2015 Rawlings Spring Catalog

Comments

Transcription

2015 Rawlings Spring Catalog
2015 BASEBALL COLLECTION
DEREK JETER
OM
INGS.C
RAWL
MANNY MACHADO
BRYCE HARPER
DEREK JETER´S FINAL SEASON
(IVIO.IXIV[MPPJSVIZIVHIƙRIEKIRIVEXMSRSJFEWIFEPPKVIEXRIWW(VEJXIHF]XLI2I[=SVO=EROIIWŽSYXSJLMKLWGLSSPMR
.IXIVLEWFIIRTEVXSJXLI6E[PMRKWJEQMP][IPPFIJSVILMWƙVWXHE]WHSRRMRKXLIJEFPIH=EROIITMRWXVMTIW8LVSYKLSYXLMWMPPYWXVMSYW
]IEVGEVIIV.IXIVTIVWSRMƙIHXLI6E[PMRKW&VERHXLVSYKLLMWLIVSMGWSRXLIƙIPHERHLMWGSQQYRMX]IJJSVXWSJJSJMX
*VSQEXEPIRXWXERHTSMRX.IXIVMWSRISJXLIXSTTPE]IVWSJLMWKIRIVEXMSRERHSRISJXLIQSWXHIGSVEXIHWLSVXWXSTWSJEPPXMQI
8LIXMQI%PP7XEVERHXMQI6E[PMRKW+SPH+PSZI%[EVH®[MRRIVŠ'ETXEMR'PYXGLšHIPMZIVIHXMQIERHXMQIEKEMRIWTIGMEPP]MRXLI
TSWXWIEWSRPIEHMRKXLI=EROIIW®XSƙZI;SVPH7IVMIWŽXMXPIW
,MKLPMKLXVIIPW[MPPJSVIZIVWLS[GEWI.IXIVERH6E[PMRKW463(.GVSWWMRK3EOPERHŞWMRƙIPHHYVMRKXLI%0(7ŽXSGYXSJJERHXLIRFEGOLERHƚMT
XLIVIPE]XSREF.IVIQ]+MEQFMEXXLITPEXISVLMWSZIVXLIWLSYPHIVGEXGLMRXSXLIWXERHWEKEMRWXXLIVMZEP&SWXSR6IH7S\®
.IXIVŞWPIKEG]GIVXEMRP]MRGPYHIWRYQIVSYWSJJIRWMZIEGGSPEHIWMRGPYHMRKLMWQIQFIVWLMTMRXLILMXGPYFTYRGXYEXMRKXLIQMPIWXSRILMX[MXLE
LSQIVYRSJJSJ8EQTE&E]6E]W®EGI(EZMH4VMGIERHEGEVIIVTSWXWIEWSRFEXXMRKEZIVEKISJ
%WLIIRXIVWLMWƙREPWIEWSR(IVIO.IXIVERH6E[PMRKW[MPPEP[E]WFIPMROIHF]E[EVH[MRRMRK[IFKIQWERHERYRVMZEPIHGSQQMXQIRXXS[MRRMRK
6E[PMRKWWEPYXIWERHGIPIFVEXIW.IXIVŞWI\XVESVHMREV]GEVIIV[MXLXLIVIVIPIEWISJLMWMGSRMG463(.ERHXLIGSQQIQSVEXMZI
ERHPMQMXIHIHMXMSR463(.*7Š(.*MREP7IEWSRšKPSZIJIEXYVMRKEREZ]TMRWXVMTIH3ZEP6
PHOTO BY: TOM DIPACE
DEREK JETER´S ACCOMPLISHMENTS
HMENTS
• 1996 AL Rookie of the Year
• 2000 ML All-Star MVP
• 2000 AL Babe Ruth Award
• 2000 ML World Series™ MVP
• 2004-’06, ’09-’10 AL Rawlings Gold Glovee Award®
• 2006 & 2009 AL Hank Aaron Award
• 2009 ML Roberto Clemente Award
• 2010 ML Lou Gehrig Memorial Award
2013 RAWLINGS
GOLD GLOVE AWARD WINNERS
®
For more than 50 years, one of baseball’s greatest honors, the Rawlings Gold Glove Award®,
has been bestowed amongst the game’s greatest defensive athletes. Legends like
Brooks Robinson, Ozzie Smith and Johnny Bench have each earned their spot in this exclusive legion of winners.
Today, a new class of greats has emerged; a group that makes the spectacular look routine. Rawlings is proud
to recognize the superior skill, ability and determination required to be a Rawlings Gold Glove Award Winner.
R.A. DICKEY
P
ADAM WAINWRIGHT
SALVADOR PEREZ
C
YADIER MOLINA
ERIC HOSMER
1B
DUSTIN PEDROIA
2B
MANNY MACHADO
3B
J.J. HARDY
SS
ALEX GORDON
LF
ADAM JONES
CF
SHANE VICTORINO
RF
TORONTO BLUE JAYS®
KANSAS CITY ROYALS®
ST. LOUIS CARDINALS®
KANSAS CITY ROYALS®
PAUL GOLDSCHMIDT
ARIZONA DIAMONDBACKS®
BOSTON RED SOX®
BRANDON PHILLIPS
CINCINNATI REDS®
BALTIMORE ORIOLES®
NOLAN ARENADO
COLORADO ROCKIES®
BALTIMORE ORIOLES®
ANDRELTON SIMMONS
ATLANTA BRAVES®
KANSAS CITY ROYALS®
CARLOS GONZALEZ
COLORADO ROCKIES®
BALTIMORE ORIOLES®
BOSTON RED SOX®
ST. LOUIS CARDINALS®
CARLOS GOMEZ
MILWAUKEE BREWERS®
GERARDO PARRA
ARIZONA DIAMONDBACKS®
: DENOTES RAWLINGS ADVISORY STAFF
WILLIE MAYS - HOF • 2013 RAWLINGS LIFETIME ACHIEVEMENT AWARD
2013 PRESENTATION CEREMONY
R.A. DICKEY
MANNY MACHADO
NOLAN ARENADO
J.J. HARDY
JOHNNY BENCH - HOF • PRESENTER
BROOKS ROBINSON - HOF • PRESENTER
JIM KAAT - HOF • PRESENTER
THE PLAZA . NEW YORK CITY . 11.8.13
ADAM JONES
CARLOS GOMEZ
ERIC HOSMER
ALEX GORDON
GOLD SPORT
COLLECTIBLES
Gold Sport Collectibles has partnered with Rawlings® – the leading baseball brand and exclusive supplier of baseballs to Major League Baseball®
to create this high-quality collectible that will undoubtedly surpass the expectations of baseball fans and collectors alike.
It is our shared vision to offer a truly innovative and quality product that will bring new enthusiasm to the baseball collector.
Why is this gold baseball so unique? It’s all in the leather…literally. 24-karat gold is artfully infused into the leather, which is then used to build the baseball to
precise Major League Baseball® standards. The process of infusing gold into leather is a unique nanotechnology known as Precious Surface®. The proprietary and
IRZMVSRQIRXEPP]JVMIRHP]TVSGIWWƙPPWXLIPIEXLIV[MXLOEVEXKSPH]IXPIEZIWXLIPIEXLIVJIIPMRKWSJXERHYRXVIEXIH9WMRKXLMWOEVEXPIEXLIVIEGLFEPPMW
XLIRFYMPXXSSJƙGMEP1ENSV0IEKYI®WTIGMƙGEXMSRWWXEQTIH[MXLERSJƙGMEPXIEQPSKSERHTPEGIHMRXSEZMZMHHMWTPE]GEWI
)ZIV]OEVEXFEWIFEPPMWFEGOIHF]ERSJƙGMEPGIVXMƙGEXMSRXLEX[MPPFIMRGPYHIH[MXLXLIƙRMWLIHTVSHYGXEWEHHIHEWWYVERGIXLEXIZIV]TVSHYGX[MPPPMZIYT
to Rawlings® and Major League Baseball® standards. Gold Sport Collectibles offers the 24-karat league standard ball with All-Star Game®, Home Run Derby
“MoneyBall”, World Series®, Regular Season and National and American League™ logos for fully customized purchase
options. The 24-karat Major League®FEWIFEPPMWXLIGSPPIGXSVŞWFEWIFEPPVIHIƙRIHEWEXVYIPY\YV]MXIQ[LMPIWXMPP
QEMRXEMRMRKXLIEYXLIRXMGMX]XLEXMWGLIVMWLIHF]XLIXVYIFEWIFEPPGSPPIGXSV8LMWQEVVMEKISJPY\YV]ERHEYXLIRXMGMX]
MWHYIXSSYVI\GPYWMZIMRJYWMSRXIGLRSPSK]QEOMRKXLMWMXIQEQYWXLEZIJSVRI[ERHWIEWSRIHGSPPIGXSVW
OFFICIAL BALL SUPPLIER
of MAJOR LEAGUE BASEBALL®
GOLD SPORT
COLLECTIBLES
Gold Sport Collectibles
855-465-3770
www.goldsportcollectibles.com
RAWLINGS.COM
OFFICIAL BALL SUPPLIER TO
MICHAEL
WACHA
JAMES
SHIELDS
TOMMY
HANSON
KRIS
MEDLEN
JIM
JOHNSON
TREVOR
ROSENTHAL
TIM
LINCECUM
JUSTIN
VERLANDER
KEVIN
CORREIA
KENLEY
JANSEN
GERRIT
COLE
WADE
MILEY
MAJOR LEAGUE BASEBALL
MARK
&9),60)
ROSS
DETWILER
®
CLIFF
LEE
JOSH
BECKETT
JOE
NATHAN
ADDISON
REED
ZACK
WHEELER
MADISON
&91+%62)6
R.A.
DICKEY
JOHN
LACKEY
STEVE
CISHEK
MAX
SCHERZER
Major League Baseball trademarks and copyrights are used with
permission of Major League Baseball Properties, Inc. Visit MLB.com.
THE OFFICIAL BATTING HELMET OF
YADIER
MOLINA
ALBERT
49.307
6977)00
MARTIN
KYLE
SEAGER
PRINCE
FIELDER
XANDER
BOGAERTS
TROY
8903;-8>/-
CHRIS
DAVIS
MIKE
13978%/%7
ADRIAN
GONZALEZ
JAYSON
WERTH
JOE
1%9)6
MAJOR LEAGUE BASEBALL
ALEX
GORDON
®
DEREK
JETER
ADRIAN
BELTRE
RYAN
ZIMMERMAN
MATT
WIETERS
MATT
KEMP
MICHAEL
'9((=)6
.978-2
94832
BILLY
HAMILTON
NICK
MARKAKIS
JACOBY
)007&96=
Major League Baseball trademarks and copyrights are used with
permission of Major League Baseball Properties, Inc. Visit MLB.com.
MANNY
MACHADO
LEGAL
RAWLINGS REGISTERED TRADEMARKS
5150®, Adirondack®, Basket Hinge®, Basket-Web®, Big Stick®, COOLFLO®,
CPT®, Deep Well®, Double Ca-Thud®, Fuel®, Gold Glove®, Gold Glove Award®,
Heart of the Hide®, Lite Toe®, MPH®, Oval R®, OPTI-FIT®, Pad Lock®, Playmaker®, Primo®, Pro Dri®, Pro Ring® and the Pro Ring Trade Dress, R®, Rawlings®,
Savage®, Superstitch®, Rawlings Gold Glove Award®, Rawlings Replay®, Red
Label Design®, S100®, SCI-FLY®, Silver Glove Award®, The Finest in the Field®,
“The Mark of a Pro”® and Trap-Eze®.
RAWLINGS TRADEMARKS
5-Tool Training™, Advanced Impact Management System™, AIMS™, All-American
Series™, Arsenal™, Basket Connector Web™, The Bull Series™, Caliber™, Champion Series™, Comebacker™, Comp-Lite™, Consistent Composite Compaction™,
Core Bond™, Custom Player Technology™, Dual Core™, Dual Wing™, Dura-Plus™,
Dynamic Fit System™, Easy Break™, EIT™, Extra Innings Technology™, Fastback™,
Flex Loop Back™, Fly Trap Web™, FX™, Gamer™, GG Gamer™, Girls Rule™,
Glovolium™, Guante de Oro de Rawlings™, Heat Exchange™, Heritage™, Horizontal
Bar Web™, Instinct™, Interlock Web™, Lightning Light Technology™, Lightning
Series™, Low Rider™, Mach™, Maple Ace™, Mark of a Pro™, National Play Catch
Month™, National Play Catch with your Kids Month™, Nemesis™, Neo-Flex™,
Perma Print™, Plasma™, Plated™, Plated Plus™, Platinum Glove Award™, Player
Preferred™, Players Series™, Poly X™, pOp™, Pro Comp™, Pro Taper™, Precision Optimized Performance™, Pro Dri Plus™, Pro H™ Web, Pro I™ Web, Pro
Mesh™, Pro Preferred™, Quick Connect™, Quick Fit System™, Raptor™, Rawlings
Gold Glove Award Play of the Day™, Rawlings Performance Rating™, Rawlings
Platinum Glove Award™, Reduced Injury Factor™, Renegade Series™, REVO Solid
Core™, REVO Solid Core Technology™, Rhino™, RIF™, RPM™, Rush Gold™, Rush
Lite™, RX4™, S70™, S80™, S90™, Sandlot Series™, Savage™, Silverback Series™,
Solid Core™, Solid Core Technology™, Speed Cap™, Speed Trap™, SRG™, Strive™,
Superstitch™, Supertoe™, Sure Lock™, Tecton™, The Gold Glove Co.™, The Gold
Glove Company™, Titan™, Trio™, Triple Play Series™, Triumph™, The Mark of a
Pro™, Vapor™, Vaporfusion™, Velo™, Workhorse™, Wing Tip™, XV1™, Zero Shock™.
TRADEMARKS
AAU® is a registered trademark of the Amateur Athletic Union®; ABCA™ is a
trademark of the American Baseball Coaches Association; ASA® is a registered
trademark of the Amateur Softball Association®; Babe Ruth League® is a
registered trademark of Babe Ruth League®; BPA™ is a trademark of Baseball
Players Association, Inc.; Cal Ripken League® is a registered trademark of Babe
Ruth League®; Ripken Baseball® is a registered trademark of Ripken Baseball
Group; Dixie League® is a registered trademark of Dixie Youth Baseball; Dizzy
Dean Baseball® is a registered trademark of Dizzy Dean Baseball Inc.; ESPRO®
MWEVIKMWXIVIHXVEHIQEVOSJ)RZMVSRQIRXEP7TSVXW4VSHYGXW00'*PI\ƙXŽMW
EXVEHIQEVOSJ*PI\ƙX00'M4SHqMWEVIKMWXIVIHXVEHIQEVOSJ%TTPIq-RG
Kevlar® is a registered trademark of E.I. DuPont Nemours and Company; Little
League® is a registered trademark of Little League Baseball®; Lyrca® is a registered trademark of INVISTA; Major League Baseball®, MLB®, All-Star Game®,
World Series®, All-Star Home Run Derby®, National Association of Professional
Baseball Leagues® and MLB® teams are registered trademarks of Major League
Baseball®; Minor League Baseball® is a registered trademark of Minor League
Baseball®; NABF® is a registered trademark of the National Amateur Baseball
Federation®; NAIA® is a registered trademark of the National Association of
Intercollegiate Athletics®; Nations Baseball™ is a trademark of Nations Baseball
Tournament Association, LLC; NCAA® is a registered trademark of the National
Collegiate Athletic Association®; NFHS® is a registered trademark of the
National Federation of State High School Associations™; NJCAA® is a registered
trademark of the National Junior Collegiate Athletic Association®; NOCSAE® is
a registered trademark of The National Operating Committee on Standards for
Athletic Equipment®; NSA® is a registered trademark of the National Softball
Association®; Oiltac™ is a trademark of Pittards plc; OUTLAST® is a registered
trademark of Outlast Technologies, Inc.;
TRADEMARKS
Pittards® is a registered trademark of Pittards plc; Pony League® is a registered trademark of Pony League Baseball®; PORON® is a registered trademark,
and XRD™ is a trademark of the Rogers Corporation; USSSA® is a registered
trademark of the United States Specialty Sports Association™, Inc.; Velcro® is a
registered trademark of Velcro Industries B.V.®; 5-Tool Training™ is a trademark
of Rawlings Sporting Goods Company, Inc.; AAP® is a registered trademark of
the American Academy of Pediatrics; ASA® is a registered trademark of the
Amateur Softball Association of America®; Babe Ruth League® is a registered
trademark of Babe Ruth League®; Ban-Rol™ is a trademark of QST Industries
Inc.; Basket-Web® is a registered trademark of Rawlings Sporting Goods Company, Inc.; BPA® is a registered trademark of the Baseball Players Association®;
Chicago Bandits® is a registered trademark of Chicago Bandits, LLC; Club K® is a
registered trademark of the Club K and Company, Inc.; COOLMAX® is a registered
trademark of INVISTA; Core Bond™ is a trademark of Rawlings Sporting Goods
Company, Inc.; deBeer® is a registered trademark of deBeer; Dixie League® is a
registered trademark of Dixie Youth Baseball®; ESPN is a registered trademark
of ESPN, Inc.; ISA™ is a trademark of Independent Softball Association; ISC™ is a
trademark of the International Softball Congress™; ISF® is a registered trademark of the International Softball Federation®; Little League® is a registered
trademark of Little League Baseball®; LVSSA™ is a trademark of the Las Vegas
Senior Softball Association, Inc.™; Lycra® is a registered trademark of INVISTA;
NAIA® is a registered trademark of the National Association of Intercollegiate
Athletics®; NCAA® is a registered trademark of the National Collegiate Athletic
Association®; NFHS® is a registered trademark of the National Federation of
State High School Associations™; NOCSAE® is a registered trademark of The
National Operating Committee on Standards for Athletic Equipment®; NPF™ is
a trademark of National Pro Fastpitch™; NSA® is a registered trademark of the
National Softball Association®; OxiClean™ is a trademark of Church & Dwight
Co., Inc. (“C&D”); Poly X™ is a trademark of Rawlings Sporting Goods Company,
Inc.; PORON® is a registered trademark, and XRD™ is a trademark of the Rogers
Corporation; Pro H™ is a trademark of Rawlings Sporting Goods Company, Inc.;
Pro I™ is a trademark of Rawlings Sporting Goods Company, Inc.; Pro Dri® is a
VIKMWXIVIHXVEHIQEVOSJ6E[PMRKW7TSVXMRK+SSHW'SQTER]-RG8YJƚMXIqMWE
registered trademark of Rawlings Sporting Goods Company, Inc.; Safetgard™ is
a trademark of Safetgard Corporation; Sanotan® is a registered trademark of
Incusa; Shout® is a registered trademark of S.C. Johnson & Son, Inc; S.P.A.™ is
a trademark of the Softball Players Association™; SPN™ is a trademark of SloPitch National; SPO™ is a trademark of Slo-Pitch Ontario; SSUSA™ is a trademark
of Senior Softball-USA™; Superstitch™ is a trademark of Rawlings Sporting
Goods Company, Inc.; USA Softball® is a registered trademark of USA Softball;
USSSA® is a registered trademark of the United States Specialty Sports Association, Inc.™; Velcro® is a registered trademark of Velcro Industries B.V.®; VO2fx®
is a registered trademark of Lifestyle Medical Group, LLC; Women’s College World
7IVMIWqMWEVIKMWXIVIHXVEHIQEVOSJXLI3JƙGISJXLI'SQQMWWMSRIVSJ&EWIFEPP
The Major League Baseball® players pictured herein are
current endorsers of the Rawlings Sporting Goods Company.
Major League Baseball trademarks and copyrights are used
with permission of Major League Baseball Properties, Inc. Visit MLB.com;
©2014 Rawlings Sporting Goods Company, Inc., a subsidiary
of Jarden Corporation (NYSE:JAH)
GIANCARLO STANTON
GLOVES
14
HELMETS
46
BATS
56
BASEBALLS
70
PROTECTIVE
82
BATTING GLOVES
89
EQUIPMENT BAGS
90
TRAINING
92
CARL CRAWFORD
STOCK APPAREL
RAWLINGS® GLOVES
Led by the new Rawlings Gold Glove® line – the pinnacle of every
technological advancement Rawlings® created for the industry – Rawlings®
and its iconic red Patch symbolize greatness on the diamond.
For generations, pros ask for Rawlings®ERHMXWMGSRMGƙIPHIVWKPSZIWF]REQI
From 16-time Rawlings Gold Glove Award® winner Willie Mays and 13-time honoree
Ozzie Smith to reigning Rawlings Platinum Glove Award™ winner Manny Machado
and 2-time all-star and Rookie of the Year Bryce Harper, the greatest
players in the game choose Rawlings®ƙIPHIVWKPSZIW
more than all other brands combined*.
104
CUSTOM APPAREL
110
OUTERWEAR
124
APPAREL OPTIONS
128
RAWLINGS.COM
RAWLINGS
GOLD GLOVE
®
R E D E F I N E D
L E G E N D A R Y
P E R F E C T I O N
The new Rawlings Gold Glove
®
The culmination of 100 years of Rawlings’ glove-making craftsmanship, the new Rawlings Gold Glove series with
Opti-Core™ Technology delivers the ultimate in playability and feel, inspiring a new generation of defensive excellence.
CRAFTSMANSHIP
PERFORMANCE
LEGACY
FEATURES
Meticulously cut, assembled and sewn,
WXEVXXSƙRMWLF]EWMRKPIGVEJXWQER
all Rawlings Gold Gloves carry an
individual serial number signifying
the maker, the date created and the
glove’s production number.
At the heart of these
hand-crafted masterpieces is
Rawlings Opti-Core™ Technology
which allows for added layers of
pre-curved padding beneath the
palm to greater absorb the impact
at the moment of catch.
Inspired by the greatest glovemen
of all time – from legends like
Willie Mays to modern stars such
as Manny Machado – the Rawlings
Gold Glove Award® and the gold
trim patch exemplify the
most heralded defenders
in the game.
Flawless, European leather
famous for its supple feel and
HYVEFPIƙRMWLGSQFMRIH[MXL
special features like hand-sewn
welting and ultra-premium, luxury
palm lining comfortably completes
EƙXERHJIIPXLEXGERSRP]FI
described as custom.
RGG1275H
• 12 ¾"
• Pro H™ web
• Conventional back
MSRP: $700.00
14
(Reg/RH)
RGG1200
• 12"
• 2-piece solid web
• Conventional back
MSRP: $700.00
(Reg/RH)
RAWLINGS
GOLD GLOVE
®
RGG1175 (Reg/RH)
• 11 ¾"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $700.00
RGG2002
• 11 ½ "
• Pro I™ web
• Conventional back
MSRP: $700.00
(Reg only)
MANNY MACHADO
ADRIÁN BELTRÉ
RAWLINGS.COM
15
PRIMO
®
Two layers of the
ƙRIWX-XEPMERPIEXLIV[SVOMRXERHIQ
to create the ultimate precision-formed pocket built for
TIVJSVQERGI;MXLEƚE[PIWWETTIEVERGIEXMKLXKVEMRWXVYGXYVIEPY\YVMSYWP]
smooth feel and an extra layer of wool padding cushion, Primo® gloves feature Dual Core Technology
that helps you break in the glove for the position you play. Built to last, the Primo provides superior comfort and exquisite
style without losing function or durability, complete with an intensive hot-stuffed injection treatment for laces that repels water to ensure
structure throughout the life of your Primo.
A
B
ITALIAN LEATHER
Born in the Tuscany region of Italy,
European full-grain leather is marked by a
XMKLXKVEMRWXVYGXYVIEPPS[MRKJSVEƚE[PIWW
appearance. The third layer of Italian calf
lining (A) creates a luxuriously smooth feel
while the 100% wool padding adds an extra
layer of cushion. Now you can get comfort
without losing function.
PRM1275H
• 12 ¾"
• Pro H™ web
• Conventional back
MSRP: $610.00
(Reg/RH)
PRM1179 (Reg/RH)
• 11 ¾"
• 2-piece solid web
• Conventional back
MSRP: $610.00
16
C
UNPRECEDENTED QUALITY
Hand-sewn welting (B), which reverses the
way the glove is sewn together, eliminates
the conjoining leather piece that would
normally rub against your thumb and
hinder your hand movements. Further, the
unique oxblood color, debossed Rawlings
logos, and direct embroidery add a touch
SJWX]PIERHƙRIV]
PRM1200
00
• 12"
2"
• Basket-W
Basket-Web
et-Web®
• Conventional
Conv
onventional back
MSRP:
SRP: $610.00
DUAL CORE™ PERFORMANCE
(C) Upon ball impact, the inner palm and
lining adjust to the shape of the outer palm
in order to absorb the impact. The
TSWMXMSRWTIGMƙGFVIEOTSMRXWIREFPIXLI
glove to close naturally and easily giving
you the durability and function you need at
the moment of impact.
D
BUILT TO LAST
Primo leather and lacing (D) undergoes an
intensive hot-stuffed injection treatment
that repels water and ensures durability.
Additionally, the laces are tested to
100-pound tensile strength, creating a
shape that endures all conditions.
(Reg/RH)
PAUL GOLDSCHMIDT
PRIMO
®
PRM1150T
Reg/RH)
• 11 ½"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $610.00
ALEX GORDON
PRM1125
(Reg only)
• 11 ¼"
• Pro II™ web
• Conventional
nventional back
MSRP:
P: $610.00
J.J. HARDY
PRMFB
RMFB
(Reg/RH)
• 13"
• Single
ngle post, double bar web
• Conventional
nventional back
MSRP:
RP: $610.00
PRMCM
RMCM (Reg only)
• 32 1/2"
• 1-piece
piece closed web
• Conventional
nventional back
MSRP:
RP: $610.00
RAWLINGS.COM
17
PRO PREFERRED™
9XMPM^MRKXLIFIWX
patterns from the best pro players,
Pro Preferred™ gloves feature impeccable kip skin leather
XLEXFVIEOWMRXSWTIGMƙGTPE]MRKTVIJIVIRGIWJSVQMRKXLITIVJIGXTSGOIX
The high-performance sheepskin lining wicks moisture away, keeping the hand dry
for better control when players need it most.
FEATURES
• Modeled from authentic Rawlings Pro Patterns
• Made from supple full-grain kip skin leather
ť4VSTEHHMRKJSVTSGOIXJSVQEXMSRERHWLETIVIXIRXMSRJSVGYWXSQM^IHJIIP
30%
70%
FACTORY
• Pittards® performance sheepskin palm lining for superior comfort
• USA-tanned leather lacing for durability
TROY TULOWITZKI
PROS303-6BR (Reg/RH)
PROS27TMO (Reg/RH)
PROS12MTKB (Reg/RH)
P
PROS20BR (Reg/RH)
• 12 ¾"
• Pro H™ web
• Conventional back
MSRP: $475.00
• 12 ¾"
ť8VET)^I® web
• Fastback Design®
MSRP: $475.00
JACOBY ELLSBURY
• 12
12"
ť1
ť1SHMƙIH8VET)^I® web
Conventional back
•C
MSRP: $475.00
MS
PROS1175-4MO (Reg/RH)
P
18
• 11 ¾"
ť1SHMƙIH8VET)^I® web
ť1
•C
Conventional back
MS
MSRP: $475.00
• 12"
• Basket-Web®
• Conventional back
MSRP: $475.00
PROS1175-9MO (Reg/RH)
• 11 ¾"
• 2-piece solid web
• Conventional back
MSRP: $475.00
PLAYER
BREAK-IN
PRO PREFERRED
PR
REFERRE
ED™
PROS17ICBR (Reg only)
• 11 ¾"
• Pro I™ web
• Wing Tip™ Conventional
ventional back
MSRP: $475.00
0
TORII HUNTER
PROS15MTBR
5MTBR (Reg/RH)
• 11 ½"
ť1SHMƙIH8VET)^I
ƙIH8VET)^I® web
• Conventional
nventional back
MSRP: $475.00
PROS200-2MO (Reg only)
• 11 ½"
• Pro I™ web
• Conventional back
MSRP: $475.00
NOLAN ARENADO
• 11 ¼"
• Pro I™ web
• Conventional back
MSRP: $475.00
PROS12ICBR (Reg only)
PROSFMMO (Reg/RH)
• 13"
• Single post, double bar web
• Conventional back
MSRP: $475.00
PROSCM20BRX (Reg only)
PROSCM41MO (Reg only)
• 32 ½"
• 1-piece solid web
• Conventional back
MSRP: $475.00
• 34"
• 1-piece solid web
• Conventional back
MSRP: $475.00
RAWLINGS.COM
19
HEART OF THE HIDE
PLAYERS
FEATURES
The Heart of the
Hide players glove series features the
game-day patterns of the Rawlings Advisory staff. Available in
select Heart of the Hide®QSHIPWXLIWILMKLUYEPMX]KPSZIWLEZIHIƙRIHXLIGEVIIVW
of those deemed “The Finest in the Field®”, and are now available to elite athletes looking to join the next
class of defensive greats.
• World renowned Heart of the Hide® leather for unmatched durability
• Crafted from authentic Rawlings Pro Patterns
ť4VSHYGIHF]XLI[SVPHŞWƙRIWXKPSZIXIGLRMGMERW
PRO303HCBP (Reg/RH)
• 12 ¾"
• Pro H™ web
• Conventional back
• Same pattern worn by Adam Jones
MSRP: $320.00
PRONP5TLB (Reg only)
• 12"
• Pro I™ web
• Conventional back
• Same pattern worn by Adrian Beltre
MSRP: $320.00
®
30%
FACTORY
70%
PLAYER
BREAK-IN
ť7SJXJYPPKVEMRPIEXLIVTEPQERHƙRKIVFEGOPMRMRKWTVSZMHII\IQTPEV]GSQJSVX
• USA-tanned leather lacing for durability
PRO601JB (Reg/RH)
PRO12DHJB (Reg/RH)
• 12"
• Vertical hinge web
• Conventional back
ť7EQITEXXIVR[SVRF]1E\7GLIV^IV
MSRP: $320.00
PRO1175-6SLM (Reg only)
PRO1175-4JB (Reg/RH)
• 11 ¾"
ť1SHMƙIH8VETI^I® web
• Conventional back
• Same pattern worn by Glen Perkins
MSRP: $320.00
• 12 ¾"
ť8VET)^I® web
• Fastback® design
• Same pattern worn by Austin Jackson
MSRP: $320.00
• 11 ¾"
• Pro H™ web
ť'SRZIRXMSREPFEGO[MXLPMKLX[IMKLXTVSQIWLƙRKIVFEGOW
• Same pattern worn by Brandon Crawford
MSRP: $320.00
PRINCE FIELDER
PRO200-9JB (Reg/RH)
20
• 11 ½"
• 2-piece solid web
• Conventional back with hand stitched, reversed welting
• Same pattern worn by Jake Peavy
MSRP: $320.00
HEART OF THE HIDE
PLAYERS
®
PRO200-2BP (Reg only)
• 11 ½"
• Pro I™ web
• Conventional back
ť7EQITEXXIVR[SVRF]%PI\IM6EQMVI^
MSRP: $320.00
YADIER MOLINA
PRONP2JB (Reg only)
• 11 ¼"
• Pro I™ web
• Conventional back
• Same pattern worn by Jose Reyes
MSRP: $320.00
PROFM20B (Reg/RH)
• 12 ¼" First base mitt
ť1SHMƙIH4VS,Ž[IF
• Overlapping Fastback®
• Same pattern worn by Prince Fielder
MSRP: $320.00
PROSCM41JB-MOL (Reg only)
• 34"
• 1-piece closed web
• Conventional back with lightweight pro mesh
• Game day glove of Yadier Molina
MSRP: $320.00
PROCM43BP28 (Reg only)
• 34"
• 1-piece Solid web
• Conventional back
• Same pattern worn by Buster Posey
MSRP: $320.00
BUSTER POSEY
RAWLINGS.COM
21
HEART OF THE HIDE
DUAL CORE
®
Constructed
with USA Horween leather and
Rawlings-patented Dual Core™ technology, the Heart
of the Hide®(YEP'SVIƙIPHIVŞWKPSZIWEVIHIWMKRIH[MXLTSWMXMSRWTIGMƙG
FVIEOTSMRXWMRXLIKPSZITEXXIVRWSTPE]IVWGEREGLMIZIXSTPIZIPTIVJSVQERGIGYWXSQM^IHJSV
their defensive needs. Additionally, these gloves are specially-tanned for a softer feel, allowing for less break-in time.
FEATURES
70%
FACTORY
30%
PLAYER
BREAK-IN
• Crafted from authentic Rawlings Pro Patterns
ť4VSHYGIHF]XLI[SVPHŞWƙRIWXKPSZIXIGLRMGMERW
ť7SJXJYPPKVEMRPIEXLIVTEPQERHƙRKIVFEGOPMRMRKW
provide exemplary comfort
• USA tanned leather lacing for durability
PRO601DCB
• 12 ¾"
ť8VET)^I® web
• Fastback Design®
MSRP: $320.00
(Reg/RH)
PRO204DCB (Reg/RH)
• 11 ½"
ť0SSTIH1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $320.00
PRO202DCB
22
• 11 ½"
• Pro I™ web
• Conventional back
MSRP: $320.00
(Reg only)
PRO12MTDCB
• 12"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $320.00
PRO1175DCB
• 11 ¾"
• 2-piece solid web
• Conventional back
MSRP: $320.00
(Reg/RH)
(Reg/RH)
DEREK JETER
HEART OF THE HIDE
DUAL CORE
®
PRO88DCB (Reg only)
• 11 ¼"
• Pro “V” web
• Conventional back
MSRP: $320.00
PRODCTDCB (Reg/RH)
• 13"
• Single post, double bar web
• Conventional back
MSRP: $320.00
PROCM33DCB (Reg only)
• 33"
• 1-piece closed web
• Conventional back
MSRP: $320.00
HEART OF THE HIDE
DUAL CORE PRO TAPER
®
STARLING MARTE
BETTER FIT FOR YOUTH PLAYERS
WITH SMALLER HAND OPENINGS
Heart of the Hide® Dual Core Pro Taper™ models
JIEXYVIQSHMƙIHTVSTEXXIVRWWQEPPIVLERH
STIRMRKWPS[IVIHƙRKIVWXEPPWERH
JEGXSV]PIEXLIVFVIEOMRJSVEFIXXIVƙX
improved glove control and instant usage
for those young future stars starting
their careers.
6 ½"
OPENING
PRO112PT (Reg/RH)
JOSÉ REYES
• 11 ¼" Pro Taper design
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $320.00
PRO110PT (Reg only)
• 11" Pro Taper design
• Pro I™ web
• Conventional back
MSRP: $320.00
RAWLINGS.COM
23
HEART OF THE HIDE
PRO MESH™
RAGE
N AVE
O
R
E
HT
15% LIG
®
Heart of the Hide®
4VS1IWLŽƙIPHIVWKPSZIWEVIXLITIVJIGX
combination of weight and performance. Featuring
15% reduced weight on average, the Pro Mesh models allow for a quicker reaction
time to “turn two,” or to snag the hot-shot down the line all while maintaining
the durability and pro-performance quality of Heart of the Hide gloves.
