/2"
1.900
1.500
0.200
Velocidad Pérdida
pps
psi
2"
2.375
1.939
0.218
Velocidad Pérdida
pps
psi
2 1/2"
2.875
2.323
0.276
Velocidad Pérdida
pps
psi
3"
3.500
2.900
0.300
Velocidad Pérdida
pps
psi
4"
4.500
3.826
0.337
Velocidad Pérdida
pps
psi
6"
6.625
5.761
0.432
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
1.37
2.74
4.11
5.48
6.85
8.22
9.59
10.96
12.33
13.70
15.07
16.44
0.74
1.48
2.23
2.97
3.71
4.45
5.19
5.94
6.68
7.42
8.16
8.90
10.39
11.87
13.36
14.84
16.32
17.81
19.29
0.25
0.50
0.75
1.00
1.25
1.50
1.75
2.00
2.25
2.50
2.75
3.00
3.50
4.00
4.50
5.00
5.50
6.00
6.50
7.00
7.50
8.75
10.00
11.25
12.51
13.76
15.01
16.26
17.51
18.76
20.01
0.18
0.36
0.54
0.73
0.91
1.09
1.27
1.45
1.63
1.82
2.00
2.18
2.54
2.90
3.27
3.63
3.99
4.36
4.72
5.08
5.45
6.35
7.26
8.17
9.08
9.99
10.89
11.80
12.71
13.62
14.52
15.43
16.34
17.25
18.16
19.97
0.11
0.22
0.33
0.43
0.54
0.65
0.76
0.87
0.98
1.09
1.20
1.30
1.52
1.74
1.96
2.17
2.39
2.61
2.82
3.04
3.26
3.80
4.35
4.89
5.43
5.98
6.52
7.06
7.61
8.15
8.69
9.24
9.78
10.32
10.87
11.95
13.04
14.12
15.21
16.30
17.38
18.47
19.56
0.08
0.15
0.23
0.30
0.38
0.45
0.53
0.61
0.68
0.76
0.83
0.91
1.06
1.21
1.36
1.51
1.67
1.82
1.97
2.12
2.27
2.65
3.03
3.41
3.78
4.16
4.54
4.92
5.30
5.68
6.06
6.43
6.81
7.19
7.57
8.33
9.08
9.84
10.60
11.35
12.11
12.87
13.63
14.38
15.14
17.03
18.92
20.82
0.05
0.10
0.15
0.19
0.24
0.29
0.34
0.39
0.44
0.49
0.53
0.58
0.68
0.78
0.87
0.97
1.07
1.17
1.26
1.36
1.46
1.70
1.94
2.19
2.43
2.67
2.91
3.16
3.40
3.64
3.89
4.13
4.37
4.61
4.86
5.34
5.83
6.31
6.80
7.29
7.77
8.26
8.74
9.23
9.71
10.93
12.14
13.36
14.57
15.79
17.00
18.21
19.43
0.03
0.06
0.08
0.11
0.14
0.17
0.20
0.22
0.25
0.28
0.31
0.33
0.39
0.45
0.50
0.56
0.61
0.67
0.73
0.78
0.84
0.98
1.12
1.26
1.40
1.53
1.67
1.81
1.95
2.09
2.23
2.37
2.51
2.65
2.79
3.07
3.35
3.63
3.91
4.19
4.47
4.74
5.02
5.30
5.58
6.28
6.98
7.67
8.37
9.07
9.77
10.46
11.16
11.86
12.56
13.26
13.95
15.35
16.74
0.01
0.02
0.04
0.05
0.06
0.07
0.09
0.10
0.11
0.12
0.14
0.15
0.17
0.20
0.22
0.25
0.27
0.30
0.32
0.34
0.37
0.43
0.49
0.55
0.62
0.68
0.74
0.80
0.86
0.92
0.98
1.05
1.11
1.17
1.23
1.35
1.48
1.60
1.72
1.85
1.97
2.09
2.22
2.34
2.46
2.77
3.08
3.38
3.69
4.00
4.31
4.62
4.92
5.23
5.54
5.85
6.15
6.77
7.38
0.81
2.92
6.18
10.52
15.90
22.27
29.62
37.92
47.16
57.30
68.35
80.29
0.18
0.66
1.39
2.37
3.57
5.01
6.66
8.53
10.60
12.88
15.37
18.05
24.01
30.74
38.22
46.45
55.40
65.08
75.47
0.45
0.89
1.34
1.78
2.23
2.68
3.12
3.57
4.01
4.46
4.91
5.35
6.24
7.14
8.03
8.92
9.81
10.70
11.60
12.49
13.38
15.61
17.84
0.05
0.19
0.40
0.69
1.04
1.45
1.93
2.47
3.07
3.74
4.46
5.23
6.96
8.91
11.08
13.47
16.06
18.87
21.88
25.10
28.51
37.92
48.55
0.01
0.05
0.10
0.17
0.25
0.36
0.47
0.61
0.75
0.91
1.09
1.28
1.70
2.18
2.71
3.30
3.93
4.62
5.36
6.14
6.98
9.28
11.88
14.78
17.96
21.42
25.16
29.18
33.47
38.02
42.84
0.01
0.02
0.05
0.08
0.12
0.16
0.22
0.28
0.35
0.42
0.50
0.59
0.78
1.00
1.24
1.51
1.80
2.12
2.46
2.82
3.20
4.26
5.45
6.78
8.24
9.83
11.54
13.38
15.35
17.44
19.65
21.99
24.44
27.01
29.70
35.42
0.00
0.01
0.01
0.02
0.03
0.05
0.06
0.08
0.10
0.12
0.14
0.17
0.22
0.29
0.36
0.43
0.52
0.61
0.70
0.81
0.92
1.22
1.56
1.94
2.36
2.82
3.31
3.84
4.40
5.00
5.64
6.31
7.01
7.75
8.52
10.16
11.93
13.84
15.87
18.03
20.32
22.73
25.27
0.00
0.00
0.01
0.01
0.01
0.02
0.03
0.03
0.04
0.05
0.06
0.07
0.09
0.12
0.15
0.18
0.21
0.25
0.29
0.34
0.38
0.51
0.65
0.81
0.98
1.17
1.37
1.59
1.83
2.08
2.34
2.62
2.91
3.22
3.54
4.22
4.95
5.74
6.59
7.49
8.44
9.44
10.49
11.59
12.75
15.85
19.26
22.97
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.09
0.10
0.11
0.13
0.17
0.22
0.27
0.33
0.40
0.47
0.54
0.62
0.71
0.80
0.89
0.99
1.09
1.20
1.43
1.68
1.95
2.24
2.54
2.87
3.21
3.56
3.94
4.33
5.39
6.54
7.81
9.17
10.63
12.20
13.86
15.61
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.06
0.07
0.09
0.10
0.12
0.14
0.16
0.18
0.21
0.23
0.26
0.28
0.31
0.37
0.44
0.51
0.58
0.66
0.74
0.83
0.93
1.02
1.12
1.40
1.70
2.03
2.38
2.76
3.17
3.60
4.05
4.54
5.04
5.57
6.13
7.31
8.58
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.04
0.04
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.13
0.14
0.15
0.19
0.23
0.28
0.33
0.38
0.43
0.49
0.55
0.62
0.69
0.76
0.84
1.00
1.17
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
( )
]
Referencia
[
El uso inteligente del agua.™
239
Referencia
5VCPEFQPMJFUJMFOP1&
DFSUJGJDBEPQBSBQSFTJØO4%3
Tubo de polietileno (PE) certificado para presión SDR
4%3$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño 1/2"
D.I.