FEATURES
• World renowned Heart of the Hide® leather
for unmatched durability
• Crafted from authentic Rawlings Pro Patterns
60%
FACTORY
ť4VSHYGIHF]XLI[SVPHŞWƙRIWXKPSZIXIGLRMGMERW
ť7SJXJYPPKVEMRPIEXLIVTEPQERHƙRKIVFEGOPMRMRKW
provide exemplary comfort
ADRIAN GONZALEZ
PRO12DM (Reg/RH)
• 12 ¾"
• Pro H™ web
• Conventional back
MSRP: $320.00
• 12"
• Basket-Web®
• Conventional back
MSRP: $320.00
PRO204DM (Reg/RH)
PROFM19MX (Reg/RH)
• 11 ½"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $320.00
• 13"
• Single post web
• Conventional back
MSRP: $320.00
PROJP20MX (Reg only)
24
PLAYER
BREAK-IN
CURTIS GRANDERSON
PRO302CVDM (Reg/RH)
40%
• 32 ½"
• 1-piece closed web
• Conventional back
MSRP: $320.00
HERITAGE™ PRO
70%
FACTORY
30%
PLAYER
This series combines Rawlings®LIVMXEKI[MXLETVSTPE]IVMRƚYIRGI)EGLQSHIPMW
HIWMKRIHJSVEWTIGMƙGTSWMXMSRSRXLIƙIPH[LMGLEPPS[WTPE]IVWXSTPE]EXXLIMVLMKLIWX
PIZIP9XMPM^MRKXLIQSWXTSTYPEVTEXXIVRWSJXSHE]ŞWKEQIXLIRI[,IVMXEKIŽ4VS7IVMIW
[MPPTVSQSXITPE]IVGSRƙHIRGIRSQEXXIV[LEXTSWMXMSRLIMWTPE]MRK
BREAK-IN
FEATURES
ť7SJXJYPPKVEMRPIEXLIVTEPQERHƙRKIVFEGOPMRMRKWGSQFMRI
for unmatched comfort
• USA-tanned leather lacing for durability
• Crafted from authentic Rawlings® Pro Patterns
• Pre oiled shell leather breaks-in to player preference
HP1275 (Reg/RH)
HP1200 (Reg/RH)
• 12 ¾"
• Pro H™ web
• Conventional back
MSRP: $220.00
• 12"
• Slanted Basket-Web®
• Conventional back
MSRP: $220.00
HP1175 (Reg/RH)
• 11 ¾"
ť0SSTIH1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $220.00
HP1150 (Reg only)
• 11 ½"
• Pro “I”™ web
• Conventional back
MSRP: $220.00
JOEY VOTTO
MARK TRUMBO
RAWLINGS.COM
25
GG GAMER™
SERIES
Rawlings®
pro patterns, pro grade laces,
and pro soft leather all work together in the
GG Gamer™ series. With a super-soft, game-ready feel and
JYPPKVEMRƙRKIVPMRMRKWXLIWIKPSZIWQEMRXEMRGSQJSVXERHJYRGXMSREPMX]
FEATURES
• Built to provide quick and easy break-in
• Soft, full-grain leather shell for game ready feel
• Authentic Rawlings®TSWMXMSRWTIGMƙGTVSTEXXIVRW
FACTORY
G12MTB (Reg/RH)
G20B (Reg/RH)
GNP5B (Reg only)
G204B (Reg/RH)
GNP2B (Reg only)
• 12"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $126.00
• 11 ½"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $126.00
BREAK-IN
• 12"
• Basket-Web®
• Conventional back
MSRP: $126.00
• 11 ¼"
• Pro “I"™ web
• Conventional back
MSRP: $126.00
ERIC HOSMER
GFBMB (Reg/RH)
26
• 12 ½"
• Single post web
• Conventional back
MSRP: $126.00
GCM325B (Reg/RH)
• 32 ½"
• 1-piece closed web
• Conventional back
MSRP: $126.00
10%
PLAYER
ť0IEXLIVTEPQERHMRHI\ƙRKIVTEHWHMQMRMWLIWFEPPMQTEGX
• USA-tanned leather lacing for durability
G601B (Reg/RH)
• 12 ¾"
ť8VET)^I® web
• Fastback Design®
MSRP: $126.00
• 11 ¾"
• Pro “I"™ web
• Conventional back
MSRP: $126.00
90%
6 ½"
OPENING
BETTER FIT FOR YOUTH PLAYERS WITH SMALLER HAND OPENINGS
8LI+++EQIV4VS8ETIVŽQSHIPWJIEXYVIQSHMƙIHTVSTEXXIVRW
WQEPPIVLERHSTIRMRKWPS[IVIHƙRKIVWXEPPWERHJEGXSV]
FVIEOMRJSVEFIXXIVƙXMQTVSZIHKPSZIGSRXVSPJSVXLSWI
young future stars starting their careers.
FEATURES
• Built to provide quick and easy break-in
• Soft, full-grain leather shell for game ready feel
G1225PT (Reg/RH)
• 12 ¼"
ť8VET)^I® web
• Fastback Design®
MSRP: $126.00
G1102PT (Reg only)
• 11"
• Pro “V” web
• Conventional back
MSRP: $126.00
GFMPT (Reg/RH)
• 12"
• Single post web
• Conventional back
MSRP: $126.00
G1150PT (Reg/RH)
• 11 ½"
• Basket-Web®
• Conventional back
MSRP: $126.00
G95XT (Reg only) -TRAINING
GG GAMER™
PRO TAPER™ SERIES
• Authentic Rawlings®TSWMXMSRWTIGMƙGTVSTEXXIVRW
ť0IEXLIVTEPQERHMRHI\ƙRKIVTEHWHMQMRMWLIWFEPPMQTEGX
• USA-tanned leather lacing for durability
G1125PT (Reg/RH)
• 11 ¼"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $126.00
ADAM JONES
• 9 ½"
• Single-post web / Semi-conventional back
• Training glove
MSRP: $96.00
GCMPT (Reg only)
• 32"
• 1-piece closed web
• Conventional back
MSRP: $126.00
RAWLINGS.COM
27
PRO SHOP
PROGRAM
Welcome to the revamped and expanded Rawlings®4VS7LST[LIVI]SYGERGVIEXIERHGYWXSQM^I]SYVKPSZINYWXPMOI
Rawlings® Advisory Staff players do. With more styles, patterns and colors – including the new Bryce Harper BH34 Collection
the Rawlings®4VS7LSTTVSZMHIWTPE]IVWERHJERWSJEPPEKIW[MXLXLISTTSVXYRMX]XSHIWMKRXLIMVƙIPHIVWŞKPSZIWXS
VIƚIGXXLIMVYRMUYITIVWSREPWX]PISVXLII\EGXQSHIPSJXLIMVJEZSVMXITPE]IVW
PROHARP34S (Reg/RH)
PROHARP34SN (Reg/RH)
GGHARP34S (Reg/RH)
PRO204NSLE (Reg/RH)
• 12 ¾” Heart of Hide® leather
• Pro H™ web
• Conventional back
• Same pattern worn by Bryce Harper
MSRP: $320.00
• 12 ¾” Gamer leather
• Pro H™ web
• Conventional back
• Same pattern worn by Bryce Harper
MSRP: $140.00
28
• 12 ¾”
• Pro H™ web
• Conventional back
• Same pattern worn by Bryce Harper
MSRP: $320.00
• 11 ½"
ť1SHMƙIH8VETI^I® web
• Conventional back
MSRP: $320.00
BRYCE HARPER
PERSONALIZED
PRO PROGRAM
PRIMO®
PAGE 16-17
PRO PREFERRED™
PAGE 18-19
3RP]4IVWSREPM^EXMSRSTXMSR'LEVEGXIVW
in Beige may be embroidered on thumb
HEART of the HIDE®
DUAL CORE™
PAGE 22-23
HEART of the HIDE®
PLAYERS
PAGE 20-21
GG GAMER™
PAGE 26-27
HEART of the HIDE®
PRO MESH™
PAGE 24
YOU CHOOSE
1) GLOVE
GLO SERIES and MODEL NUMBER:
Primo®
Pro Preferred™
Heart of the Hide® Players
Heart of the Hide® Dual Core™
Heart of the Hide® Pro Mesh™
GG Gamer™
HAND:
2) HA
4) SPECIFY EMBROIDERY
a) CHOOSE STYLE: SCRIPT OR BLOCK
7GVMTX*MVWXPIXXIVGETMXEPM^IHVIQEMRMRKPS[IVGEWI
Block - UPPER/lower case available, PLUS #, @, apostrophe (’),
period (.)
b) CHOOSE EMBROIDERY THREAD COLOR
Beige, Brown, Black, Camel (matches camel lace), Columbia Blue,
Copper (matches JTanHK lace), Dark Green, Gold, Gold Tan, Navy,
Orange, Pink, Primo Sherry, Purple, Red Orange, Royal, Scarlet, Silver,
Vegas Gold, White
Throws right or throws left
LACE COLOR:
3) LA
Black, Columbia Blue, Camel, Chocolate Brown, Dark Green, Gold Tan
Gray, Tan (HTan), Dark Tan (JTanHK), Maroon, Navy, Orange, Pink,
Purple, Red Orange, Royal, Scarlet, White, Yellow
(Does not apply to Primo)
G'39286=78%8)*0%+7SRMRHI\ƙRKIV97%'EREHE
Dominican Republic, Japan, Mexico, Puerto Rico or Texas
See website for more options.
(Not available on Primo or Heart of the Hide Pro Mesh)
d) NAME, NICKNAME, PLAYER NUMBER: Name limited to 15 letters,
numbers or spaces: (thumb location only)
NAME LIMITED TO 15 LETTERS, NUMBERS, OR SPACES
U
_P
_ _ T_ O
_ _ 1_ 5_ _ S_ P_ A
_C
_ E_ S
_
Rawlings reserves the right to refuse or cancel orders for any reason.
No cancellations on approved orders will be accepted.
RAWLINGS.COM
29
CUSTOM GLOVE
PRO SHOP PROGRAM
2) CHOOSE YOUR HAND
1) CHOOSE YOUR LEATHER
1a) Pro Preferred™
1b) Heart of the Hide®
1a)
2a) Throws right
2b) Throws left
1b)
2a)
2b)
3) CHOOSE SIZE, PATTERN & WEB:
E+PSZIWM^IERHGSVVIWTSRHMRKQSHIPF*EWXFEGOŽSV'SRZIRXMSREPFEGOG;IFWX]PI
FIELDERS GLOVES
GLOVE
SIZE
Fastback™
Pattern
12 ¾"
12 ¾"
12 ¾"
12 ¾"
12 ½"
12 ½"
12 ½"
PRO601
12 ¼"
12"
12"
11 ¾"
11 ¾"
11 ½"
11 ½"
11 ½"
11 ½"
11 ¼"
11 ¼"
11 ¼"
11"
Conventional
Pattern
Single
Post
Pro I™
BasketWeb®
Modified
Trap-Eze®
Single Post
Double Bar
Pro H™
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
PRO303
PRO302
PRO302CV
PRO502
PRO504
PROJD7
PRO1000
PRO200
PRO200
PRONP5
PRO200
PRO200
PRO200
PRODJ2
PRONP4
PRO88
PRONP2
PRO217
PROSC47
✓
V-web
1-piece
Solid
2-piece
Solid
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
FIRST BASE MITTS
Gameday glove of
EDWIN ENCARNACION
Glove
SIZE
13"
13"
12 ¾"
12 ½"
12 ¼"
12"
30
Fastback™
Pattern
Conventional
Pattern
PROFM19
PRODCT
PROCMHCB2
PROFM18
PROFM20XL
PROTM
Single
Post Double
Bar / Base
Modified
Pro H™
✓
✓
Horizontal
Double Bar
✓
✓
✓
✓
✓
✓
✓
✓
COMMENTS
(Position, POCKET DEPTH)
First Base, DEEP
First Base, DEEP
First Base, DEEP
First Base, DEEP
First Base, DEEP
First Base, DEEP
CUSTOM GLOVE
PRO SHOP PROGRAM
Gameday glove of
GIANCARLO STANTON
GLOVE
SIZE
12 ¾"
12 ¾"
12 ¾"
12 ¾"
12 ½"
12 ½"
12 ½"
12 ¼"
12"
12"
11 ¾"
11 ¾"
11 ½"
11 ½"
11 ½"
11 ½"
11 ¼"
11 ¼"
11 ¼"
11"
Basket
Connector
Web™
Vertical
Hinge
Modified
Single Post
Vertical
Hinge
Basket
Modified
Trap-Eze®
with loops
Y-Post
Trap-Eze®
web
COMMENTS
(Position, POCKET DEPTH, Gripping Style)
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
✓
Outfield, Pitcher, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
✓
Outfield, Pitcher, STANDARD, Thumb to Middle of 2nd & 3rd finger
Outfield, DEEP, Thumb to Little finger
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
✓
Pitcher, Infield, DEEP, Thumb & 3rd finger
✓
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
CATCHERS MITTS
Gameday glove of
RUSSELL MARTIN
Glove
SIZE
34"
33"
32 ½"
32 ½"
Fastback™
Pattern
Conventional
Pattern
1-Piece
Solid Web
COMMENTS
(Position, POCKET DEPTH)
PROCM41
PROCM33
✓
Catcher, DEEP
Catcher,DEEP
Catcher, STANDARD
Catcher, STANDARD
✓
✓
PROPL31
PROJP20
✓
RAWLINGS.COM
31
CUSTOM GLOVE
PRO SHOP PROGRAM
PRO PREFERRED
™
4) CUSTOMIZE YOUR GLOVE:
4a) Glove back:
Black, Camel, Brown (Bruciato), Dark Brown (Mocha) or Rich Tan
4b) Glove Palm:
Black, Camel, Brown (Bruciato), Dark Brown (Mocha) or Rich Tan
4c) Web Color:
Black, Camel, Brown (Bruciato), Dark Brown (Mocha) or Rich Tan
4d) Lace Color:
Black, Columbia Blue, Camel, Chocolate Brown, Dark Green, Gold Tan, Gray, Tan (HTan), Dark Tan (JTanHK) , Maroon,
Navy, Orange, Pink, Purple, Red Orange, Royal, Scarlet, White, Yellow
4e) Lining Color:
Sheepskin Black or Sheepskin Brown (Bruciato)
4f) Welting Color:
Black,Camel, Brown (Bruciato), Dark Brown (Mocha), Rich Tan, Dark Green, Gold Tan, Gray, Navy, Orange, Red Orange, Royal,
7GEVPIX8ER7LIVV]8MQFIVKPE^I'SPYQFME&PYI7ERHPSX;LMXI4MRO
4g) Binding Color:
Black,Camel, Brown (Bruciato), Dark Brown (Mocha), Rich Tan, Dark Green, Gold Tan, Gray, Navy, Orange, Red Orange, Royal,
7GEVPIX4VMQS7LIVV]8MQFIVKPE^I'SPYQFME&PYI7ERHPSX;LMXI4MRO
L8VMQ3TXMSR
&PEGO'EQIP&VS[R&VYGMEXS(EVO&VS[R1SGLE6MGL8ER'SRZIRXMSREPFEGOXVMQMRGPYHIWPMXXPIƙRKIVXLYQF[VMWX
*EWXFEGOŽXVMQMRGPYHIWPMXXPIƙRKIVXLYQF(VMRKFIPXWXVET
4i) Stitching Thread Color: OPTION 1: Tone on tone - matches leather color chosen in steps 4a - 4c
OPTION 2: Choose one of the following colors - Beige, Brown, Black, Columbia Blue, Dark Green, Ivory, Navy, Orange, Pink, Purple, Royal,
Scarlet, Silver, Vegas Gold, White
5) OPTIONS:
5a) Stamping:
F-RWMHI4EPQ4EH
G*MRKIV4EH
5d) Finger Hood:
5e) Sweatband:
6) PERSONALIZE:
6a) Thread Color:
6b) Embroidery Style:
6c) Add Number:
6d) Country/State Flag:
Gold, Silver or Indent
=IWSV2S-J]IWPIEXLIVTEHJSVƙIPHIVŞWKPSZIWPIEXLIVTEHSV<6(JSVQMXXW
=IWSV2S7TIGMJ]MRHI\SVQMHHPIƙRKIV
Color: Must match color(s) chosen in Step 4
Yes or No: If yes: Same as shell back color
Yes or No: Available in Black only (Only offered on conventional back models)
Beige, Brown, Black, Camel (matches camel lace), Columbia Blue, Copper (matches JTanHK lace),
Dark Green, Gold, Gold Tan, Navy, Orange, Pink, Primo Sherry, Purple, Red Orange, Royal,
Scarlet, Silver, Vegas Gold, White
Script *MVWXPIXXIVGETMXEPM^IHVIQEMRMRKPS[IVGEWI
BLOCK- UPPER/lower case available, PLUS #, @, apostrophe (’), period (.)
Yes or No: If yes, 0-99 (will replace Oval R®). White number on red background only.
Yes or No: If yes, USA, Canada, Dominican Republic, Japan, Mexico,
Puerto Rico or Texas. See website for more options.
NAME LIMITED TO 15 LETTERS, NUMBERS, OR SPACES
U
_P
_ _ T_ O
_ _ 1_ 5_ _ S_ P_ A
_C
_ E_ S
_
Rawlings reserves the right to refuse or cancel orders for any reason.
No cancellations on approved orders will be accepted.
PRO PREFERRED™ SHELL COLORS
BLACK
CAMEL
BROWN (BRUCIATO)
DARK BROWN
(MOCHA)
PRO PREFERRED™ LINING COLORS
RICH TAN
SHEEPSKIN
BLACK
SHEEPSKIN
BROWN (BRUCIATO)
PRO PREFERRED™ LACE COLORS
BLACK
COLUMBIA BLUE
CAMEL
CHOCOLATE BROWN
DARK GREEN
GOLD TAN
GRAY
TAN (HTan)
DARK TAN (JTanHK)
MAROON
NAVY
ORANGE
PINK
PURPLE
RED ORANGE
ROYAL
SCARLET
WHITE
YELLOW
32
CUSTOM GLOVE
PRO SHOP PROGRAM
HEART OF THE HIDE
®
4) CUSTOMIZE YOUR GLOVE:
4a) Glove back:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, JT Tan, Navy, Orange, Pink,
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8MQFIVKPE^I;LMXI
4b) Glove Palm:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, JT Tan, Navy, Orange, Pink,
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8MQFIVKPE^I;LMXI
4c) Web Color:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, JT Tan, Navy, Orange, Pink,
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8MQFIVKPE^I;LMXI
4d) Lace Color:
Black, Columbia Blue, Camel, Chocolate Brown, Dark Green, Gold Tan, Gray, Tan (HTan), Dark Tan (JTanHK), Maroon,
Navy, Orange, Pink, Purple, Red Orange, Royal, Scarlet, White, Yellow
4e) Lining Color:
Black or Dark Tan (JTan)
4f) Welting Color:
Black, Camel, Columbia Blue, Chocolate, Dark Green, Gray, Gold Tan, Navy, Orange, Pink, Red Orange, Royal, Sandlot, Scarlet,
4VMQS7LIVV]8ER8MQFIVKPE^I;LMXI
4g) Binding Color:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, Navy, Orange, Pink
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8ER8MQFIVKPE^I;LMXI
4h) Trim Option:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, Navy, Orange, Pink, Red Orange,
6S]EP7GEVPIX.88ER7ERHPSX4VMQS7LIVV]8MQFIVKPE^I;LMXI'SRZIRXMSREPFEGOXVMQMRGPYHIWPMXXPIƙRKIVXLYQF[VMWX
*EWXFEGOŽXVMQMRGPYHIWPMXXPIƙRKIVXLYQF(VMRKFIPXWXVET
4i) Stitching Thread Color: OPTION 1: Tone on tone - matches leather color chosen in steps 4a - 4c
OPTION 2: Choose one of the following colors - Beige, Brown, Black, Columbia Blue, Dark Green, Ivory, Navy, Orange, Pink, Purple, Royal,
Scarlet, Silver, Vegas Gold, White
5) OPTIONS:
5a) Stamping:
F-RWMHI4EPQ4EH
G*MRKIV4EH
Gold, Silver or Indent
=IWSV2S-J]IWPIEXLIVTEHJSVƙIPHIVŞWKPSZIWPIEXLIVTEHSV<6(JSVQMXXW
=IWSV2S7TIGMJ]MRHI\SVQMHHPIƙRKIV
Color: Must match color(s) chosen in Step 4
Yes or No: If yes: Same as shell back color
Yes or No: Available in Black only (Only offered on conventional back models)
5d) Finger Hood:
5e) Sweatband:
6) PERSONALIZE:
6a) Thread Color:
Beige, Brown, Black, Camel (matches camel lace), Columbia Blue, Copper (matches JTanHK lace),
Dark Green, Gold, Gold Tan, Navy, Orange, Pink, Primo Sherry, Purple, Red Orange, Royal, Scarlet, Silver, Vegas Gold, White
6b) Embroidery Style:
Script *MVWXPIXXIVGETMXEPM^IHVIQEMRMRKPS[IVGEWI
6c) Add Number:
6d) Country/State Flag:
BLOCK- UPPER/lower case available, PLUS #, @, apostrophe (’), period (.)
Yes or No: If yes, 0-99 (will replace Oval R®). White number on red background only.
Yes or No: If yes, USA, Canada, Dominican Republic, Japan, Mexico,
NAME LIMITED TO 15 LETTERS, NUMBERS, OR SPACES
Puerto Rico or Texas. See website for more options.
U
_P
_ _ T_ O
_ _ 1_ 5_ _ S_ P_ A
_C
_ E_ S
_
Rawlings reserves the right to refuse or cancel orders for any reason.
No cancellations on approved orders will be accepted.
HOH® SHELL COLORS
BLACK DRY
BLACK OILED
HOH® LINING COLORS
BLACK SOFT DUAL CORE
CAMEL
CHOCOLATE
COLUMBIA BLUE
BLACK
DARK GREEN
GOLD TAN
GRAY
JT TAN
NAVY
ORANGE
PINK
RED ORANGE
ROYAL
SANDLOT
SCARLET
PRIMO SHERRY
TIMBERGLAZE
DARK TAN (JTAN HK)
WHITE
HOH® LACE COLORS
BLACK
COLUMBIA BLUE
CAMEL
CHOCOLATE BROWN
DARK GREEN
GOLD TAN
GRAY
TAN (HTan)
DARK TAN (JTanHK)
MAROON
NAVY
ORANGE
PINK
PURPLE
RED ORANGE
ROYAL
SCARLET
WHITE
YELLOW
RAWLINGS.COM
33
PRO MESH™
PRO SHOP PROGRAM
2) CHOOSE YOUR HAND
1) CHOOSE YOUR LEATHER
1a) Pro Preferred™
1b) Heart of the Hide®
1a)
2a) Throws right
2b) Throws left
1b)
2a)
2b)
3) CHOOSE SIZE, PATTERN & WEB:
E+PSZIWM^IERHGSVVIWTSRHMRKQSHIPF*EWXFEGOŽSV'SRZIRXMSREPFEGOG;IFWX]PI
FIELDERS GLOVES
FIELDER
GLOVE
SIZE
Fastback™
Pattern
12 ¾"
12 ¾"
12 ¾"
12 ¾"
12"
11 ¾"
11 ¾"
11 ½"
11 ¼"
11"
PRO601
Conventional
Pattern
Single
Post
Pro I™
PRO303
PRO302
PRO302CV
PRO200
PRONP5
PRO200
PRO200
PRO217
PROSC47
Conventional
Pattern
1-Piece
Solid
34"
33"
32 ½"
13"
PROCM41
PROCM33
PROJP20
PROFM19
✓
Single Post
double bar
Single Post
Double Bar
Pro H™
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
V-web
2-piece
Solid
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
Modified
Pro H™
✓
✓
%PPƙVWXFEWIERH'EXGLIVŞWQMXXWEVISRP]EZEMPEFPI[MXLXLIMVWXSGO[IFWX]PI
✓
4) CHOOSE MESH BACK DESIGN:
POSITION
Catcher
Catcher
Catcher
First Base
4a) REGULAR MESH
Available Models:
PRO601, PR0303, PRO302,
PRO302CV, PRO200, PRONP5,
PRO217, PROSC47
4b) DECO MESH
Available Models:
PRO302CV,PRO200, PRONP5,
PRO217, PROCM41, PROCM33,
PROJP20, PROFM19
PRO PREFERRED™ PRO MESH™ CUSTOM OPTIONS STEPS 5-9: Mesh on back of glove is always Black
5) Shell Leather:
Black, Camel, Brown (Bruciato), Dark Brown (Mocha), Rich Tan - Web color same as shell color.
6) Lace Color:
Black, Columbia Blue, Camel, Chocolate Brown, Dark Green, Gold Tan, Gray, Tan (Htan), Dark Tan (JTanHK) , Maroon, Navy,
Orange, Pink, Purple, Red Orange, Royal, Scarlet, White, Yellow
7) Lining Color:
Sheepskin Black or Sheepskin Brown (Bruciato)
8) Welting Color:
Black,Camel, Brown (Bruciato), Dark Brown (Mocha), Rich Tan, Dark Green, Gold Tan, Gray, Navy, Orange, Red Orange,
6S]EP7GEVPIX8ER7LIVV]8MQFIVKPE^I'SPYQFME&PYI7ERHPSX;LMXI4MRO
9) Binding Color:
Black,Camel, Brown (Bruciato), Dark Brown (Mocha), Rich Tan, Dark Green, Gold Tan, Gray, Navy, Orange, Red Orange,
6S]EP7GEVPIX7LIVV]8MQFIVKPE^I'SPYQFME&PYI7ERHPSX;LMXI4MRO
HEART OF THE HIDE® PRO MESH™ CUSTOM OPTIONS STEPS 5-9: Mesh on back of glove is always Black
5) Shell Leather:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, JT Tan, Navy, Orange, Pink,
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8MQFIVKPE^I;LMXI;IFGSPSVWEQIEWWLIPPGSPSV
6) Lace Color:
Black, Columbia Blue, Camel, Chocolate Brown, Dark Green, Gold Tan, Gray, Tan (Htan), Dark Tan (JTanHK) , Maroon, Navy,
Orange, Pink, Primo Sherry, Purple, Red Orange, Royal, Scarlet, White, Yellow
7) Lining Color:
Black or Dark Tan (JTan)
8) Welting Color:
Black, Brown (Bruciato), Camel, Columbia Blue, Chocolate, Dark Green, Gray, Gold Tan, Dark Brown (Mocha), Navy, Orange, Pink,
6IH3VERKI6MGL8ER6S]EP7ERHPSX7GEVPIX4VMQS&YVKYRH]8ER8MQFIVKPE^I;LMXI
9) Binding Color:
Black Dry, Black Oiled, Black Soft Dual Core, Camel, Chocolate, Columbia Blue, Dark Green, Gold Tan, Gray, Navy, Orange, Pink
6IH3VERKI6S]EP7ERHPSX7GEVPIX4VMQS7LIVV]8ER8MQFIVKPE^I;LMXI
34
1-piece
Solid
✓
✓
✓
Modified
Trap-Eze®
✓
FIRST BASE & CATCHERS MITTS
Glove
SIZE
BasketWeb®
PRO MESH™
PRO SHOP PROGRAM
Gameday glove of
ALCIDES ESCOBAR
FIELDER
GLOVE
SIZE
Basket
Connector
Web™
12 ¾"
12 ¾"
12 ¾"
12 ¾"
12"
11 ¾"
11 ¾"
11 ½"
11 ¼"
11"
Vertical
Hinge
Modified
Single Post
Vertical
Hinge
Basket
Modified
Trap-Eze®
with loops
Y-Post
Trap-Eze®
web
COMMENTS
(Position, POCKET DEPTH, Gripping Style)
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
Outfield, DEEP, Thumb to Little finger
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Pitcher, Infield, DEEP, Thumb to 3rd finger
✓
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
✓
✓
Infield, STANDARD, Thumb to Middle of 2nd & 3rd finger
OPTIONS FOR BOTH PRO PREFERRED™ AND HEART of the HIDE®:
10) Stamping:
-RWMHI4EPQ4EH
*MRKIV4EH
13) Finger Hood:
14) Sweatband:
Gold, Silver or Indent
=IWSV2S-J]IWPIEXLIVTEHJSVƙIPHIVŞWKPSZIWPIEXLIVTEHSV<6(JSVQMXXW
=IWSV2S7TIGMJ]MRHI\SVQMHHPIƙRKIV[MPPFIWEQIGSPSVEWWLIPPPIEXLIV
Yes or No: If yes: Same as shell color
Yes or No: Available in Black only (Only offered on conventional back models)
PERSONALIZE:
15) Choose name and/or number to be embroidered on thumb only.
E)QFVSMHIV]7X]PI 7 GVMTX*MVWXPIXXIVGETMXEPM^IHVIQEMRMRKPS[IVGEWI
Block - UPPER/lower case available, PLUS #, @, apostrophe (’), period (.)
15b) Thread Color:
Beige, Brown, Black, Camel, Columbia Blue, Copper (matches JTanHK lace),
Dark Green, Gold, Gold Tan, Gray, Navy, Orange, Pink, Primo Sherry,
Purple, Red Orange, Royal, Scarlet, Silver, Tan, Vegas Gold, White
15c) Name:
Limited to 15 letters, numbers or space
NAME LIMITED TO 15 LETTERS, NUMBERS, OR SPACES
U
_P
_ _ T_ O
_ _ 1_ 5_ _ S_ P_ A
_C
_ E_ S
_
Rawlings reserves the right to refuse or cancel orders for any reason.
No cancellations on approved orders will be accepted.
PRO PREFERRED™ SHELL COLORS
BLACK
CAMEL
DARK BROWN (MOCHA)
RICH TAN
BROWN (BRUCIATO)
HOH® SHELL COLORS
BLACK DRY
BLACK OILED
BLACK SOFT DUAL CORE
CAMEL
CHOCOLATE
COLUMBIA BLUE
DARK GREEN
GOLD TAN
GRAY
JT TAN
NAVY
ORANGE
PINK
RED ORANGE
ROYAL
SANDLOT
SCARLET
PRIMO SHERRY
TIMBERGLAZE
WHITE
LINING COLORS
PRO PREFERRED™
SHEEPSKIN
BLACK
HEART OF THE HIDE®
SHEEPSKIN
BROWN (BRUCIATO)
BLACK
DARK TAN (JTTAN)
PRO MESH LACE COLORS
BLACK
COLUMBIA BLUE
CAMEL
CHOCOLATE BROWN
DARK GREEN
GOLD TAN
GRAY
TAN (HTan)
DARK TAN (JTanHK)
MAROON
NAVY
ORANGE
PINK
PURPLE
RED ORANGE
ROYAL
SCARLET
WHITE
YELLOW
RAWLINGS.COM
35
PREMIUM PRO
SERIES
The Solid Core™
technology features OPTI-FIT®, an
MRRSZEXMSRHIWMKRIHXSMQTVSZILS[XLIKPSZIƙXWXLILERH
resulting in enhanced grip, maximum command and optimal feel. Matched
[MXLEPEGIPIWWLIIPXLITMIGITEPQGSRWXVYGXMSRVIZSPYXMSRM^IWXLIXVEHMXMSREP[E]
and glove is assembled, providing the player with ultimate control.
FEATURES
• Soft, full-grain leather shell for game-ready feel
ť4EXIRXIH7SPMH'SVIŽ8IGLRSPSK]IRLERGIWŠƙXšŠJIIPšERHŠJYRGXMSRš
PPR1275 (Reg/RH)
• 12 ¾"
ť8VET)^I® web
• Fastback Design®
MSRP: $75.00
RYAN ZIMMERMAN
20%
FACTORY
PLAYER
BREAK-IN
ť7SPMH'SVIŽ8IGLRSPSK]GSRWXVYGXMSRIRLERGIWXLIƙXSJXLIKPSZITVSZMHMRK
maximum control
• Lace-less heel and palm provide better feel for the ball and effortless break-in
PPR1250 (Reg/RH)
• 12 ½"
• Pro H™ web
• Conventional back
MSRP: $75.00
PPR1200 (Reg/RH)
PPR1175 (Reg/RH)
• 11 ¾"
• 2-piece solid web
• Conventional back
MSRP: $75.00
PPR1150 (Reg/RH)
• 11 ½"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $75.00
• 12"
• Basket-Web®
• Conventional back
MSRP: $75.00
PPR1125 (Reg only)
36
80%
• 11 ¼"
• Pro I™ web
• Conventional back
MSRP: $75.00
90%
FACTORY
10%
PLAYER
RCS
SERIES
In a sport dominated by uniformity, the new Rawlings Custom Series (RCS) is perfect for players looking
XSMRGSVTSVEXIXLIMVTIVWSREPWX]PIMRXSXLIMVSRƙIPHKEQI*IEXYVMRKYRMUYITVSTEXXIVRWERHEZEVMIX]
of bold color options, RCS gloves are made of full-grain leather steer hide with rawhide lacing, creating a
durable, comfortable and fashionable look with game-ready feel and quick, effortless break-in.
BREAK-IN
FEATURES
• Full-grain leather shell for durability
ť'YWXSQM^IHPSSOGSQFMRIWTVSTEXXIVRW[MXLEZEVMIX]SJGSPSVSTXMSRW
• Strong durable leather lace for continued performance
RCS120S (Reg only)
ť4EPQERHMRHI\ƙRKIVTEHWHMQMRMWLFEPPMQTEGX
• Game ready feel for a quick and effortless break-in
• 12"
• Basket-Web®
• Fastback Design®
MSRP: $70.00
RCS175S (Reg only)
• 11 ¾"
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $70.00
RCS115S (Reg only)
• 11 ½"
• Pro I™ web
• Conventional back
MSRP: $70.00
RCS120NO (Reg only)
R
RCS175NO
(Reg
(Re
eg only)
RCS115NO (Reg only)
• 12"
• Basket-Web®
• Fastback Design®
MSRP:
SRP: $70.00
• 11 ¾"
®
ť
ť1SHMƙIH8VET)^I
webb
• Conventional back
M
MSRP:
$70.00
• 11 ½"
• Pro I™ web
• Conventional back
MSRP: $70.00
YOENIS CÉSPEDES
JASON HEYWARD
RAWLINGS.COM
RAWLIN
37
PLAYER PREFERRED
ADULT
Designed
for recreational players
of various ages and skill levels, the Rawlings
Player Preferred™ glove series features quality, full-grain oiled
leather shells and rawhide laces that require minimal break-in. With popular patterns
and styles for all positions, the Player Preferred series seamlessly covers youth leagues to baseball and
softball’s weekend warriors.
FEATURES
90%
10%
FACTORY
PLAYER
BREAK-IN
ť-QTVSZIHƙX[MXLTEXIRXIHLERHEHNYWXQIRXW
• Quick, easy break-in for a game ready feel
• Quality full grain leather for enhanced durability
• Strong durable leather lace for continued performance
CARLOS GOMEZ
P140 (Reg/RH)
• 14" Softball pattern
• Basket Web® with support strap
ť'YWXSQƙXEHNYWXEFPIRSRWPMTTYPPWXVETFEGO
MSRP: $68.00
P130H (Reg/RH)
• 13" Softball pattern
• Pro H™ web
• Conventional with Flex Loop Back™
MSRP: $68.00
P1
P125 (Reg/RH)
FINGER SHIFT
• 12 ½" Baseball/Softball pattern
• Ba
Basket Web®
• Co
Conventional with Flex Loop Back™
MSR
MSRP: $68.00
P1250FS (Reg/RH)
• 12 ½" Baseball/Softball pattern
ť1SHMƙIH8VET)^I® web
ť'SRZIRXMSREP[MXLƙRKIVWLMJXHIWMKR
MSRP: $68.00
P1
P120 (Reg/RH)
P1200FS (Reg/RH)
FINGER SHIFT
MARK TEIXEIRA
38
• 12
12" Baseball/Softball pattern
Basket Web®
• Ba
• Co
Conventional with Flex Loop Back™
MSR
MSRP: $68.00
• 12" Baseball/Softball pattern
• Basket Web®
ť'SRZIRXMSREP[MXLƙRKIVWLMJXHIWMKR
MSRP: $68.00
PLAYER PREFERRED™
YOUTH
P150MT (Reg/RH)
P150BF (Reg/RH)
P1100V (Reg only)
• 11" Youth pattern
• “V” web
• Conventional back
MSRP: $52.50
P1100B (Reg/RH)
• 11 ½" Youth pattern
ť1SHMƙIH8VET)^I® web
• Conventional back
MSRP: $57.00
• 11 ½" Youth pattern
• Basket Web®
• Fastback Design® with custom
ƙX:IPGVS® strap
MSRP: $57.00
• 11" Youth pattern
• Basket Web®
• Neo-Flex™ back with custom
ƙX:IPGVS® strap
MSRP: $52.50
PLAYER PREFERRED™
MITTS
RFBDCTSB (Reg/RH)
• 12 ½" First base mitt
• Single-post, double-bar web
• Conventional back
• Original Double Ca-Thud® design
MSRP: $85.00
RCM325SB (Reg/RH)
• 32 ½" Catcher’s mitt
• 1-piece closed web
• Conventional with Flex Loop Back™
MSRP: $75.00
RCM30SB (Reg/RH)
• 33" Catcher’s mitt
• 1-piece closed web
• Conventional back
MSRP: $70.00
RCM30TCB (Reg only)
• 33" Catcher’s mitt
• 1-piece closed web
• Conventional back
MSRP: $79.50
RCM315SB (Reg/RH)
• 31 ½" Youth Catcher’s mitt
• 1-piece closed web
• Fastback Design®[MXLƙRKIVLSSH
MSRP: $61.50
RAWLINGS.COM
39
RENEGADE™
SERIES
Game-ready
right off the shelf, the Renegade™ Series
delivers quality at an affordable price. Equipped with a
full-grain leather shell for durability and shape retention, the Renegade™ gloves
JIEXYVIEHIITƚI\MFPITSGOIXJSVFEWIFEPPSVWSJXFEPPYWI:IPGVS®WXVETWJSVEGYWXSQM^EFPIƙX
and palm pads for added impact protection.
FEATURES
• All leather shell construction for durability and shape retention
ť,MKLHIRWMX]GYWLMSRIHTEPQERHƙRKIVFEGOPMRMRKJSVEHHIHGSQJSVX
10%
PLAYER
BREAK-IN
• Game ready feel right off the shelf
• Select models feature Basket Webs®JSVEHIITƚI\MFPITSGOIX:IPGVS® straps for
EGYWXSQƙXERHTEPQTEHWJSVEHHIHMQTEGXTVSXIGXMSR
R130WB (Reg/RH)
R125WB
(Reg only)
• 12 ½" Baseball/Softball pattern
• Basket Web®
• Neo-Flex™ back with custom
ƙX:IPGVS® strap
MSRP: $56.00
R120WB (Reg/RH)
RFBRB (Reg/RH)
• 12 ½" First base mitt
• Single-post, double-bar web
• Conventional back
MSRP: $61.00
R115FBB
RCMBB
RCMYBB
(Reg/RH)
• 32 ½" Catcher’s mitt
• 1-piece solid web
• Fastback Design®
MSRP: $60.00
40
FACTORY
R140WB (Reg/RH)
• 14” Softball pattern
• Basket Web®
• Fastback Design® with custom
ƙX:IPGVS® strap
MSRP: $66.00
RENEGADE™
MITTS
90%
• 13" Baseball/Softball pattern
• Basket Web®
• Fastback Design® with custom
ƙX:IPGVS® strap
MSRP: $61.00
• 12" Baseball/Softball pattern
• Basket Web®
• Conventional back
MSRP: $54.00
(Reg/RH)
• 11 ½" First base mitt
• Single-post, double-bar web
• Conventional back
MSRP: $56.00
(Reg/RH)
• 31 ½” Youth catcher’s mitt
• 1-piece solid web
• Fastback Design®[MXLMRHI\ƙRKIV
hood for added protection
MSRP: $54.50
RENEGADE™
YOUTH
FEATURES
• Patterns designed for youth baseball players
• All-leather construction for durability and shape retention
FACTORY
R15R
(Reg/RH)
• 11 ½" youth pattern
• Basket-Web®
• Neo-Flex™ conventional back
with Velcro® adjustment
MSRP: $39.00
R110R
R105R (Reg/RH)
• 10 ½" youth pattern
• Basket-Web®
• Neo-Flex™ conventional back with Velcro®
adjustment
MSRP: $32.00
R100R
10%
PLAYER
(Reg only)
• 11" youth pattern
• Basket-Web®
• Neo-Flex™ conventional back
with Velcro® adjustment
MSRP: $36.00
(Reg only)
• 10" youth pattern
• Basket-Web®
• Conventional back
MSRP: $30.00
SAVAGE™
SERIES
FEATURES
90%
• Super soft, super easy to close for a game ready feel right off the shelf
ť%HHIHGSQJSVX[MXLGYWLMSRIHJSEQƙXXIHƙRKIVWXEPPW
• Patterns designed for young T-ball players
• Cowhide split leather shell for greater durability
• Super soft, super easy to close allows for easy break-in
• Deeper web designs makes catching easier
BREAK-IN
S105NO (Reg/RH)
• 10 ½" youth pattern
• Basket-Web®
• Neo-Flex™ back design with
Velcro® strap
MSRP: $35.50
S100NO
(Reg/RH)
• 10" youth pattern
• Basket-Web®
• Neo-Flex™ back design with
Velcro® strap
MSRP: $31.50
S950NO
(Reg/RH)
• 9 ½" youth pattern
• Basket-Web®
• Conventional back
MSRP: $28.00
RAWLINGS.COM
41
PLAYMAKER
SERIES
90%
FEATURES
• All leather palm construction
for durability and shape retention
• Basket-Web®GVIEXIWEHIITƚI\MFPITSGOIXJSVIEWMIVGEXGLIW
ť,MKLHIRWMX]GYWLMSRIHTEPQERHƙRKIVFEGOPMRMRKWJSVEHHIHGSQJSVX
• Select models feature Velcro®WXVETWJSVEGYWXSQƙXTEPQ
TEHWERHMRHI\ƙRKIVTEHWJSVEHHIHMQTEGXTVSXIGXMSR
PM130BT
PM125BT
(Reg/RH)
• 13" Softball pattern
• Pro H™
• Neo Flex™ conventional back
with Velcro® adjustment
MSRP: $40.00
PLAYER
SERIES
(Reg only)
• 12 ½”
• Basket-Web® with support strap
• Neo Flex™ conventional
with Velcro® adjustment
MSRP: $37.00
FACTORY
10%
PLAYER
BREAK-IN
PM120BT (Reg/RH)
• 12"
• Basket-Web®
• Fastback™ with Velcro® strap
MSRP: $35.00
FEATURES
90%
FACTORY
10%
PLAYER
• Performance designed, easy to close youth patterns for enhanced performance
ť7SJXƚI\MFPIWLIPPERHPMRMRKQEXIVMEPWQEOIWGEXGLMRKIEWMIV
• Select models features Basket-Webs® for a deep pocket and Velcro®WXVETWJSVEGYWXSQƙX
BREAK-IN
PL129BPU (Reg/RH)
• 11" youth pattern
• Basket-Web®
• Neo-Flex™ conventional back
with Velcro®WXVETJSVGYWXSQƙX
MSRP: $24.00
PL105BB (Reg/RH)
• 10 ½" T-ball pattern
• Slanted Basket-Web®
• Neo-Flex™ conventional back
with Velcro®WXVETJSVGYWXSQƙX
MSRP: $19.00
PL91SB
PL91PB
(Reg/RH)
• 9" T-ball pattern
• Basket-Web®
• Conventional back with molded
PU training ball
MSRP: $13.50
(Reg/RH)
• 9" T-ball pattern
• Basket-Web®
• Conventional back with molded
PU training ball
MSRP: $13.50
MINIRGG
• Miniature Rawlings Gold Glove Award®
ť7XERH[MXLGYWXSQM^EFPIREQITPEXI
• Ideal for any occasion, including coach appreciation,
player awards or newborns
MSRP: $19.00
42
For baseball players, the Heart of the Hide®QSRMOIVERHMGSRMGPSKSW]QFSPM^IW6E[PMRKWŞ
commitment to providing top-grade leather to the highest levels of baseball worldwide.
Now, Rawlings’ legendary heritage of leather goods and product innovation is available for
on-the-go business executives and travelers who demand luggage that is functional, durable
and stylish. Introducing the new Rawlings Heart of the Hide™ Luxury Leather Collection,
handcrafted style and luxury for today’s traveling all-stars.
HOHDUFBL
– HOH™ DUFFLE BAG
ť<<
• Premium HOH Baseball Glove Leather
ť)\XIVMSVJVSRX^MTTSGOIXW
ť)\XIVMSVWMHI^MTTSGOIXWERHTSYGLIW
• All leather handles
• Detachable deluxe padded leather shoulder strap
• Durable nylon interior lining
ť-RXIVMSV^MTTSGOIX
• Includes Rawlings HOH luggage tag
• MSRP: $690.00
HOHMESB – HOH™ MESSENGER BAG
ť<<
• Premium HOH Baseball Glove Leather
• Deluxe padded leather shoulder strap
• Durable nylon interior lining
• Exterior snap pocket
ť1EKRIXMGGPSWYVISRƚET
ť(SYFPI^MTTIVIHSTIRMRK
ť-RXIVMSV^MTTSGOIX
• Two small interior open pockets with pen holders
• MSRP: $610.00
HEART OF THE HIDE
LUXURY LEATHER
COLLECTION
®
HOHBCB – HOH™ BRIEFCASE
ť<<
• Premium HOH Baseball Glove Leather
ť)\XIVMSVJVSRX^MTTSGOIXW
• Exterior front snap pocket: Featuring pen holders,
WQEPP^MTTSGOIXERHWQEPPSTIRTSGOIX
ť&VMIJGEWIMWHMZMHIHMRXSQEMRWIGXMSRWHMZMHIHF]E^MTTIVTSGOIX
• Interior back snap pocket
• All leather handles
• Detachable deluxe padded leather shoulder strap
• Durable nylon interior lining
ť)\XIVMSVFEGO^MTTSGOIX
• MSRP: $850.00
HOHTKB - HOH™ TRAVEL KIT
ť<<
• Premium HOH Baseball Glove Leather
ť-RXIVMSV^MTTSGOIX
• Two small interior open pockets
• Durable nylon interior lining
• MSRP: $160.00
HOHWBL – HOH™ LARGE WALLET
ť<<
• Premium HOH Baseball Glove Leather
• Clear ID pocket
• Three credit card pocket slots
• Two interior pockets slots
• Two Currency pockets
• MSRP: $110.00
RAWLINGS.COM
43
HEART OF THE HIDE
LUXURY LEATHER
COLLECTION
®
HOHDUFTL
– HOH™ DUFFLE BAG
• 22" x 12" x 11"
• Premium HOH baseball glove leather
ť)\XIVMSVJVSRX^MTTSGOIX
• Exterior back pouch pocket
• Reinforced handle
• Expandable snaps for easier access
• Detachable deluxe padded shoulder strap
• Durable nylon interior lining
ť-RXIVMSV^MTTSGOIX
• Includes Rawlings Patch HOH luggage tag
MSRP: $720.00
HOHLUGTT
– HOH™ LUGGAGE TAG
ť<
• Premium HOH baseball glove leather
• Clear ID pocket
• Belted attachment loop
• Features Rawlings Patch
MSRP: $28.00
HOHBCT
– HOH™ BRIEFCASE
• 16" x 10" x 7"
• Premium HOH baseball glove leather
ť0EVKII\XIVMSVJVSRX^MTTSGOIXJIEXYVMRKETIRLSPHIV
X[SMRXIVMSV^MTTSGOIXWERHJSYVWQEPPSTIRTSGOIXW
ť&VMIJGEWIMWHMZMHIHMRXSX[SQEMR^MTWIGXMSRW
Section 1: features a laptop cradle
7IGXMSRJIEXYVIWERMRXIVMSV^MTTSGOIXERHƙPIWTEGI
• All leather handles
• Detachable deluxe padded shoulder strap
• Durable nylon interior lining
ť)\XIVMSVFEGO^MTTSGOIX
• Includes custom HOH ID tag
MSRP: $800.00
HOHTKT
– HOH™ TRAVEL KIT
• 10" x 6½" x 4"
• Premium HOH baseball glove leather
ť-RXIVMSV^MTTSGOIX
• Two small interior open pockets
• Durable nylon interior lining
MSRP: $155.00
44
HOHWT
– HOH™ SLIM WALLET
• 4¼" x 3¼" x ½"
• Premium HOH baseball glove leather
ť7M\GVIHMXGEVHWM^ITSGOIXWPSXW
• Two interior pockets slots
• Currency pocket
MSRP: $84.00
HEART OF THE HIDE
LUXURY LEATHER
COLLECTION
®
HOHTOT – HOH™ TRAVEL ORGANIZER
• 5¼" x 9" x 1"
• Premium HOH baseball glove leather
• Clear ID pocket
• 12 credit card pocket slots
• Passport pocket
• Boarding pass pocket
• Pen holder
ť-RXIVMSV^MTTSGOIX
• Currency pocket
• Two open pocket slots
MSRP: $230.00
HOHPFT – HOH™ PADFOLIO
• 9¾" x 12" x ¾"
• Premium HOH baseball glove leather
• One large interior pocket
• Two small pocket slots
• Four card pocket slots
• Pen loop
ť0IXXIVWM^IQIQSTEH
MSRP: $216.00
4IVWSREPM^EXMSRMWEZEMPEFPISRXLIXLYQFSRP]
*Thumb text panel is 16" wide by 5" tall and centered
XSFIWXƙXXLIIQFVSMHIV]WTEGI
M16100 – HOH™ GLOVE CHAIR
• Chair dimensions: 44" x 39" x 28"
MSRP: $7,000.00
M16100SO – HOH™ GLOVE CHAIR - CUSTOM
MSRP: $7,314.30
'YWXSQM^I[MXLGSQTER]PSKS
'YWXSQM^I[MXLXI\X 4IVWSREPM^IXLYQF
ť%((
ť%((
ť%((
*Company Logo (Subject to embroidery limitations, artwork must be supplied in an eps or
EMƙPIEVX[SVOHMQIRWMSRWQYWXFI[MHIF]XEPP
*VSRXXI\XTERIPMW[MHIF]XEPPERHGIRXIVIHXSFIWXƙXXLIIQFVSMHIV]WTEGI
HOHCHROTT – HOH™ CHAIR/OTTOMAN COMBO
• Ottoman dimensions: 25" x 16" x 21"
MSRP: $9,000.00
RAWLINGS.COM
45
MLB AUTHENTIC
BATTING HELMETS
®
The OFFICIAL BATTING HELMET
of MAJOR LEAGUE BASEBALL®
%WXLI3JƙGMEP&EXXMRK,IPQIXSJ1ENSV0IEKYI&EWIFEPP®6E[PMRKW[EWXEWOIH
XSGVIEXIXLIMRHYWXV]ŞWQSWXEHZERGIHLIPQIXXSTVSXIGXXLILIEHWSJXLIKEQIŞWKVIEXIWXWXEVW
8LI6E[PMRKW7®4VS'SQTŽHIPMZIVWYRTEVEPPIPIHTVSXIGXMSR[MXLSYXWEGVMƙGMRKTIVJSVQERGITVSZMHMRKLMXXIVW
[MXLXLIGSRƙHIRGIRIIHIHXSGSQIXLVSYKLMRXLIGPYXGL
8LMWWEQIXIGLRSPSKMGEPI\TIVXMWIHIHMGEXMSRXSWXERHEVHWI\GIIHMRKIRKMRIIVMRKERHHVMZIXSIUYMTTPE]IVW[MXL
KEQIGLERKMRKTVSHYGXWJYIPW6E[PMRKWŞHIZIPSTQIRXSJXLIƙVWXSJMXWOMRH
6E[PMRKW4IVJSVQERGI6EXMRKŽFEXXMRKLIPQIXW]WXIQ
BRYCE HARPER
MANNY MACHADO
MICHAEL CUDDYER
ALBERT PUJOLS
PRINCE FIELDER
CHRIS DAVIS
46
*This helmet registered a severity index of less than 1200 based on tests using an air cannon, projectile; impact test equivalent to a 100 mph baseball pitch speed
WARNING:
W
WARN
WARNIN
A NIN
NG
NG:
N
G S
Severe
evvere
er head
h d or neckk injury,
innjury iincluding
inj
nclluding
l di pparalysis
arallysis
i or death
d th may ooccur
ccur
cur
ur tto
o yyou
ou ddespite
espit
ite uusing
sing
ing thi
this
his hel
he
hhelmet.
lmet
mett N
No
o helmet
hellmet
he
m t can prevent
preventt all
all head
al
head
d injuries
injurie
jurie
uries
rie
i s or
o any
ny neck
nec injuries a player might receive while participating in baseball or softball.
S100 PRO COMP
MLB AUTHENTIC BATTING HELMETS
®
®
The OFFICIAL BATTING HELMET
of MAJOR LEAGUE BASEBALL®
XANDER BOGAERTS
MATT CARPENTER
S100® PRO COMP™ PROTECTION AT THE PLATE,
AND NOW BEHIND THE PLATE
S100PC/S100PCCH
– RAWLINGS S100® PRO COMP™ - MSRP: $600.00
6E[PMRKWŞGSQQMXQIRXXSTVSXIGXMRKXLIKEQIŞWKVIEXIWXTPE]IVWHVSZIXLIHIZIPSTQIRXSJXLI6E[PMRKW7®4VS'SQTŽFEXXMRKLIPQIX
HIWMKRIHXS[MXLWXERHXLIMQTEGXSJEQMPIWTIVLSYVFEPPWXVMOI;MXLFEXXIVWŞRIIHWEHHVIWWIH6E[PMRKWXYVRIHXSXLIFEGOWXSTWXLEX
HMGXEXIXLIKEQI-RXVSHYGMRKXLIRI[6E[PMRKW74VS'SQTGEXGLIVŞWLIPQIXXLIƙVWXSJMXWOMRHWOYPPGETHIWMKRIH[MXLXLIWEQI
IRIVK]EFWSVFMRKXIGLRSPSK]EWMXWFEXXMRKLIPQIXTVIHIGIWWSVMRGPYHMRK
ť%IVSWTEGIKVEHIGSQTSWMXIƙFIVWLIPPGVIEXMRKERI\XIVMSVPE]IVXLEXMWWXMJJIVERHXMQIWWXVSRKIVXLER%&7WLIPPW
ť6E[PMRKW,IEX)\GLERKIŽEMVƚS[HIWMKREPPS[MRKQSVILIEXXSIWGETI
ť'SQJSVXEFPIPIEXLIV[VETTIHTEHHMRKGSRWMWXMRKSJEL]FVMH:2ERHGSQJSVXJSEQ
8STZIRXWUYMGOP]QSZILIEXIHEMV
JVSQTPE]IVŞWLIEHEPPS[MRK
QSVILIEXXSIWGETI
*This helmet registered
a severity index of less than
1200 based on tests using
an air cannon, projectile;
impact test equivalent
to a 100 mph
baseball pitch speed
%IVSWTEGIKVEHIGEVFSRƙFIVITS\]VIWMR
GSRWXVYGXMSRMWWXMJJIVERHXMQIW
WXVSRKIVXLERXVEHMXMSREP%&7TPEWXMGLIPQIXW
RAWLINGS.COM
47
RAWLINGS IS THE OFFICIAL BATTING
HELMET OF MAJOR LEAGUE BASEBALL®
RAWLINGS PERFORMANCE RATING ™
FOR BATTING HELMETS
RAWLINGS S100™
MEETS NOCSAE® STANDARDS UP
TO 100 MPH BASEBALL PITCH SPEED
RAWLINGS S90™
MEETS NOCSAE® STANDARDS UP
TO 90 MPH BASEBALL PITCH SPEED
RAWLINGS S80™
MEETS NOCSAE® STANDARDS UP
TO 80 MPH BASEBALL PITCH SPEED
RAWLINGS S70™
MEETS NOCSAE® STANDARD UP
TO 70 MPH BASEBALL PITCH SPEED
KNOW YOUR SPEED
LOOK FOR THE RAWLINGS SEAL BEFORE YOU STEP TO THE PLATE.
RAWLINGS PERFORMANCE RATING™
CAN BE FOUND ON THE
REAR OF YOU HELMET
AND ON THE INTERIOR
CROWN PADDING
NOCSAE® STANDARD EQUATES
TO 68 MPH BASEBALL PITCH SPEED.
BE AWARE OF THE AVERAGE BASEBALL PITCH SPEEDS AT YOUR LEVEL OF PLAY.
NOTE: These are general guidelines and baseball pitch speeds may vary.
WARNING: Severe head or neck injury, including paralysis or death may occur to you despite using this helmet. No helmet can prevent all head injuries or any neck injuries a player might receive while participating in baseball or softball.
48
RAWLINGS PERFORMANCE RATING
BATTING HELMETS
™
RAWLINGS S100
®
(S]SY[ERXXLIWEQIPIZIPSJFEXXMRKLIPQIXTIVJSVQERGIEW]SYVJEZSVMXITVSTPE]IV#8LISVMKMREP6E[PMRKW7®MRGPYHIWEGSQTSWMXIMRWIVX[MXL43632®<6(Ž
TEHHMRKERHMW23'7%)®GIVXMƙIHJSVKEQIYWI
8LI7MWHIWMKRIHXS[MXLWXERHEQMPIWTIVLSYVFEPPMQTEGX4S[IVIHF]6E[PMRKWŞ%HZERGIH-QTEGX1EREKIQIRX7]WXIQŽXLI7TVSZMHIW
TEVEQSYRXTVSXIGXMSRJSVER]TPE]IV[ERXMRKXLIFIWXTVSXIGXMZITIVJSVQERGIMRXLIKEQIXSHE]
S100P
- RAWLINGS S100® CLEAR-COAT HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7®
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť)\GPYWMZI&EXXMRK,IPQIXSJ1MRSV0IEKYI&EWIFEPP®
ť-RXIVMSVPMRIVJIEXYVIW4VS(VM®JSVQSMWXYVIQEREKIQIRXERHTVSJIWWMSREPPIZIPGSQJSVX
ť)\TERHIHTSP]TVST]PIRI)44PMRIV[MXL43632®<6(ŽJSVTVSJIWWMSREPTIVJSVQERGI
ť'PIEVGSEXTEMRXƙRMWL
ť7M^MRKś8, 7 4, 7 8, 7 2, 7 58, 7 4, 8
1764
RAWLINGS S90
B
N
R
S
®
8LIRI[6E[PMRKW7ŽFEXXMRKLIPQIXMWHIWMKRIHWTIGMƙGEPP]XSTVSXIGXEKEMRWXLMKLWTIIHMQTEGXWYTXSQMPIWTIVLSYV8EVKIXIHJSVGSPPIKMEXIERHLMKLWGLSSP
WXYHIRXEXLPIXIW[LSKIRIVEPP]JEGITMXGLWTIIHWEXSVFIPS[QMPIWTIVLSYVXLI7FVMRKWMRGVIEWIHTVSXIGXMSRERHTIVJSVQERGIXSER]TPE]IVWXVMZMRKXSVIEGL
XLIRI\XPIZIP
S90PA
- RAWLINGS 90MPH CLEAR-COAT ALPHA-SIZED HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7Ž
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť*IEXYVIWI\GPYWMZI10&®LIPQIXHIWMKR[MXLEHHIH,IEX)\GLERKIŽ
ZIRXMRKXIGLRSPSK]
ť6E[PMRKW7ŽHYEPHIRWMX]JSEQPMRIVJSVQE\MQYQMQTEGXEFWSVTXMSR
ERHSTXMQEPGSQJSVX
ť)RLERGIH%&7TPEWXMGWLIPPWXMJJRIWWJSVSTXMQEPTIVJSVQERGI
ť'PIEVGSEXTEMRXƙRMWL
ť7M^MRKś778184082<0584
1764
B
C
DG
MA
PU
R
S
W
N
S90PAM
- RAWLINGS 90MPH MATTE ALPHA-SIZED HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7Ž
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť*IEXYVIWI\GPYWMZI10&®LIPQIXHIWMKR[MXLEHHIH,IEX)\GLERKIŽ
ZIRXMRKXIGLRSPSK]
ť6E[PMRKW7ŽHYEPHIRWMX]JSEQPMRIVJSVQE\MQYQMQTEGXEFWSVTXMSR
ERHSTXMQEPGSQJSVX
ť)RLERGIH%&7TPEWXMGWLIPPWXMJJRIWWJSVSTXMQEPTIVJSVQERGI
ť6YFFIVM^IHQEXXITEMRXƙRMWL
ť7M^MRKś778184082<0584
1764
MBK
MC
MS
MW
MDG
MMA
MN
MPU
MR
RAWLINGS.COM
49
RAWLINGS PERFORMANCE RATING
BATTING HELMETS
RAWLINGS S80
®
8LIRI[6E[PMRKW7ŽFEXXMRKLIPQIXWIVMIWMWHIWMKRIHWTIGMƙGEPP]XSTVSXIGXEKEMRWXLMKLWTIIHMQTEGXWYTXSQMPIWTIVLSYV8EVKIXIHJSVLMKLWGLSSPERHIPMXI
]SYXLTPE]IVW[LSKIRIVEPP]JEGITMXGLWTIIHWEXSVFIPS[QMPIWTIVLSYVXLI7TVSZMHIWEHHIHTVSXIGXMSRERHTIVJSVQERGIJSV]SYRKTPE]IVWFIKMRRMRKXSJEGI
EHZERGIHTMXGLMRKMRXLIMVZEVWMX]ERHXVEZIPFEPPKEQIW
™
S80X2S/J - RAWLINGS 80MPH TWO-TONE TRANSLUCENT MATTE HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7Ž
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť*IEXYVIWI\GPYWMZI'330*03®<:ŽLIPQIXHIWMKRZIRXMRK
ERH,IEX)\GLERKIŽXIGLRSPSKMIW
ť6E[PMRKW7ŽHYEPHIRWMX]JSEQPMRIVJSVLMKLMQTEGXEFWSVTXMSR
ERHMQTVSZIHGSQJSVX
ť-RGVIEWIH%&7TPEWXMGWLIPPWXMJJRIWWJSVMQTVSZIHTIVJSVQERGI
ť8[SXSRIXVERWPYGIRXQEXXITEMRXƙRMWL
ť7M^MRKś7IRMSV7ś44.YRMSV.ś28
1764
MBK
MC
MDG
MGPH
MMA
S80X1AM
- RAWLINGS 80MPH MATTE ALPHA-SIZED HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7Ž
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť*IEXYVIWI\GPYWMZI'330*03®<:ŽLIPQIXHIWMKRZIRXMRK
ERH,IEX)\GLERKIŽXIGLRSPSKMIW
ť6E[PMRKW7ŽHYEPHIRWMX]JSEQPMRIVJSVLMKLMQTEGXEFWSVTXMSRERH
MQTVSZIHGSQJSVX
ť-RGVIEWIH%&7TPEWXMGWLIPPWXMJJRIWWJSVMQTVSZIHTIVJSVQERGI
ť6YFFIVM^IHQEXXITEMRXƙRMWL
ť7M^MRKś778184082<0584
1764
MN
MBK
MPU
MR
MS
MTXO
RAWLINGS S70
MDG
MN
MR
MS
MW
MVG
®
8LIRI[6E[PMRKW7ŽFEXXMRKLIPQIXWIVMIWMWHIWMKRIHWTIGMƙGEPP]XSTVSXIGXEKEMRWXLMKLWTIIHMQTEGXWYTXSQMPIWTIVLSYV8EVKIXIHJSVLMKLWGLSSPERHIPMXI]SYXL
TPE]IVW[LSKIRIVEPP]JEGITMXGLWTIIHWEXSVFIPS[QMPIWTIVLSYVXLI7TVSZMHIWEHHIHTVSXIGXMSRERHTIVJSVQERGIJSV]SYRKTPE]IVWFIKMRRMRKXSJEGIEHZERGIH
TMXGLMRKMRXLIMVZEVWMX]ERHXVEZIPFEPPKEQIW
S70XS/J
- RAWLINGS 70MPH MATTE HELMET
ť6E[PMRKW4IVJSVQERGI6EXMRKŽś7Ž
ť1IIXW23'7%)®WXERHEVHYTXSQMPIWTIVLSYVFEWIFEPPTMXGLWTIIH
ť*IEXYVIWI\GPYWMZI'330*03®<:ŽLIPQIXHIWMKRZIRXMRKERH,IEX)\GLERKIŽXIGLRSPSKMIW
ť6E[PMRKW7ŽHYEPHIRWMX]JSEQPMRIVJSV-QTEGXEFWSVTXMSRERHGPEWWMGGSQJSVX
ť%&7TPEWXMGWLIPPJSVGPEWWMGTIVJSVQERGI
ť6YFFIVM^IHQEXXITEMRXƙRMWL
ť7M^MRKś7IRMSV7ś44.YRMSV.ś28
1764
MBK
MGPH
MN
MR
MS
MW
WARNING: Severe head or neck injury, including paralysis or death may occur to you despite using this helmet. No helmet can prevent all head injuries or any neck injuries a player might receive while participating in baseball or softball.
REVISED NOCSAE
STANDARD HELMETS
®
With head protection at the forefront of the sporting goods industry,
the National Operating Committee on Standards for Athletic Equipment (NOCSAE®)
updated its batting helmet standards.
The revised NOCSAE® standards establish a stricter quality control testing process, including increased testing on various-sized
LIEHJSVQW%PPFEXXMRKLIPQIXWQERYJEGXYVIHEJXIV.YRIQYWXEHLIVIXSXLIRI[HMVIGXMZIXSFIGIVXMƙIHEWQIIXMRKXLI
NOCSAE® standards. Any inventory currently on shelves will continue to be sellable as the NOCSAE® logo itself is not changing.
To differentiate new batting helmets tested and approved using the revised NOCSAE® standard,
Rawlings added new colored padding to these helmets. The optic orange pad design clearly communicates to consumers
that these batting helmets meet the revised NOCSAE® standards. Marketing communications will educate both customers
and consumers about the new directive and corresponding design change.
OLD
HELMET
NEW
HELMET
OLD
NEW
OPTIC ORANGE
PAD DESIGN
New optic orange
EVA padding and crown liner
30% THICKER
EVA PADDING
114% INCREASE
IN DENSITY
EVA foam experienced a 114% increase in density
& 30% increase in thickness
providing higher quality protection
SIDE CROWN
PADDING
Added side crown padding resulting
in improved protection/safety
RAWLINGS.COM
BATTING HELMETS
CFBHNFG
- RAWLINGS COOLFLO®
NOCSAE CLEAR-COAT HELMET W/FACE GUARD
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť'*&,2LIPQIX[MXL23'7%)®ETTVSZIH6;+
JEGIKYEVHEXXEGLIH
ť7M^MRK22
1764
CF2MATN - RAWLINGS COOLFLO® NOCSAE
TWO-TONE TRANSLUCENT MATTE HELMET
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť4VIHVMPPIHJSV6E[PMRKW23'7%)®ETTVSZIHJEGIKYEVHW
ťXSRIXVERWPYGIRXQEXXIƙRMWL
ť7M^MRK22
1764
MBK
B
MDG
MN
CFMATN - RAWLINGS COOLFLO® NOCSAE
MATTE HELMET
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť4VIHVMPPIHJSV6E[PMRKW23'7%)®ETTVSZIHJEGIKYEVHW
ťXSRIQEXXIƙRMWL
ť7M^MRK22
1764
MBK
MC
MDG
MMA
MN
MPU
MR
MS
N
S
R
MR
CFBHMN - RAWLINGS COOLFLO® NOCSAE
METALLIC OSFM HELMET
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť4VIHVMPPIHJSV6E[PMRKW23'7%)®ETTVSZIHJEGIKYEVHW
ťXSRIQIXEPPMGƙRMWL
ť7M^MRK22
1764
MS
CFBHN
- RAWLINGS COOLFLO® NOCSAE CLEARCOAT OSFM HELMET
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť4VIHVMPPIHJSV6E[PMRKW23'7%)®ETTVSZIHJEGIKYEVHW
ť'PIEVGSEXƙRMWL
ť7M^MRK22
1764
B
C
DG
MA
B
C
DG
LG
N
O
PU
R
MA
N
PINK
PU
S
SIL
VG
W
R
S
W
CFTBN
- RAWLINGS COOLFLO® NOCSAE T-BALL
CLEAR-COAT HELMET
ť1IIXWVIZMWIHUYEPMX]23'7%)®WXERHEVHW
ť'330*03®HIWMKR
ť4VIHVMPPIHJSV6E[PMRKW23'7%)®ETTVSZIHJEGIKYEVHW
ť'PIEVGSEXƙRMWL
ť7M^MRK478
1764
B
52
N
S
WARNING: Severe head or neck injury, including paralysis or death may occur to you despite using this helmet. No helmet can prevent all head injuries or any neck injuries a player might receive while participating in baseball or softball.