0.622
Caudal
Velocidad Pérdida
(gpm)
pps
psi
3/4"
1"
0.824
1.049
Velocidad Pérdida Velocidad Pérdida
pps
psi
pps
psi
1 1/4"
1.380
Velocidad Pérdida
pps
psi
1 1/2"
1.610
Velocidad Pérdida
pps
psi
2"
2.067
Velocidad Pérdida
pps
psi
2 1/2"
2.469
Velocidad Pérdida
pps
psi
3"
3.068
Velocidad Pérdida
pps
psi
4"
4.026
Velocidad Pérdida
pps
psi
6"
6.065
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
0.60
1.20
1.80
2.41
3.01
3.61
4.21
4.81
5.41
6.02
6.62
7.22
8.42
9.63
10.83
12.03
13.24
14.44
15.64
16.85
18.05
0.21
0.43
0.64
0.86
1.07
1.29
1.50
1.72
1.93
2.15
2.36
2.57
3.00
3.43
3.86
4.29
4.72
5.15
5.58
6.01
6.44
7.51
8.58
9.65
10.73
11.80
12.87
13.94
15.02
16.09
17.16
18.23
19.31
0.16
0.32
0.47
0.63
0.79
0.95
1.10
1.26
1.42
1.58
1.73
1.89
2.21
2.52
2.84
3.15
3.47
3.78
4.10
4.41
4.73
5.52
6.30
7.09
7.88
8.67
9.46
10.24
11.03
11.82
12.61
13.40
14.18
14.97
15.76
17.34
18.91
0.10
0.19
0.29
0.38
0.48
0.57
0.67
0.76
0.86
0.96
1.05
1.15
1.34
1.53
1.72
1.91
2.10
2.29
2.49
2.68
2.87
3.35
3.82
4.30
4.78
5.26
5.74
6.21
6.69
7.17
7.65
8.13
8.61
9.08
9.56
10.52
11.47
12.43
13.39
14.34
15.30
16.25
17.21
18.17
19.12
0.07
0.13
0.20
0.27
0.34
0.40
0.47
0.54
0.60
0.67
0.74
0.80
0.94
1.07
1.21
1.34
1.47
1.61
1.74
1.88
2.01
2.35
2.68
3.02
3.35
3.69
4.02
4.36
4.69
5.03
5.36
5.70
6.03
6.37
6.70
7.37
8.04
8.71
9.38
10.05
10.72
11.39
12.06
12.73
13.40
15.08
16.75
18.43
0.04
0.09
0.13
0.17
0.22
0.26
0.30
0.35
0.39
0.43
0.48
0.52
0.61
0.69
0.78
0.87
0.95
1.04
1.13
1.22
1.30
1.52
1.74
1.95
2.17
2.39
2.60
2.82
3.04
3.25
3.47
3.69
3.91
4.12
4.34
4.77
5.21
5.64
6.08
6.51
6.94
7.38
7.81
8.25
8.68
9.76
10.85
11.93
13.02
14.10
15.19
16.27
17.36
18.44
19.53
0.03
0.05
0.08
0.10
0.13
0.15
0.18
0.20
0.23
0.25
0.28
0.30
0.35
0.40
0.45
0.50
0.55
0.60
0.66
0.71
0.76
0.88
1.01
1.13
1.26
1.39
1.51
1.64
1.76
1.89
2.02
2.14
2.27
2.39
2.52
2.77
3.02
3.28
3.53
3.78
4.03
4.28
4.54
4.79
5.04
5.67
6.30
6.93
7.56
8.19
8.82
9.45
10.08
10.71
11.34
11.97
12.60
13.86
15.12
0.01
0.02
0.03
0.04
0.06
0.07
0.08
0.09
0.10
0.11
0.12
0.13
0.16
0.18
0.20
0.22
0.24
0.27
0.29
0.31
0.33
0.39
0.44
0.50
0.56
0.61
0.67
0.72
0.78
0.83
0.89
0.94
1.00
1.06
1.11
1.22
1.33
1.44
1.55
1.67
1.78
1.89
2.00
2.11
2.22
2.50
2.78
3.05
3.33
3.61
3.89
4.16
4.44
4.72
5.00
5.28
5.55
6.11
6.66
1.06
2.11
3.17
4.22
5.28
6.34
7.39
8.45
9.50
10.56
11.61
12.67
14.78
16.89
19.01
0.43
1.55
3.28
5.58
8.43
11.81
15.71
20.12
25.01
30.40
36.26
42.59
56.64
72.52
90.17
0.11
0.39
0.83
1.42
2.15
3.01
4.00
5.12
6.37
7.74
9.23
10.84
14.42
18.46
22.95
27.89
33.27
39.08
45.32
51.98
59.05
0.37
0.74
1.11
1.48
1.86
2.23
2.60
2.97
3.34
3.71
4.08
4.45
5.20
5.94
6.68
7.42
8.17
8.91
9.65
10.39
11.14
12.99
14.85
16.71
18.56
0.03
0.12
0.26
0.44
0.66
0.93
1.24
1.58
1.97
2.39
2.85
3.35
4.45
5.70
7.09
8.62
10.28
12.07
14.00
16.06
18.24
24.26
31.06
38.62
46.94
0.01
0.03
0.07
0.12
0.17
0.24
0.33
0.42
0.52
0.63
0.75
0.88
1.17
1.50
1.87
2.27
2.71
3.18
3.69
4.23
4.80
6.39
8.18
10.17
12.36
14.74
17.32
20.08
23.03
26.17
29.49
32.99
36.67
0.00
0.02
0.03
0.05
0.08
0.12
0.15
0.20
0.24
0.30
0.35
0.42
0.55
0.71
0.88
1.07
1.28
1.50
1.74
2.00
2.27
3.02
3.86
4.80
5.84
6.96
8.18
9.49
10.88
12.36
13.93
15.58
17.32
19.14
21.05
25.11
29.49
0.00
0.00
0.01
0.02
0.02
0.03
0.05
0.06
0.07
0.09
0.11
0.12
0.16
0.21
0.26
0.32
0.38
0.45
0.52
0.59
0.67
0.89
1.15
1.42
1.73
2.06
2.43
2.81
3.23
3.66
4.13
4.62
5.14
5.68
6.24
7.44
8.74
10.14
11.63
13.21
14.89
16.65
18.51
20.46
22.50
0.00
0.00
0.00
0.01
0.01
0.01
0.02
0.02
0.03
0.04
0.04
0.05
0.07
0.09
0.11
0.13
0.16
0.19
0.22
0.25
0.28
0.38
0.48
0.60
0.73
0.87
1.02
1.18
1.36
1.54
1.74
1.95
2.16
2.39
2.63
3.14
3.68
4.27
4.90
5.56
6.27
7.01
7.80
8.62
9.48
11.78
14.32
17.08
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.09
0.10
0.13
0.17
0.21
0.25
0.30
0.36
0.41
0.47
0.54
0.60
0.68
0.75
0.83
0.91
1.09
1.28
1.48
1.70
1.93
2.18
2.44
2.71
2.99
3.29
4.09
4.98
5.94
6.97
8.09
9.27
10.54
11.87
13.28
14.76
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.03
0.04
0.06
0.07
0.08
0.09
0.11
0.13
0.14
0.16
0.18
0.20
0.22
0.24
0.29
0.34
0.40
0.45
0.52
0.58
0.65
0.72
0.80
0.88
1.09
1.33
1.58
1.86
2.16
2.47
2.81
3.16
3.54
3.93
4.35
4.78
5.70
6.70
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.02
0.03
0.03
0.03
0.04
0.05
0.05
0.06
0.07
0.08
0.09
0.10
0.11
0.12
0.15
0.18
0.22
0.25
0.29
0.34
0.38
0.43
0.48
0.54
0.59
0.65
0.78
0.91
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
[
( )
]
Referencia
240
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
5VCPEFBDFSPFTUÈOEBS4DIFEVMF
Tubo de acero estándar Schedule 40
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
(
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
1/2"
0.840
0.622
0.109
Velocidad Pérdida
pps
psi
3/4"
1"
1.050
1.315
0.824
1.049
0.113
0.133
Velocidad Pérdida Velocidad Pérdida
pps
psi
pps
psi
1 1/4"
1.660
1.380
0.140
Velocidad Pérdida
pps
psi
1 1/2"
1.900
1.610
0.145
Velocidad Pérdida
pps
psi
2"
2.375
2.067
0.154
Velocidad Pérdida
pps
psi
2 1/2"
2.875
2.469
0.203
Velocidad Pérdida
pps
psi
3"
3.500
3.068
0.216
Velocidad Pérdida
pps
psi
4"
4.500
4.026
0.237
Velocidad Pérdida
pps
psi
6"
6.625
6.065
0.280
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
600
1.06
2.11
3.17
4.22
5.28
6.34
7.39
8.45
9.50
10.56
11.61
12.67
14.78
16.89
19.01
0.60
1.20
1.80
2.41
3.01
3.61
4.21
4.81
5.41
6.02
6.62
7.22
8.42
9.63
10.83
12.03
13.24
14.44
15.64
16.85
18.05
0.21
0.43
0.64
0.86
1.07
1.29
1.50
1.72
1.93
2.15
2.36
2.57
3.00
3.43
3.86
4.29
4.72
5.15
5.58
6.01
6.44
7.51
8.58
9.65
10.73
11.80
12.87
13.94
15.02
16.09
17.16
18.23
19.31
0.16
0.32
0.48
0.64
0.80
0.96
1.12
1.28
1.44
1.60
1.76
1.91
2.23
2.55
2.87
3.19
3.51
3.83
4.15
4.47
4.79
5.58
6.38
7.18
7.98
8.78
9.57
10.37
11.17
11.97
12.77
13.56
14.36
15.16
15.96
17.55
19.15
0.10
0.19
0.29
0.38
0.48
0.57
0.67
0.76
0.86
0.96
1.05
1.15
1.34
1.53
1.72
1.91
2.10
2.29
2.49
2.68
2.87
3.35
3.82
4.30
4.78
5.26
5.74
6.21
6.69
7.17
7.65
8.13
8.61
9.08
9.56
10.52
11.47
12.43
13.39
14.34
15.30
16.25
17.21
18.17
19.12
0.07
0.13
0.20
0.26
0.33
0.40
0.46
0.53
0.59
0.66
0.73
0.79
0.92
1.06
1.19
1.32
1.45
1.58
1.71
1.85
1.98
2.31
2.64
2.97
3.30
3.63
3.96
4.29
4.62
4.95
5.28
5.60
5.93
6.26
6.59
7.25
7.91
8.57
9.23
9.89
10.55
11.21
11.87
12.53
13.19
14.84
16.48
18.13
0.04
0.09
0.13
0.17
0.22
0.26
0.30
0.35
0.39
0.43
0.48
0.52
0.61
0.69
0.78
0.87
0.95
1.04
1.13
1.22
1.30
1.52
1.74
1.95
2.17
2.39
2.60
2.82
3.04
3.25
3.47
3.69
3.91
4.12
4.34
4.77
5.21
5.64
6.08
6.51
6.94
7.38
7.81
8.25
8.68
9.76
10.85
11.93
13.02
14.10
15.19
16.27
17.36
18.44
19.53
0.03
0.05
0.08
0.10
0.13
0.15
0.18
0.20
0.23
0.25
0.28
0.30
0.35
0.40
0.45
0.50
0.55
0.60
0.66