BATTING HELMETS
CFMPBHSR/L
- Rawlings COOLFLO® Single Flap Helmet
ť4VS'330*03®WX]PIFEXXMRKLIPQIX
ť'SZIVIHPIEXLIVLIEHFERH
ť%&7TPEWXMGWLIPP[MXLGPIEVGSEXƙRMWL
ť'330*03®ZIRXMRKXIGLRSPSK]GSRXEMRWZIRXWXSPIXEMVƚS[XLVSYKLXLILIPQIX
ť7M^MRK7858
ť'*4&,7607M^MRK4
ť7XSGOIHMRFPEGOSRP]
*SVEHHMXMSREPGSPSVWWIITK
1764
CCMPBHSR/L
CFPBH - COOLFLO® STYLE BASE COACH HELMET
CCPBH - TRADITIONAL STYLE BASE COACH HELMET
ť(IZIPSTIHJSVGEXGLIVŞWSVFEWIGSEGLLIPQIX
ť%&7TPEWXMGWLIPPGSRWXVYGXMSR[MXLEGSZIVIHLIEHFERHJSVMRGVIEWIHGSQJSVX
ť'PIEVGSEXƙRMWL
ť7M^MRK78, 7, 7 8, 7 4, 7 8, 7 2, 7 58
1764
ť'330*03®HIWMKR
ť%&7TPEWXMGWLIPPGSRWXVYGXMSR[MXLEGSZIVIHLIEHFERHJSVMRGVIEWIHGSQJSVX
ť'PIEVGSEXƙRMWL
ť7M^MRK78, 7, 7 8, 7 4, 7 8, 7 2, 7 58
1764
B
C
DG
N
PU
R
MA
- Rawlings Pro Single Flap Helmet
ť4VSWX]PIFEXXMRKLIPQIX
ť'SZIVIHPIEXLIVLIEHFERH
ť%&7TPEWXMGWLIPP[MXLGPIEVGSEXƙRMWL
ť7M^MRK8, 7 8, 7 2
ť7XSGOIHMRFPEGOSRP]
*SVEHHMXMSREPGSPSVWWIITK
1764
B
C
N
PU
DG
R
MA
S
S
RAWLINGS.COM
FACEMASKS AND ACCESSORIES
BATTING HELMETS
BBWG - RAWLINGS BBWG FACE GUARD
ť1IIXW23'7%)®WXERHEVHW
ť2I[[MVIGSRƙKYVEXMSRJSVQE\MQYQZMWMFMPMX]ERH
VIHYGIH[IMKLX
ť4S[HIVGSEXƙRMWLVIHYGIW[MVIHMEQIXIVJSVPIWW
SFWXVYGXMSR
ť-RGPYHIWGLMRWXVET
ť%TTVSZIHJSVFEWIFEPPERHWSJXFEPP
ť*MXWQSHIPW7<77<.7<77<.7<7
7<.7<7ERH7<.
ť3JJIVIHMRWMPZIV[LMPIWYTTPMIWPEWX
1764
RWG2 - RAWLINGS RWG2 FACE GUARD
ť1IIXW23'7%)®WXERHEVHWJSVFSXLFEWIFEPPERH
WSJXFEPP
ť&EPERGIH[MVIGSRƙKYVEXMSR[MXLQIXEPGPMTWJSVIEW]
EWWIQFP]
ť2SEHHMXMSREPXSSPWVIUYMVIH
ť*MXWQSHIPW'*&,'*&,1'*&,2'*&,12
'*1%82ERH'*1%82
ť3JJIVIHMRREZ]ERHWGEVPIX[LMPIWYTTPMIWPEWX
1764
RCS1A - RAWLINGS ELASTIC CHIN STRAP
ť)PEWXMGGLMRWXVETJSVFEXXIVŞWLIPQIXW
ť6IXEMPTEGOIH
ť7SPHMRMRGVIQIRXWSJSRP]
1764
CFXFK - RAWLINGS RPR FIT KIT
ť'YWXSQƙXOMX
ť7IXSJX[SWMHITEHWERHSRIVIEVTEH
ť)EW]:IPGVS®EXXEGLQIRXXSI\MWXMRKTEHW
ť6IHYGIWƙXX[SLEXWM^IW
ť*MXWQSHIPW7<77<.7<77<.
7<%17<77<.7<77<.
1764
54
ABCRWG2 - RAWLINGS ABCRWG2
T-BALL FACE GUARD
ť1IIXW23'7%)®WXERHEVHWJSVFSXLFEWIFEPPERHWSJXFEPP
ť:MR]PGSEXIHWSPMHWXIIP[MVI
ť&EPERGIH[MVIGSRWXVYGXMSR
ť7GVI[XRYXEXXEGLQIRX
ť*MXWQSHIP'*8&'*8&2ERH;8&
ť3JJIVIHMRREZ]TMROVS]EPERHWGEVPIX[LMPIWYTTPMIWPEWX
1764
RCSCUP - RAWLINGS CHIN CUP
ť2I[GLMRGYTHIWMKRJSVFIXXIVGYWXSQƙX
ť,IPTWOIITXLILIPQIXMRTPEGI[LMPILMXXMRKERH
VYRRMRK
ť*MXWEPPLIPQIXW[MXLI\XIVMSVWRETW
1764
HDKTC - RAWLINGS REPLACEMENT
HARDWARE PACK FOR FACE GUARDS
ť6ITPEGIQIRXLEVH[EVITEGOJSV6E[PMRKWJEGIKYEVHW
ť-RGPYHIWXLVIIWIXWSJWGVI[WXRYXWERHGPMTW
ť*MXWJEGIQEWOQSHIPW%&'6;+ERH6;+
ť*MXWLIPQIXQSHIPW'*1%82'*1%82'*&,12
'*&,2ERH'*8&2
1764
HDKTX - RAWLINGS REPLACEMENT
HARDWARE PACK FOR FACE GUARDS
ť6ITPEGIQIRXLEVH[EVITEGOJSV6E[PMRKWJEGIKYEVHW
ť-RGPYHIWXLVIIWIXWSJWGVI[WXRYXWERHGPMTW
ť*MXWJEGIQEWOQSHIPW&&;+
ť*MXWLIPQIXQSHIPW7<77<.7<77<.
7<77<.7<7ERH7<.
1764
WARNING: Severe head or neck injury, including paralysis or death may occur to you despite using this helmet. No helmet can prevent all head injuries or any neck injuries a player might receive while participating in baseball or softball.
CUSTOM
MLB AUTHENTIC
BATTING HELMETS
®
The OFFICIAL BATTING HELMET
of MAJOR LEAGUE BASEBALL®
HOW TO ORDER
CCPBHSO (TRADITIONAL STYLE)
4MGOQSHIP''14&,760SV''4&,
4MGOWM^I8, 7 8, 7 2
ť4MGOXIEQ
ť4MGOLSQISVE[E]
1764
CFPBHSO (COOLFLO STYLE)
4MGOQSHIP'*14&,760
'*4&760SV'*4&,
4MGOWM^I78, ť4MGOXIEQ
ť4MGOLSQISVE[E]
1764
MLBDK - MLB® AUTHENTIC COLLECTION TEAM DECAL
ť10&®%YXLIRXMG'SPPIGXMSRXIEQHIGEPOMX
ť6IQSZEFPIEHLIWMZIJSVGYWXSQLIPQIXHIWMKR
ť-RGPYHIW10&XIEQLSQIPSKSFEGO10&®WMPLSYIXXIPSKS
ERHRYQFIVWIXJSVEHHMXMSREPTIVWSREPM^EXMSR
ť3RP]EZEMPEFPIJSVLSQIPSKSW
1764
AMERICAN LEAGUE™ LOGOS
NATIONAL LEAGUE™ LOGOS
SPECIAL ORDER OPTIONS
1MRMQYQSVHIVSJTIVWX]PI
Suggested List Price:
3RI8MQI4EMRX'LEVKI
%XXEGLIH*EGI+YEVH
Option
,&4
,*4
,74
%8*+
Description
4EMRX&MPP
4EMRX*VSRX
4EMRXIH7MHIW
%XXEGLIH*EGI+YEVH
SPECIAL ORDER HELMET COLORS:
Stock (Clear Coat or Matte)
&PEGO'EVHMREP'SPYQFME&PYI+VETLMXI
(EVO+VIIR/IPP]+VIIR0MKLX+SPH1EVSSR
2EZ]3VERKI8I\EW3VERKI4MRO4YVTPI
6S]EP7GEVPIX;LMXI
Metallic
:IKEW+SPH6S]EP7GEVPIX7MPZIV
MLB
'ER1EXGLER]10&LIPQIXGSPSVMRGPIEV
GSEXSVQEXXI
RAWLINGS.COM
55
COLLEGIATE BASEBALL
ADVISORY SCHOOLS
llegiate
owered co
by high-p
d
e
st
u
Tr
nabes.
from wan
emselves e.
th
te
ra
a
p
ry tim
eroes se
at bat. Eve
d, when h
l is realize need it most: every
a
ti
n
te
o
p
itters
, when
er when h
on the line
e game is ce BBCOR bats deliv
th
n
e
h
w
t
n
a
n
Big Mome lings max-perform
am of the
aw
Players dre oss the country, R
acr
programs
™
™
Youngstown State University
BBCOR
BATS
Boasting technologically-advanced new technologies – including its Precision-Optimized Performance™ 2.0 (pOp™2.0)
sweet spot-maximizing barrels and Trio™ aerospace-grade construction, Rawlings continues
to reload its roster of power, speed and balance-centric bats for players of all ages and skill levels.
™
™
BBRTTB/
BBRTTE
BBRVB/
BBRVE
-3
BBRTTB/BBRTTE
Rawlings with TRIO™ Technology, Balanced Hybrid - MSRP: $520.00
• Trio™ technology featuring a 3-piece balanced design with an extra-large barrel
increases the size of the sweet spot
LENGTH
WEIGHT
32"
29oz
33"
30oz
34"
31oz
-3
BBRVB/BBRVE
Rawlings VELO™, Balanced Alloy with Composite End Cap - MSRP: $400.00
• New VELO™ balanced design utilizing high strength VELO™ alloy and Comp-Lite™
end cap that delivers ultra-low M.O.I for maximum swing speed
LENGTH
WEIGHT
31"
28oz
32"
29oz
• Available in End load construction (33" and 34" only) - BBRTTE
33"
30oz
• Available in End load construction (33" and 34" only) - BBRVE
34"
31oz
BALANCED CONSTRUCTION
END-LOAD CONSTRUCTION
Unlocking power potential forms the
core of Rawlings end-load bat system
design that offers increased barrel
weight for maximum power behind
every swing.
Designed to amplify bat velocity,
Rawlings unique balanced construction
enables batters to drive through
the zone faster in the clutch.
Precision–Optimized Performance™ just got more
precise. Extending the sweet spot size by 25% will
boost an average and increase power numbers.
RAWLINGS.COM
57
BBCOR
BATS
™
™
5150 BBCOR – BATTLE TESTED
Rawlings reset the baseball industry’s benchmark with its inaugural 5150® BBCOR bat, propelling the University of South Carolina Gamecocks™ to its second,
consecutive NCAA® College World Series™ championship in 2011. Rawlings has yet again raised the bar. The introduction of the Comp-Lite end cap to the 5150
achieves better sound, better feel, and championship performance.
-3
BB5150
- Rawlings 5150®, Alloy with Composite End Cap - MSRP: $260.00
• 5150® now comes equipped with the Comp-Lite™ end cap to lower M.O.I
and generate additional swing speed
LENGTH 30"
31"
32"
33"
34"
WEIGHT 27oz
28oz
29oz
30oz
31oz
™
™
BBCOR WOOD COMPOSITE – PREPARING FOR BATTLE
In order to be clutch in clutch situations, one must be ready for battle. Built on the strength, performance and technology that power game days, Rawlings BBCOR wood
GSQTSWMXIFEXWTVITEVILMXXIVWJSVXLIPSRKWIEWSRŞWMRKEQIHYIPW[MXLSYXWEGVMƙGMRKER]TIVJSVQERGIMRXLIGEKI
-3
WC5150 - 5150 Wood Composite - 150 day Warranty - MSRP: $180.00
ť'SRWXVYGXIH[MXLELEVHQETPIFEVVIPERHEGEVFSRƙFIVMRJYWIHLERHPIERHMRRIV
barrel core, the Rawlings 5150® wood composite provides hitters with a similar swing
weight and feel in the cage as they have with their game day Rawlings 5150 bat
LENGTH
WEIGHT
31"
28oz
32"
29oz
33"
30oz
• 150 day warranty
34"
31oz
-3
BB3RX - Rawlings RX4™, Alloy - MSRP: $90.00
• Thin RX4 alloy barrel end-construction for consistent performance
LENGTH
WEIGHT
58
30"
27oz
31"
28oz
32"
29oz
33"
30oz
34"
31oz
• Stiff handle generates a balanced feel for any type of hitter
• New performance end cap and knob that creates both a balanced and comfortable
feel
SENIOR LEAGUE
BATS
Batted ball performance is a by-product of a bat's tramTSPMRISVFEVVIPƚI\8LI6E[PMRKW1EGLŽWIVMIWLEW
QSVIFEVVIPƚI\XLERXLIGPSWIWXGSQTIXMXSV
SLRMC - Rawlings Mach 2, 2 5/8" Composite - MSRP: $400.00
3C™ - Consistent-Composite-Compaction™ - a secondary compaction
TVSGIWWHIWMKRIHXSMQTVSZIXLIQIGLERMGEPTVSTIVXMIW[MXLMRXLIƙFIV
laminate resulting in better durability and higher performance.
-10
• Approved for USSSA®, Dixie League®, BPA™, Dizzy Dean®, and all other
associations that allow 2 5/8" barrels with 1.15 BPF with ABI standard
ťTMIGIXIGLRSPSK][MXLMRGVIEWIHFEVVIPƚI\ERHQSVIGSQTSWMXIƙFIVW
• 2 5/8" barrel diameter
LENGTH
WEIGHT
28"
18oz
29"
19oz
30"
20oz
31"
21oz
32"
22oz
SLRM34 - Rawlings Mach 2, 2 3/4" Composite - MSRP: $400.00
ťTMIGIXIGLRSPSK][MXLMRGVIEWIHFEVVIPƚI\ERHQSVIGSQTSWMXIƙFIVW
• 2 3/4" big barrel diameter
• BPF 1.15
LENGTH
WEIGHT
27"
15oz
28"
16oz
29"
17oz
-12
30"
18oz
-10
SLRVEL - Rawlings Velo, 2 5/8" Alloy with Composite End Cap - MSRP: $250.00
• New VELO™ balanced design utilizing high strength VELO™ alloy and Comp-Lite™
end cap that delivers ultra-low M.O.I for maximum swing speed
LENGTH
WEIGHT
28"
18oz
29"
19oz
30"
20oz
31"
21oz
32"
22oz
• 2 5/8" barrel diameter
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®,
BPA™, Dizzy Dean®, and all other associations that allow 2 5/8 barrels
with 1.15 BPF with ABI standard
-5
SLRV5 - Rawlings Velo, 2 5/8" Alloy with Composite End Cap - MSRP: $250.00
• New VELO™ balanced design utilizing high strength VELO™ alloy and Comp-Lite™
end cap that delivers ultra-low M.O.I for maximum swing speed
LENGTH
WEIGHT
30"
25oz
31"
26oz
32"
27oz
33"
28oz
• 2 5/8" barrel diameter
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®,
BPA™, Dizzy Dean®, and all other associations that allow 2 5/8 barrels
with 1.15 BPF with ABI standard
RAWLINGS.COM
59
SENIOR LEAGUE
BATS
-10
SLRPRO
- Rawlings Prodigy, 2 3/4" Hybrid - MSRP: $250.00
• Ultra High performing Prodigy alloy barrel with a 100% composite handle
JSVEHHIHƚI\ERH[LMTPEWLXLVSYKLXLILMXXMRK^SRI
LENGTH 27"
28"
29"
30"
31"
WEIGHT 17oz
18oz
19oz
20oz
21oz
• 2 3/4" big barrel diameter
• 1.15 BPF approved
-10
YBBP10 - Rawlings Prodigy, 2 3/4" Alloy - MSRP: $120.00
• High strength Prodigy alloy with x-tended sweet spot technology
LENGTH
WEIGHT
26"
16oz
27"
17oz
28"
18oz
• 2 3/4" big barrel diameter
• 1.15 BPF approved
-10
SL105
- Rawlings 5150, 2 5/8" Alloy - MSRP: $120.00
• Championship performance 5150 alloy with a balanced construction
LENGTH
WEIGHT
27"
17oz
28"
18oz
29"
19oz
30"
20oz
• 2 5/8" barrel diameter
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®, BPA™,
Dizzy Dean®, and all other associations that allow 2 5/8 barrels with 1.15 BPF
with ABI standard
-5
SLRX5 - Rawlings RX4, 2 5/8" Alloy - MSRP: $80.00
• Thin RX4 alloy barrel with new performance end cap and knob that creates
both a balanced and comfortable feel at the plate
LENGTH 30"
31"
32"
33"
34"
WEIGHT 25oz
26oz
27oz
28oz
29oz
• 2 5/8" barrel diameter
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®, BPA™,
Dizzy Dean®, and all other associations that allow 2 5/8 barrels with 1.15 BPF
with ABI standard
-11
YBRX11 - Rawlings RX4, 2 5/8" Alloy - MSRP: $60.00
• Thin RX4 alloy barrel with new performance end cap and knob that creates
both a balanced and comfortable feel at the plate
LENGTH 25"
26"
27"
WEIGHT 14oz
15oz
16oz
60
• 2 5/8" barrel diameter
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®, BPA™,
Dizzy Dean®, and all other associations that allow 2 5/8 barrels with 1.15 BPF
with ABI standard
YOUTH BASEBALL
BATS
YBRMC - Rawlings Mach 2, 2 1/4" Composite - MSRP: $300.00
ťTMIGIXIGLRSPSK][MXLMRGVIEWIHFEVVIPƚI\ERHQSVIGSQTSWMXIƙFIVW
• 2 1/4" barrel diameter
LENGTH
WEIGHT
27"
17oz
28"
18oz
29"
19oz
30"
20oz
-10
• Approved for Little League®, Babe Ruth®, Pony League®, AABC, Dixie League®,
USSSA®, and all other associations that allow 2 1/4" barrels with 1.15 BPF
with ABI standard
31"
21oz
YBRX4A - Rawlings RX4, 2 1/4" Alloy - MSRP: $70.00
-13
• 2 1/4" barrel diameter
• Approved for Little League®, Babe Ruth®, Pony League®, AABC, Dixie League®,
USSSA®, and all other associations that allow 2 1/4" barrels with 1.15 BPF
with ABI standard
• Thin RX4 alloy barrel with new performance end cap and knob that creates
both a balanced and comfortable feel at the plate
LENGTH 27"
28"
29"
30"
31"
WEIGHT 14oz
15oz
16oz
17oz
18oz
-11
YBRP11
- Rawlings Raptor, 2 1/4" Alloy - MSRP: $44.00
• High strength aerospace alloy generates a balanced feel for any type of hitter
LENGTH
WEIGHT
27"
16oz
28"
17oz
29"
18oz
30"
19oz
• 2 1/4" barrel diameter
• Approved for Little League®, Babe Ruth®, Pony League®, AABC, Dixie League®,
USSSA®, and all other associations that allow 2 1/4" barrels with 1.15 BPF
with ABI standard
31"
20oz
T-BALL
BATS
-13.5
JRRMC
- Rawlings Mach 2, 2 1/4" Coach Pitch/Tball Composite - MSRP: $40.00
• Ultra-lightweight coach pitch/T-ball bat with 100% composite barrel
LENGTH
WEIGHT
25"
11.5oz
26"
12.5oz
-13
TBRP13
- Rawlings Raptor, 2 1/4" Tball Alloy - MSRP: $30.00
• Features a large sweet spot for better contact
LENGTH
WEIGHT
24"
11oz
• 2 1/4" barrel diameter
• 1.15 BPF approved for all associations
25"
12oz
• 2 1/4" barrel diameter
• 1.15 BPF approved for all associations
26"
13oz
RAWLINGS.COM
61
WOOD
BATS
JOE MAUER
MATT WIETERS
MATT KEMP
A preferred constant in pro clubhouses across the country,
Rawlings® legendary wood bats have powered some of the most iconic moments
in baseball history. From Hank Aaron’s record-setting 715th home run launched from a Rawlings ®
Adirondack® bat and Reggie Jackson’s Rawlings® Big Stick electrifying 3-home run performance to clinch Game 6 of the
1977 World Series™ to David Freese’s game-winning
-winning home run in Game 6 of the 2011 World Series™.
Understanding the needs of tomorrow’s future stars, Rawlings® wood engineers dedicate the same timeless
meless craftsmanship and attention-to-detail
awlings® revitalized wood bat collection.
they develop for the pros throughout Rawlings
62
SELECTING THE RIGHT WOOD
WOOD BATS
TECHNOLOGY
A quality at-bat starts with quality wood, and this is why the game’s biggest pros trust Rawlings at the plate. Rawlings’ goal is to provide athletes with
the most durable, balanced and high-performing bat whether it be constructed from ash, maple or birch. Understanding the key differences between
ash, maple and birch is essential to maximizing each swing and outperforming the competition in every game.
MAPLE
ť'PSWIHKVEMRWEVIPIWWZMWMFPIERH[MPPRSXƚEOISVWTPMRXIVPMOIEWL
• Maple is very dense with an 8 – 10% moisture content resulting in
a hard hitting surface
• Maple can feel slightly heavier than ash due to its closed
grain structure and high density
ASH
• As one of the strongest timbers available, ash is durable
and known for its exceptional feel
• Ash contains a 10 – 12% moisture content resulting in
EHHMXMSREPƚI\MFMPMX]ERH[LMT
• Ash is porous and lightweight due to its open grain structure
BIRCH
ť'PSWIHKVEMRWXVYGXYVITVIZIRXWƚEOMRKERHWTPMRXIVMRKERHMW6E[PMRKW
most durable wood offering
• Birch is an ideal combination of maple and ash characteristics
ť*IEXYVIWMRGVIEWIHƚI\MFMPMX]PMOIEREWL[MXLXLILEVHRIWWSJEQETPI
Maple Ace™ utilizes the same
high-grade maple as the pros and
combines Adirondack® balanced
timber with the player-preferred
REXYVEPYRƙRMWLIHPSSO
Process of Burning off raised dead
[SSHƙFIVWXLIRLEVHIRMRKERH
sealing the grains for increased
performance.
Rawlings’ Composite Wood bats are
constructed from eco-friendly bamboo
and the strongest maple wood
available, and feature a balanced
weight distribution for improved
swing speed. Designed to last,
these bats are 2X more durable
than previous models.
The ink dot is placed on the bat taper
to measure the slope of grain. The
lower the degree of slope will result
in higher performance and durability
of the bat.
RAWLINGS.COM
63
WOOD BATS
BIG STICK
®
JOE MAUER
SWINGS
®
WHAT IT MEANS TO BE
®
BARREL SIZE GENERATES POWER
With a larger hitting surface and increased sweetspot,
Rawlings’ Big Sticks were created for athletes who can
swing with a heavier barrel resulting in maximum power at the plate.
R243CB
- Big Stick Wood Composite - 90 Day Warranty - MSRP: $104.00
• 31", 32", 33", 34"
• Wood: maple/bamboo composite
ť4VSƙPI
ť&EVVIP&MK7XMGO0EVKITVSƙPI
• Guaranteed -2 length-to-weight ratio
• Handle: 19/20"
R243BM
- Big Stick Maple Ace - MSRP: $94.00
• 32", 33", 34"
• Wood: Maple Ace
ť4VSƙPI6
ť&EVVIP&MK7XMGO0EVKITVSƙPI
• Handle: 15/16"
MAUER
- Big Stick Joe Mauer Gameday Ash - MSRP: $72.00
• 32", 33", 34"
• Wood: Burn and Bone Ash
ť4VSƙPI1EYIV
ť&EVVIP&MK7XMGO0EVKITVSƙPI
• Handle: 31/32"
R325B
-3
64
- Big Stick Ash -3 Guarantee or Better - MSRP: $60.00
• 31", 32", 33", 34"
• Wood: Ash
ť4VSƙPI
ť&EVVIP&MK7XMGO0EVKITVSƙPI
• Guaranteed -3 or lighter length-to-weight ratio
• Handle: 31/32"
• Ultra thin tac-grip for enhanced feel
WOOD BATS
VELO
™
WHAT IT MEANS TO BE
™
BALANCE GENERATES BAT SPEED
MATT KEMP
SWINGS
™
Rawlings’ Velo™ bats are best suited for players looking to maximize
their swing speed while seeking a more balanced stick.
R110CV
- Velo Wood Composite - 90 Day Warranty - MSRP: $104.00
• 31", 32", 33", 34"
• Wood: maple/bamboo composite
ť4VSƙPI
ť&EVVIP:IPS1IHMYQTVSƙPI
• Guaranteed -3 length-to-weight ratio
• Handle: 15/16"
-3
141BIR - Velo Birch - MSRP: $82.00
• 32", 33", 34"
• Wood: Yellow Birch
ť4VSƙPI
ť&EVVIP:IPS1IHMYQTVSƙPI
• Handle: 29/32"
KEMP
- Velo Matt Kemp Gameday Ash - MSRP: $72.00
• 32", 33", 34"
• Wood: Burn and Bone Ash
ť4VSƙPI/IQT
ť&EVVIP:IPS1IHMYQTVSƙPI
• Handle: 57/64"
R271V
- Velo Ash -3 Guarantee or Better - MSRP: $60.00
• 31", 32", 33", 34"
• Wood: Ash
ť4VSƙPI
ť&EVVIP:IPS1IHMYQTVSƙPI
• Guaranteed -3 or lighter length-to-weight ratio
• Handle: 15/16"
• Ultra thin tac-grip for enhanced feel
-3
RAWLINGS.COM
65
WOOD BATS
ADIRONDACK
®
R110M
- Adirondack® Maple - MSRP: $56.00
• 31", 32", 33", 34"
• Wood: Maple
• Barrel: Medium
• Handle: 1"
R212A
- Adirondack® Black Ash - MSRP: $36.00
• 31", 32", 33", 34"
• Wood: Ash
• Barrel: Large
• Handle: 31/32"
R232A
- Adirondack® Natural Ash - MSRP: $31.00
• 31", 32", 33", 34"
• Wood: Ash
• Barrel: Large
• Flame Treated
• Handle: 31/32"
232APSIG
• 34"
• Wood: Ash
• Barrel: Large
• Handle: 31/32"
- Adirondack® Signature Natural Ash - MSRP: $36.00
212BAPSIG
• 34"
• Wood: Ash
• Barrel: Large
• Handle: 31/32"
66
- Adirondack® Signature Black Ash - MSRP: $36.00
WOOD BATS
YOUTH
SL151V
- Velo® Youth Ash - 90 Day Warranty - MSRP: $80.00
• 29”, 30”, 31”, 32”
• Wood: maple/bamboo composite
ť4VSƙPI
ť&EVVIP:IPS1IHMYQTVSƙPI
• Guaranteed -5 length-to-weight ratio
• Handle: 15/16”
-5
Y62V
- Velo® Youth Ash -7.5 Guarantee or Better - MSRP: $40.00
• 27", 28", 29", 30", 31"
• Wood: Ash
• Barrel: 2 1/4"
• Guaranteed -7.5 or lighter length-to-weight ratio
• Handle: 7/8"
• Ultra thin tac-grip for enhanced feel
-7.5
Y242A
- Adirondack® Youth Natural Ash - MSRP: $19.80
• 27", 28", 29", 30", 31"
• Wood: Ash
• Barrel: 2 1/4"
• Flame Treated
• Handle: 7/8"
WOOD BATS
T-BALL
WBTBC - T-Ball Wood Bat/Ball Combo - MSRP: $19.80
• 25"
• T-ball bat and combo set
• Barrel: 2"
• Includes TVB soft core baseball
RAWLINGS.COM
67
WOOD BATS
FUNGO
-16
114MBF - Wood Composite Fungo - MSRP: $64.00
• 36"
• Ultra-light -16 oz. weight drop
• Wood:Maple/Bamboo
• Barrel: 2 1/4"
R114AF - MSRP: $48.00
• Ash Fungo (Clear)
• 35"
• Hollow barrel for ultra-light weight design
• Wood: Ash
• Barrel: 2 1/4"
WOOD BATS
CUSTOM AND DISPLAYS
MB24
- Mini Bat - MSRP: $8.00
• 17"
• 24-count retail pack
• Wood: Ash collectable grade
BATOF - Bat Display Case - MSRP: $26.00
• For wall mount or desk display
•Fits 33" or 34" bats
CUSTOM AND MINI “BABY” BATS
• Ideal gifts to commemorate life’s biggest events:
weddings, birthdays, anniversaries, awards, etc.
68
AVAILABLE OPTIONS:
• Laser engraving
• Pad printing
• Branding
• Special colors
INTERNATIONAL
BATS
BBCOR
-3
BB3RX - Rawlings RX4™, Alloy- MSRP: $90.00
• Thin RX4 alloy barrel end-construction for consistent performance
LENGTH
WEIGHT
30"
27oz
31"
28oz
32"
29oz
33"
30oz
34"
31oz
• Stiff handle generates a balanced feel for any type of hitter
• New performance end cap and knob that creates both a balanced
and comfortable feel
SENIOR LEAGUE
-5
SLRX5 - Rawlings RX4, 2 5/8" Alloy - MSRP: $80.00
• Thin RX4 alloy barrel end-construction for balance and consistent performance
• 2 5/8" barrel diameter
LENGTH
WEIGHT
30"
25oz
31"
26oz
32"
27oz
33"
28oz
34"
29oz
• Approved for USSSA®, Babe Ruth®, Pony League®, AABC, Dixie League®, BPA™,
Dizzy Dean®, and all other associations that allow 2 5/8 barrels with 1.15 BPF
with ABI standard
YOUTH BASEBALL
YBIR10 – RUSH™ YOUTH- MSRP: $30.00
• High-strength aerospace alloy with rolled end for additional durability
LENGTH
WEIGHT
27"
17oz
28"
18oz
29"
19oz
30"
20oz
-10
• 2 1/4” barrel diameter
• Approved for Little League®, Babe Ruth®, Pony League®, AABC, Dixie League®,
USSSA® and all other associations that allow 2 1/4” barrels with 1.15 BPF standard
T-BALL
TBIR11
– RUSH™ T-BALL- MSRP: $24.00
• Balanced -11 design with rolled end for increased durability
LENGTH
WEIGHT
24"
13oz.
25”
14 oz.
26”
15 oz.
-11
• 2 1/4” barrel diameter
• 1.15 BPF approved for all associations
RAWLINGS.COM
69
THE #1 BASEBALL
BRAND WORLDWIDE
Great Lakes Intercollegiate Athletic Conference
Central Coast Section
Midwest Conference
Pac West Conference
Wolverine Hoosier Athletic Association
Cascade Collegiate Conference
Connecticut American Legion
Appalachian Athletic Conference
Southern States Athletic Conference
University Athletic Association
Heart of America Athletic Conference
MINK League
Chicagoland Collegiate Athletic Conference
North Coast Section
Red River Athletic Conference
The Sun Conference
Collegiate Club Sports
Texas New Mexico Junior College Baseball Coaches Assoc.
Arrowhead Athletic Conference
Region X
CIF San Francisco Section
United States Travel Sports Association
California Collegiate League
CIF Southern Section
Pennsylvania State University Athletic Conference
CIF Los Angeles Section
State University of New York Athletic Conference
CIF San Diego Section
Kansas State Hitgh School Baseball
South Carolina Athletic Coaches Association
Idaho Baseball Coaches Association
South Carolina High School League
Missota Conference
Rhode Island Interscholastic League
Heartland Conference
Sunbelt League
Great Lakes Valley Conference
Rocky Mountain Athletic Conference
South Athletic Conference
Mountain East Conference
Lonestar Conference
Mid South Conference
North Atlantic Conference
Florida League
70
Major League Baseball and Minor League Baseball trademarks and copyrights are used
with permission of Major League Baseball Properties, Inc. Visit MLB.com and MiLB.com
OFFICIAL BALL SUPPLIER OF
MAJOR LEAGUE BASEBALL
®
®
OFFICIAL BALL SUPPLIER OF MAJOR LEAGUE BASEBALL
Baseball simply would not be baseball without Rawlings’ legendary pearls. Trusted by Major League Baseball®
XSGVIEXIXLIKEQIŞWMGSRMGW]QFSPERHEYXLIRXMGSRƙIPHREQIWEOI6E[PMRKW® and its legendary baseballs are
the #1 choice of leagues, coaches, parents and players worldwide.
In order to play at their highest levels, competitions, leagues and teams demand their baseballs to perform and the highest levels of durability and playability.
4S[IVIHF]MXWVIZSPYXMSREV])\XVE-RRMRKW8IGLRSPSK]Ž)-8Ž6E[PMRKWGSRXMRYIWXSWIXXLIWXERHEVHXLIVIWXSJXLIQEVOIXEXXIQTXWXSQMQMG
*VSQIPMXIXVEZIPFEPPXSYVREQIRXWEGVSWW2SVXL%QIVMGE.ETER%YWXVEPMEERH)YVSTIXSMRXVSHYGXSV]KEQIWSJGEXGLMRIQIVKMRKQEVOIXWWYGLEW%YWXVEPMEERH'LMRE
%QIVMGE.ETER%YWXVEPMEERH)YVSTIXSMRXVSHYGXSV]KEQIWSJGEXGLMRIQIVKMRKQEVOI
RXVSHYGXSV]KEQIWSJGEXGLMRIQIVKMRKQEVOIIXWWYGLEW%YWXVEPMEERH'LMRE
ayed.
d
Rawlings® is at the center wherever baseball is played.
ADDISON REED
JAMES SHIELDS
JUSTIN VERLANDER
ZACK
WHEELER
MICHAEL WACHA
RAWLINGS.COM
RAWLINGS
COM
M
71
2014 SPECIAL EVENT
BASEBALLS
OFFICIAL BALL SUPPLIER OF MAJOR LEAGUE BASEBALL®
ANTHONY RIZZO
CHRIS DAVIS
DEREK JETER
ROMLBMOM-R
ROMLBWF100-R
ROM
ROMLBBAL60-R
ťJVSQXLIWEPISJIEGLFEWIFEPP[MPPFI
ť%YXLIRXMG'LMGEKS'YFW® 100th Anniversary • Authentic Baltimore Orioles® Franchise
60th Anniversary®SRƙIPHFEWIFEPP
HSREXIHXS1ENSV0IEKYI&EWIFEPP'LEVMXMIW SJ;VMKPI]*MIPH®SRƙIPHFEWIFEPP
1764(>
MRWYTTSVXSJXLIƙKLXEKEMRWXFVIEWXGERGIV 1764(>
To learn more about Major League Baseball’s
support for breast cancer programs, please
ZMWMX10&'SQQYRMX]SVK1SXLIVW(E]
1764(>
ASBBSET
ť'SQTPIXIWIXSJ%PP7XEV+EQI®
baseballs from 1979-2014
1764
72
ROMLBDJC-R
ť%YXLIRXMG(IVIO.IXIV
*MREP7IEWSR'SQQIQSVEXMZI
baseball
1764(>
WSBBSET
ť'SQTPIXIWIXSJ;SVPH7IVMIW®
baseballs from 1978-2014
1764
MLB AUTHENTIC AND EVENT
BASEBALLS
®
ROMLB-R
ť8LISJƙGMEPSRƙIPHFEWIFEPPSJ1ENSV0IEKYI&EWIFEPP® set inside
a UV-protected, crystal styrene baseball display case.