0.71
0.76
0.88
1.01
1.13
1.26
1.39
1.51
1.64
1.76
1.89
2.02
2.14
2.27
2.39
2.52
2.77
3.02
3.28
3.53
3.78
4.03
4.28
4.54
4.79
5.04
5.67
6.30
6.93
7.56
8.19
8.82
9.45
10.08
10.71
11.34
11.97
12.60
13.86
15.12
0.02
0.03
0.05
0.06
0.08
0.10
0.11
0.13
0.14
0.16
0.18
0.19
0.22
0.26
0.29
0.32
0.35
0.38
0.42
0.45
0.48
0.56
0.64
0.72
0.80
0.88
0.96
1.04
1.12
1.20
1.28
1.36
1.44
1.52
1.60
1.76
1.92
2.08
2.25
2.41
2.57
2.73
2.89
3.05
3.21
3.61
4.01
4.41
4.81
5.21
5.61
6.01
6.41
6.82
7.22
7.62
8.02
8.82
9.62
0.91
3.28
6.94
11.81
17.85
25.01
33.27
42.59
52.96
64.35
76.76
90.17
119.93
153.53
190.91
0.23
0.83
1.77
3.01
4.54
6.37
8.47
10.84
13.48
16.38
19.54
22.95
30.53
39.08
48.59
59.05
70.44
82.74
95.94
110.04
125.02
0.37
0.74
1.11
1.48
1.86
2.23
2.60
2.97
3.34
3.71
4.08
4.45
5.20
5.94
6.68
7.42
8.17
8.91
9.65
10.39
11.14
12.99
14.85
16.71
18.56
0.07
0.26
0.55
0.93
1.40
1.97
2.62
3.35
4.16
5.06
6.04
7.09
9.43
12.07
15.01
18.24
21.76
25.56
29.64
34.00
38.62
51.37
65.76
81.78
99.37
0.02
0.07
0.14
0.24
0.37
0.52
0.69
0.88
1.10
1.33
1.59
1.87
2.48
3.18
3.95
4.80
5.73
6.73
7.81
8.95
10.17
13.53
17.32
21.53
26.17
31.21
36.67
42.52
48.77
55.40
62.43
69.84
77.63
0.01
0.03
0.07
0.12
0.18
0.25
0.34
0.43
0.53
0.65
0.77
0.91
1.21
1.55
1.92
2.34
2.79
3.28
3.80
4.36
4.95
6.59
8.43
10.48
12.74
15.20
17.85
20.70
23.74
26.98
30.40
34.01
37.80
41.77
45.93
54.79
64.36
0.00
0.01
0.02
0.03
0.05
0.07
0.10
0.12
0.15
0.19
0.22
0.26
0.35
0.45
0.55
0.67
0.80
0.94
1.09
1.25
1.42
1.89
2.43
3.02
3.66
4.37
5.14
5.95
6.83
7.76
8.74
9.78
10.87
12.02
13.21
15.76
18.51
21.47
24.62
27.97
31.52
35.26
39.19
43.32
47.63
0.00
0.00
0.01
0.01
0.02
0.03
0.04
0.05
0.06
0.08
0.09
0.11
0.14
0.18
0.22
0.27
0.33
0.38
0.44
0.51
0.58
0.77
0.98
1.22
1.48
1.77
2.08
2.41
2.77
3.14
3.54
3.96
4.40
4.87
5.35
6.38
7.50
8.69
9.97
11.33
12.77
14.28
15.87
17.54
19.29
23.99
29.15
34.77
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.05
0.07
0.08
0.10
0.12
0.14
0.16
0.18
0.21
0.28
0.36
0.44
0.54
0.64
0.75
0.87
1.00
1.14
1.28
1.43
1.59
1.76
1.93
2.31
2.71
3.14
3.60
4.09
4.61
5.16
5.74
6.34
6.97
8.67
10.54
12.57
14.76
17.12
19.63
22.31
25.14
28.12
31.25
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.01
0.02
0.02
0.03
0.03
0.04
0.04
0.05
0.06
0.07
0.09
0.12
0.14
0.17
0.20
0.23
0.27
0.30
0.34
0.38
0.42
0.47
0.52
0.61
0.72
0.84
0.96
1.09
1.23
1.38
1.53
1.69
1.86
2.31
2.81
3.35
3.93
4.56
5.23
5.95
6.70
7.49
8.33
9.21
10.12
12.08
14.19
0.00
0.00
0.00
0.00
0.01
0.01
0.02
0.04
0.05
0.08
0.11
0.14
0.24
0.38
0.57
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
0.00
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
( )
]
Referencia
[
El uso inteligente del agua.™
241
Referencia
5VCPQBSBBHVBEFDPCSF5JQP,
Tubo para agua de cobre Tipo K
$
Pérdida en psi por cada 100 pies de tubo (psi/100 pies)
5BNB×PTEFDN
BDN
DBVEBMTEFBHQNBMT
Tamaño
D.E.
D.I.
Esp. pared
Caudal
(gpm)
1/2"
0.625
0.5270
0.049
Velocidad Pérdida
pps
psi
5/8"
0.750
0.652
0.049
Velocidad Pérdida
pps
psi
3/4"
0.875
0.745
0.065
Velocidad Pérdida
pps
psi
1“
1.125
0.995
0.065
Velocidad Pérdida
pps
psi
1 1/4"
1.375
1.245
0.065
Velocidad Pérdida
pps
psi
1 1/2"
1.625
1.481
0.072
Velocidad Pérdida
pps
psi
2“
2.125
1.959
0.083
Velocidad Pérdida
pps
psi
2 1/2"
2.625
2.435
0.095
Velocidad Pérdida
pps
psi
3"
3.125
2.907
0.109
Velocidad Pérdida
pps
psi
1
2
3
4
5
6
7
8
9
10
11
12
14
16
18
20
22
24
26
28
30
35
40
45
50
55
60
65
70
75
80
85
90
95
100
110
120
130
140
150
160
170
180
190
200
225
250
275
300
325
350
375
400
425
450
475
500
550
1.47
2.94
4.41
5.88
7.35
8.83
10.30
11.77
13.24
14.71
16.18
17.65
0.96
1.92
2.88
3.84
4.80
5.77
6.73
7.69
8.65
9.61
10.57
11.53
13.45
15.38
17.30
19.22
0.74
1.47
2.21
2.94
3.68
4.42
5.15
5.89
6.62
7.36
8.10
8.83
10.30
11.78
13.25
14.72
16.19
17.66
19.14
0.41
0.83
1.24
1.65
2.06
2.48
2.89
3.30
3.71
4.13
4.54
4.95
5.78
6.60
7.43
8.25
9.08
9.90
10.73
11.55
12.38
14.44
16.50
18.57
0.26
0.53
0.79
1.05
1.32
1.58
1.84
2.11
2.37
2.64
2.90
3.16
3.69
4.22
4.74
5.27
5.80
6.33
6.85
7.38
7.91
9.22
10.54
11.86
13.18
14.49
15.81
17.13
18.45
19.77
0.19
0.37
0.56
0.74
0.93
1.12
1.30
1.49
1.68
1.86
2.05
2.23
2.61
2.98
3.35
3.72
4.10
4.47
4.84
5.21
5.59
6.52
7.45
8.38
9.31
10.24
11.17
12.11
13.04
13.97
14.90
15.83
16.76
17.69
18.62
0.11
0.21
0.32
0.43
0.53
0.64
0.75
0.85
0.96
1.06
1.17
1.28
1.49
1.70
1.92
2.13
2.34
2.55
2.77
2.98
3.19
3.73
4.26
4.79
5.32
5.85
6.39
6.92
7.45
7.98
8.52
9.05
9.58
10.11
10.64
11.71
12.77
13.84
14.90
15.97
17.03
18.10
19.16
0.07
0.14
0.21
0.28
0.34
0.41
0.48
0.55
0.62
0.69
0.76
0.83
0.96
1.10
1.24
1.38
1.52
1.65
1.79
1.93
2.07
2.41
2.76
3.10
3.44
3.79
4.13
4.48
4.82
5.17
5.51
5.86
6.20
6.55
6.89
7.58
8.27
8.96
9.65
10.33
11.02
11.71
12.40
13.09
13.78
15.50
17.22
18.95
0.05
0.10
0.15
0.19
0.24
0.29
0.34
0.39
0.44
0.48
0.53
0.58
0.68
0.77
0.87
0.97
1.06
1.16
1.26
1.35
1.45
1.69
1.93
2.18
2.42
2.66
2.90
3.14
3.38
3.63
3.87
4.11
4.35
4.59
4.83
5.32
5.80
6.28
6.77
7.25
7.73
8.22
8.70
9.18
9.67
10.88
12.08
13.29
14.50
15.71
16.92
18.13
19.34
1.09
3.94
8.34
14.20
21.46
30.06
39.98
51.19
63.65
77.35
92.26
108.38
0.39
1.40
2.96
5.04
7.62
10.67
14.20
18.17
22.60
27.46
32.76
38.48
51.17
65.51
81.46
98.99
0.20
0.73
1.55
2.63
3.98
5.58
7.42
9.50
11.81
14.35
17.12
20.11
26.75
34.24
42.58
51.74
61.72
72.50
84.07
0.05
0.18
0.38
0.64
0.97
1.36
1.82
2.32
2.89
3.51
4.19
4.92
6.54
8.38
10.42
12.66
15.10
17.74
20.57
23.59
26.80
35.65
45.64
56.75
0.02
0.06
0.13
0.22
0.33
0.46
0.61
0.78
0.97
1.18
1.41
1.65
2.20
2.82
3.50
4.25
5.07
5.96
6.91
7.93
9.01
11.98
15.34
19.07
23.17
27.64
32.47
37.65
43.18
49.06
0.01
0.03
0.05
0.09
0.14
0.20
0.26
0.34
0.42
0.51
0.60
0.71
0.94
1.21
1.50
1.83
2.18
2.56
2.97
3.41
3.87
5.15
6.59
8.19
9.96
11.88
13.95
16.18
18.56
21.08
23.76
26.58
29.54
32.65
35.90
0.00
0.01
0.01
0.02
0.04
0.05
0.07
0.09
0.11
0.13
0.16
0.18
0.24
0.31
0.39
0.47
0.56
0.66
0.76
0.87
0.99
1.32
1.69
2.10
2.55
3.05
3.58
4.15
4.76
5.41
6.09
6.81
7.58
8.37
9.21
10.98
12.90
14.96
17.15
19.49
21.96
24.57
27.31
0.00
0.00
0.00
0.01
0.01
0.02
0.02
0.03
0.04
0.05
0.05
0.06
0.08
0.11
0.13
0.16
0.19
0.23
0.26
0.30
0.34
0.46
0.59
0.73
0.89
1.06
1.24
1.44
1.65
1.88
2.11
2.37
2.63
2.91
3.19
3.81
4.48
5.19
5.95
6.76
7.62
8.53
9.48
10.47
11.52
14.32
17.40
20.76
0.00
0.00
0.00
0.00
0.01
0.01
0.01
0.01
0.02
0.02
0.02
0.03
0.04
0.05
0.06
0.07
0.08
0.10
0.11
0.13
0.15
0.19
0.25
0.31
0.37
0.45
0.52
0.61
0.70
0.79
0.89
1.00
1.11
1.23
1.35
1.61
1.89
2.19
2.51
2.86
3.22
3.60
4.00
4.42
4.86
6.05
7.35
8.77
10.30
11.94
13.70
15.56
17.53
Nota: El área de la tabla con sombreado oscuro indica velocidades superiores a 5 pies por segundo. Utilice con precaución.
-BWFMPDJEBEEFMPTWBMPSFTEFDBVEBMTFDBMDVMBQPSNFEJPEFMBFDVBDJØOHFOFSBM72d 2
2
Los valores de pérdida de presión por fricción se computan a partir de la siguiente ecuación: IG 100
x.433 para calcular la pérdida en psi cada 100 pies de tubo
c 1.852d4.866
[
( )
]
Referencia
242
El uso inteligente del agua.™
Cuadros de
referencia
de pérdida
de presión
Referencia
www.rainbird.com/reference
Guía de especificación de estaciones de bombeo
QBSBCPNCBT-1Z4FSJF%
Guía de especificación de estaciones de bombeo para bombas de perfil inferior y Serie D
amaño de la bomba (hp) en base a los
requisitos
de presión yde
caudal
Rain
Bird® Estaciones
bombas de perfil inferior (LP)
hp
CR3-3
CR3-4
CR3-5
CR5-2
CR10-1
CR3-6
CR5-3
CR3-7
CR5-4
CR5-5
CR10-2
CR3-10
CR5-7
CR15-1
CR10-3
CR10-4
CR20-1
0.5
0.75
0.75
0.75
0.75
1
1
1.5
1.5
1.5
1.5
2
2
2
3
3
3
Conexiones
embridadas
suc./desc.
2"
2"
2"
2"
2"
2"
2"
2"
2"
2"
2"
2"
2"
3"
2"
2"
3"
(Presión diferencial [psiG]) Aumento en caudal máximo (gpm)
15
psiG
22
30
15
20
psiG
20
30
psiG
12
18
40
psiG
50
psiG
12
18
14
18
80
psiG
90
psiG
100
psiG
110
psiG
120
psiG
60
14
10
18
15
10
16
14
12
8
110
psiG
120
psiG
23
37
23
35
27
17
37
34
27
18
20
45
60
55
45
30
55
80
60
130
70
psiG
23
40
110
60
psiG
110
Bomba de succión extrema horizontal
Modelol de
bomba
hp
$15
$15
1WC
1WC
$55
$15
1WC
1.5WH
1WC
1.25W
1.5WH
$15
2WH
:
:
1.5WH
$15
$15
1
2
2
3
3
5
5
5
7.5
7.5
7.5
7.5
7.5
7.5
10
10
10
10
Conexiones
embridadas
suc./desc.
2"
3"
2"
2"
3"
3"
2"
4"
2"
4"
4"
4"
4"
4"
4"
4"
4"
4"
(Presión diferencial [psiG]) Aumento en caudal máximo (gpm)
15
psiG
20
psiG
35
180
30
psiG
40
psiG
55
30
27-40
70
60
95
15-20
25-42
30
85
140-165
90-135
75-90
170-215
190
200-235
140-160
140-195
190
115-185
200-235
50
psiG
60
psiG
70
psiG
80
psiG
90
psiG
100
psiG
70
35-47
50
17-50
17-50
20-30
45-55
35-55
20-45
105-160
95-165
170
65-125
80-125
130
65-75
145
150-160
170-215
125
130-160
130-190
100
105-145
90-150
65
105
88
215
204
180
130
15-30
60
Bombas serie D
Modelol de
bomba
Versiones
personalizadas
Sin número de
modelo
hp
5
5
5
7.5
5
5
7.5
10
10
5
7.5
10
2(5)
3
5
7.5
7.5
7.5
10
2(5)
2(7.5)
2(10)
2(10)
7.5
2(5)
2(7.5)
2(10)
2(3)
2(5)
2(7.5)
2(7.5)
2(7.5)
Conexiones
embridadas
suc./desc.
2"
2"
2"
2"
3"
3"
3"
3"
3"
3"
3"
3"
3"
4"
4"
4"
4"
4"
4"
4"
4"
4"
4"
4"
4"
4"
4"
6"
6"
6"
6"
6"
El uso inteligente del agua.™
(Presión diferencial [psiG]) Aumento en caudal máximo (gpm)
15
psiG
20
psiG
30
psiG
40
psiG
50
psiG
60
psiG
60
70
psiG
60
80
psiG
50
60
90
psiG
50
60
100
psiG
110
psiG
120
psiG
100
90
200
180
50
60
100
120
100
120
90
50
100
90
80
100
100
80
100
100
100
120
120
120
120
120
150
180
130
180
160
180
130
150
170
140
180
160
140
200
200
200
220
260
260
240
240
240
360
120
200
190
230
240
300
360
160
200
330
360
270
310
340
240
210
Referencia
Seleccione el caudal requerido dentro de la columna de presión deseada
Tipo de bomba vertical multifase
Modelol de
bomba
280
243
Referencia
Guía de especificación de estaciones de bombeo
QBSBCPNCBT-1Z4FSJF%
Guía de especificación de estaciones de bombeo para bombas LP y Serie D
Índice de caudal en galones por minuto (gpm)
Diámetro del tubo en pulgadas
gpm
0.5
0.75
1
1.5
2
2.5
3
4
6
8
1
2
3
4
5
6
7
8
9
10
15
20
25
30
35
40
45
50
60
70
80
90
100
125
150
175
200
225
250
275
300
325
350
375
400
425
450
475
500
1.6
3.3
4.9
6.5
8.2
9.8
11.4
13.1
14.7
16.3
24.5
32.7
40.9
49
57.2
65.4
73.5
81.7
98
114.4
130.7
147.1
163.4
204.3
245.1
286
326.8
367.7
408.5
449.4
490.2
531.1
571.9
612.8
653.6
694.5
735.3
776.2
817
0.7
1.5
2.2
2.9
3.6
4.4
5.1
5.8
6.5
7.3
10.9
14.5
18.2
21.8
25.4
29
32.7
36.3
43.6
50.8
58.1
65.4
72.6
90.8
108.9
127.1
145.2
163.4
181.6
199.7
217.9
236
254.2
272.3
290.5
308.6
326.8
345
363.1
0.4
0.8
1.2
1.6
2
2.5
2.9
3.3
3.7
4.1
6.1
8.2
10.2
12.3
14.3
16.3
18.4
20.4
24.5
28.6
32.7
36.8
40.9
51.1
61.3
71.5
81.7
91.9
102.1
112.3
122.6
132.8
143
153.2
163.4
173.6
183.8
194
204.3
0.2
0.4
0.5
0.7
0.9
1.1
1.3
1.5
1.6
1.8
2.7
3.6
4.5
5.4
6.4
7.3
8.2
9.1
10.9
12.7
14.5
16.3
18.2
22.7
27.2
31.8
36.3
40.9
45.4
49.9
54.5
59
63.5
68.1
72.6
77.2
81.7
86.2
90.8
0.1
0.2
0.3
0.4
0.5
0.6
0.7
0.8
0.9
1
1.5
2
2.6
3.1
3.6
4.1
4.6
5.1
6.1
7.1
8.2
9.2
10.2
12.8
15.3
17.9
20.4
23
25.5
28.1
30.6
33.2
35.7
38.3
40.9
43.4
46
48.5
51.1
0.1
0.1
0.2
0.3
0.3
0.4
0.5
0.5
0.6
0.7
1
1.3
1.6
2
2.3
2.6
2.9
3.3
3.9
4.6
5.2
5.9
6.5
8.2
9.8
11.4
13.1
14.7
16.3
18
19.6
21.2
22.9
24.5
26.1
27.8
29.4
31
32.7
0
0.1
0.1
0.2
0.2
0.3
0.3
0.4
0.4
0.5
0.7
0.9
1.1
1.4
1.6
1.8
2
2.3
2.7
3.2
3.6
4.1
4.5
5.7
6.8
7.9
9.1
10.2
11.3
12.5
13.6
14.8
15.9
17
18.2
19.3
20.4
21.6
22.7
0
0.1
0.1
0.1
0.1
0.2
0.2
0.2
0.2
0.3
0.4
0.5
0.6
0.8
0.9
1
1.1
1.3
1.5
1.8
2
2.3
2.6
3.2
3.8
4.5
5.1
5.7
6.4
7
7.7
8.3
8.9
9.6
10.2
10.9
11.5
12.1
12.8
0
0
0
0
0.1
0.1
0.1
0.1
0.1
0.1
0.2
0.2
0.3
0.3
0.4
0.5
0.5
0.6
0.7
0.8
0.9
1
1.1
1.4
1.7
2
2.3
2.6
2.8
3.1
3.4
3.7
4
4.3
4.5
4.8
5.1
5.4
5.7
0
0
0
0
0
0
0
0.1
0.1
0.1
0.1
0.1
0.2
0.2
0.2
0.3
0.3
0.3
0.4
0.4
0.5
0.6
0.6
0.8
1
1.1
1.3
1.4
1.6
1.8
1.9
2.1
2.2
2.4
2.6
2.7
2.9
3
3.2
Los valores representan la velocidad en pies por segundos
Naranja = velocidad de entrada/descarga recomendada. La típica es de 5.0 pies/s
Referencia
244
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
Servicio al cliente y garantías
Servicio al cliente
En Rain Bird consideramos que cuando usted compra nuestros productos,
también debe recibir la asistencia necesaria para asegurarse de que
GVODJPOFOEFMNPEPFORVFGVFSPOEJTF×BEPT5BMDPNPOVFTUSPTQSPEVDUPT
el servicio al cliente de Rain Bird está diseñado para superar sus expectativas.