ť1EHIXSXLII\EGXWTIGMƙGEXMSRWSJ1ENSV0IEKYI&EWIFEPP®
• Ball cube with display box
1764(>
ROMLBOD14-R
• Authentic 2014 MLB®3TIRMRK(E]®
SRƙIPHFEWIFEPP
1764(>
ASBB14-R
• Authentic 2014 MLB®%PP7XEV+EQI®
SRƙIPHFEWIFEPP
1764(>
ROMLBPS14-R
• Authentic 2014 MLB® Postseason®
SRƙIPHFEWIFEPP
%VX[SVOMWWYFNIGXXSGLERKI
1764(>
WSBB14-R
• Authentic 2014 MLB®;SVPH7IVMIW®
SRƙIPHFEWIFEPP
%VX[SVOMWWYFNIGXXSGLERKI
1764(>
MAX SCHERZER
OFFICIAL BALL SUPPLIER OF MAJOR LEAGUE BASEBALL®
RAWLINGS.COM
MLB AUTHENTIC
BASEBALLS
®
OFFICIAL BALL SUPPLIER OF MAJOR LEAGUE BASEBALL®
BOF
• Individual crystal styrene baseball display case
ť9TXSVIHYGXMSRSJ9:VE]W
• Reduces the fading of autographs
• Ball not included
1764
ROMLBHOF - Hall of Fame edition
• Authentic Major League Baseball®, National Baseball Hall of Fame® edition
ť&PEROJVSRXGIRXIVW[IIXWTSXMHIEPJSVHMWTPE]MRKEYXSKVETLW
ť-RHMZMHYEPP]FS\IHWXERHEVHHS^IRTIVFS\
1764(>
ROML
ť3JƙGMEP1ENSV0IEKYIWTIGMƙGEXMSRW
• Premium leather cover for added durability
• Rawlings® Major League seam
ť'YWLMSRIHGSVOGIRXIV
ť[SSP[MRHMRKW
1764(>
MiLB AUTHENTIC BASEBALLS
®
RAWLINGS IS THE OFFICIAL BASEBALL
OF MINOR LEAGUE BASEBALL®
ROM
ť3JƙGMEPFEWIFEPPSJ1MRSV0IEKYI&EWIFEPP®
1764
74
The NCAA® (Division I through III) and the NAIA®[MPPSJƙGMEPP]EHSTXERHFIKMRYWMRK6E[PMRKW®ƚEXWIEQ
FEWIFEPPW*IFVYEV]EJXIV6E[PMRKWŞVIWIEVGLLMKLPMKLXIHEREZIVEKIJSSXMRGVIEWIMRƚEXWIEQ
FEWIFEPPHMWXERGIWGSQTEVIHXSVEMWIHWIEQFEWIFEPPW8LI2'%%ŞWS[RMRHITIRHIRXXIWXMRKZIVMƙIH
Rawlings’ original conclusions.
FLAT SEAM
TECHNOLOGY
Rawlings’ raised-seam baseballs will continue to be used in the 2014 Division I tournament, including the NCAA College World Series™,
until the new mandate begins.
According to the NCAA®, the switch to Rawlings®ƚEXWIEQWFEWIFEPPW[MPPRSXGSQTVSQMWITPE]IVWŞLIEPXLERHTVSXIGXMSR
as the increases in distance (due to less drag on the ball) does not change the baseball’s C.O.R. or bat-exit speed.
SEAM HEIGHT:
.048 inches
SEAM HEIGHT:
.031 inches
RAISED SEAM
FLAT SEAM
* when launched out of a pitching machine at averages of 95 MPH,
at a 25-degree angle and a 2200RPM spin rate
EIT™ ADVANCED BASEBALLS
LAST 15% LONGER WITH
THE SAME GREAT
CONSISTENCY AND
MOISTURE PROTECTION
COLLEGIATE AUTHENTIC
BASEBALLS
RAWLINGS IS THE
OFFICIAL BASEBALL
OF THE NCAA®
CHAMPIONSHIPS
FSR1NCAA - FLAT SEAM
ť3JƙGMEPFEWIFEPPSJXLI
2'%%®'LEQTMSRWLMTW
1764(>
RAWLINGS IS THE
OFFICIAL BASEBALL
OF THE NAIA®
CHAMPIONSHIPS
FSR100NAIA - FLAT SEAM
ť3JƙGMEPFEWIFEPPSJXLI
NAIA®'LEQTMSRWLMTW
1764(>
FSR100 - FLAT SEAM
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť[SSP[MRHMRKW
ť'SVI&SRHŽEHLIWMZI
1764(>
RAWLINGS.COM
ADULT/HIGH SCHOOL
BASEBALLS
76
R100
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť[SSP[MRHMRKW
ť'SVI&SRHŽEHLIWMZI
1764(>
R100NF
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť[SSP[MRHMRKW
ť'SVI&SRHŽEHLIWMZI
1764(>
R100HS
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť'SVI&SRHŽEHLIWMZI
1764(>
R100HSNF
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť'SVI&SRHŽEHLIWMZI
1764(>
R1SPC
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
ť'SVI&SRHŽEHLIWMZI
1764(>
RNFHS
• Full-grain leather cover for added durability
• Rawlings’ raised seam for improved grip
ť'YWLMSRIHGSVOGIRXIV
ť'SVI&SRHŽEHLIWMZI
1764(>
RNFC
• Full-grain leather cover for added durability
• Rawlings’ raised seam for improved grip
ť'YWLMSRIHGSVOGIRXIV
1764(>
RNF
• Full-grain leather cover for added durability
• Rawlings’ raised seam for improved grip
ť'SQTSWMXIGSVOERHVYFFIVGIRXIV
1764(>
R200USSSA
• Full-grain leather cover for added durability
ť4EXIRXIH7YTIVWXMXGLLMKLWIEQXIGLRSPSK]
ť'YWLMSRIHGSVOGIRXIV
1764(>
TOURNAMENT GRADE
• Full-grain leather cover
for added durability
ť'YWLMSRIHGSVOGIRXIV
• Rawlings’ raised seam for improved grip
1764(>
ROLB
RSLL
RLLB
RBRO
RCAL
RPLB
RDBM
RDYB
RDZY
ROLBUSSSA
AAU2
RBPA
JUNIOR LEAGUE
BASEBALLS
COMPETITION GRADE
• Full-grain leather cover
for added durability
ť'SQTSWMXIGSVOERHVYFFIVGIRXIV
• Rawlings’ raised seam for improved grip
1764(>
ROLB1
RSLL1
RLLB1
RBRO1
RCAL1
ROLB1Y
RPLB1
RDYB1
RDZY1
ROLB1USSSA
AAU3
RBPA1
*non-EIT
*non-EIT
RAWLINGS.COM
77
PRACTICE
BASEBALLS
R850
ť€YRHIVWM^IH
• Full-grain leather cover for added durability
ť7SPMHGSVOGIRXIV
• For soft-toss advanced eye-bat coordination.
Not recommended for youth league or for use
[MXLWXERHEVHGEXGLIVŞWQEWO
1764(>
ROLB2
• Leather cover
ť;SYRHWSPMHGSVOERHVYFFIVGIRXIV
ť3JƙGMEPWM^IERH[IMKLX
1764(>
R100HSX
ť6,7FEWIFEPPW[MXLQMRSVGSWQIXMGMQTIVJIGXMSRW
ť7TIGMEPGSQFSTVMGISRXLVIIHS^IRTVEGXMGI
FEPPWERHFYGOIXSVHIVEW6,7<&9'/
1764(>
1764&9'/)8
ROLB1X
• ROLB1 baseballs with minor cosmetic imperfections
ť7TIGMEPGSQFSTVMGISRXLVIIHS^IRTVEGXMGI
FEPPWERHFYGOIXSVHIVEW630&<&9'/
1764(>
FSOLBX - FLAT SEAM
• Full grain leather cover for added durability
ť'YWLMSRIHGSVOGIRXIV
• OLB Baseballs with minor cosmetic imperfections
1764(>
RPBX - FLAT SEAM
• Full-grain leather cover for added durability
ť'SQTSWMXIGSVOERHVYFFIVGIRXIV
• OLB1 Baseballs with minor cosmetic imperfections
1764(>
PITCHING MACHINE
BASEBALLS/SOFTBALLS
ROPM
ť(IWMKRIHJSVYWIMR
pitching machines
ť(YVEFPIƚEX/IZPEVWIEQ
• Full-grain leather cover
ť;SYRHGSVOVYFFIVGIRXIV
1764(>
78
PMY9
• 9” pitching machine baseball
• Yellow dimpled polyurethane
1764(>
PMY11
• 11” pitching machine softball
• Yellow dimpled polyurethane
1764(>
PMY12
• 12” pitching machine softball
• Yellow dimpled polyurethane
1764(>
TRAINING
BASEBALLS
ROTB1 - LEVEL 1 (AGES 5-7)
ť3JƙGMEPWM^I[IMKLXXVEMRMRKFEWIFEPP
ť(YVEFPIW]RXLIXMGPIEXLIVGSZIV
• Polyurethane soft center
• Rawlings’ pro-style seam
1764(>
ROTB5 - LEVEL 5 (AGES 7-10)
ť3JƙGMEPWM^I[IMKLXXVEMRMRKFEWIFEPP
ť(YVEFPIW]RXLIXMGPIEXLIVGSZIV
ť4SP]YVIXLERIQIHƙVQGIRXIV
• Rawlings’ pro-style seam
1764(>
ROTB10 - LEVEL 10 (AGES 10 & UP)
ť3JƙGMEPWM^I[IMKLXXVEMRMRKFEWIFEPP
• Full-grain leather cover for added durability
ť4SP]YVIXLERIƙVQGIRXIV
• Rawlings’ pro-style seam
1764(>
LITTLE LEAGUE TRAINING
BASEBALLS
®
TVB - T-BALL
ť-RHSSVSYXHSSV8FEPPXVEMRMRKFEWIFEPP
ť(YVEFPIW]RXLIXMGPIEXLIVGSZIV
ť7TSRKIVYFFIVGIRXIV
ť3JƙGMEPWM^IERH[IMKLX
1764(>
RIF5L
• Reduced Injury Factor™ baseball
• Leather cover
ť23'7%)® Level 1
1764(>
RIF10L
• Reduced Injury Factor™ baseball
• Leather cover
ť23'7%)® Level 2
1764(>
BUCKETS
BIGBUCK6PK
ť(YVEFPI[LMXITPEWXMGFYGOIX
LSPHWIMKLXHS^IRFEWIFEPPW
ť7M\FYGOIXWTIVTEGO
ť&YGOIXWSPHIQTX]
1764
BUCKET6PK
ť(YVEFPI[LMXITPEWXMGFYGOIX
LSPHWJSYVHS^IRFEWIFEPPW
ť7RETSRPMH[MXLGYWLMSRIHWIEX
stays securely in place
ť7M\FYGOIXWTIVTEGO
ť&YGOIXWSPHIQTX]
1764
OLB3BUCK24
ť(YVEFPI[LMXITPEWXMGFYGOIX
with clear lid
ť-RGPYHIWX[SHS^IR
30&VIGVIEXMSREPYWIFEWIFEPPW
1764
ROLB1XBUCK36
ť(YVEFPI[LMXITPEWXMGFYGOIX
ť7RETSRPMH[MXLGYWLMSRIHWIEX
stays securely in place
ť-RGPYHIWHS^IR630&<FEWIFEPPW
with minor cosmetic imperfections
1764
RAWLINGS.COM
79
RETAIL
BASEBALLS
RLLB2BT24
• Leather cover
ť;SYRHWSPMHGSVOERHVYFFIVGIRXIV
• Little League® stamped
ť8[SHS^IRHMWTPE]FS\
1764
TVBBT24
ť-RHSSVSYXHSSV8FEPPXVEMRMRKFEWIFEPP
ť(YVEFPIW]RXLIXMGPIEXLIVGSZIV
ť7TSRKIVYFFIVGIRXIV
ť3JƙGMEPWM^IERH[IMKLX
ť8[SHS^IRHMWTPE]FS\
1764
ROLB1BT24/RLLB1BT24
• Full-grain leather cover for added durability
ť'SQTSWMXIGSVOERHVYFFIVGIRXIV
ť3JƙGMEPPIEKYI630&SV0MXXPI0IEKYI® (RLLB1) stamped
ť8[SHS^IRHMWTPE]FS\
1764
OLB3BT24/OLB3SW3-24
ť(YVEFPIW]RXLIXMGPIEXLIVGSZIV
• Pro-style seams
ť7SPMHGSVOERHVYFFIVGIRXIV
ť8[SHS^IRHMWTPE]FS\
ť30&EPWSEZEMPEFPIMRFEPPWLVMRO[VETTEGO
30&7;
30&&81764
30&7;1764
RSRBBT24
ť7SPMHWTSRKIVYFFIVFEPP
ť-RHSSVSYXHSSVTPE]
ť2SRQEVOMRKSRƚSSVW
ť8[SHS^IRHMWTPE]FS\
1764
TVBBAG6
ť7M\8:&8&EPPXVEMRMRKFEWIFEPPW
ť6IYWEFPIQIWLFEK[MXL^MTTIV
1764
80
OLB3BAG12
ť3RIHS^IR30&VIGVIEXMSREPYWIFEWIFEPPW
• Reusable mesh bag with drawstring
1764
CANADA
BASEBALLS
RAWLINGS IS THE OFFICIAL BASEBALL
OF BASEBALL CANADA™
®
ROMLCAN
ť3JƙGMEP1ENSV0IEKYIWTIGMƙGEXMSRW
ť'YWLMSRIHGSVOGIRXIV
• Rawlings pro-style seams
ť[SSP[MRHMRKW
80CC
• Full-grain leather cover for added durability
ť'YWLMSRIHGSVOGIRXIV
• Rawlings pro-style seams
CAN100HS
• Full-grain leather cover for added durability
ť'YWLMSRIHGSVOGIRXIV
• Rawlings’ pro-style seams
65CC
• Full-grain leather cover for added durability
ť'SQTSWMXIGSVOERHVYFFIVGIRXIV
• Rawlings’ pro-style seams
BUCKET6PKCAN
ť(YVEFPI[LMXITPEWXMGFYGOIXLSPHW
XLVIIHS^IRFEWIFEPPW
ť7RETSRPMH[MXLGYWLMSRIHWIEX
stays securely in place
• Ideal for storing game or practice balls
ť7M\FYGOIXWTIVTEGO
ť&YGOIXWSPHIQTX]
45CC
• Leather cover
ť;SYRHWSPMHGSVOERHVYFFIVGIRXIV
ť3JƙGMEPWM^IERH[IMKLX
BKTROLB1XCAN
ť(YVEFPI[LMXITPEWXMGFYGOIX
ť7RETSRPMH[MXLGYWLMSRIHWIEXWXE]W
securely in place
ť-RGPYHIWHS^IR630&<FEWIFEPPW[MXL
minor cosmetic imperfections
RAWLINGS.COM
81
CHEST PROTECTOR
AND LEG GUARD
SIZING GUIDE
YADIER MOLINA
RUSSELL MARTIN
CHEST PROTECTOR SIZING
For chest si
size, measure from top of breast plate
to w
waist to give length required
JSVGSVVIGXƙX
MODEL
CP950X
CP950XI
CP950XY
XCPM
XCPMI
XCPMY
AGP2
12P2
LLBP2
8P2
6P1
LENGTH
17''
16''
15''
17"
16"
15"
17"
16"
14"
14"
12''
LEG GUARD SIZING
LE
For leg guard
g
size, measure from center of the
kneecap to bottom of shin and refer to chart
MODEL
LG950XPRO
LG950X
LG950XI
LG950XY
XLGMBO
XLGMIBO
XLGMYBO
5DCW
76DCW
9DCW
9C
6C
ULGPRO
LG in CS10-14
LG in CS7-10
LLG in CS5-7 (6C)
82
LENGTH
18"
15"
13"
12"
16.5"
15.5"
14.5"
17"
14.5"
13"
12.5"
10"
16.5"
14"
12.5"
10"
WARNING: No catcher's equipment can prevent all injuries a player might receive while participating in baseball or softball.
950X SERIES
PROTECTIVE
%-17Ž%HZERGIH-QTEGX1EREKIQIRX7]WXIQŽQE\MQM^IWTIVJSVQERGIF]YXMPM^MRK
innovative technologies to match the demand of today’s athlete. The most important
features to baseball or softball catchers are control, mobility, protection and comfort.
CH950X/CH950XY
TWO-TONE TRANSLUCENT MATTE HOCKEY STYLE CATCHER'S HELMET
• COOLFLO® highlight hockey-style catcher’s helmet
• Meets NOCSAE® standards
• Improved interior padding with Pro Dri Plus™ moisture-wicking technology
JSVFIXXIVƙXERHGSQJSVX
• High strength, increased impact resistance cage
ť2I[GLVSQI[MVIƙRMWL
• CH950X Adult – 7 1/8"-7 3/4" - MSRP: $170.00
• CH950XY Youth – 6 1/2"-7" - MSRP: $ 160.00
MBK
MC
MDG
MMA
MN
MPU
MR
MS
CP950X/CP950XI/CP950XY
950 SERIES
• PORON® XRD™ chest protector provides optimal ball control
with an aggressive, 3-dimensional style
ť(]REQMG*MX7]WXIQŽSZIVXLIWLSYPHIVTVSZMHIWSTXMQEPƙX
ť2I[PMKLX[IMKLXERHƚI\MFPIHIWMKR
• Adjustable and removable shoulder caps
ť%HNYWXEFPIFEGOLEVRIWWJSVEGYWXSQƙX
• CP950X Adult – 17" (age 15 and older) - MSRP: $156.00
• CP950XI Intermediate – 16" (age 12-15) - MSRP: $146.00
• CP950XY Youth – 15" (age 9-12) - MSRP: $136.00
* Youth offered in B, N, R, S only
B
C
DG
MA
N
PU
R
S
LG950XPRO/LG950X/LG950XI/LG950XY
950 SERIES
• AIMS™: Advanced Impact Management System™
• PORON® XRD™ technology in the knee for impact absorption
• Conforming lightweight design for comfort and mobility
• Triple-knee design for protection
• Patented Supertoe™ for ultimate instep protection
• Premium riveted design for durability
• LG950XPRO Pro – 18" (age 15 and older) - MSRP: $156.00
• LG950X Adult – 15" (age 15 and older) - MSRP: $146.00
• LG950XI Intermediate – 13" (age 12-15) - MSRP: $130.00
• LG950XY Youth – 12" (age 9-12) - MSRP: $124.00
=SYXLSJJIVIHMR&267SRP]HSIWRSXLEZIXSIƚETPMOIMRXERHEHYPX
B
C
DG
MA
N
PU
R
S
RAWLINGS.COM
83
XRD BLACKOUT
SERIES
™
MCH1BO/MCH2BO
BLACK OUT MATTE HOCKEY STYLE CATCHER'S HELMET
ť6YFFIVM^IHQEXXIƙRMWLGEXGLIVŞWLIPQIX
• Lightweight high strength cage
ť2I[NE[TEHHIWMKRJSVSTXMQEPƙXERHGSQJSVX
• Meets NOCSAE® standards
• MCH1BO Adult – 7 1/8"-7 3/4" - MSRP: $126.0
• MCH2BO Youth – 6 1/2"–7" - MSRP: $118.00
XCPMBO/XCPMIBO/XCPMYBO
*XCPMI / XCMPY
INCLUDE VELCRO®
REMOVABLE TAIL
XRD™ BLACK OUT SERIES
ť6YFFIVM^IHQEXXIƙRMWLGLIWXTVSXIGXSV
• PORON® XRD™ chest protector provides the best ball control
with a new pro style
ť(]REQMG*MX7]WXIQŽSZIVXLIWLSYPHIVTVSZMHIWSTXMQEPƙX
• Flat front keeps ball rebound close and in front of the body
• Adjustable and customizable neck roll
• Adjustable and removable shoulder caps
ť%HNYWXEFPIFEGOLEVRIWWJSVEGYWXSQƙX
• XCPMBO Adult – 17" (age 15 and older) - MSRP: $140.00
• XCPMIBO Intermediate – 16" (age 12-15) - MSRP: $134.00
• XCPMYBO Youth – 15" (Age 9-12) - MSRP: $130.00
XLGMBO/XLGMIBO/XLGMYBO
XRD™ BLACK OUT SERIES
ť6YFFIVM^IHQEXXIƙRMWLPIKKYEVHW
• AIMS™: Advanced Impact Management System™
• PORON® XRD™ technology in the knee for impact absorption
• Conforming full-shin design for comfort and mobility
• Triple-knee design for protection
• Patented Supertoe™ for ultimate instep protection
• Premium riveted design for durability
• XLGMBO Adult – 16.5" (Age 15 and older) - MSRP: $162.00
• XLGMIBO Intermediate – 15.5" (Age 12-15) - MSRP: $152.00
• XLGMYBO Youth – 14.5" (Age 9-12) - MSRP: $147.00
8SIƚETMRGPYHIHSREHYPXWM^ISRP]
84
YOUTH
PROTECTIVE
CFA1JP
B
N
R
S
• Dual density foam for protection and comfort
• Polyethylene sternum insert imbedded in foam
ť%HNYWXEFPIFEGOLEVRIWWJSVGYWXSQƙX
• Only available in black
• 12P2 and LLBP2 include removable tail
• AGP2 Adult - 17" (Age 15 and older) - MSRP: $46.00
• 12P2 Intermediate - 16" (Age 12-15) - MSRP: $44.00
• LLBP2 Youth - 14" (Age 9-12) - MSRP: $42.00
5DCW/76DCW/9DCW
ť(IPY\I[MRKWJSVJYPPPIKTVSXIGXMSR
• Additional knee padding for comfort and protection
• Only available in black
• 5DCW Adult - 17" (Age 15 and older) - MSRP: $64.00
• 76DCW Intermediate - 14.5" (Age 12-15) - MSRP: $57.00
• 9DCW Youth - 13" (Age 7-9) - MSRP: $51.00
N
R
S
CFA2
ť'SSPƚS® hockey-style catcher’s helmet
• ABS plastic shell for impact resistance
• Dual density foam lining
• Pro Dri Plus™ fabric covered pads feature
moisture-wicking technology
ť.E[TEHHIWMKRJSVSTXMQEPƙXERHGSQJSVX
• Meets NOCSAE® standards
ť3RIWM^IƙXW1/8"-7 3/4"
MSRP: $84.00
AGP2/12P2/LLBP2
B
• COOLFLO® hockey-style catcher’s helmet
• ABS plastic shell for impact resistance
• Dual density foam lining
• Pro Dri Plus™ fabric covered pads feature
moisture-wicking technology
• Meets NOCSAE® standards
ť3RIWM^IƙXW1/2”–7”
MSRP: $68.00
8P2
ť(IWMKRIHJSVFIXXIVƙXERHQSFMPMX]
• Dual density foam for protection and comfort
• Polyethylene sternum insert imbedded in foam
ť%HNYWXEFPIFEGOLEVRIWWJSVGYWXSQƙX
• Only available in black
• 8P2 Youth - 14" (Age 9-12)
MSRP: $40.00
9C
• 12.5" length, knee to ankle
• Recommended for T-ball
• Only available in black
• 9C Youth - 12.5" (Age 7 and under)
MSRP: $30.00
Ai2OS - ALL-IN-ONE CATCHER'S HELMET
ť3RIWM^IƙXWEPPHIWMKR
• Sleek design combines helmet and mask
• Easy on and off
• Meets NOCSAE® standards
• Only available in black
MSRP: $50.00
6P1
• 12" body length with tail
• Quick Fit™ attachment system
for easy on and off
• Dual adjustment back straps
JSVEGYWXSQƙX
• Only available in black
• 6P1 Youth - 12" (Age 7 and under)
MSRP: $28.00
6C
• 10" length, knee to ankle
• Recommended for T-ball
• Only available in black
• 6C Youth - 10" (Age 7 and under)
MSRP: $30.00
RAWLINGS.COM
85
YOUTH PROTECTIVE
AND ACCESSORIES
CS10-14 - CATCHER'S SET - AGES 10-14
• All-in-one catcher’s helmet
• 15" Black chest protector
• 14" single knee leg guards
• Bonus two (2) wristbands and throat protector
• CS10-14 young adult (Age 10-14)
MSRP: $176.00
RKR/RKRY
RAWLINGS KNEE RELEIVER
• Provides cushion and support to knee
• Attaches directly to any leg guard
• Available in youth and adult sizes
MSRP: $23.50
B
86
N
R
S
CS7-10
- CATCHER'S SET - AGES 7-10
• All-in-one catcher’s helmet
• 13" Quick Fit™ black chest protector
• 12.5 " single knee leg guards
• Bonus two (2) wristbands and throat protector
• CS7-10 Youth (Age 7-10)
MSRP: $156.00
TP5
TP4
- RAWLINGS 6" THROAT PROTECTOR
- RAWLINGS 4" THROAT PROTECTOR
• Fits any model Rawlings mask
• Adult TP5, 6" in length
• Youth TP4, 4" in length
• Ties to mask with leather lace (included)
• Only available in black
TP5 MSRP: $10.00
TP4 MSRP: $9.00
CS5-7 - CATCHER'S SET - AGES 5-7
• All-in-one catcher’s helmet
• 12" Quick Fit™ black chest protector
• 10" single knee leg guards
• Bonus two (2) wristbands and throat protector
• CS5-7 Youth (Age 5-7)
MSRP: $136.00
CFCLIPS
RAWLINGS COOLFLO CATCHER'S HELMET SNAPS
• Replacement buckles for the Hockey Style Catcher's
Helmet
• Set of 3 Buckles per pack
MSRP: $4.00
UMPIRE
PROTECTIVE
FRONT
BACK
FRONT
CFA1JP
LWMXTI
LWMX
PWMX
UCPPRO
UGPC
ť'SSPƚS® hockey-style catcher’s helmet
• ABS plastic shell for impact resistance
• Dual density foam lining
• Pro Dri Plus™ fabric covered pads feature
moisture-wicking technology
ť2I[NE[TEHHIWMKRJSVSTXMQEPƙXERHGSQJSVX
• Meets NOCSAE® standards
ť3RIWM^IƙXW1/8”-7 3/4”
MSRP: $84.00
WIRE UMPIRE'S MASK
• High visibility design
• Simulated leather pad covering
• Includes PWMH harness
• Only available in black
MSRP: $30.00
TP5
ULTRA-LIGHTWEIGHT TITANIUM
WIRE CATCHER'S MASK
• Ultra-lightweight titanium wire construction
• Pro Dri Plus™ fabric covered pads feature
moisture-wicking technology
• Includes color matching PWMH harness
• Interior cage painted black to reduce glare
MSRP: $300.00
PRO STYLE UMPIRE'S CHEST PROTECTOR
• Pro style interior umpire chest protector
• Premium PU leather for durability and easy
cleaning
• Lightweight stretch-mesh back harness for
GSQJSVXEFPIƙX
• Attached plastic shoulder caps
• 15.5" body length
• Only available in black
• UCPPRO Adult - 15.5"
MSRP: $110.00
UMPIRE'S THROAT PROTECTOR
• Fits any model Rawlings mask
• 6" in length
• Ties to mask with leather lace (included)
• Only available in black
• TP5 Adult - 6"
MSRP: $10.00
BACK
LIGHTWEIGHT HOLLOW WIRE
UMPIRE'S MASK
• Lightweight hollow wire construction
• Leather covering on inside mask for comfort
and moisture absorption
• Includes PWMH harness
MSRP: $70.00
UMPIRE'S CHEST PROTECTOR
• Inside umpire chest protector
• Ribbed foam
• Attached plastic shoulder caps and arm pads
• 13.5" body length
• Only available in black
• UGPC Adult - 13.5"
MSRP: $76.00
ULGPRO
UMPIRE LEG GUARDS
• Designed to be worn inside OR outside of pants
• 16.5" length, knee to ankle
ť(IPY\I[MRKWJSVJYPPPIKTVSXIGXMSR
ť(SYFPITEHHIHORIIGETWJSVI\XVETVSXIGXMSR
• Only available in black
• ULGPRO Adult - 16.5"
MSRP: $76.00
RAWLINGS.COM
87
CUSTOM
PROTECTIVE
3A
2C
2B
3B
3C
2A
2D
1) CHOOSE YOUR MODEL • 950X SERIES
1A) CHEST PROTECTOR
CP950X-SO
ADULT 17"
CP950XI-SO
CP950XY-SO
INTERMEDIATE 16" YOUTH 15"
1B) LEG GUARD
LG950XPRO-SO LG950X-SO
PRO 18"
ADULT 15"
LG950XI-SO
INTERMEDIATE 13"
2) CHOOSE YOUR CHEST PROTECTOR COLORS
2A) BODY
Black
Cardinal
Dark Green
Gray
Maroon
Navy
Purple
Royal
Scarlet
White
2B) BINDING
Black
Cardinal
Dark Green
Gray
Light Gold
Maroon
Navy
Orange
Purple
Royal
Scarlet
Vegas Gold
White
2C) NECK ROLL
Black
Cardinal
Dark Green
Gray
Maroon
Navy
Purple
Royal
Scarlet
3) CHOOSE YOUR LEG GUARD COLORS
3A) BODY
Black
Cardinal
Dark Green
Gray
Maroon
Navy
Purple
Royal
Scarlet
White
3B) BINDING
Black
Cardinal
Dark Green
Gray
Light Gold
Maroon
Navy
Orange
Purple
Royal
Scarlet
Vegas Gold
White
LG950XY-SO
YOUTH 12"
2D) CHANNELS
Black
Cardinal
Dark Green
Gray
Maroon
Navy
Purple
Royal
Scarlet
3C) SHIN PADDING
Black
Cardinal
Dark Green
Gray
Maroon
Navy
Purple
Royal
Scarlet
4) CHOOSE YOUR EMBROIDERY (OPTIONAL)
4A) EMBROIDERY
YES NO
4C) THREAD COLOR
Black
Navy
Royal
Scarlet
White
4D) EMBROIDERY TEXT Limited to nine spaces
88
4B) FONT STYLE
Dark Green
Maroon
Orange
Purple
Cardinal
Gray
Light Gold
Vegas Gold
BL OCK
BATTING GLOVES
EXCLBG/EXCLBGY - EXCELLENCE
• Durable Pittards® leather palm
ť*PI\ƙX[MXLWXVIXGLJEFVMG
ť2ISTVIRIGYJJJSVMRGVIEWIHƚI\MFMPMX]
ť7M^IWEHYPX7<0<<0&ERH;SRP]]SYXL70&ERH;SRP]
MSRP: Adult $40.00
Youth $34.00
B
W
N
R
S
LGN
WORK950BG/WORK950BGY - WORKHORSE
ť*IEXYVIW6E[PMRKWI\GPYWMZI(]REQMG*MX7]WXIQ
ť(YVEFPI3MPXEGPIEXLIVTEPQ
ť6E[PMRKW(YVE4PYWTEPQTEH
ť7M^IWEHYPXERH]SYXL7<0
MSRP: Adult $37.00
Youth $30.00
B
DG
LGN
N
R
S
MOTBG/MOTBGY
- MOTIVATION
ť(YVEFPIW]RXLIXMGTEPQ[MXLTEHHMRK
ť0]GVEFEGOJSVGSQJSVXERHƙX
ť2ISTVIRIGYJJJSVMRGVIEWIHƚI\MFMPMX]
ť7M^IWEHYPXERH]SYXL7<0<0SRP]EZEMPEFPIMREHYPX
MSRP: Adult $24.00
Youth $22.00
B
LGN
MA
NOR
R
S
RAWLINGS.COM
89
EQUIPMENT BAGS
WHWB2
– WORKHORSE™
• 37”L x 14”W x 16” H
ť,SPHWWM\FEXW
ť0IKKYEVHGSQTEVXQIRX
ť'EXGLIVŞWQEWOGSQTEVXQIRX
ť'LIWXTVSXIGXSVGSQTEVXQIRX
ť)\XVEPEVKIQEMRGSQTEVXQIRX
ť&QSRWXIV[LIIPW
MSRP: $116.00
B
N
R
S
BKPK
– BASEBALL BACKPACK
• 16”W x 20”H x 10”D
ť7MHIRISTVIRIFEXWPIIZIW
JSVWIGYVITVSXIGXMSR
ť6IQSZEFPII\XIVREPTSGOIX
JSVXIEQPSKS
ť,MHHIRZIRXMPEXIHWLSITSGOIX
ť7QEPPMRXIVMSVZEPYEFPIWTSGOIX
MSRP: $70.00
B
DG
R
90
PPWB – PLAYER PREFERRED™ BAG
• 35”L x 11 ½”W x 10 ½”H
ť,SPHWJSYVFEXW
ť:IRXMPEXIHWLSITSGOIX
ť(IXEGLEFPITERIPJSVIEW]GYWXSQM^EXMSR
ť)>VSPPMRPMRI[LIIPW
• Padded shoulder strap
MSRP: $53.00
N
S
B
BO
CB
N
R
S
SIL
DG
MA
EQUIPMENT BAGS
COVERT – COVERT DUFFLE
• 26”L x 13”W x 13”H
ť6IQSZEFPIXSTTERIPJSVTIVWSREPM^EXMSR
ť(YVEFPIZMR]PFSXXSQJSVQSMWXYVITVSXIGXMSR
ť:IRXMPEXIHWLSIGSQTEVXQIRX
ť7MHIFEXWPIIZIGSQTEVXQIRXW
MSRP: $53.00
B
DG
N
R
S
ASBC2
RBALLB – BALL BAG
ť,SPHWƙZIHS^IRFEWIFEPPW
ť8[SEGGIWWSV]WMHITSGOIXW
ť:IPGVS®GPSWILERHWXVETW
ť,IEZ]HYX]QSPHIHFSXXSQ
ť3RP]EZEMPEFPIMRFPEGO
MSRP: $38.00
– COACH’S BAG
• 16 ½”L x 6”W x 13”H
ť4EHHIHQIWLFEGOTERIP
ť'EVV]SRPYKKEKILERHPISTIRMRKJSVUYMGOWXSVEKI
ť-RXIVMSVHMZMHIVWJSVHSGYQIRXSVKERM^EXMSR
ť)EW]EGGIWWXSPETXST
ť3RP]EZEMPEFPIMRFPEGO
MSRP: $94.00
RAWLINGS.COM
91
RAWLINGS
TRAINING
PM3SP60
– 3-SPORT PITCHING MACHINE
8LMWWTSVXTMXGLMRKQEGLMRIMWHIWMKRIHJSVFEWIFEPPWPS[TMXGLERHJEWXTMXGLWSJXFEPP
-XJIEXYVIWER0)(HMKMXEPHMWTPE]GSQTEGXJVEQIXLEXMWIEW]XSQERIYZIV
ERHEQE\TMXGLWTIIHYTXSQMPIWTIVLSYV
ťWTSVXTMXGLMRKGETEFMPMX]śFEWIFEPPWPS[TMXGLJEWXTMXGL
ť4MXGLWTIIHWYTXSQMPIWTIVLSYV
ť0)(HMKMXEPHMWTPE]WGVIIRśSRIXSYGLYTHS[RFYXXSRMR
SRIQMPITIVLSYVMRGVIQIRXW
ť'SQTEGXERHIEW]XSQERIYZIVśTSYRHWHITIRHIRXSRPIKI\XIRWMSRW
ť%HNYWXEFPIPIKLIMKLXJSVEHHIHZIVWEXMPMX]
ť'ERFIYWIH[MXLTMXGLMRKQEGLMRIFEPPWVIGSQQIRHIHFEWIFEPPWSVWSJXFEPPW
ťZSPXEKI
ť]IEVPMQMXIH[EVVERX]
MSRP: $1,250.00
LSCREENCW – L-SCREEN
8LMW0WGVIIRJIEXYVIWEGSPPETWMFPITMIGIHIWMKRERH[LIIPWJSVIEW]QSFMPMX]
ť'SPPETWIWMRXSXLVIIš\šWIGXMSRWETTVS\MQEXIP]Ş\Ş[LIREWWIQFPIH
ť-RGPYHIW[LIIPWJSVIEWISJQSFMPMX]
ť(SYFPIWMHIHORSXXIHEFVEWMSR[IEXLIVVIWMWXERX,(4)TMPPS[GEWIWX]PIRIX
ť4S[HIVGSEXIHWXIIPXYFIJVEQI
MSRP: $255.00
92
RAWLINGS PRO LINE
PITCHING MACHINES
®
THREE WHEEL MACHINE
• Throws any pitch from any angle
• Top speed: 100 mph baseball / 90 mph softball
• 3 contact points for best accuracy at top speeds
• Exclusive digital control panel lets user directly set
pitch speed, spin direction, and spin amount for a
total of 37 different pitches at any speed.