Cuando usted llama para hacer una pregunta sobre su encargo o sobre
nuevos productos, los mejores profesionales en administración de agua de la
industria le proporcionan la asistencia que necesita. Esta asistencia se origina
en nuestra casa central ubicada en Azusa, California, o en nuestro Centro de
TFSWJDJPBMDMJFOUFVCJDBEPFO5VDTPO"SJ[POBZFTUÈSFTQBMEBEPQPSOVFTUSB
amplia red global de socios distribuidores.
Garantías sin preocupaciones
Las completas garantías de nuestros productos hacen que elegir Rain Bird sea
más fácil y lo ayudan a despreocuparse. La mayor parte de los productos de
irrigación paisajística de Rain Bird tienen garantía comercial por un período
de tres o cinco años a partir de la fecha original de compra. Una garantía de
Rain Bird es el soporte libre de problemas que permite que los profesionales
de los sistemas de riego alcancen el máximo rendimiento. Para usted, es la
tranquilidad de saber que Rain Bird estará presente cuando lo necesite.
ii. Productos para golf
3PUPSFTQBSBHPMG3PUPSFTQBSBHPMG4FSJF%3%)%4&43&"(-&™Z4FSJF&"(-&
IC™, serie Rain Bird y Rain Bird IC™: 3 años.
"EFNÈTDVBMRVJFSSPUPSQBSBHPMG4FSJF%3%)%4&"(-&™ZTFSJF&"(-&*$™TFSJF
Rain Bird y Rain Bird IC™ que se adquiera y se instale junto con una junta articulada
Rain Bird: 5 años. Se requiere constancia de instalación simultánea.
+VOUBTBSUJDVMBEBTB×PT
Válvulas con control remoto de latón y llaves de acople rápido de latón: 3 años
Controladores de sistemas de filtración: 3 años
3BEJPT-*/,™B×PT
4FOTPSEFTVFMP54.4%**44
B×PT
Aireador para mantenimiento de lagos: LM10, LM11, LM20, LM30: 5 años
Aireador para mantenimiento de lagos: LMM: 2 años
Luces del aireador para mantenimiento de lagos: 1 año
Carretes para mangueras: 2 años
5PEPTMPTPUSPTQSPEVDUPTQBSBHPMGB×P
iii. Productos agrícolas
Política de satisfacción del cliente profesional de Rain Bird
Rain Bird reparará o sustituirá sin cargo cualquier producto profesional de Rain
Bird que falle durante el uso normal dentro del período de garantía estipulado
a continuación. Usted debe devolverlo al proveedor o distribuidor en donde lo
adquirió. Las fallas de producto ocasionadas por fenómenos de la naturaleza
(incluidos, entre otros, relámpagos e inundaciones) no están cubiertas por esta
garantía. Este compromiso de reparación o sustitución constituye nuestra única
y total garantía.
Las garantías implícitas de comerciabilidad y aptitud, si
corresponden, se limitan a un año a partir de la fecha de venta.
Bajo ninguna circunstancia seremos responsables por daños incidentales o
consecuentes, sin importar la forma en que éstos sucedan.
l. Productos para riego y drenaje en jardines
Aspersores de vástago retráctil Serie 1800, boquillas Serie U, boquillas MPR de latón,
adaptadores para arbustos A-8 y PA-8S-PRS, y burbujeadores 1300 y 1400, rotores
4FSJFSPUPSFT4FSJFSPUPSFTZSPUPSFT'BMDPO¥4FSJF
WÈMWVMBTEFQMÈTUJDP1&#1&4#ZMÓOFBTEFSJFHPQPSHPUFP4FSJF9'B×PT
Aireador para mantenimiento de lagos: LM10, LM11, LM20, LM30: 3 años
Aireador para mantenimiento de lagos: LMM, 2 años
Luces del aireador para mantenimiento de lagos: 1 año
Unidad de potencia C2: 2 años
5PEPTMPTPUSPTQSPEVDUPTQBSBSJFHPZESFOBKFFOKBSEJOFTB×PT
Línea de riego AG con compensación de presión A5 PC: cinco años para defectos de
fabricación, siete años para grietas por exposición al medio ambiente
5VCFSÓBEFQPMJFUJMFOP1&DJODPB×PTQBSBEFGFDUPTEFGBCSJDBDJØOTJFUFB×PTQBSB
grietas por exposición al medio ambiente
"TQFSTPSFT4FSJF-'™DJODPB×PT
Aspersores de impacto: dos años
5PEPTMPTEFNÈTQSPEVDUPTBHSÓDPMBTVOB×P
iV. Estaciones de bombeo
Rain Bird garantiza que su estación de bombeo estará libre de fallas de fabricación
por un período de un año a partir de la fecha autorizada de arranque, pero no
posterior a los dieciséis meses de la fecha de la factura.
La puesta en marcha por parte de otra persona que no forme parte del personal
autorizado de Rain Bird anulará estos términos y condiciones.
Siempre que se hayan ejecutado adecuadamente todas las responsabilidades
correspondientes a la instalación, el arranque y el funcionamiento, Rain Bird
reemplazará y sustituirá, a su elección, cualquier pieza que encuentre defectuosa
bajo el uso normal recomendado durante este período. Las reparaciones que corran
por cuenta de Rain Bird deben ser autorizadas por éste previo a su realización.
En caso de que así se solicite, Rain Bird debe proporcionar sugerencias sobre el
diagnóstico y la solución de problemas durante el período de vigencia de esta
Política de satisfacción del cliente. No obstante, no se brindará ningún servicio,
sustitución o reparación bajo esta política de satisfacción del cliente en caso de que
el cliente tenga alguna deuda con Rain Bird.
Rain Bird no aceptará la responsabilidad por ningún costo asociado con el traslado,
la sustitución o la reparación de equipos en sitios de difícil acceso. Los sitios de
difícil acceso incluyen (pero no están limitados a) lugares que requieran cualquiera
de los puntos mencionados a continuación:
* Línea de riego por goteo serie XF: siete años para grietas por exposición al medio ambiente (ESCR)
continúa en la siguiente página
El uso inteligente del agua.™
Referencia
Para obtener mayor información, consulte a su distribuidor de Rain Bird. Para encontrar al
distribuidor autorizado más cercano en su área, visite www.rainbird.com o llame al 1-800-RAINBIRD
245
Referencia
Servicio al cliente y garantías,
Referencias para las páginas 2 a 6
1) Grúas con peso superior a 15 toneladas
Referencias para las páginas 2 a 6
2) Buzos
3) Barcazas
4) Helicópteros
%FSJWBEPEFMBFDVBDJØOEF#FSOPVMMJ
$POTVMUF3PCFSTPO$SPXF&OHJOFFSJOH
Fluid Mechanics (Cuarta edición), Houghton Mifflin Co., Boston MA 1990
1
2
%SBHBEP
6) Cualquier otro medio o requisito inusual
5BMDPTUPJOVTVBMEFCFDPSSFSQPSDVFOUBEFMDMJFOUFJOEFQFOEJFOUFNFOUFEFM
motivo que requiera el traslado del equipo desde el servicio.