• Geared crank wheels for fast, precise adjustment
• 5 year warranty
TWO WHEEL MACHINE
• Throws any pitch from any angle
• Top speed: 105 mph baseball / 88 mph softball
• Super portable - weighs just 59 lbs
• LED speed displays with switches for selecting
mph / kph and baseball / softball
• ARP (Adjustable Release Point) option: Telescopic
legs create an adjustable release height of 4-7 ft
• 5 year warranty
AUTOMATIC BALL FEEDER
• Patent pending turret design holds more balls in less
space than any other system
• Capacity: 35 baseballs or 29 softballs
• Wireless remote control included
• Flexible open ramp connects directly to the machine
and displays ball to hitter as it feeds
• 2 year warranty
Baseball
RPM3BB
$3500
Softball
RPM3SB
$3500
Combination
RPM3C2
$3700
Baseball
RPM2BB
$2300
Softball
RPM2SB
$2300
BB-ARP
RPM2AR
$2400
BB-ARP&SB
RPM2C1
$2500
BB & SB
RPM2C2
$2400
BB-2W
RAF2BB
$500
BB-3W
RAF3BB
$500
SB-2W
RAF2SB
$500
SB-3W
RAF3SB
$500
Combo-2W
RAF2C1
$600
Combo-3W
RAF3C1
$600
Combinations:
Contact Info: [email protected] www.spinballsports.com 618-244-4587
%PPTVSHYGXWEVIQEHIMRXLI97%ERHWLMTJVII[MXLMRXLIGSRXMRIRXEP97%
RAWLINGS.COM
93
SUPPORT
BRACES
™
ALL NEOPRENE WRAPS OFFER ADJUSTABLE COMPRESSION FOR:
%HHMXMSREPWYTTSVXť4VSZMHIWTEMRVIPMIJJVSQGSQQSRWTSVXWMRNYVMIWť/IITWFVEGIWIGYVIHYVMRKEGXMZIYWIť'YWXSQM^IHƙXIRLERGIHMRNYV]TVSXIGXMSRERHTVIZIRXMSR
RG437
RG441
ť6IMRJSVGIHSTIRTEXIPPEPMQMXWW[IPPMRK
ERHVIPMIZIWTVIWWYVI
ť'SRXSYVIHHIWMKRJSVSTXMQEPƙXERHNSMRXTVSXIGXMSR
ť6IXEMRWXLIVETIYXMGLIEXXSLIPTWSSXLIQYWGPIW
ERHQEMRXEMRƚI\MFMPMX]
ť)\XVEXLMGORISTVIRIGSRWXVYGXMSRJSVEHHIH
WYTTSVXERHTVSXIGXMSR
ť0MRMRK[MGOWE[E]QSMWXYVIJVSQWOMR
ť%RXMFEGXIVMEPFMSGMHIMRXIKVEXIHXSEWWMWXMRVIHYGMRK
XLIKVS[XLSJSHSVGEYWMRKFEGXIVME
ť7M^IW%HYPX3RIWM^IƙXWQSWX
ť'SPSV&PEGO
ť4VSZMHIWGSQJSVXWYTTSVXXS[IEOSVMRNYVIHORIIW
ť'SRXSYVIHHIWMKRJSVSTXMQEPƙXERHNSMRXTVSXIGXMSR
ť6IXEMRWXLIVETIYXMGLIEXXSLIPTWSSXLIQYWGPIW
ERHQEMRXEMRƚI\MFMPMX]
ť)\XVEXLMGORISTVIRIGSRWXVYGXMSRJSVEHHIH
WYTTSVXERHTVSXIGXMSR
ť0MRMRK[MGOWE[E]QSMWXYVIJVSQWOMR
ť%RXMFEGXIVMEPFMSGMHIMRXIKVEXIHXSEWWMWX
MRVIHYGMRKXLIKVS[XLSJSHSVGEYWMRKFEGXIVME
ť7M^IW%HYPX3RIWM^IƙXWQSWX
ť'SPSV&PEGO
NEOPRENE OPEN KNEE WITH COMPRESSION STRAPS
NEOPRENE CLOSED KNEE WITH COMPRESSION STRAPS
RG525
RG695
ť:EVMSYWORMXHIRWMXMIWLIPTXSTVSQSXIFPSSHƚS[
ť7MPMGSRIHSXWEXXSTLIPTOIITORIIMRTPEGI
ť)\XVEƚI\FILMRHORIIJSVVERKISJQSXMSRERHGSQJSVX
ť)\XVEWYTTSVXFILMRHERHFIPS[TEXIPPE
JSVSTXMQEPTVSXIGXMSR
ť)\XVIQIP]XLMRTVSƙPIXSTVIZIRXMRXIVJIVIRGI[MXLEXLPIXMGW
SVGPSXLMRKERHFVIEXLEFPI
ť7M^IW%HYPX710<0
ť1IEWYVIQIRXW%VSYRH/RII€%HYPX71
€%HYPX0<0
ť'SPSV&PEGO+VE]SV&PYI;LMXI
ť1YPXMWTSVXHIWMKRIHJSVZSPPI]FEPPWSJXFEPP[VIWXPMRKFEWOIXFEPPERHJSSXFEPP
ť-QTEGXEFWSVFMRKHIWMKR[MXLEHHMXMSREPGSRXSYVIH
WMHITEHHMRKTVSXIGXMSR
ť1EHIJVSQQSMWXYVI[MGOMRKQEXIVMEPW
• Size: Youth, Adult
'SPSVW&PEGO;LMXI
KNEE SUPPORT, ELASTIC MULTI-COMPRESSION
SLIM-FIT KNEE PAD
RG439
RG519
NEOPRENE ANKLE WITH COMPRESSION STRAPS
LACE UP ANKLE BRACE
ť6IPMIZIWTEMRXLVSYKLGSRWXERXTVIWWYVISJEROPI
ť3TIRLIIPHIWMKRJSVQWXSƙXEROPITVSZMHMRKVIPMEFPIWYTTSVX
ť6IXEMRWXLIVETIYXMGLIEXXSLIPTOIITQYWGPIERHNSMRXƚI\MFMPMX]
ť)\XVEXLMGORISTVIRIGSRWXVYGXMSRJSVEHHIHWYTTSVXERHTVSXIGXMSR
ť0MRMRK[MGOWE[E]QSMWXYVIJVSQWOMR
ť%RXMFEGXIVMEPFMSGMHIMRXIKVEXIHXSEWWMWXMR
VIHYGMRKXLIKVS[XLSJSHSVGEYWMRKFEGXIVME
7M^IW%HYPX3RIWM^IƙXWQSWX
'SPSV&PEGO
ť8[SQIXEPWXE]WSRIEGLWMHIJSVEHHMXMSREP
lateral support
ť1EHISJZMR]PJSVWXVIRKXLERHHYVEFMPMX]
ť4VSZMHIWI\GIPPIRXWYTTSVXJSVWTVEMRIHSV[IEOEROPIW
[LMPILIPTMRKXSTVIZIRXJYVXLIVMRNYVMIW
ť*MXW1IRŞW7LSI7M^IW7€1€
L: 11 ½-13, XL: 13+
ť*MXW;SQIRŞW7LSI7M^IW7€€1
L: 12 ¼-14 ½, XL: 15+
ť'SPSV6IH2EZ]&PEGO;LMXI
RG408
NEOPRENE WAIST & BACK WITH COMPRESSION STRAPS
ť(IWMKRIHXSEPPIZMEXITEMRMRPS[IVFEGO
ť%HNYWXEFPIGSQTVIWWMSRWXVETWEPPS[JSVWYTTSVXERHGSQJSVXƙX
ť6IXEMRWXLIVETIYXMGLIEXXSLIPTVIPE\PMKEQIRXWERHQYWGPIW
ť0MRMRK[MGOWE[E]QSMWXYVIJVSQWOMR
ť%RXMFEGXIVMEPFMSGMHIMRXIKVEXIHXSEWWMWXMRVIHYGMRKXLIKVS[XLSJSHSVGEYWMRKFEGXIVME
ť7M^IW%HYPX3RIWM^IƙXWQSWXYTXS[EMWX
ť'SPSV&PEGO
RG406
NEOPRENE WRIST WITH COMPRESSION STRAPS
LACE UP SIZE CHART
MEN’S
Shoe Size
6 -7
7.5 -9
Narrow Foot
Regular Foot
Wide Foot
94
S
WOMEN’S
9.5 -11 11. 5 -13 13. 5 -15
S
M
L
S
M
L
XL
M
L
XL
15 +
XL
Shoe Size
5 -6
6.5 -8
8.5 -10
10. 5 -12
S
M
L
S
M
L
XL
M
L
XL
XL
Narrow Foot
Regular Foot
Wide Foot
S
12. 5 -14
ť6IPMIZIWTEMRJVSQGSQQSRWTSVXWMRNYVMIW
ť%HNYWXEFPIWXVETEPPS[WJSVGYWXSQƙX
and additional support
ť(IWMKRSJJIVWJVIIVERKISJQSXMSRJSVƙRKIVWERHXLYQF
ť*MXWXSFSXLPIJXERHVMKLXLERH
ť0MRMRK[MGOWE[E]QSMWXYVIJVSQWOMR
ť%RXMFEGXIVMEPFMSGMHIMRXIKVEXIHXSEWWMWXMRVIHYGMRKXLI
KVS[XLSJSHSVGEYWMRKFEGXIVME
ť7M^IW%HYPX3RIWM^IƙXWQSWX
ť'SPSV&PEGO
Phone: 303-763-8900 Toll-Free: 800.356.9026
E-mail: [email protected]
SafeTGard, Corp. 12980 West Cedar Dr. Lakewood, CO 80228
www.safetgard.com
™
PROTECTIVE
MOUTHGUARDS
RG556B
AIR MOUTHGUARD
ť136)WLSGOEFWSVFIRG]XLERWXERHEVHQSYXLKYEVHW
ť%MVGLERRIPWWYVVSYRHJVSRXXIIXLERHFIX[IIRFEGOQSPEVW
ťPMKLXIVXLERGSRZIRXMSREPQSYXLKYEVHW
ť'ERFIYWIH[MXLFVEGIW
ť&YRKIIGSVHLIPQIXEXXEGLQIRX
• Latex Free
• Custom Form Fit®XSXIIXLMRWIGSRHW
RG210TB
TB
ť6IQSZEFPIFYRKIIGSVHJSVRSRGSRXEGXWTSVXW
ť
LIP & MOUTHGUARD
GUARD
7M^IW3RIWM^IXVMQXSƙX
7M
ť9RMUYITMIGIGSRWXVYGXMSR
GSRWXVYGXMSR
'SPSV&PEGO;LMXI+SPH&PYI6IH+VIIR
'S
ťHIRXEP[EVVERX]
VVERX]
ť0EXI\JVII
• Custom Form Fit®XSXIIXLMRWIGSRHW
ť7M^IW3RIWM^IXVMQXSƙX
ť'SPSV1SYXLKYEVH&PEGO*SVIWX+VIIR/IPP]+VIIR1EVSSR
2EZ]3VERKI4YVTPI+SPH6S]EP6IH
0MT+YEVH&PEGO
RG5522B
26B
RG55
RG5523B*
RG5521B
*
RG5508B
BRACES MOUTHGUARD FOR
R ALL SPORTS
ť(IWMKRIHJSVEXLPIXIW[MXLFVEGIW
IW
ť,IPTWTVIZIRXGYXWXSMRXIVMSVSJQSYXLERHTVSZMHIW
QSYXLERHTVSZMHIW
PMQMXIHTVSXIGXMSRXSFVEGIWERHXIIXL
IIXL
ť0EXI\JVII
• Custom Form Fit®XSXIIXLMRWIGSRHW
SRHW
ť6IQSZEFPIFYRKIIGSVHJSVRSRGSRXEGXWTSVXW
XEGXWTSVXW
ť7M^IW3RIWM^IXVMQXSƙX
ť'SPSV&PEGO
RETAIL MOUTHGUARDS
UARDS
RG5511 - ADULT
RG5532 - YOUTH
TEAM MOUTHGUARDS IN POLYBAGS
ťHIRXEP[EVVERX]
ť0EXI\JVII
• Custom Form Fit®XSQSYXLMRWIGSRHW
ť1YPXMWTSVXYWEKI
ť7M^IW=SYXLEKIW8IIR%HYPXEKIW
YT
ť'SPSVW&PEGO+SPH6IH*SVIWX+VIIR/IPP]+VIIR
1EVSSR2EZ]3VERKI4YVTPI6S]EP
ťHIRXEP[EVVERX]
ť0EXI\JVII
• Custom Form Fit®XSXIIXLMRWIGSRHW
ť1YPXMWTSVXYWEKI
ť7M^IW=SYXLEKIW8IIR%HYPXEKIW
YT
ť'SPSV&PEGO+SPH&PYI6IH'PIEV
%HHMXMSREP1SHIPW[WXVET6+&6+&
%HHMXMSREP1SHIPW[SWXVET6+&6+&
QSHIPWRSXEZEMPEFPIMRGPIEV
RG5511TP
MOUTHGUARD TEAM PACK MODEL
ťHIRXEP[EVVERX]
ť0EXI\JVII
• Custom Form Fit®XSQSYXLMRWIGSRHW
ť1YPXMWTSVXYWEKI
ť'SRXEMRW1SYXLKYEVHW
6+84%HYPX'SPSVW&PEGO*SVIWX+VIIR+SPH/IPP]+VIIR
1EVSSR2EZ]3VERKI4YVTPI6IH6S]EP
6+84=SYXL'SPSVW&PEGO+SPH/IPP]+VIIR2EZ]6IH6S]EP
DOUBL MOUTHGUARD
DOUBLE
WITH CASE
C
RG556, RG5511, RG5523, RG5524 and RG5532
$8000 Warranty; $250 per replaced tooth; $100 per injured tooth.
RG5521, RG5522, RG5525 and RG5526
$3200 Warranty: $100 per replaced towoth; $50 per injured tooth.
ť(IWMKRIHJSVT
ť(IWMKRIHJSVTVSXIGXMSRSJYTTIVERHPS[IVXIIXL
ť:IRXIHJSVIEW]FVIEXLMRK
ť:IRXIHJSVIEW
ťHIRXEP[EVVERX]
ťHIRXEP
ť0EXI\JVII
• Custom Form Fit®XSXIIXLMRWIGSRHW
ť)UYMTTIH[MXL
ť)UYMTTIH[MXLTVSXIGXMZIGEWI
7M^IW
7M^IW=SYXLEKIW8IIR%HYPXEKIW
YT
=SYXL EKI
Color: Clear
RG5508 No Warranty
RAWLINGS.COM
95
PROTECTIVE CUPS
AND SUPPORTERS
TEST RESULTS
ť'EKI'YT14,1E\:IPSGMX]XS&VIEO
ť%HYPX8VEHMXMSREP14,1E\:IPSGMX]XS&VIEO
RG335
CAGE CUP
In independent laboratory testing, the cage cup
outperformed the traditional cup
ť2I[P]HIWMKRIHGEKIGYT
ť'SSPIVQSVIPMKLX[IMKLXERHQSVIGSQJSVXEFPI
ť-HIEPJSVEPPGSRXEGXWTSVXW
ť1MGVSIRGETWYPEXIHEMVMRJSEQTVSZMHIWGSQJSVX
ERHƚI\MFMPMX]EKEMRWXWOMR
ť,MKLMQTEGXWLEXXIVVIWMWXERX%&7TPEWXMGGEKI
EFWSVFWXLIMQTEGXWLSGOMRWXIEHSJXVERWJIVVMRKXSXLIFSH]
Sizes: PeeWee, Youth, Adult
'SPSV&PEGO
+VE]*SEQ4II;II6IH
+VE]*SEQ=SYXL
&PYI
+VE]*SEQ%HYPX
RG729
BRIEF WITH CAGE CUP
ť;MHIGSQJSVXƙX[EMWXFERH
ť,MKLTIVJSVQERGITSP]GSXXSRJSVQE\MQYQWYTTSVX
ť'SSPIVERHQSVIGSQJSVXEFPIGEKIGYTHIWMKR
ť'YTTVSZIRWXVSRKF]MRHITIRHIRXPEFSVEXSV]XIWXMRK
7M^IW4II;II=SYXL6IKYPEV=SYXL0EVKI=SYXL<0
and Adult S, M, L, XL
&VMIJ'SPSV;LMXI
RG730
BOXER WITH CAGE CUP
ť2I[P]HIWMKRIHJSVER]WTSVXVIUYMVMRKETVSXIGXMZIGYT
ť,MKLTIVJSVQERGITSP]GSXXSRJSVQE\MQYQWYTTSVX
ť&S\IVPIRKXLJSVQMRMQEPGLEƙRK
ť'SSPIVERHQSVIGSQJSVXEFPIGEKIGYTHIWMKR
ť'YTTVSZIRWXVSRKF]MRHITIRHIRXPEFSVEXSV]XIWXMRK
7M^IW4II;II=SYXL6IKYPEV=SYXL0EVKIERH%HYPX710<0
Boxer Color: White
RG728
SUPPORTER WITH CAGE CUP
ť;MHIGSQJSVXƙX[EMWXFERH
ť,MKLTIVJSVQERGITSP]GSXXSRJSVQE\MQYQWYTTSVX
ť)\XIVMSVTSGOIX
ť'SSPIVERHQSVIGSQJSVXEFPIGEKIGYTHIWMKR
ť'YTTVSZIRWXVSRKF]MRHITIRHIRXPEFSVEXSV]XIWXMRK
RG740
AVAILABLE AS:
COMPRESSION SHORT WITH CAGE CUP
6+7YTTSVXIV[MXL4SYGL320=ERH
6+7YTTSVXIV[MXL'EKI'YT
7M^IW=SYXL6IKYPEV=SYXL0EVKIERH%HYPX710<0
Supporter Color: White
ť;MHIGSQJSVXƙX[EMWXFERH
ť[E]WXVIXGLQEXIVMEP[MXLQIWLTSGOIX
ť%HHWWYTTSVXXSEFHSQMREPKVSMRERHLEQWXVMRKEVIEW
ť'SSPIVERHQSVIGSQJSVXEFPIGEKIGYTHIWMKR
ť'YTTVSZIRWXVSRKF]MRHITIRHIRXPEFSVEXSV]XIWXMRK
7M^IW4II;II=SYXL6IKYPEV=SYXL0EVKIERH%HYPX710<0
Compression Short Color: White
RG300
ATHLETIC SUPPORTER
SIZE
ADULT
YOUTH
PEE WEE
96
HEIGHT
WEIGHT (POUNDS)
SMALL
3’ 7” to 6’ 2”
80-135
MEDIUM
3’ 7” to 6’ 2”
135-160
LARGE
3’ 7” to 6’ 2”
160-180
X-LARGE
3’ 7” to 6’ 2”
180-210
XX-LARGE
3’ 7” to 6’ 2”
210 +
MEDIUM
3’ 1” to 4’ 1”
55-80
LARGE
3’ 1” to 4’ 1”
55-80
LARGE
4’ 7” to 5’ 2”
80-115
3’ 1” to 3’7”
30-55
ť7XE]MRTPEGIYPXVE[MHI[EMWXFERH
ť,MKLTIVJSVQERGIGSXXSRTSP]IWXIVFPIRH
ť8LMR4VSƙPI(IWMKR
ť;MXLSYX'YT4SYGL
7M^IW=SYXL6IKYPEV=SYXL0EVKI%HYPX710<0
Color: White
6+'SPSV&PEGO
™
Phone: 303-763-8900 Toll-Free: 800.356.9026
E-mail: [email protected]
SafeTGard, Corp. 12980 West Cedar Dr. Lakewood, CO 80228
www.safetgard.com
™
PROTECTIVE CUPS,
SUPPORTERS AND WRAPS
RG330
ATHLETIC SUPPORTER WITH POUCH FOR USE WITH CUP
z;MHIGSQJSVXƙX[EMWXFERH
z,MKLTIVJSVQERGITSP]GSXXSRJSVQE\MQYQWYTTSVX
z4SYGLHIWMKRIHXSƙXGEKIGYT
z&VMIJGSXXSRTSP]IWXIV
;EMWXFERHTSP]IWXIVVYFFIVR]PSR
AVAILABLE AS:
RG329
BRIEF WITH POUCH FOR USE WITH CUP
ť;MHIGSQJSVXƙX[EMWXFERH
ť,MKLTIVJSVQERGITSP]GSXXSRJSVQE\MQYQWYTTSVX
ť4SYGLHIWMKRIHXSƙXGEKIGYT
ť&VMIJGSXXSRTSP]IWXIV
;EMWXFERHTSP]IWXIVVYFFIVR]PSR
7M^IW4II;IIERH=SYXL6IKYPEV
&VMIJ'SPSV;LMXI
6+7YTTSVXIV[MXL4SYGL320=ERH
6+7YTTSVXIV[MXL'EKI'YT
7M^IW4II;II=SYXL6IKYPEV=SYXL0EVKIERH%HYPX710<0
Supporter Color: White
NEW
CT
PRODU
NEW
CT
PRODU
RG830Y - YOUTH
RG
ELIT KOLD SHOULDER WRAP
ELITE
RG830A
RG
ťL
ťLSYVGSPHVIXIRXMSRVIYWEFPI
ť0EX
ť0EXI\JVIIRSRXS\MG97(%ETTVSZIHQEXIVMEPWW
ť/IITWGSQJSVXEFPIERHHV][LMPIEPPS[MRKQSFMPMX]
ť/II
FMPMX]
ť'SRXEGXGPSWYVIQEOIW[VETWIEWMP]EHNYWXEFPI
ť'SR
ť-RXIKVEXIHTEXIRXIHMGIQEXIVMEPWEJIJSVWOMR
ť-RXI
7M^IW=SYXL6IGSQQIRHIHERH9RHIV
7M^IW
'SPS
'SPSV&PEGO
NEW
CT
PRODU
RG837
R
E
ELITE KOLD KNEE WRAP
ť LSYVGSPHVIXIRXMSRVIYWEFPI
ť
ťť%HNYWXEFMPMX]XSƙXFSXL%HYPXERH=SYXL
ťť0EXI\JVIIRSRXS\MG97(%ETTVSZIHQEXIVMEPW
ťť/IITWGSQJSVXEFPIERHHV][LMPIEPPS[MRKQSFMPMX]
ťť'SRXEGXGPSWYVIQEOIW[VETWIEWMP]EHNYWXEFPIƙXWQSWXEKIW
ťť-RXIKVEXIHTEXIRXIHMGIQEXIVMEPWEJIJSVWOMR
77M^IW3RIWM^IƙXWQSWX
'SPSV&PEGO
'
- ADULT
ELIT
ELITE KOLD SHOULDER WRAP
ťLS
ťLSYVGSPHVIXIRXMSRVIYWEFPI
ť0EXI
ť0EXI\JVIIRSRXS\MG97(%ETTVSZIHQEXIVMEPW
ť/II
ť/IITWGSQJSVXEFPIERHHV][LMPIEPPS[MRKQSFMPMX]
ť'SRXEGXGPSWYVIQEOIW[VETWIEWMP]EHNYWXEFPI
ť'SR
ť-RXIKVEXIHTEXIRXIHMGIQEXIVMEPWEJIJSVWOMR
ť-RXI
7M^IW%HYPX6IGSQQIRHIHERH3ZIV
7M^IW
'SPSV
'SPSV&PEGO
NEW
CT
PRODU
RG835
R
E
ELITE KOLD ANKLE WRAP
ť LSYVGSPHVIXIRXMSRVIYWEFPI
ť
ťť%HNYWXEFMPMX]XSƙXFSXL%HYPXERH=SYXL
ťť0EXI\JVIIRSRXS\MG97(%ETTVSZIHQEXIVMEPW
ťť/IITWGSQJSVXEFPIERHHV][LMPIEPPS[MRKQSFMPMX]
ťť'SRXEGXGPSWYVIQEOIW[VETWIEWMP]EHNYWXEFPIƙXWQSWXEKIW
ťť-RXIKVEXIHTEXIRXIHMGIQEXIVMEPWEJIJSVWOMR
77M^IW3RIWM^IƙXWQSWX
'SPSV&PEGO
'
FOOTBALL GRADIENT
®
TINTED VISOR
ťTSP]GEVFSREXI
• Shatter resistant
ť7LMIPHWI]IWJVSQƙRKIVTSOIWEMVFSVRITEVXMGPIWERHER]GSQMRKSFNIGXW
ť2SFPMRHWTSXHMWXSVXMSRJVIIZMWMSRJSVGPIEVERHTVIGMWIZMI[MRKJVSQEPPERKPIW
W
ť&PSGOW9:LEVQJYPFPYIPMKLXIPMQMREXIWKPEVIGSRXVSPWPMKLXMRXIRWMX]
ť%RXMJSKERHERXMWGVEXGLGSEXMRKIRWYVIWGPEVMX]ERHHYVEFMPMX]MREPPGSRHMXMSRW
ť8[SGPMTW]WXIQEPPS[WJSVJEWXERHIEW]EXXEGLQIRXSVVIQSZEP
'SPSV&PEGO8MRXIH+VEHMIRX
RGVS1Y
RGVS1
RAWLINGS.COM
97
CLEATS
WINDUP LOW TURF
ť0IEXLIVERHQIWLYTTIVJSVQE\MQYQFVIEXLEFMPMX]
ť*YPPPIRKXL):%QMHWSPIJSVQE\MQYQGSQJSVX
ť%PPVYFFIV8YVJ8IOOFYMPXMRTMZSXTSMRXJSVXVEGXMSRSR
EPPWYVJEGIW
• Sizes: 6.5-11,12,13
FIELD ASSAULT LOW
ť2I[P]HIZIPSTIHI\XVIQIP]PMKLX[IMKLX'1)[IHKI
TVSZMHIWQE\MQYQWYTTSVXERHGSQJSVX
ť0MKLX[IMKLXHYVEFPIW]RXLIXMGYTTIV
ť'SRWXVYGXIHSRE[MHIVPEWXSJJIVMRKWYTIVMSVƙX
• Sizes: 6.5-11,12,13
FIELD ASSAULT MID
ť2I[P]HIZIPSTIHI\XVIQIP]PMKLX[IMKLX'1)[IHKI
TVSZMHIWQE\MQYQWYTTSVXERHGSQJSVX
ť0MKLX[IMKLXHYVEFPIW]RXLIXMGYTTIV
ť'SRWXVYGXIHSRE[MHIVPEWXSJJIVMRKWYTIVMSVƙX
• Sizes: 6.5-11,12,13
NEW 015
FOR 2
MAGNUM “COOL FLO” MID
ť0IEXLIVERHQIWLYTTIVJSVQE\MQYQFVIEXLEFMPMX]
ť1MHLIMKLX[MXLTEHHIHGSPPEVJSVEHHIHEROPIWYTTSVX
ť6YFFIVSYXWSPI[MXLFMPIZIPGPIEXTEXXIVRJSVWYTIVMSVXVEGXMSR
ťŠ'SSP*PSšMRWIVXSRSYXWSPILEWEPMKLXIV[IMKLXJSVWTIIH
ť0MKLX[IMKLX):%QMHWSPI
ť(SYFPITEHHIHMRWSPIJSVKVIEXIVGYWLMSRMRKERHGSQJSVX
ť7M^IW1IRŞW
98
Contact info: 973-389-2627 or 973-956-6990.
Fax: 973-956-6991
Leif J. Ostberg Inc.
401 Hamburg Turnpike, Suite 305, Wayne , NJ 07470
[email protected]
CLEATS
Contact info: 973-389-2627 or 973-956-6990. Fax: 973-956-6991
Leif J. Ostberg Inc.
401 Hamburg Turnpike, Suite 305, Wayne , NJ 07470
[email protected]
BASE INVADER LOW
ť0MKLX[IMKLXHYVEFPIW]RXLIXMGYTTIV
ť6YFFIVSYXWSPI[MXLFMPIZIPGPIEXTEXXIVRJSV
WYTIVMSVXVEGXMSR
ť'SRWXVYGXIHSRE[MHIVPEWXSJJIVMRKEWYTIVMSVƙX
ť7M^IW;SQIRŞW
+MVPW
PEAK LOW
ť(YVEFPIW]RXLIXMGYTTIV
ť6YFFIVSYXWSPI[MXLFMPIZIPGPIEXTEXXIVR
JSVWYTIVMSVXVEGXMSR
ť0MKLX[IMKLX):%ŠHYEPGSVIšQMHWSPI
ť(SYFPITEHHIHMRWSPIJSVKVIEXIVGYWLMSRMRK
ERHGSQJSVX
ť7M^IW1IRŞW
&S]ŞW
=SYXLŞW
PEAK MID
ť(YVEFPIW]RXLIXMGYTTIV
ť1MHLIMKLX[MXLTEHHIHGSPPEVJSVEHHIHEROPIWYTTSVX
ť6YFFIVSYXWSPI[MXLFMPIZIPGPIEXTEXXIVRJSVWYTIVMSV
XVEGXMSR
ť0MKLX[IMKLX):%ŠHYEPGSVIšQMHWSPI
ť(SYFPITEHHIHMRWSPIJSVKVIEXIVGYWLMSRMRKERH
GSQJSVX
ť7M^IW1IRŞW
RAWLINGS.COM
99
PERFORMANCE
EYEWEAR
Distributed by FGX International.
For more information please call 800-426-6396
ADULT
6E[PMRKWŽ)]I[IEVJIEXYVIWPMKLX[IMKLXTIVJSVQERGIJVEQIWHIWMKRIHJSVGSQJSVXERHHYVEFMPMX]SRERHSJJXLIƙIPH)UYMTTIH[MXLTSP]GEVFSREXIQQ
HIGIRXIVIHPIRWIWXLI]SJJIVWLEXXIVMQTEGXVIWMWXERGIERHHMWXSVXMSRJVIIZMWMSR6E[PMRKW)]I[IEVEPWSYXMPM^IWFSXLEWGVEXGLVIWMWXERXLEVHPIRWGSEXMRK
ERHERIEW]GPIERPIRWGSEXMRKXLEX[MPPVITIPHMVXSMPERH[EXIVXSOIIT]SYVZMWMSRGPIEV[LIR]SYRIIHMXQSWX
RAWLINGS 2
- BLACK
RAWLINGS 3
RAWLINGS 7
- BLACK
RAWLINGS 7 - WHITE
ťQQWLEXXIVVIWMWXERXTSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť7SJXVYFFIVVYFFIVRSWITEHWERHXIQTPIWJSV
EQSVIGSQJSVXEFPIƙX
ť9:%9:&TVSXIGXMSR
MSRP: $29.99
- BLACK
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWITSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $29.99
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWITSP]GEVFSREXIPIRWIWť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWITSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSV
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
ť9:%ERH9:&TVSXIGXMSR
MSRP: $34.99
MSRP: $34.99
Rawlings 19 WHT RV
Rawlings 20 BLK
Rawlings 23 BLU RV POL
Rawlings 24 BLK POL
ťQQWLEXXIVVIWMWXERXTSP]GEVFSREXIPIRWIW
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSVPIRW
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť(SYFPIMRNIGXIHVYFFIVRSWITEHWERHXIQTPIWJSVEQSVIGSQJSVXEFPIƙX
ť:MWSVKVMTFVS[TMIGI
ť9:%9:&TVSXIGXMSR
MSRP: $34.99
• 1.0 mm polarized lenses
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSVPIRW
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť(SYFPIMRNIGXIHVYFFIVRSWITEHWERHXIQTPIXMTWJSV
EQSVIGSQJSVXEFPIƙX
ť9:%9:&TVSXIGXMSR
MSRP: $39.99
100
ťQQWLEXXIVVIWMWXERXPIRWIWTSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť(SYFPIMRNIGXIHVYFFIVRSWITEHWERHXIQTPIWJSV
EQSVIGSQJSVXEFPIƙX
ť:MWSVKVMTFVS[TMIGI
ť9:%9:&TVSXIGXMSR
MSRP: $29.99
• 1.0 mm polarized lenses
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť(SYFPIMRNIGXIHVYFFIVRSWITEHWERHXIQTPIXMTWJSV
EQSVIGSQJSVXEFPIƙX
ť9:%9:&TVSXIGXMSR
MSRP: $39..99
RAWLINGS 3 - WHITE
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť9:%9:&TVSXIGXMSR
ť4SP]GEVFSREXIQQHIGIRXIVIHPIRWIW
ť3JJIVWLEXXIVMQTEGXVIWMWXERGIERHHMWXSVXMSRJVIIZMWMSR
ť6IHYGMRKPIRWIW[MXLWGVEXGLVIWMWXERXLEVHGSEXMRK
MSRP: $34.99
RAWLINGS 10
- POLARIZED
• 1.0mm polarized 8 base lenses
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $39.99
Rawlings 20 ORN RV
ťQQWLEXXIVVIWMWXERXTSP]GEVFSREXIPIRWIW
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSVPIRW
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVX[EXIVSMP
ť(SYFPIMRNIGXIHVYFFIVRSWITEHWERHXIQTPIWJSV
EQSVIGSQJSVXEFPIƙX
ť:MWSVKVMTFVS[TMIGI
ť9:%9:&TVSXIGXMSR
MSRP: $34.99
RAWLINGS FLIP
ťQQWLEXXIVVIWMWXERXFEWITSP]GEVFSREXIPIRWIW
ť)EW]ƚMTYTPIRWQIGLERMWQ
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $39.99
PERFORMANCE
EYEWEAR
YOUTH
6E[PMRKW=SYXL)]I[IEVJIEXYVIWEPPXLIWEQIEXXVMFYXIWEWSYVEHYPXTIVJSVQERGIHIWMKRWFYXMREWQEPPIVWM^IJSVXLIPMXXPIWPYKKIVW(IWMKRIHJSVGSQJSVX
ERHHYVEFMPMX]ERHIUYMTTIH[MXLXLIWEQITSP]GEVFSREXIQQHIGIRXIVIHPIRWIWXLI6E[PMRKW=SYXL)]I[IEVMWTIVJIGXJSV]SYVPMXXPIPIEKYIV
RAWLINGS RY 103
- WHITE
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť9:%9:&TVSXIGXMSR
ť4SP]GEVFSREXIQQHIGIRXIVIHPIRWIW
ť3JJIVWLEXXIVMQTEGXVIWMWXERGIERHHMWXSVXMSR
JVIIZMWMSRPIRWIW
MSRP: $24.99
RAWLINGS RY 102 - GREY
RAWLINGS RY 101 - RED
RAWLINGS RY 102 - BLACK
RAWLINGS RY 102 - WHITE
RAWLINGS RY 103
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWI
TSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $24.99
ť7GVEXGLVIWMWXERXLEVHGSEXMRK
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť9:%9:&TVSXIGXMSR
ť4SP]GEVFSREXIQQHIGIRXIVIHPIRWIW
ť3JJIVWLEXXIVMQTEGXVIWMWXERGIERHHMWXSVXMSR
JVIIZMWMSRPIRWIW
MSRP: $24.99
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWI
TSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť&VMPPMERXQYPXMPE]IVIHGSPSVIHQMVVSV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $24.99
*IEXYVIW
&IRIƙXW
ť,MKL+VEHI86JVEQIQEXIVMEP[LMGLMWPMKLXIVERHQSVIƚI\MFPI
XLERVIKYPEVTSP]GEVFSREXIJVEQIW
ť%HNYWXEFPIRSWITEHWERHXIQTPIXMTWJSVEGYWXSQƙX
ť(SYFPIMRNIGXIHVYFFIVGSQTSRIRXWJSVEHHIHWXEFMPMX]ERHGSQJSVX
ť,(4LSXSGLVSQMGPIRWSTXMSR[LMGLEHNYWXWXSZEV]MRKPMKLXGSRHMXMSRW
[LMPITVSZMHMRKGPIEVGVMWTZMWMSR
- BLACK
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWI
TSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $21.99
PRO
ť4SP]GEVFSREXIPIRWIW[MXLQYPXMPE]IVIHGSPSVIHQMVVSVWJSVKVIEXIVKPEVIVIHYGXMSR
ť,(WQSOITSP]GEVFSREXIPIRWSTXMSRJSVKVIEXIVGPEVMX]ERHLMKLHIƙRMXMSRSTXMGW
ť%PPPIRWIWSJJIV9:%9:&
ť%PPPIRWIWEVIMQTEGXERHWLEXXIVVIWMWXERX
RAWLINGS PRO BLUE
MSRP: $95.00
RAWLINGS PRO HD SMOKE
MSRP: $70.00
RAWLINGS PRO RED
MSRP: $95.00
Distributed by FGX International.