Los términos y condiciones de esta Política de satisfacción del cliente no cubren
ningún daño causado o que sea el resultado de alguno de los siguientes:
1) Mala aplicación, abuso o incapacidad de llevar a cabo el mantenimiento de
rutina (se incluirán procedimientos de preparación y almacenamiento para el
invierno)
Ahorro de agua de las boquillas serie U según pruebas del fabricante. Las boquillas
giratorias utilizan de un 20 a un 30% menos de agua que los aspersores tradicionales
porque funcionan con índices inferiores de precipitación, una mayor uniformidad de
distribución y un radio superior de cobertura, según el Distrito Metropolitano de Agua
del Sur de California. También se ha observado un ahorro de un 22 a un 41% con este
UJQPEFCPRVJMMBTQVFEFDPOTVMUBSFMFTUVEJPDPNQMFUPFOIUUQXXXDVXDDPSH
[email protected]@[email protected],[email protected]@*[email protected]@
3
Según casos de estudio de organismos públicos de suministro de agua (Irvine Ranch
8BUFS%JTUSJDU4BOUB#ÈSCBSB#PVMEFS-POHNPOUZ(SFFOMZ
ZEFGBCSJDBOUFTEF
controladores de tipo ET.
4
2) Bombeo de líquidos además del agua fresca, según se indica en la Agencia de
protección ambiental de los EE.UU., a menos que la estación de bombeo esté
específicamente diseñada para hacer esto
3) Uso sin cloro u otros biocidas fuertes
4) Exposición a la electrólisis, erosión o abrasión
5) Presencia de gases o químicos destructivos
6) Exceso de voltaje o bajo voltaje
7) Pérdida o inversión de la fase eléctrica
8) Exposición a cortacircuitos por falta de energía entrante o protección de fusibles
9) Uso del panel de control como una forma de desconexión del servicio
10) Rayos u otros actos de la naturaleza.
'BMMBBMTFMMBSFMQBRVFUFEFCPNCBBNFOPTRVFEJDIBGBMMBPDVSSBEVSBOUFFM
arranque).
Los términos y condiciones mencionados anteriormente constituyen la Política de
satisfacción del cliente de Rain Bird. Rain Bird no ofrece ningún otro tipo de garantía
adicional con respecto al sistema de bombeo o sus componentes. Rain Bird no
efectúa ninguna garantía implícita correspondiente a la aptitud para un propósito
o comerciabilidad en particular del sistema de bombeo o sus componentes.
Los componentes fabricados por otros (según se establece en la Cotización de
la estación de bombeo) se cubren únicamente por y de acuerdo a la garantía,
si existiese, que brinda el fabricante. Rain Bird no debe ser responsable ante el
cliente o ningún otro individuo o entidad por cualquier responsabilidad, pérdida
o daño ocasionado, o presuntamente ocasionado, en forma directa o indirecta,
por el sistema de bombeo. Rain Bird no será responsable por daños o pérdida de
ganancias incidentales, consecuentes, colaterales o indirectos relacionados con las
operaciones comerciales del cliente, ni por aquellos ocasionados por los actos de
la naturaleza. En ningún caso y bajo ninguna circunstancia la responsabilidad de
Rain Bird debe exceder el precio neto de venta del sistema de bombeo de Rain Bird
Corporation.
Ahorros de agua confirmados en el Controlador del sensor de humedad del suelo y
en el Informe final de prueba de sensor de lluvia (17 de enero, 2010), llevado a cabo
por el Departamento de Ingeniería y Agricultura de la Universidad de Florida.
5
Bilderback, T.E. y M.A. Powell. Riego eficiente. North Carolina Extension Service,
OÞNFSPEFQVCMJDBDJØO"(NBS[PEFEFFOFSPEF3JFHP
eficiente).
6
El rotor 5000 PRS ha obtenido la certificación de Smart Approved WaterMark, un
programa australiano de certificación de ahorro de agua en exteriores para productos
que ayudan a reducir el consumo de agua fuera del hogar. Una comisión de pruebas
independiente confirmó que el rotor Rain Bird 5000 PRS proporciona un ahorro de
agua del 15% al 45% en comparación con rotores de la competencia sin regulación
de presión.
7
Las boquillas MPR de Rain Bird consumen 3.70 gpm versus 1.60 gpm de las boquillas
rotativas, lo cual significa un 60% menos de caudal.
8
Valores medios de ahorro de agua en varias instalaciones. Podrá encontrar
diferentes casos de estudio que verifican este ahorro de agua en el sitio web de LEED y
[email protected]
Las leyes pertinentes a las garantías y las exenciones de responsabilidad del
cliente varían de estado a estado;por consiguiente, es posible que algunas de las
limitaciones precedentes no se apliquen a usted.
V. Todos los otros productos: 1 año
Referencia
Para obtener mayor información, consulte a su distribuidor de Rain Bird. Para encontrar al
distribuidor autorizado más cercano en su área, visite www.rainbird.com o llame al 1-800-RAINBIRD
246
El uso inteligente del agua.™
Referencia
www.rainbird.com/reference
Índice
Índice
Cuadros de referencia de pérdida
de presión. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
Cuadros de referencia de pérdida
de presión. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 242
Cuencas recolectoras redondas . . . . . . . . . . 225
%FDPEJGJDBEPSFTEFEPTDBCMFT'%563' . 130
%FTDPEJGJDBEPSFTEFTFOTPSFTEFQVMTPT . .157
%JTQPTJUJWPEFFNJTJØOEFWBSJBTTBMJEBT
Xeri-Bird™ 8 . . . . . . . . . . . . . . . . . . . . . . . . . . . . .167
El sistema de riego de jardines y
mantenimiento remoto (LIMR) . . . . . . . . . 133
Emisores Xeri-Bug™ . . . . . . . . . . . . . . . . . . . . . . 164
Ensamble de manija violeta para válvula. . 108
Estaca galvanizada ara sujetar. . . . . . . . . . . . 188
&TUBDBQBSBUVCFSÓBEFžDPODVCJFSUB . . 176
Estaca para tubería universal de 1⁄4" . . . . . . 176
Estaca roscada para tubería de elevación .177
Estaciones meteorológicas WS-PRO. . . . . . 156
'JMUSPDBOBTUB2VJDL$IFDL . . . . . . . . . . . . . . . .201
'JMUSP3#:FOMÓOFB. . . . . . . . . . . . . . . . . . . . . . . . 200
'JMUSPSFHVMBEPSEFQSFTJØO3#:
. . . . . . . . . 199
'JMUSPTDBOBTUB2VJDL$IFDLSFHVMBEPSFT
de presión. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 203
'JMUSPTDBOBTUBSFHVMBEPSFTEFQSFTJØO . . . 202
'SFFEPNQBSBDPOUSPMDFOUSBMJ[BEP. . . . . . . 156
Garantías sin preocupaciones . . . . . . . . . . . . 245
Guía de especificación de estaciones de
bombeo para bombas de perfil
JOGFSJPSZ4FSJF%. . . . . . . . . . . . . . . . . . . . . . . . 243
Guía de especificación de estaciones de
CPNCFPQBSBCPNCBT-1Z4FSJF%. . . . . 244
Guía de referencia cruzada para boquillas
Rain Curtain™ . . . . . . . . . . . . . . . . . . . . . . . . . . . .75
Guía de selección de la pirámide del kit
de control de zona . . . . . . . . . . . . . . . . . . . . . 190
Guía de selección del kit de control
de zona en línea. . . . . . . . . . . . . . . . . . . . . . . . 190
Herramienta Xeriman™ . . . . . . . . . . . . . . . . . . 189
)0-%61500-IFSSBNJFOUBEFTPTUÏO
con nivel de burbuja . . . . . . . . . . . . . . . . . . . . .79
Indicador de funcionamiento para
sistemas de riego por goteo . . . . . . . . . . . . 183
interfaz Cluster Control Unit - CCU
(unidad de control de grupo). . . . . . . . . . . .151
Interfaz para decodificador de dos
DBCMFT-%*4%* . . . . . . . . . . . . . . . . . . . . . . . . . . 149
*OUFSGB[TBUFMJUBM58* . . . . . . . . . . . . . . . . . . . . . 149
,JUEFDPOUSPMEF[POBEFDBVEBMBMUPQBSB
aplicaciones comerciales con 2 filtros
canastareguladores de presión . . . . . . . . . .197
,JUEFDPOUSPMEF[POBQBSBBQMJDBDJPOFT
comerciales de caudal medio con filtro
canasta regulador de presión. . . . . . . . . . . 196
,JUEFSFFNQMB[PQBSBDPOWFSUJSBSJFHP
por goteo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 189
,JUEFWÈMWVMBEFBMJWJPEFBJSFWBDÓP . . . . . 183
,JUTEFDPOUSPMEF[POB. . . . . . . . . . . . . . . . . . . .191
,JUTEFDPOUSPMEF[POBEFDBVEBMCBKP
con filtro PR . . . . . . . . . . . . . . . . . . . . . . . . . . . . 192
,JUTEFDPOUSPMEF[POBEFDBVEBMCBKP
con válvula antisifón y filtro PR . . . . . . . . . 193
,JUTEFDPOUSPMEF[POBEFDBVEBMNFEJP
con filtro PR . . . . . . . . . . . . . . . . . . . . . . . . . . . . 194
,JUTEFDPOUSPMEF[POBEFDBVEBMNFEJP
con filtro PR, control de caudal . . . . . . . . . 194
,JUTEFDPOUSPMEF[POBEFDBVEBMNFEJP
con válvula antisifón y filtro PR . . . . . . . . . 193
,JUTEFDPOUSPMEF[POBQBSBBQMJDBDJPOFT
comerciales livianas de caudal medio
con filtro canasta con regulación de
presión . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 195
El uso inteligente del agua.™
,JUTEFSFKJMMBTDVBESBEBT . . . . . . . . . . . . . . . . . .227
Línea de riego por goteo en superficie
9'% . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 178
Línea de riego por goteo subterráneo
9'4DPOUFDOPMPHÓB$PQQFS4IJFME™ . . . . 180
Lista de contactos y recursos en línea
de Rain Bird . . . . . . . . . . . . . . . . . . . . . . . . . . . . 233
Llave Maxi-Paw® . . . . . . . . . . . . . . . . . . . . . . . . . . .76
Llave para tapa de seguridad . . . . . . . . . . . . .107
Llaves de válvulas . . . . . . . . . . . . . . . . . . . . . . . . .107
Maxicom2® . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150
Microaspersor Xeri-Pop™. . . . . . . . . . . . . . . . . 172
Modulos compensadores de presión . . . . 169
Módulos compensadores de presión . . . . 168
PA-8S-PRS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19
PA-80 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
Panorama general de un sistema de
Riego por goteo/Xerigation® . . . . . . . . . . . 162
Paquete de boquillas de sellado
reutilizable . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
Pedestales de controlador . . . . . . . . . . . . . . . 140
Placa de descarga a tierra MGP-1. . . . . . . . . 158
Planes de asistencia global para los
sistemas de control centralizado. . . . . . . . 159
Procedimiento para calcular el calibre
de los cables de la válvula . . . . . . . . . . . . . . 109
Procedimiento para calcular el calibre
de los cables de la válvula . . . . . . . . . . . . . . 110
Programa "Entrenado por la fábrica"
de Rain Bird . . . . . . . . . . . . . . . . . . . . . . . . . . . . 232
Programas de recompensas Rewards . . . . .231
Protección contra sobretensiones MSP-1. . . 158
134%JBM. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105
Radio de espectro ensanchado . . . . . . . . . . 155
Radio del rotor del cuadro de alcance y
regulación de presión . . . . . . . . . . . . . . . . . . . .50
Rain Check™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 140
Referencias para las páginas 2 a 6 . . . . . . . . 246
Regulador de presión de retroadaptación. . 204
Reguladores de presión en línea . . . . . . . . . 204
Rejillas cuadradas . . . . . . . . . . . . . . . . . . . . . . . . 226
Rejillas cuadradas de bajo perfil. . . . . . . . . . .227
Rejillas cuadradas de plástico . . . . . . . . . . . . 224
Rejillas cuadradas universales . . . . . . . . . . . . 225
Rejillas redondas de plástico . . . . . . . . . . . . . 223
Relés de arranque de bombas PSR,
PSRP y PSRPL. . . . . . . . . . . . . . . . . . . . . . . . . . . 213
Rendimiento de los módulos y
burbujeadores compensadores
de presión. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169
Resumen de uso de energía del controlador
de Rain Bird (con una válvula maestra) . .141
30503500- . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79
34%#&Y34%$&Y. . . . . . . . . . . . . . . . . . . . . . . 139
Sensor de lluvia RAINGAUGE . . . . . . . . . . . . 158
Sensor de viento"/&.0.&5&3. . . . . . . . . 158
Sensores de flujo y transmisores . . . . . . . . . 135
Sensores de lluvia yheladas inalámbricos
serie WR2. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .137
4FSJF#1+"%+ . . . . . . . . . . . . . . . . . . . . . . . . . . . .84
4FSJF"5/5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .85
Serie 1400. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47
Serie 1800®-PRS . . . . . . . . . . . . . . . . . . . . . . . . . . . .10
Serie 1800®-SAM . . . . . . . . . . . . . . . . . . . . . . . . . . .11
Serie 1800®-SAM-P45 . . . . . . . . . . . . . . . . . . . . . .12
Serie 1800®-SAM-PRS . . . . . . . . . . . . . . . . . . . . . .12
Serie 3504. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52
Serie 5000. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54
Serie 5500. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63
Serie 8005. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72
4FSJF"47' . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .90
4FSJF%7. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88
4FSJF%7' . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89
4FSJF'BMDPO¥ . . . . . . . . . . . . . . . . . . . . . . . . .67
Serie HV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .92
Serie LM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 219
Serie LMM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220
Serie modular ESP. . . . . . . . . . . . . . . . . . . . . . . . 123
Serie para aplicaciones de agua no
QPUBCMF3%™ . . . . . . . . . . . . . . . . . . . . . . . .16
Serie PGA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .94
4FSJF3%™'MPX4IJFME™. . . . . . . . . . . . . . .16
4FSJF3%™4".. . . . . . . . . . . . . . . . . . . . . . . .15
4FSJF3%™4".134 . . . . . . . . . . . . . . . . . . .15
Serie RWS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 114
Serie SA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112
Serie SH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107
Series PEB y PESB . . . . . . . . . . . . . . . . . . . . . . . . . .96
4FSJFT54+:54+134 . . . . . . . . . . . . . . . . . . . . . . . .78
Serie UNI-Spray™. . . . . . . . . . . . . . . . . . . . . . . . . . .17
Servicio al cliente . . . . . . . . . . . . . . . . . . . . . . . . 245
Sistema de accesorios de compresión
&BTZ'JU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 186
Sistema de control modular inteligente
&414.5. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124
Sistema de riego paisajístico por goteo
EFž . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .187
Sistemas en paquete para el control
de riego . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 154
SiteControl. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .147
4PGUXBSFEFDPOUSPMDFOUSBMJ[BEP*2™ v2.0 . 144
SPLICE-1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108
5BCMFSPTEFJOUFSGB[.BYJ. . . . . . . . . . . . . . . . . 158
5BQB¥/1 . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
5BQBEJGVTPSBDPODPNQFOTBDJØO
de presión. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 176
5BQBEJGVTPSBDPOUSBJOTFDUPT . . . . . . . . . . . . 176
5BQBTEJGVTPSBTDPODPNQFOTBDJØOEF
presión . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169
5BQØOQBSBUVCFSÓB . . . . . . . . . . . . . . . . . . . . . . . 188
5#04™ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .134
5FDOPMPHÓBEFCPRVJMMBT3BJO$VSUBJO™ . . . . .51
5VCFSÓBEFEJTUSJCVDJØO92EFh . . . . . . . 184
5VCFSÓBEFEJTUSJCVDJØO95 . . . . . . . . . . . 185
5VCFSÓBEFFMFWBDJØO1PMZ'MFYEF
(30.5 cm) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .177
5VCFSÓBEFSBZBTOFHSBT9#4. . . . . . . . . . . . . . 185
5VCFSÓBGMFYJCMFTFSJF419. . . . . . . . . . . . . . . . . 113
5VCFSÓBTFSJF9' . . . . . . . . . . . . . . . . . . . . . . . . . . 182
Unidad de programación del
EFDPEJGJDBEPS%16. . . . . . . . . . . . . . . . . .131
Uso Inteligente del Agua™ . . . . . . . . . . . . . . . 248
7ÈMWVMB+BS5PQ4FSJFT+57Z+57'. . . . . . . . . .91
Válvulas de acoplamiento rápido . . . . . . . . 106
Válvulas de caudal bajo . . . . . . . . . . . . . . . . . . 198
Válvulas de latón 300-BPE/300-BPES . . . . . 104
Válvulas de latón Serie B . . . . . . . . . . . . . . . . . 100
7ÈMWVMBTEFMBUØO4FSJF&'#$1 . . . . . . . . . . . 102
Válvulas retráctiles para drenaje. . . . . . . . . . 228
Válvulas serie PESB-R. . . . . . . . . . . . . . . . . . . . . . .98
Xeri-Bubblers™ . . . . . . . . . . . . . . . . . . . . . . . . . . . 173
Xeri-Bug™de varias salidas . . . . . . . . . . . . . . . . 166
Xeri-Caps™ para aspersores . . . . . . . . . . . . . . . 189
Xeri-Sprays™ y vaporizadores . . . . . . . . . . . . . 174
Xeri-Spray™¡5SVF4QSBZ . . . . . . . . . . . . . . 174
Referencia
"'%7"'%7. . . . . . . . . . . . . . . . . . 118
"%+# . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83
1+"%+5/5 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .86
"' . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .47
1800®&95. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
1800 PCS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19
1800® Serie. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
2045A Maxi-Paw™. . . . . . . . . . . . . . . . . . . . . . . . . .76
1+.BYJ#JSE™. . . . . . . . . . . . . . . . . . . . . . . . .81
A-8S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
A-8S-NP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .18
Accesorio de transferencia gris con
conectores en punta x rosca hembra
QBSBUVCFSÓBEF›wDN
. . . . . . . . . . . . 166
Accesorios de inserción para sistemas
EFSJFHPQPSHPUFP9FSJ'MFY. . . . . . . . . . . . 182
Accesorios de transferencia con
DPOFDUPSFTFOQVOUBEFž . . . . . . . . . . . . . 188
Adaptador 1800 Xeri-Bubbler . . . . . . . . . . . . .177
Adaptador de inserción del sistema de
SJFHPQPSHPUFPTFSJF9'QBSB17$EF
DN
›DN
PNÈTHSBOEF . . . . 183
Adaptador de rosca 10-32. . . . . . . . . . . . . . . . .177
Adaptadores y accesorios para rejillas . . . . 229
Anatomía de un sistema de riego
con agua no potable . . . . . . . . . . . . . . . . . . . . . . 6
Asistencia técnica . . . . . . . . . . . . . . . . . . . . . . . . 234
"TQFSTPSFTTFSJF3%™. . . . . . . . . . . . . . . . . .13
#PRVJMMBTEFQBUSØODVBESBEPTFSJF42 . . . .28
Boquillas giratorias. . . . . . . . . . . . . . . . . . . . . . . . .42
Boquillas plásticas MPR . . . . . . . . . . . . . . . . . . . .23
Boquillas plásticas Serie U. . . . . . . . . . . . . . . . . .30
Boquillas Serie 5000 MPR . . . . . . . . . . . . . . . . . .61
Boquillas serie HE-VAN . . . . . . . . . . . . . . . . . . . . .38
Boquillas serie R-VAN . . . . . . . . . . . . . . . . . . . . . .45
Boquillas serie VAN. . . . . . . . . . . . . . . . . . . . . . . . .34
Cable flexible de conexión . . . . . . . . . . . . . . . .141
Cajas de válvulas Serie VB . . . . . . . . . . . . . . . . 116
Caja subterránea para emisor . . . . . . . . . . . . 188
Calculadores de ahorro de agua
en línea. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79
Calibre de los cables de las válvulas
residenciales . . . . . . . . . . . . . . . . . . . . . . . . . . . . .93
Cartucho de comunicaciones de
SFE*2/$$ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 146
$BSUVDIP&5.BOBHFS™ . . . . . . . . . . . . . . . . . . 132
$BSUVDIP1#$-9%EFSFTQBMEPEF
QSPHSBNBDJØOQBSB&41-9%. . . . . . . . . . . . 129
Categoría de nuevos productos.