For more information please call 800-426-6396
ť(IGIRXIVIHQQWLEXXIVVIWMWXERXFEWI
TSP]GEVFSREXIPIRWIW
ť7GVEXGLVIWMWXERXLEVHGSEXIHPIRWIW
ť)EW]GPIERPIRWGSEXMRKVITIPWHMVXSMPERH[EXIV
ť2SRWPMTWSJXVYFFIVRSWIFVMHKIERHXIQTPIXMTW
ť9:%ERH9:&TVSXIGXMSR
MSRP: $21.99
RAWLINGS PRO PHOTOCHROMIC
MSRP: $140.00
RAWLINGS.COM
101
APPAREL
MINOR LEAGUE TEAMS
102
APPAREL
ADVISORY SCHOOLS
®
NCAA DIVISION I
Dallas Baptist University
University of Texas Pan American
Virginia Military Institute
Hofstra University
Eastern Kentucky University
New Jersey Institute of Technology
Appalachian State
Manhattan College
University of North Carolina - Charlotte
University of Toledo
Monmouth University
Long Island University - Brooklyn
Youngstown State University
Fairleigh Dickinson University
University of the Incarnate Word
McNeese State University
Wagner College
®
NCAA DIVISION II
Columbus State University
Cal Poly-Pomona
Hillsdale College
University of West Georgia
University of Indianapolis
Atlanta Christian College
Queens College
Erskine College
New Mexico Highlands University
LIU Post
SUNY Fredonia
North Georgia College
Saginaw Valley State University
St. Michael’s College
Shippensburg University
Bemidji State University
Regis University
Maryville University
University of Mary
SUNY IT
Lenoir Rhyne University
Ashland University
Mercyhurst University
St. Mary’s University
®
NCAA DIVISION III
Emory University
St. Joseph’s College
U. of Pittsburgh-Bradford
Penn State-Harrisburg
Oglethorpe University
St. Lawrence University
The College of New Jersey
;IWXƙIPH7XEXI9RMZIVWMX]
Grove City College
SUNY Old Westbury
North Central College
Shenandoah University
Lehman College
Thiel College
Keystone College
Kalamazoo College
Westminster College
Dickinson College
Olivet College
Southern Vermont College
University of LaVerne
Grove City College
Lynchburg College
Webster University
NAIA
®
Georgia Gwinnett College
&IRIHMGXMRI9RMZIVWMX]EX7TVMRKƙIPH
Spring Arbor University
Central Methodist University
Mayville State University
St. Andrews University
Siena Heights University
Malone College
Missouri Baptist University
®
NJCAA
Merced College
Weatherford College
West Georgia Tech
North Central Missouri College
Chaffey College
Navarro College
Monroe College - New Rochelle
San Jacinto Junior College
Suffolk County CC
Kalamazoo Valley CC
Potomac State University
Georgia Perimeter College
Lake Michigan CC
California CC-Cypress
Chattahoochee Valley CC
Lansing CC
California CC-Santa Ana
Louisburg Junior College
Niagara County CC
Truett McConnell College
Nassau CC
RAWLINGS.COM
103
CUSTOM AND STOCK
FABRICS
PLATED PLUS™
Featuring Rawlings best fabrics engineered for optimum performance and durability,
6E[PMRKW4PEXIH4PYWŽXIGLRSPSK]TS[IVWTPE]IVWŞSRƙIPHTIVJSVQERGI(IWMKRIH[MXL
a 88% polyester/12% spandex fusion for speed and comfort, Plated Plus™ technology
provides maximum mobility and lightweight performance, while its smooth,
ŠJIIPWPMOIFYXXIVšXSYGL[MPPFIXLIIRZ]SJSTTSRIRXWIZIV][LIVI
140 CLOTH
88% Polyester / 12% Spandex
4-WAY
STRETCH
MOISTURE
MANAGEMENT
STAIN
RELEASE
PLATED
PLATED™
Boasting a technologically-advanced construction, Rawlings Plated™ technology
JIEXYVIWLMKLUYEPMX]JEFVMGWFYMPXJSVEKMPMX]GSQJSVXERHHYVEFMPMX]
150 CLOTH
100% Polyester
2-WAY
STRETCH
MOISTURE
MANAGEMENT
STAIN
RELEASE
PLATED
TECTON™
(IWMKRIHXSEQTPMJ]KEQIHE]TIVJSVQERGI6E[PMRKW8IGXSRŽXIGLRSPSK]KMZIW
TPE]IVWXLIIHKIXLI]HIQERHJVSQXLIMVSRƙIPHETTEVIP
350 CLOTH
100% Polyester
2-WAY
STRETCH
MOISTURE
MANAGEMENT
STAIN
RELEASE
PLATED
STAIN
RELEASE
104
• Stain-lifting performance
• Easy-to-clean durability
MOISTURE
MANAGEMENT
• Sweat wicks away from the body
• Actively cools during
peak performance
2-WAY
STRETCH
• 100% polyester
ť(YEPWXVIXGLTSMRXWJSV
QE\MQYQƚI\MFMPMX]
4-WAY
STRETCH
• 88% polyester
12% soft-touch spandex
• Actively transfers energy
throughout fabric when sliding
ť(YEPPE]IVIH[SZIRJEFVMG
• Exceptionally durable
for season-long usage
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
DECORATED STOCK
BASEBALL PACKAGES
HOW TO ORDER RAWLINGS BASEBALL JERSEYS:
1. CHOOSE YOUR STOCK JERSEY
2. CHOOSE YOUR DECORATION TYPE AND COLORS
3. GIVE US YOUR PLAYER SIZES AND NUMBERS
Pricing shown includes standard decoration!
VaporFusion™ Twill (VT)
standard decoration includes:
Perma Print (PP)
standard decoration includes:
7YFPMQEXIH8[MPP8IEQ2EQISV0SKS
4IVQE4VMRX8IEQ2EQISV0SKS
7YFPMQEXIH8[MPP*VSRX
&EGO2YQFIVW
4IVQE4VMRX*VSRX
&EGO2YQFIVW
VT Package Details:
Team Name and Numbers include solid color or
sublimated design with up to two (2) solid outlines.
PP Package Details:
Team Name and Numbers can be
one (1) or two (2) colors.
Braid options OP1, OP2, OP3 included in VT Package, where available. All stock fonts included. Custom artwork available with $200.00 creation charge. Fee waived if Vector or Digitized artwork is provided.
RAWLINGS.COM
105
STOCK
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
RJ140A shown with OP1 and OP3 1/8" Pattern 1; Best Size,
Script, Slanted, “Virginia” PL2; 4" Plain Block Number PL6;
1 1/2" Custom logo, PL16L
PPU140 shown with OP4, 3/8" Pattern 3
RJ140/RJ140AKVETLMXIś40%8)(4097Ž.)67)=
• Premium button front jersey with raglan sleeves
• Men’s sizes – 38-52 (even sizes only)
MSRP: $64.00
VT: $110.00
PP: $80.00
B
BG
GR
2
R
S
W
PPU140/PPU140A KVETLMXIś40%8)(4097Ž4%28QIRŞW
ť4VIQMYQWXVEMKLXƙXYRLIQQIHTERX
• Men’s sizes – 30-44 (even sizes only) with 37” inseam
*May be hemmed with or without elastic; inseam: 16”-36””
MSRP: Men’s $67.50
BG
RJ140 shown with OP1 and OP3 1/8”;
4” custom logo PL3; 4” Full Block
number PL1
PPU140 shown with OP4, 1/8”,
hemmed at 18”
106
GR
W
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR
with Rawlings Sporting Goods or Jarden Corporation
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
STOCK
APPAREL
RBJ150/YBJ150 ś40%8)(Ž.)67)=QIRŞWERH]SYXL
RSJ150/YSJ150 ś40%8)(Ž70)):)0)77.)67)=QIRŞWERH]SYXL
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes – M (30-32), L (34-36), XL (38-40)
RBJ150 MSRP: Men’s $48.50
Youth $40.00
RSJ150 MSRP: Men’s $42.50
Youth $35.00
B
BG
(+
2
R
S
BG
W
W
PRO150/YPRO150 ś40%8)(Ž730-(4%28
PRO150P/YPRO150P ś40%8)(Žš4-4)(4%28
ť7IQMVIPE\IHƙXTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
ť=SYXLMRWIEQś7š1š0š<0š<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
PRO150 MSRP: SOLID Men’s $49.00
VT: $90.00
PP: $70.00
Youth $45.00
VT: $90.00
PP: $70.00
PRO150P MSRP: PIPED Men’s $55.00
VT: $90.00
PP: $70.00
Youth $51.00
VT: $90.00
PP: $70.00
BG
W
BG/B
&+2
BG/R
BG/S
W/B
;2
W/R
W/S
RBJ150 shown with OP1 1/8”; Best Size, Custom,
Straight, Sublimated “St. John’s” PL2; 8”
Sublimated NCAA Number PL30
PRO150 shown with OP4, 3/8” Pattern 3
RSJ150 shown with OP1 3/8” Pattern 3; 4” Fancy, Arc Text,
“VIRGINIA” PL2; 4” Plain Block Number PL6
BPU150 shown with OP4, 3/8” Pattern 3
BPU150 ś40%8)(Ž92,)11)(4%28QIRŞW
YBPU150 ś40%8)(Ž92,)11)(4%28]SYXL
ť4VIQMYQWXVEMKLXƙXYRLIQQIHTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
*May be hemmed with or without elastic; inseam: 16”-36”
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
*May be hemmed with or without elastic; inseam: 10”-32”
MSRP: Men’s $49.00
Youth $45.00
BG
W
BP150K ś40%8)(Ž/2)),-+,4%28QIRŞW
YP150K ś40%8)(Ž/2)),-+,4%28]SYXL
RBJ150 shown with OP2 and OP3 1/8”; 4” Sublimated Special
Logo, PL3; 4” Sublimated Plain Block Number PL4; 8” Sublimated
Plain Block Number PL30; 4” Sublimated Custom Logo PL16R
BP150K
ť4VIQMYQORIILMKLƙXTERX[MXLIPEWXMGLIQ
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
• Men’s inseam – S (16”), M-XXL (18”)
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – S (10”), M (12”), L (14”), XL-XXL (16”)
MSRP: Men’s $41.00
Youth $38.00
BG
W
RAWLINGS.COM
107
STOCK
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
NEW
RBJ2B
YRBJ2B
• 2-button jersey with baseball style placket
• Body - Pro Dri® 100% polyester interlock
• Inserts - Pro Dri 100% polyester pin-dot mesh
• Men’s sizes - S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes - S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $33.00 VT: $74.00
PP: $50.00
Youth $31.00 VT: $74.00
PP: $50.00
RBJ2B shown with 4” Fancy, Vertical Arch,
“REX WOODS” PL2; 4” Fancy Number PL6
RP150
B
NEW
(+
2
R
S
W
RP150 ś40%8)(Ž&6%-(4%28QIRŞW
YRP150 ś40%8)(Ž&6%-(4%28]SYXL
ť7IQMVIPE\IHƙX
• 2-color braid around belt loops, down side seams, and on pocket openings
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
ť=SYXLMRWIEQś7š1š0š<0š<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
MSRP: Men’s $56.00
Youth $52.00
&+&&3
BG/B/R
BG/S/B
RBJ2B shown with 4” CustomLogo, Straight,
“Colts” PL2; 4” Full Block Number PL6
PRO150P
RBJ167 (men’s)
YBJ167 (youth)
• Full-button front jersey with raglan sleeves
• 167 cloth – 100% polyester pin-dot mesh
• Pro Dri® with moisture management and stain release
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes – M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $37.00 VT: $74.00
PP: $50.00
Youth $34.00 VT: $74.00
PP: $50.00
B
NEW
BO
C
DG
MA
N
R
S
VG
W
BP150 ś40%8)(Ž4%28QIRŞW
YBP150 ś40%8)(Ž4%28]SYXL
ť'PEWWMGƙXTERX[MXLIPEWXMGLIQ
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
• Men’s inseam – S (28”), M-L (30”), XL-XXL (31”)
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – S (23”), M (24”), L (25”), XL (26”), XXL (27”)
MSRP: Men’s $43.00
RBJ167 shown with OP1 and OP3, 3/8” pattern 3;
Youth $39.00
4” Anaheim, Vertical Arch, Sublimated “KENT STATE” PL2;
108
BG
W
4” Sublimated Anaheim Number PL6; 8” Sublimated
Anaheim Number PL30
BP150
&+72
;&&3
W/B/R
W/S/B
;72
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
STOCK
APPAREL
RBBJ350 ś8)'832Ž.)67)=QIRŞW
RYBBJ350 ś8)'832Ž.)67)=]SYXL
• Full-button front jersey with raglan sleeves
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes – M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $44.00 VT: $90.00 PP: $70.00
Youth $36.00 VT: $90.00 PP: $70.00
BG
W
PP350MR ś8)'832Ž4%28QIRŞW
YBP350MR ś8)'832Ž4%28]SYXL
ť6IPE\IHƙXTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – XS (23”), S (24”), M (25”), L (26”), XL (27”), XXL (28”);
ƙRMWLIHLIQ[MXLRSIPEWXMG
PP350MR MSRP: Men’s $47.00
Youth $43.00
BG
W
RBBJ350 shown with OP1 and OP3, 3/8” pattern 3;
4” Sublimated Custom Logo, Straight, PL2;
4” Sublimated Full Block Number PL6;
8” Sublimated Full Block Number PL30;
2” Sublimated Custom Logo PL14
PP350MR shown with OP4, 3/8” Pattern 3
RBBJ95 ś8)'832Ž4-2786-4).)67)=QIRŞW
RYBBJ95 ś8)'832Ž4-2786-4).)67)=]SYXL
ť*YPPVIPE\ƙX
• Pinstripe full-button front jersey with raglan sleeves
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes – M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $48.50 VT: $90.00 PP: $70.00
Youth $40.00 VT: $90.00 PP: $70.00
(=&
(=2
W/B
;2
BP95MR ś8)'832Ž4-2786-4)4%28QIRŞW
YBP95MR ś8)'832Ž4-2786-4)4%28]SYXL
ť4MRWXVMTIVIPE\IHƙXTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – XS (23”), S (24”), M (25”), L (26”), XL (27”), XXL (28”);
ƙRMWLIHLIQ[MXLRSIPEWXMG
MSRP: Men’s $49.00
Youth $45.00
(=&
(=2
W/B
;2
RBBJ95 shown with OP1 3/8" Pattern 3;
4", Special Style, “DB” PL3; 4" Full Block
Number PL1; 8" Full Block Number PL30
BP95MR shown in W/N
RAWLINGS.COM
109
STOCK
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
ROAD (men’s)
YROAD (youth)
• 2-button jersey with henley placket
ť&SH]śGPSXLśTSP]IWXIVƚEXFEGOQIWL
• Inserts – 100% polyester pin-dot mesh for breathability
• Piping along raglan sleeves and side seams (Blue Grey piping on colors)
• Pro Dri® with moisture management and stain release
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $26.00 VT: $74.00
PP: $50.00
Youth $24.00 VT: $74.00
PP: $50.00
ROAD shown with 4” 2-color Script,
slanted with tail, “Spiders” PL2;
2” stock logo PL1C
BPVP shown in BG/S with OP4,
3/8” pattern 3
B
'
(+
W/B
1%
2
;2
49
W/R
R
S
W/S
BPVPś8)'832Ž:238',4%28QIRŞW
YBPVP ś8)'832Ž:238',4%28]SYXL
ť6IPE\IHƙXTERX[MXL:2SXGLMRWIVX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – XS (23”), S (24”), M = 25”, L = 26”, XL = 27”, XXL = 28”;
ƙRMWLIHLIQ[MXLRSIPEWXMG
MSRP: Men’s $53.00
Youth $49.00
W/B
;2
W/R
W/S
BG/B
&+2
ROAD shown with 4” Perma Print, Fancy Block, Vertical Arch,
“PIRATES” PL2
PRO150 shown with OP4, 3/8” Pattern 3
SSBASE (men’s)
YSBASE (youth)
• Crew neck, short-sleeve performance shirt with raglan sleeves
• Body - Pro Dri® 100% polyester interlock
• Inserts - Pro Dri 100% polyester pin-dot mesh
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52), XXXL (54-56)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $17.00
Youth $15.00
B
&3
1%
'
2
'&
49
(+
R
BP31MR (men’s)
YBP31MR (youth)
GR
S
0+
W
ť6IPE\IHƙXTERX
• 31 cloth – 100% polyester double knit medium weight
ť>MTTIVƚ]JVSRX[MXLFIPXERHXYRRIPPSSTW
• Double knees and two (2) set-in back pockets
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
ť1IRŞWMRWIEQś7š10š<0<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
ť=SYXLMRWIEQś<7š7š1š0š<0š<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
MSRP: Men’s $25.00
Youth $22.00
110
B
BG
W
BG/R
BG/S
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
B
BG
STOCK
APPAREL
W
B
'
(+
GR
1%
2
49
R
S
W
BEP31 (men’s)
YBEP31 (youth)
LSBASE (men’s)
YLSBASE (youth)
• Crew neck, long-sleeve performance shirt with raglan sleeves
• Body - Pro Dri® 100% polyester interlock
• Inserts - Pro Dri® 100% polyester pin-dot mesh
• Men’s sizes – S (34-36), M (38-40), L (42-44), XL (46-48), XXL (50-52), XXXL (54-56)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $19.00
Youth $17.00
• Pull-up pant with elastic waistband and drawstring
• 31 cloth – 100% polyester double knit medium weight
ť1SGOƚ]JVSRX[MXLFIPXPSSTW
• Double knees with one (1) set-in back pocket
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42)
• Men’s inseam – 24” hemmed with elastic
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28), XL (29-30)
• Youth inseam – XS (14 ½”), S (16 ½”), M (18 ½”), L (20 ½”), XL (21 ½”); hemmed with elastic
MSRP: Men’s $17.00
Youth $12.00
SLDR (men’s)
YSLDR (youth)
NEW
YPS
• Compression protective undershirt
• Body - Pro Dri® 85% polyester/15% spandex
• Inserts - Pro Dri 83% polyester/13% spandex/4% nylon
• Protective foam to disperse impact
• Shirt is machine washable
• Youth sizes – S-2XL
MSRP: $35.00
• Body - 92% polyester/8% spandex
• Insert - 90% polyester/10% spandex
• Protective padding in critical areas
ť'YTIRGEWIQIRXśGYTTSGOIX[MXLJSPHSZIVXSTƚETJSVGSQJSVX
• Comfortable, durable waistband
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42), XXL (44-46)
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30)
MSRP: Men’s $26.00
Youth $24.00
WHILE SUPPLIES LAST
PP350MRP/YBP350MRP
BPU350/YBPU350
8)'832Žš4-4)(4%28QIRŞWERH]SYXL
ť6IPE\IHƙXTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38),
XL (40-42), XXL (44-46)
• Men’s inseam – S (31”), M-L (33”), XL-XXL (34”);
ƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – XS (21-22), S (23-24), M (25-26), L (27-28),
XL (29-30), XXL (31-32)
• Youth inseam – XS (23”), S (24”), M (25”), L (26”),
XL (27”), XXL (28”);
ƙRMWLIHLIQ[MXLRSIPEWXMG
PP350MRP MSRP: Men’s $49.80
Youth $45.70
BG/B
&+2
BG/R
BG/S
W/B
;2
W/R
W/S
8)'832Ž92,)11)(4%28QIRŞWERH]SYXL
ť7XVEMKLXƙXYRLIQQIHTERX
• Men’s sizes – S (28-30), M (32-34), L (36-38), XL (40-42),
XXL (44-46) ; with 37” inseam
*May be hemmed with or
without elastic: inseam: 16”-36”
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30),
XXL (31-32); with 33” inseam *May be
hemmed with or without elastic:
inseam: 10”-32”
MSRP: Men’s $42.60
Youth $38.50
BP350/YBP350
8)'832Ž'0%77-'*-84%28QIRŞWERH]SYXL
ť'PEWWMGƙXTERX[MXLIPEWXMGLIQ
• Men’s sizes – S (28-30), M (32-34), L (36-38),
XL (40-42), XXL (44-46)
• Men’s inseam – S (28”), M-L (30”), XL-XXL (31”)
• Youth sizes – S (23-24), M (25-26), L (27-28),
XL (29-30), XXL (31-32)
• Youth inseam – S (23”), M (24”), L (25”), XL (26”), XXL (27”)
MSRP Men’s $36.50
Youth $30.80
BG
BG
W
W
RAWLINGS.COM
111
CUSTOM
BASEBALL PACKAGES
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
HOW TO ORDER RAWLINGS BASEBALL JERSEYS:
1. CHOOSE AND DESIGN YOUR JERSEY
2. CHOOSE YOUR DECORATION TYPE AND COLORS
Pricing shown includes standard decoration!
VaporFusion™ Twill (VT)
standard decoration includes:
Perma Print (PP)
standard decoration includes:
7YFPMQEXIH8[MPP8IEQ2EQISV0SKS
4IVQE4VMRX8IEQ2EQISV0SKS
7YFPMQEXIH8[MPP*VSRX
&EGO2YQFIVW
4IVQE4VMRX*VSRX
&EGO2YQFIVW
VT Package Details:
Team Name and Numbers include solid color or
sublimated design with up to two (2) solid outlines.
112
3. GIVE US YOUR PLAYER SIZES AND NUMBERS
PP Package Details:
Team Name and Numbers can be
one (1) or two (2) colors.
Braid options OP1, OP2, OP3 included in VT Package, where available. All stock fonts included. Custom artwork available with $200.00 creation charge. Fee waived if Vector or Digitized artwork is provided.
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CUSTOM
BASEBALL PACKAGES
PRO CUSTOM JERSEYS
&0%2/
:%436*97-32Ž
8;-00:8
4)61%
46-2844
ADULT
$90.00
$130.00
$110.00
YOUTH
$90.00
$130.00
$110.00
Shown in pricelist as Pro Baseball Jerseys (RPBJ/RYPBJ)
Pro Available Fabrics: 140
COLLEGIATE CUSTOM JERSEYS
&0%2/
:%436*97-32Ž
8;-00:8
4)61%
46-2844
ADULT
$70.00
$120.00
$90.00
YOUTH
$70.00
$120.00
$90.00
Shown in pricelist as Collegiate Baseball Jerseys (RCBJ/RYCBJ)
Collegiate Available Fabrics: 22, 67, 77, 350, 95, 139, 150
TRAVELBALL CUSTOM JERSEYS
&0%2/
:%436*97-32Ž
8;-00:8
4)61%
46-2844
ADULT
$60.00
$110.00
$74.00
YOUTH
$60.00
$110.00
$74.00
Shown in pricelist as Travelball Baseball Jerseys (RTBJ/RYTBJ)
Travelball Available Fabrics: 79, 167
PRO CUSTOM PANTS
&0%2/
3434
&6%-(
ADULT
$110.00
$124.00
YOUTH
$80.00
$94.00
Shown in price list as Pro Custom Baseball Pants (RPBP/RYPBP)
Available Fabrics: 140
COLLEGIATE CUSTOM PANTS
&0%2/
3434
&6%-(
ADULT
$100.00
$114.00
YOUTH
$70.00
$84.00
Shown in pricelist as Collegiate Custom Baseball Pants (RCBP/RYCBP)
Available Fabrics: 350, 150, 139, 95
=398,7->)7%:%-0%&0);,)6)-2(-'%8)(
RAWLINGS.COM
113
CUSTOM
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
NEW
CROAD (men’s)
YCROAD (youth)
• 2-button jersey with henley placket
• Color 1 - 1/8” piping on front shoulder seams and side seams (option to delete)
• Color 2 - Body
• Color 3 - Side inserts
• Color 4 - Side insert accents
• Color 5 - Upper back insert
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CPVN (men’s)
YCPVN (youth)
ť6IPE\IHƙXTERX[MXL:RSXGLMRWIVX
• Color 2 - body
• Color 3 - V-Notch Insert
• Color 4 - Pocket welts
• Color 5 - Rawlings Oval R®
• Men’s sizes – 28-42 (even sizes only)
ť1IRŞWMRWIEQśšƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL(31-32)
ť=SYXLMRWIEQś7š1š0š<0š<<0šƙRMWLIHLIQ[MXLRSIPEWXMG
MSRP: Men’s $110.00
Youth $80.00
CROAD shown with 4” Perma Print, Fancy, Vertical Arch,
“WARRIORS” PL2; 4” Perma Print Fancy Number PL6;
8” Perma Print Fancy Number PL30
CPVN shown with OP4 1/8”
NEW
CJDIP (men’s)
YCJDIP (youth)
• 2-button jersey with baseball-style placket
• Color 2 - body
• Color 3 - sleeve insert front and back
• Color 4 - side insert front and back
MSRP: Men’s $90.00
Youth $90.00
CPRO (men’s)
YCPRO (youth)
• Custom cut, semi-relaxed PRO150 pattern
• Men’s sizes – 30-44 (even sizes only)
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – S (24”), M (25”), L (26”), XL (27”), XXL (28”)
MSRP: Men’s $110.00
Youth $80.00
114
CJDIP shown with Best Size, Script w/ tail,
Slanted, “Camden” PL2; 4” NCAA Number PL6;
8” NCAA Number PL30
CPRO shown with OP4, 3/8” Pattern 3
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CUSTOM
APPAREL
BBSS (men’s)
YBBSS (youth)
• Sleeveless full-button front jersey
• Color 2 - Body
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CPROB (men’s)
YCPROB (youth)
• 2-color braid around belt loops, down side seams,
and on pocket openings
• Color 2 – body
• Color 3 – front stripe
• Color 4 – back stripe
• Color 5 – Rawlings Oval R®
MSRP: Men’s $124.00
Youth $94.00
BBSS shown with OP1, 3/8” pattern 6; Best Size,
Script w/ tail, Slanted, “Broncos” PL2; 4” Full Block
Number PL6; 8” Full Block Number PL30
3/8” Pattern 6
NEW N
OPTIO
CS5 (men’s)
YCS5 (youth)
• Full-button front jersey with raglan sleeves
• Color 2 - Body
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CS5 shown with OP3, 1” pattern 3;
4” Full Block, Vertical Arch, “HOFSTRA” PL2;
8” Full Block Number PL30
CPRO shown with OP4, 1” Pattern 3;
RIBWST option, pattern 3
CPRO QIRŞWWLS[R[MXL6-&;78
YCPRO (youth)
• RIBWST option: 2 ½” rib knit waistband for men, 2” for youth
• SEE PAGE 114
RAWLINGS.COM
115
CUSTOM
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CSSF (men’s)
YCSSF (youth)
• Full-button front jersey with raglan sleeves
• Color 2 - body
• Color 3 - right sleeve
• Color 4 - left sleeve
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes - S-XL
MSRP: Men’s $90.00
Youth $90.00
CPK (men’s)
YCPK (youth)
• Custom knee-length pant with elastic hem
• Color 2 - body
• Men’s sizes – 28-44 (even sizes only)
• Men’s inseam – 28-30 (16”); all other sizes (18”)
• Youth sizes: S (23-24), M (25-26), L (27-38), XL (29-30), XXL (31-32)
• Youth inseam: S (10”), M (12”), L (14”), XL-XXL (16”)
MSRP: Men’s $110.00
Youth $80.00
CSSF shown with best size, custom logo PL2, 3”
Method numbers PL16R
CPK shown with OP4, 1/2” pattern 6
CSSP (men’s)
YCSSP (youth)
• 1-button front jersey with raglan sleeves
• Color 2 - body
• Color 3 - right sleeve
• Color 4 - left sleeve
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes - S-XL
MSRP: Men’s $90.00
Youth $90.00
CP5 (men’s)
YCP5 (youth)
ť8VEHMXMSREPƙXTERX[MXLIPEWXMGLIQGYWXSQ&4TEXXIVR
• Men’s sizes – 28-42 (even sizes only)
• Men’s inseam – 29”
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL (31-32)
• Youth inseam – S (17 ½), M (19 ½), L (21 ½), XL (22 ½), XXL (23 ½)
MSRP: Men’s $110.00
Youth $80.00
CSSP shown with OP3, 3/8” Pattern 3;
4” Arizona, Vertical Arch “VALHALLA” PL2;
4” Arizona Number PL6
CP5 shown with OP4, 3/8” Pattern 3
116
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CUSTOM
APPAREL
CS10C (men’s)
• Full-button front jersey with set-in sleeves
• Color 2: body
• Color 3: sleeves
• Men’s sizes – 34-48 (even sizes only)
MSRP: $90.00
CP5MR (men’s)
YCP5MR (youth)
ť6IPE\IHƙXTERX
• Color 2 - body
• Men’s sizes – 28-42 (even sizes only)
ť1IRŞWMRWIEQśšƙRMWLIHLIQ[MXLRSIPEWXMG
• Youth sizes – S (23-24), M (25-26), L (27-28), XL (29-30), XXL(31-32)
ť=SYXLMRWIEQś7š1š0š<0š<<0šƙRMWLIHLIQ
with no elastic
MSRP: Men’s $110.00
Youth $80.00
CS10C shown with OP2, 3/8" Pattern 3;
4" Connecticut, Arc, “PANTHERS” PL2;
4" Connecticut Number PL6;
BUTTON option
CP5MR shown with OP4, 3/8" Pattern 3
CS2 (men’s)
YCS2 (youth)
• Pullover v-neck jersey with set-in sleeves
• 1” rib knit neck trim standard
• 2” rib knit sleeve end trim standard (option to change to 1” or omit)
• Color 2 - body
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CPRO 7IITEKI
CS2 shown with 1” rib knit neck and 2” rib knit cuffs;
Best Size, Script w/ tail, Slanted, “Johnnies” PL2;
4” Full Block Number PL6; 8” Full Block Number PL30
CPRO shown with OP4, 1” Pattern 3; RIBWST option, pattern 3
RAWLINGS.COM
117
CUSTOM
APPAREL
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CJP2 shown with OP3-, 3/8” pattern 3;
Best Size, Script, Slanted, “Thomas” PL2;
4” Full Block Number PL6
RP150 shown with OP4, 3/8” Pattern 3
CJSB shown with 4” Sublimated
Bridged Arch, Straight, “CLOVER” PL2;
4” Sublimated Full Block Number PL6;
BUTTON option
CPRO shown with OP4, 3/8” Pattern 3
CJSB (men’s)
YCJSB (youth)
• 2-button front jersey with set-in sleeve
• Color 2 – body
• Color 3 – side insert
• Color 4 – shoulder insert
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CJSB shown with 4" Maryland,
Vertical Arch, “HIGHLANDERS” PL2;
4" Maryland number’s PL6
CPW shown with OP4 1" Pattern 3
118
CJSB shown with best size,
custom logo PL2;
CPVN
CJP2 (men’s)
YCJP2 (youth)
ťFYXXSRTYPPSZIVNIVWI][MXLQSHMƙIHVEKPERWPIIZIW
• Straight hem bottom
• Color 2 – body
ť'SPSVśMRWIVXWEPSRKQSHMƙIHVEKPERWPIIZIWJVSRXERHFEGO
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CJP2 shown with OP3, 3/8” pattern CJP2 shown with OP3, 1" pattern 3;
3; 4” Method, Straight, “BRONCOS”
4" Miami, Straight, “OREM” PL2;
PL2; 4” Method number PL6
4" Miami 47 Number PL6;
CPK shown with OP4, 1/8”
BUTTON option
CPW shown with OP4, 1" pattern 3
CJDI shown with Fancy Block,
Vertical Arch “LATHROP” PL2;
4" Plain Block Number PL6
CPVN shown with OP4C, 1/8"
CJDI (men’s)
YCJDI (youth)
ť*YPPFYXXSRJVSRXNIVWI][MXLQSHMƙIHVEKPERWPIIZIW
• Color 2 – body
• Color 3 – sleeve insert front and back
• Color 4 – side insert front and back
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CJDI shown with 3” Fancy, Arc,
“WEST JORDAN” PL2; 4” Fancy
Number PL6; 2” Panther logo,
PL14; FAUX option
PP350MR shown with OP4 1/2”,
Pattern 6
CJDI shown with OP2, 3/8" pattern 3;
4" Arizona, Vertical Arch,
“PELICANS” PL2; 4" Arizona
Number PL6; Embroidered
logo PL16R
CP5MR shown with OP4 3/8", Pattern 3
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CUSTOM
APPAREL
CSUCPJ shown with 4" Times Bold,
“Cyprus” PL2; 4" Full Block Number PL6;
CJMSI shown with 3 1/2" Full Block,
Angled “WEST HAVEN” PL2;
4" Connecticut number’s PL6
CSUCFJ shown with 4” Full Block, Straight,
“APP STATE” PL2; BUTTON option
CSUCFJ (men’s)
YCSUCFJ (youth)
• Full-button front jersey with underarm panel inserts
ť'SPSVśŪšTMTMRKEPSRKJVSRXSJWPIIZIWSTXMSRXSHIPIXI
• Color 2 – body
• Color 3 – underarm inserts
• Color 4 – top/front shoulder and sleeve inserts
ť'SPSVśŪšTMTMRKEPSRKFEGOSJWPIIZIWSTXMSRXSHIPIXI
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38- 40)
MSRP: Men’s $90.00
Youth $90.00
CSUCFJ shown with 4” Times Bold,
Vertical Arch “HOLYOKE” PL2;