La misma dureza.. . . . . . . . . . . . . . . . . . . . . . . 222
Color, tamaño y estilo son opcionales.
Los acoples flojos no lo son. . . . . . . . . . . . . 222
Cómo usar este catálogo. . . . . . . . . . . . . . . . . 234
$POFDUPSBVUPQFSGPSBOUFEFž. . . . . . . . . . . 166
$POFDUPSEFTBMJEBT&.5XERI . . . . . . . 166
$POFDUPSEFDBCMFTTFSJF%# . . . . . . . . . . . . . .141
Conectores de punta en espiral
de la Serie SB . . . . . . . . . . . . . . . . . . . . . . . . . . . 113
Conjunto de tubería de elevación
EF1PMZ'MFYZBEBQUBEPS . . . . . . . . . . . . . . . . .177
Conjunto de tubería de elevación de
1PMZ'MFYZFTUBDB . . . . . . . . . . . . . . . . . . . . . . . .177
$POUSPMBEPSEFTBUÏMJUF&414"5. . . . . . . . . . 152
$POUSPMBEPSEFTBUÏMJUF&414J5&4"5. . . . . 153
Controladores de la serie ESP-Me . . . . . . . . 122
$POUSPMBEPS&41-9%DPOEFDPEJGJDBEPS . 128
Controlador ESP-LXME . . . . . . . . . . . . . . . . . . . 126
$POUSPMBEPSTFSJF&413;9 . . . . . . . . . . . . . . . .121
Cortador de tubería . . . . . . . . . . . . . . . . . . . . . . 188
247
Referencia
l uso inteligente del agua™
La eficiencia del agua puesta a su servicio
%VSBOUFNÈTEFB×PT3BJO#JSETFIBEFEJDBEPBMBVUJMJ[BDJØOEFMBHVBEFNBOFSBSFTQPOTBCMF-PMMBNBNPT5IF*OUFMMJHFOU6TFPG
Water™ (El uso inteligente del agua) y es la idea que está detrás de toda nuestra gama de productos, servicios, servicios de capacitación y
herramientas para el ahorro de agua. Gracias a estas soluciones, Rain Bird está mejor posicionado que ningún otro fabricante de sistemas de
riego para ayudarle a suministrar, diseñar, programar, aplicar y mantener el recurso más preciado del mundo.
Bueno para nuestro medio ambiente. Mejor aún para su economía.
La industria del riego está cambiando. Cada año, las restricciones al uso del agua son mayores. Los profesionales del riego poseen dos
opciones: adaptarse y prosperar... o quedarse atrás. Rain Bird, líder de la industria en sistemas de riego eficientes, puede ayudar a hacer crecer
su negocio.
Uso Inteligente del Agua™
FUENTE
Aprovechar suministros
poco utilizados, como
agua de pozos subterráneos, aguas grises y
negras, condensación de
aparatos de climatización
(HVAC) y agua de lluvia.
FUENTE
DISEÑAR
Crear jardines tan hermosos
como sustentables.
HERRAMIENTAS
MANTENER
Soluciones
CAPACITACIÓN
SERVICIOS
DISEÑAR
PROGRAMAR
APLICAR
Optimizar los tiempos, la
cantidad y la frecuencia del
riego aplicado al jardín con
los controles de gestión del
agua más avanzados.
Distribuir el agua en el jardín
de la manera más eficiente
posible.
PRODUCTOS
APLICAR
PROGRAMAR
MANTENER
Mantener cada elemento del
sistema para asegurar un
uso del agua eficiente y
accesible a largo plazo.
Referencia
No permita que su negocio se quede atrás.
Visite www.rainbird.com o contacte con su representante de ventas de Rain Bird.
248
El uso inteligente del agua.™
Hechos acerca del compromiso de Rain Bird con los
esfuerzos para apoyar el ahorro de agua
Rain Bird ha celebrado 12
cumbres sobre El uso inteligente
del agua™ desde 2004
Rain Bird presenta el concurso
de cinematografía sobre El uso
inteligente del agua™
tEn las cumbres se reúnen expertos en
agua, medio ambiente e industria verde
de todo el mundo para discutir estrategias
e iniciativas para el ahorro del agua en
exteriores
t%JSFDUPSFTZQSPGFTJPOBMFTEFMBJOEVTUSJB
verde están invitados a compartir sus
ideas sobre el uso responsable del agua
mediante el poderoso medio del cine
tRain Bird ha publicado cuatro libros blancos
en los que se examina la crisis global del
agua y se exploran las posibles soluciones
tLas primeras presentaciones de cortos (de
1 a 10 minutos de duración) son exhibidas
en un evento de proyección especial en LA
tLos libros blancos están disponibles
gratuitamente en: http://www.rainbird.com/
corporate/IUOW/whitepapers.htm
tLos ganadores reciben premios en efectivo
tRain Bird ha publicado dos programas
educativos para estudiantes de primaria y
sus docentes sobre el ahorro de agua
tSitios de las cumbres pasadas: California;
"SJ[POB8BTIJOHUPO%$'SBODJB&TQB×B
Australia
tVea las medidas de la cumbre pasada (a
USBWÏTEFMWJEFPZEFMPT1%'
FOFMTJUJP
http://www.rainbird.com/corporate/IUOW/
summits.htm
tPara ver las entradas de los ganadores
anteriores, visite: http://www.iuowfilm.com
Rain Bird educa a nuestra
industria y a nuestras
comunidades sobre el ahorro
del agua
tLos programas están disponible
gratuitamente en: http://www.rainbird.com/
corporate/IUOW/education.htm
Los premios al Uso inteligente
del agua™ de Rain Bird
conceden becas para estimular
la conservación de agua en
exteriores.
tEl programa de becas interactivo otorga
fondos para proyectos de conservación
de agua y sustentabilidad ambiental que
promueven la conservación de agua y
espacios verdes en comunidades de todo
el mundo.
tPara obtener más información, visite
http://IUOWAwards.com.
Rain Bird patrocina el Día
Nacional de los Jardines Públicos
tEn colaboración con la Asociación de
+BSEJOFT1ÞCMJDPTEF&TUBEPT6OJEPT"1("
Rain Bird intenta aumentar la concienciación
acerca del papel que juegan los jardines
botánicos, los arboretos, los conservatorios y
los jardines zoológicos como representantes
del medio ambiente
t&MQPSUBWP[OBDJPOBM1BVM+BNFTQSFTFOUBEPS
EFMQSPHSBNBEF)(57(BSEFOJOHCZUIF
:BSE
MMFWBBDBCPFOUSFWJTUBTRVFTFEJWVMHBO
en prensa, televisión, radio y en Internet
desde todo el país, y presenta campañas de
difusión de interés público para televisión
y radio poniendo énfasis en las actividades
educativas de los jardines públicos sobre la
gestión de las plantas y el ahorro de agua
tSe celebra el viernes anterior al día de las
madres
tPara obtener más información, visite http://
nationalpublicgardensday.org.
El uso inteligente del agua.™
En Rain Bird, estamos convencidos de que nuestra
responsabilidad es desarrollar productos y
tecnologías que utilicen el agua de manera eficaz.
Además, nuestro compromiso se extiende a la
educación, la capacitación y los servicios para
nuestras industrias y comunidades.
La importancia del ahorro de agua nunca ha sido
mayor. Queremos hacer aun más. Con su ayuda,
podemos lograrlo. Para obtener más información
sobre El uso inteligente del agua™, visite
www.rainbird.com
Rain Bird Corporation
6991 E. Southpoint Road
5VDTPO";
5FMÏGPOP
'BY
Rain Bird Corporation
970 West Sierra Madre Avenue
Azusa, CA 91702
5FMÏGPOP
'BY
Rain Bird International, Inc.
1000 West Sierra Madre
Azusa, CA 91702
5FMÏGPOP
'BY
Servicio técnico de Rain Bird
3"*/#*3%
(EE. UU. y Canadá)
Línea directa de especificaciones
800-458-3005 (EE. UU. y Canadá)
www.rainbird.com
Impreso en papel reciclado.
® Marca registrada de Rain Bird Corporation
© 2013 Rain Bird Corporation 1/13
%%

Similar documents