4” Times Bold Number PL6;
CPW shown with OP4, 3/8”
Pattern 3
CSUCFJ shown with 4” Custom
logo, “EC” PL3; 4” Full
Block Number PL6;
CPK shown with OP4, 1/2”
Pattern 6
CSUCPJ (men’s)
YCSUCPJ (youth)
CJMSI (men’s)
• Pullover 1-button placket jersey
ť'SPSVśŪšTMTMRKEPSRKJVSRXSJWPIIZIWSTXMSRXSHIPIXI
• Color 2 – body
• Color 3 – underarm inserts
• Color 4 – top/front shoulder and sleeve inserts
ť'SPSVśŪšTMTMRKEPSRKFEGOSJWPIIZIWSTXMSRXSHIPIXI
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CSUCPJ shown with 4 1/2” Fancy,
Vertical Arch “ROME” PL2;
4” Fancy Number PL6;
CPW shown with OP4, 3/8”,
Pattern 3
CSUCPJ shown with 4” Connecticut,
Vertical Arch “WAYNE STATE”
PL2; 4” Connecticut #’s PL6
CP5MR shown with OP4
1/8” Piping
• Full-button front jersey with set-in sleeves
• Color 2 – body
• Color 3 – top side insert
• Color 4 – bottom side insert
• Men’s sizes – 34-48 (even sizes only)
MSRP: $90.00
CJMSI shown with OP1, 1/8”; 4”
Fancy, Arc, “THUNDER” PL2; 4”
Sublimated Electric Fancy
Number PL6; BUTTON option
CP5MR shown with OP4 1”,
Pattern 4
CJMSI shown with OP1, 1/8”; OP3, 1/8”;
4” Fancy, Vertical Arch “VIKINGS”
PL2;
4” Fancy Number PL6
CP5MR shown with OP4, 3/8”
Pattern 3
RAWLINGS.COM
119
CUSTOM
APPAREL
CSPL shown with OP1 (color 1) 1/8”;
4” custom logo PL3; 4” Fancy number PL1
CPK shown with OP4, 1/8”
CSPL (men’s)
YCSPL (youth)
• Full-button front, 2-piece placket jersey
with raglan sleeves
• Buttons match placket color
ť'SPSVśŪšTMTMRKMRFIX[IIRTPEGOIXERHFSH]
OP1 is standard
• Color 2 – Body
• Color 3 – Placket
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CSPL shown with Best Size, Script,
Slanted, Sublimated 3-Color
“Kennedy” PL2; faux option
CPK shown with OP4, 1/8”
120
CSPL shown with OP1; OP2; OP3,
3/8” Pattern 3; 4” Fancy, Vertical
Arch “BRONCOS” PL2; 4” Fancy
Number PL6
CP5MR shown with OP4, 1” Pattern 3
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CJ3F shown with OP2 and OP3 1/8”;
Best Size, Script with tail, slanted,
“Murray” PL2; FAUX Option
CP5MR shown with OP4 1”, Pattern 3
CJ3F (men’s)
YCJ3F (youth)
ť*YPPFYXXSRJVSRXNIVWI][MXLQSHMƙIHWIXMRWPIIZIW
• Color 2 – body
• Color 3 – inserts
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CJ3F shown with OP2 3/8”, pattern 3; CJ3F shown with Best Size, Brush
Script, Slanted, “Salinas” PL2;
4” Pinline Full Block, Arc, “OLYMPUS”
BUTTON option
PL2; 4” Pinline Full Block Number
KLPHSO shown with OP4 1/8”
PL6
CP5MR shown with OP4 3/8”, Pattern 3
CJI shown with OP1 3/8”,
pattern 3; 4” Full Block,
Vertical Arch, “KCD” PL2;
3” Full Block Number PL6
CPVN shown with OP4C 3/8”,
Pattern 3
CJI (men’s)
YCJI (youth)
• Full-button front jersey with raglan sleeves
• Color 2 – body
• Color 3 – shoulder/arm insert
• Men’s sizes – 34-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CJI shown with Best Size, Fancy,
Bridged Arch “TIGERS” PL2; 4”
Maryland Number PL6
CP5MR shown with OP4, 1” Pattern 3
CJI shown with 5” Fancy, Bridged Arch
5” ends with 4” middle
“RED DEVILS” PL2;
4” Fancy number’s PL6
CP5 shown with OP4 3/8” Pattern 3
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
SS1 (men’s)
• Pullover 1-button placket jersey
• 1” rib knit collar
• Color 2 – body
• Men’s sizes – 36-48 (even sizes only)
MSRP: $90.00
FILL-IN
THROUGH 2015 SEASON
CSBI (men’s)
• Full-button front jersey with side inserts
• Standard 1 ½” ribknit on sleeve end
(option to delete)
• Color 2 – body
• Color 3 – inserts
• Men’s sizes – 36-48 (even sizes only)
MSRP: $90.00
CPW (men’s)
KLPHSO (men’s)
ť7IQMVIPE\IHƙXTERX[MXLXETIVIH
bottom hem
• Color 2 – body
• Men’s sizes – 30-44 (even sizes only)
MSRP: $110.00
CSMPPJ shown with Collar Pattern 6;
5 1/2" Full Block, Bridged Arch
“INDIANS” PL2;
4" Full Block Number PL6;
CP5MR shown with OP4, 3/8" Pattern 6
ť7XVEMKLXƙX[MXLXETIVIHEROPI
• Color 2 – body
• Sizes – 28-42 (even sizes only)
• Inseam – 33”
MSRP: $110.00
CSMPFJ shown with OP1 and OP3 1/8”;
3” Script, Slanted with tail, “Kent
State” PL2;
CPRO shown with OP4, 1/8”
CSSIFJ shown with OP1 1/8"; 5"
Full Block, Vertical Arch “LODI”
PL2; 4" Bold Block #’s PL6
CP5MR shown with OP4 3/8"
Pattern 3
CSMPPJ (men’s)
YCSMPPJ (youth)
• Pullover 1-button placket jersey with 1” rib knit collar
• Straight hem bottom
• Color 2 – body
• Color 3 – raglan sleeve panels
• Color 4 – side insert upper front panel
• Color 5 – side insert lower front panel
• Color 6 – side insert back panel
• Color 7 – back shoulder insert panel
• Men’s sizes – 36-48 (even sizes only)
• Youth sizes – S (26-28), M (30-32), L (34-36), XL (38-40)
MSRP: Men’s $90.00
Youth $90.00
CSMPFJ (men’s)
• Full-button front jersey with raglan sleeves
• Color 2 – body
• Color 3 – raglan sleeve panels
• Color 4 – side insert upper front panel
• Color 5 – side insert lower front panel
• Color 6 – side insert back panel
• Color 7 – back shoulder insert panel
• Men’s sizes – 36-48 (even sizes only)
MSRP: $90.00
CSSIFJ (men’s)
• Full-button front jersey with set-in sleeves
• Color 2 – body
• Color 3 – side inserts
• Men’s sizes – 36-48 (even sizes only)
MSRP: $9 0.00
RAWLINGS.COM
121
VAPORFUSION SUBLIMATED
BASEBALL PACKAGE
™
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
PRO SUBLIMATED
JERSEYS
ADULT
$110.00
YOUTH
$110.00
Shown in pricelist as Pro Sublimated Jerseys
(RPVFFB/RYPVFFB/RPVFP/RYPVFP)
Pro Available Fabric: 140
COLLEGIATE SUBLIMATED
JERSEYS
ADULT
$90.00
YOUTH
$90.00
Shown in pricelist as Collegiate Sublimated Jerseys
(CVFFB/CVFYFB/CVFP/CVFYP)
Collegiate Available Fabrics: 22, 67, 74, 77, 350,
139, 150, 247
TRAVELBALL SUBLIMATED
JERSEYS
ADULT
$74.00
YOUTH
$74.00
Shown in pricelist as Travelball Sublimated Jerseys
(TBVF/TBYVF)
Travelball Available Fabrics: 79, 126, 167
PRO SUBLIMATED
PANTS
ADULT
$130.00
YOUTH
$100.00
Shown in pricelist as Pro Sublimated Baseball Pants
(RPBPVF/RYPBPVF)
Available Fabrics: 140
COLLEGIATE SUBLIMATED
PANTS
ADULT
$120.00
YOUTH
$90.00
Shown in pricelist as Collegiate Sublimated Baseball Pants
(RCBPVF/RYCBPVF)
Available Fabrics: 350, 150, 139
122
=398,7->)7%:%-0%&0);,)6)-2(-'%8)(
VAPORFUSION
SUBLIMATED APPAREL
™
NEW CHIJ (men’s)
YCHIJ (youth)
• Pullover V-neck jersey with set-in sleeves
• Fully sublimated jersey
• Color 2 – Body
• Color 3 – middle stripe
• Color 4 – border stripes
• Color 5 – upper collar
• Color 6 – lower collar
• Available fabrics refer to page 134
• Men’s sizes – S-XXL
• Youth sizes – S-XL
MSRP: Men’s $110.00
Youth $110.00
HOUSJ (men’s)
YHOUSJ (youth)
• Pullover V-neck jersey with set-in sleeves
• Fully sublimated jersey
• Color 1 – Bottom of jersey and stripes
• Color 2 – Secondary stripe
• Color 3 – Tertiary stripe
• Color 4 – sleeve end and middle stripe
• Color 5 – Chest
• Color 6 – Upper collar
• Color 7 – Lower collar
• Available fabrics refer to page 134
• Men’s sizes – S-XXL
• Youth sizes – S-XL
MSRP: Men’s $110.00
Youth $110.00
RAWLINGS.COM
123
VAPORFUSION
SUBLIMATED JERSEYS
™
CS5/YCS5
CSSF/YCSSF
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
CJP2/YCJP2
S9BT/YS9BT
CSRMT/YCSRMT
CS2/YCS2
CJDI/YCJDI
&&77=&&777X]PIEPWSEZEMPEFPI
BRAID OPTIONS
OP1
OP2
OP3
Piping/Braid around neck and down
front placket of full button jersey
Ƃƃ
Piping/Braid around edge of neck
Ƃƃ
Piping/Braid around both sleeve ends
(edge of armhole for sleeveless styles)
Ƃƃ
SUBLIMATED DESIGNS
CAMO
7LS[R[MXL'SPSV7GEVPIX
'SPSV'EVHMREP'SPSV&PEGO
FLANNEL
7MQYPEXIHƚERRIPXI\XYVI
124
DIGITAL CAMO
7LS[R[MXL'SPSV;LMXI'SPSV6S]EP
'SPSV'SPYQFMEFPYI
SPLAT
7LS[R[MXL'SPSV=IPPS[
'SPSV*P+VIIR'SPSV4YVTPI
ELECTRIC
7LS[R[MXL'SPSV8I\EW3VERKI
'SPSV8IRRIWWII3VERKI
PRO STRIPE
7LS[R[MXL'SPSV;LMXI'SPSV&PEGO
FADE
7LS[R[MXL'SPSV&PEGO'SPSV'EVHMREP
TIE DYE
7LS[R[MXL'SPSV;LMXI'SPSV1EVSSR
Apparel shown with extra options.
Team names, logos and colors are for demonstration
TYVTSWIWSRP]ERHEVIRSXQIERXXSMHIRXMJ]ER]EJƙPMEXMSR[MXL
Rawlings Sporting Goods or Jarden Corporation
VAPORFUSION
SUBLIMATED PANTS
™
CP5/YCP5
CP5MR/YCP5MR
CPVN/YCPVN
CPK/YCPK
CPRO/YCPRO
SUBLIMATED DESIGNS
FLANNEL
7MQYPEXIHƚERRIPXI\XYVI
PRO STRIPE
7LS[R[MXL'SPSV;LMXI'SPSV&PEGO
CPVN/YCPVN Insert Designs:
CAMO
7LS[R[MXL'SPSV7GEVPIX
'SPSV'EVHMREP'SPSV&PEGO
FLANNEL
7MQYPEXIHƚERRIPXI\XYVI
DIGITAL CAMO
7LS[R[MXL'SPSV;LMXI'SPSV6S]EP
'SPSV'SPYQFMEFPYI
SPLAT
7LS[R[MXL'SPSV=IPPS[
'SPSV*P+VIIR'SPSV4YVTPI
ELECTRIC
7LS[R[MXL'SPSV8I\EW3VERKI
'SPSV8IRRIWWII3VERKI
PRO STRIPE
7LS[R[MXL'SPSV;LMXI'SPSV&PEGO
FADE
7LS[R[MXL'SPSV&PEGO'SPSV'EVHMREP
TIE DYE
7LS[R[MXL'SPSV;LMXI'SPSV1EVSSR
RAWLINGS.COM
125
OUTERWEAR
70)):)7
6)13:)(
B
'
(+
GR
1%
B
&3
2
49
B/S
27
R
R/B
ťTSP]IWXIVƚIIGI[MXL[E]WXVIXGL
• Team logo embroidery area below front neck
• Rib knit neck and sleeve openings
• Men’s sizes – S-3XL
• Youth sizes – M-XL
MSRP: Men’s $45.50
Youth $42.50
(+
2
R
S
BREAKRś59%68)6>-44)(.%'/)8QIRŞW
YBREAKRś59%68)6>-44)(.%'/)8]SYXL
• Water-resistant, 100% poly taffeta fabric with blue grey inserts
• Two (2) front pockets
• Curved, baseball-style hem with a drawstring cord
• Men’s sizes – S-3XL
• Youth sizes – M-L
MSRP: Men’s $33.00
Youth $31.00
126
1%
2
R
S
• Pullover jacket (100% rip-stop nylon) with zip-off removable long sleeves,
GSRXVEWXMRKKVETLMXIWPIIZIWTSP]IWXIVƚEXFEGOQIWL
• Zippered front pockets
• Bottom hem with drawstring cord
• Men’s sizes – XS-3XL
• Youth sizes – M-L
MSRP: Men’s $57.50
Youth $51.50
UDFP2 (men’s)
YUDFP2 (youth)
BG
GR
SWCHRU (men’s)
YSWCHRU (youth)
S/B
&%'/()8%-0
B
(+
S
B
(+
GR
2
TOCCJ ś'%+).%'/)8QIRŞW
YTOCCJś'%+).%'/)8]SYXL
R
• 100% Polyester with soft hand feel
• Graphite Pro Dri®-RWIVXWTSP]IWXIVƚEXFEGOQIWL
• Straight hem with a drawstring cord
• Men’s sizes – S-3XL
• Youth sizes – M-L
MSRP: Men’s $38.00
Youth $36.00
S
W
OUTERWEAR
NOW UTH
IN YO
B
GR
2
S
B
(+
GR
2
R
S
W
PFH (men’s)
YPFH (youth)
ť&VYWLIHTIVJSVQERGIƚIIGITSP]IWXIV
• MP3/phone pocket, with internal media eyelet for cord security
• V-cut neckline
• Graphite hood liner (black on graphite)
• Self-fabric hem and cuffsv
• Men’s sizes – S-3XL
• Youth sizes – S-XL
MSRP: Men’s $45.50
Youth $40.00
GR
NEW
PFP (men’s)
TPOLO QIRŞW8)%14303
• 94% polyester/ 6% spandex pique
• 6” placket length
• VaporFusion™ contrast sleeve insert
• Chest/sleeve insert 1.75” tall
ť7IPJJEFVMGPE]ƚEXGSPPEV
• Pro Dri®
• Men’s sizes: S-3XL
MSRP: $38.00
B
ť&VYWLIHTIVJSVQERGIƚIIGITSP]IWXIV
• Baseball inspired action gusset
• 1.5” woven elastic waistband with drawcord
• Angled pocket with extended depth
• Open bottom hem
• Men’s sizes – S-3XL
MSRP: Men’s $43.50
B/W
C/W
DG/W
GR/W
PU/W
N/S
R/B
S/B
EPIC (men’s)
• Pro Dri® lightweight polo
• 100% polyester mock mesh for breathability
• Self-material collar
• Men’s sizes – S-3XL
MSRP: Men’s $33.00
RAWLINGS.COM
127
OUTERWEAR
SOCKS AND BELTS
B
'
2
(+
49
GR
R
B
1%
1%
W
S
LSBASE (men’s)
YLSBASE (youth)
B
'
(+
1%
2
49
R
S
0+
W
B
(+
2
R
S
SOCK SIZE CHART
TUBEA
• Full-cushion foot
• 76% acrylic/15% nylon/9% spandex
MSRP: $4.10
B
DG MA LG BO PU CB
S
%8+
SHOE SIZE
9-12
13-3
4-9
9-12
X-SMALL
SMALL
MEDIUM
LARGE
ABELT1)2Ş7
• Pro-stretch elastic web
• Nickel plated buckle
• Leather tabs with Rawlings logo
embossed keeper
ť%HYPX3RIWM^IƙXWQSWX7M^I
MSRP: $5.10
N
R
GR
• Moisture-wicking training short 9 ½” inseam
• Two (2) side pockets
• Pro Dri® fabric 95% polyester/5% spandex with 4-way stretch
ť6IPE\IHƙXJSVQE\MQYQQSFMPMX]
• Internal drawstring
• Men’s sizes – S-3XL
• Youth sizes – S-XL
MSRP: Men’s $26.00
Youth $24.00
SOCKS AND BELTS
R
49
(+
TTS9 (men’s)
YTTS9 (youth)
ť%XLPIXMGƙXTIVJSVQERGIWLMVX[MXLVEKPERWPIIZIW
• 92% polyester/8% spandex body
• 90% polyester/10% spandex mesh inserts
• Mesh inserts on side of body and along front and back
SJVEKPERWPIIZIJSVQE\MQYQEMVƚS[
• Men’s sizes – S-3XL
• Youth sizes – M-XL
MSRP: Men’s $26.50
Youth $24.50
S
2
'&
• Crew neck, short-sleeve performance shirt with raglan sleeves
• Body – Pro Dri® 100% polyester interlock
• Inserts – Pro Dri 100% polyester pin-dot mesh
• Self-material collar
• Men’s sizes – S-3XL
• Youth sizes – S-XL
MSRP: Men’s $17.00
Youth $15.00
SRGPS (men’s)
YSRGPS (youth)
B
'
SSBASE (men’s)
YSBASE (youth)
• Crew neck, long-sleeve performance shirt with raglan sleeves
• Body – Pro Dri® 100% polyester interlock
• Inserts – Pro Dri 100% polyester pin-dot mesh
• Self-material collar
• Men’s sizes – S-3XL
• Youth sizes – S-XL
MSRP: Men’s $19.00
Youth $17.00
128
&3
S
R
N
LG BO PU CB
SOCK SIZE
5-6
7-8
9-11
10-13
ARCHCRA
• Arch support
• Half cushion foot
• 76% acrylic/15% nylon/9% spandex
MSRP: $4.60
DG MA
B
W
LG BO PU CB
S
R
N
DG MA
W
OUTERWEAR
WHILE SUPPLIES LAST
TOCTJ ś59%68)6>-44)(.%'/)8QIRŞW
YTOCTJś59%68)6>-44)(.%'/)8]SYXL
B
(+
GR
2
R
S
GDP (men’s)
• Pro Dri® moisture-wicking polo
• 95% polyester/5% spandex with 4-way stretch
• Self-material collar with backing
• Wrinkle-resistant
• Men’s sizes – S-4XL
MSRP: $38.10
B
(+
1%
2
R
S
• 100% polyester with100% rip-stop polyester inserts
• Mesh lining in the body with rayon lining in the sleeves
• Back vent and two (2) zippered front pockets
• Straight hem with a drawstring cord
• Men’s sizes – S-3XL
• Youth sizes – M-L
MSRP: Men’s $48.30
Youth $44.20
WPJH (men’s)
• 100% nylon outer
• Fully seam sealed
• Full-zip front
• Zip-off hood with reinforced bill
• Zip closure front pockets
ť%HNYWXEFPI[VMWXWXVETWJSVGYWXSQM^EFPIƙX
• Men’s sizes – S-3XL
MSRP:100.70
W
B
W/B
;(+ ;1%
B
(+
GR
2
R
S
;2
W/R
2
70
W/S
ACSJ (men’s)
• 95% polyester/5% spandex
• Full-zip front
• Raised collar
• Two (2) front pockets
• Elastic in bottom hem
• Men’s sizes – S-3XL
MSRP: $36.00
B
(+
R
S
CCJ ś'%+).%'/)8QIRŞW
• 96% polyester/4% spandex shell with Pro Dri® inserts and mesh
• Straight hem with drawstring cord
• Rib knit inserts on back shoulder
ť6IƚIGXMZITMTMRKEVSYRH^MTTIV
• Men’s sizes – S-3XL
MSRP: $46.30
ACSP (men’s)
• 95% polyester/5% spandex
• Elastic waist with internal drawstring
• Two (2) front pockets and one (1)
back pocket
• Quarter-zip from bottom hem
• Men’s sizes – S-3XL
• Men’s inseam – 32”
MSRP: $36.00
RMS9 (men’s)
• 100% polyester 70 denier tricot mesh
• Cover elastic waistband with inside draw cord
• 2-ply fabric
• Men’s sizes – XXS-3XL
• 7” inseam (2XS – XS)
• 9” inseam (S – 3XL)
MSRP: $9.00
B
(+
2
R
B
(+
2
R
S
S
RAWLINGS.COM
129
APPAREL FABRIC COLOR CHART
C
S
BO
TX
LG
P
KG
DG
CB
R
N
PU
VG PINK
Blue Grey
Dark Brown
Maroon
Cardinal
Scarlet
Burnt Orange
Texas Orange
Light Gold
Putty
Kelly Green
Dark Green
Vegas Gold
X
X
X
X
X
X
X
X
Pink
MA
Purple
DB
Navy
BG
Royal
SG
Columbia Blue
GR
Silver Grey
Black
Please use the Material Number and
Color Code when placing your order.
W
White
B
Graphite
COLOR CODE
MATERIAL NUMBER AND DESCRIPTION
TRAVELBALL FABRICS AND COLORS
TRAVELBALL FABRICS AND COLORS
X
X
X
X
22
100% polyester Moisture Management
X
X
X
55
100% nylon tricot mesh heavyweight /
white 100% polyester Moisture Management
X
X
X
67
100% polyester mesh heavyweight Moisture Management
X
X
74
95% polyester / 5% spandex with 4-way stretch
77
88%/12% nylon/spandex / white 88%/12% poly/spandex
X
X
95
100% polyester warp knit with knitted pinstripe
Moisture Management
79
100% polyester microfiber Moisture Management
126
100% polyester lightweight flatback mesh
167
100% polyester pindot mesh Moisture Management
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
COLLEGIATE FABRICS AND COLORS
X
X
X
X
X
X
COLLEGIATE FABRICS AND COLORS
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
X
139
100% polyester double knit heavyweight
Moisture Management
X
X
150
100% polyester circular knit Moisture Management
X
X
X
X
X
X
X
247
92% polyester / 8% spandex pointelle stretch mesh
350
100% polyester warp knit Moisture Management
X
X
X
X
X
X
X
X
X
X
X
X
PRO FABRICS AND COLORS
140
X
X
PRO FABRICS AND COLORS
88% polyester/12% spandex circular knit
Moisture Management
X
X
X
X
X
X
X
X
X
X
MATCHING COLORS:
There is no known process which can positively regulate the final results when
cotton, polyester or nylon yarns or cloth are dyed in both yarns and fabrics. Even
though the finest dyes are used, each lot may absorb the color in a different manner and vary in shading when finished. Every possible effort is made to match
colors as closely as the peculiarities in dyes and dye action will permit, but the
situation is not controllable.
All orders are handled by us with the understanding that the purchaser realizes
these conditions and accepts the responsibility for any variations within standard
tolerances. Fabric of 100% polyester or polyester blends in dark shades contain
dyes that may tint light colors of Perma-Print® ink. Rawlings® will not assume
responsibility should this occur.
MEN’S SIZING
YOUTH SIZING
JERSEY SIZE
S
M
L
XL
2XL
3XL
JERSEY SIZE
S
M
L
XL
2XL
3XL
Chest in inches
34/36
38/40
42/44
46/48
50/52
54/56
Chest in inches
22/24
26/28
30/32
34/36
38/40
42/44
S
M
L
XL
2XL
3XL
PANT SIZE
S
M
L
XL
2XL
3XL
28/30
32/34
36/38
40/42
44/46
48/50
Waist in inches
21/22
22/23
24/25
26/27
28/29
30/31
PANT SIZE
Waist in inches
130
DECORATION PACKAGES
PERMA PRINT
FRONT
BACK
FRONT
BACK
PPST1
PPST2
PL2: 1 color, 3" or 4" team name
PL30: 1 color, 8" number
MSRP: $10.00
PL2: 2 color, 3" or 4" team name
PL30: 2 color, 8" number
MSRP: $14.00
SUBLIMATED TWILL
FRONT
BACK
FRONT
BACK
VAPST
VAPPR
PL2: 3" or 4" team name
PL30: 8" number
MSRP: $42.00
PL2: 3" or 4" team name
PL4 or PL6: 3" or 4" number
PL30: 8" number
MSRP: $50.00
*Tail (PL2T) can be included at no charge for all packages for team names in Script or Brush Script fonts.
RAWLINGS.COM
131
JERSEY OPTIONS
OP1
OP2
OP3
Piping/Braid around neck and down
front placket of full button jersey
ǩǪòô
MSRP: $9.00
Piping/Braid around edge of neck
ǩǪ
MSRP: $5.50
Piping/Braid around both sleeve ends
(edge of armhole for sleeveless styles)
ǩǪ
MSRP: $8.00
BRDC
OP17
OP18
Piping/Braid along front and back
raglan sleeve seams
(Custom only) ǩǪò
MSRP: $6.50
Piping/Braid along top of shoulder from
neck to sleeve end on set-in sleeve jersey
(Custom only) ǩǪò
MSRP: $8.00
Piping/Braid down sideseam of jersey
(Custom only) ǩǪòôò
MSRP: $9.00
BUTTON
FAUX
FAUX
BUTTONS
Change button color
(Custom only)
N/C
Faux-button placket on any full button jersey
(Custom only)
N/C
OPTIONS
SUGGESTED LIST
OP8
Arched nameplate sewn to jersey. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$9.00
OP9
Straight nameplate, sewn to jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$10.00
OP10
Arched or straight nameplate not attached . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$6.50
OP11
ID Tags sewn in jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$5.50
OP12
Attach customer supplied patch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$7.00
OP13
Attach American flag patch (2" x 3") . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$7.00
OP14
Velcro added between 2nd and 3rd buttons
(Stock only, this is standard on custom jerseys) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$3.50
EEL
Extra Length (Custom only)
EEL: 1" – 6". . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$8.50
EEL7: 7"+ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$15.50
132
BRANDING - The Oval R cannot be removed from Rawlings® garments
PANT OPTIONS
RIBWST
OP15
OP4
òRib Knit Waistband
(2” Youth)
MSRP: $9.90
Piping/Braid down both sideseams of pant
ǩǪòô
MSRP: Piping/Braid around tunnel loops
(Custom only) ǩǪ
MSRP: V-NOTCH
Piping/Braid along V-notch of BPVP or CPVN pant ǩ, Ǫ
OP4 - $11.00
OP4B - $11.00
OP4C - $11.00
Along front of V-notch,
down sideseams
Along back of V-notch,
down sideseams
Along front and back of V-notch,
down sideseams
OPTIONS
SUGGESTED LIST
OP5
Specify hemmed length for un-hemmed pants. Must be ordered in whole inches
(stock only). Please specify with or without elastic . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .N/C
OP11
ID Tags sewn in pant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$5.50
EEL
Extra Length (Custom only)
EEL: 1" – 6". . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$8.50
EEL7: 7"+ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$15.50
BRANDING - The Oval R cannot be removed from Rawlings® garments
RAWLINGS.COM
133
VaporFusion™ is the process of fusing ink into fabric fibers to create permanently bonded colors.
This state-of-the-art equipment is used to decorate Rawlings’ finest premium fabrics and twill.
VaporFusion™ is lighter, faster, and more durable.
SUBLIMATED TWILL
• Twill just got faster – 24% lighter than standard 1 color twill
• Twill just got more functional –has more “give” than standard twill applications
• Twill just got more personal – boundless customization with 30+ colors
3-COLOR
CAMO
WITH 2 OUTLINE COLORS
Use any of these stock designs on any custom garment inserts or sublimated twill. No art charge for these designs.
134
BUSTED DOTS
BUSTED HONEYCOMB
CAMO
CHECK
Shown with Color 1: Black
Color 2: Burnt Orange
Shown with Color 1: White Color 2: Teal
Shown with Color 1: Scarlet
Color 2: Cardinal Color 3: Black
Shown with Color 1: Dark Green
Color 2: Kelly Green
DIGITAL CAMO
ELECTRIC
FADE
FLANNEL
Shown with Color 1: White Color 2: Royal
Color 3: Columbia blue
Shown with Color 1: Texas Orange
Color 2: Tennessee Orange
Shown with Color 1: Black Color 2: Cardinal
Simulated flannel texture
GRADIENT DOTS
PLATED
SCRATCH
SHUTTER
Shown with Color 1: Light Gold Color 2:
Black
Shown with Color 1: Dark Green
Color 2: * plate design is always Silver Gray
Shown with Color 1: Royal
Color 2: Black
Shown with Color 1: Black Color 2: Cardinal
SPLAT
SPLIT
STRIPE
TIE DYE
Shown with Color 1: Yellow
Color 2: Fl. Green Color 3: Purple
Shown with Color 1: Columbia Blue
Color 2: Blue Gray Color 3: Marlin Blue
Shown with Color 1: White Color 2: Black
Shown with Color 1: White Color 2: Maroon
SUBLIMATED TWILL ORDERING INFORMATION
SUBLIMATED TWILL LETTERS AND NUMBERS
• Choose Font Pg. 144-145
• Choose Letter Configuration Pg. 146 (N/A for Numbers)
• Choose Size (2” – 12”, whole inches)
• Choose Colors (Up to 3 colors) or Choose a Design and add up to 2 Solid Outlines
Script or Brush Script letters are priced
per location, based on how many letters
SIZE
Numbers and other Letter Fonts are
priced per digit, based on size
PRICING
SIZE
1-COLOR
1-5 Letters
PSBS1 - $18.00
2"-6"
PSBT1 - $5.50
6-10 Letters
PSBS2 - $24.00
7"-12"
PSBT2 - $7.50
11+ Letters
PSBS3 - $30.00
Add Tail
PBSBT - $7.00
NOTES: TAIL OPTIONS
SUBLIMATED TWILL MONOGRAMS – Two or three interlocking/touching letters
• Choose Font Pg.144-145
• Choose Monogram Configuration Pg.146
• Choose Size
• Choose Colors
Sublimated Twill Monograms are priced per location,
based on quantity of garments.
# OF PIECES
1-5 Garments
SBM1C1 - $20.00
6-48 Garments
SBM2C1 - $13.00
49+ Garments
SBM3C1 - $12.50
SUBLIMATED TWILL PATCH – Sublimated Logo on Twill Patch, sewn to garment
• Choose a Stock Sublimation Logo Pg XXX, or send us yours
Sublimated Twill Patches are priced per location, based on size
SIZE
PRICING
Up to 4"
4"+
PSBP4 - $9.00
PSBP4+ - $13.00
SUBLIMATED TWILL ARTWORK/CUTTING CHARGES
• Cutting Charges apply for all Sublimated Twill orders
New Custom Artwork Creation
CSPAC2 - $200.00
New Stock Artwork Creation
PPTC - $70.00
Repeat Artwork or Stock Numbers Only
RTC - $32.00
COLOR AVAILABILITY:
BLACK
WHITE
GRAPHITE
SILVER GREY
BLUE GREY
KELLY GREEN
DARK GREEN
MARLIN BLUE
COLUMBIA BLUE
ROYAL
DARK BROWN
MAROON
CARDINAL
SCARLET
HOT PINK
NAVY
PURPLE
LIGHT PINK
BURNT ORANGE
TEXAS ORANGE
LIGHT GOLD
LIGHT OLD GOLD
VEGAS GOLD
OLD GOLD
TENNESSEE ORANGE
AFA BLUE
AQUA
CAMO TAN
CAMO GREEN
CAMO BROWN
YELLOW
LIME GREEN
TEAL
PUTTY
FL. BLUE
FL. GREEN
RAWLINGS.COM
135
PERMA-PRINT® ORDERING INFORMATION
PERMA PRINT® LETTERS AND NUMBERS
NOTES:
• Choose Font Pg. 144-145
• Choose Letter or Monogram Configuration Pg. 146 (N/A for Numbers)
• Choose Size (3", 4", 6", 8", 10", or 12") Select fonts available in 2". See font list Pg. 144-145.
• Choose Colors (See font for number of colors available)
1. Perma-Print® is a screen printing process
unique to Rawlings® and Worth®.
2. Flexible Plastisol Printing adheres to most
knitted garments, will not crack or peel, and
stretches with the garment.
3. Perma-Print® lettering is washable.
Do not dry clean or iron.
4. Rawlings® and Worth® carry several stock
designs, however, if you do not find one that
meets your needs, our artists will design one
to your specifications for a nominal pattern
charge. Art is kept on file for 2 years under
the invoice number of the order. After this
time
the art is destroyed. All re-orders received
without the original invoice number will be
charged as a new design. If you change
garments, locations, colors, size, etc. the
artwork
may have to be redone.
5. Rawlings® and Worth® cannot guarantee
any screening performed by a dealer’s own
screening operation.
6. Finished digital artwork in EPS, vector format
must accompany any order for non-standard
or new designs.
7. Fabric of 100% polyester or polyester blends
in dark shades contain dyes that may tint
light colors of Perma-Print® ink. Rawlings®
and Worth® will not assume responsibility for
this happening.
8. Screenprinting may cause the garment to
shrink up to 5%.
Perma Print® Letters and Numbers are priced per location, based on
quantity of garments and number of colors.
# OF PIECES
1-COLOR
2-COLORS
3-COLORS
1-5 Garments
$8.00
$10.00
$12.00
6-48 Garments
$4.00
$6.00
$8.00
49+ Garments
$3.50
$5.50
$7.50
Add Tail
Included with Script and Brush Script fonts
PERMA PRINT® MASCOTS
• Choose a Stock Perma Print® Mascot from Pg. 137, or send us yours
• Choose Colors (1 or 2 colors for Stock Mascots, up to 4 Colors Custom
Mascots are priced per location, based on quantity of garments and
number of colors.
# OF PIECES
1-COLOR
2-COLORS
3-COLORS
4-COLORS
1-5 Garments
$8.00
$10.00
$12.00
$14.00
6-48 Garments
$4.00
$6.00
$8.00
$10.00
49+ Garments
$3.50
$5.50
$7.50
$9.50
NOTES: TAIL OPTIONS
PERMA PRINT® ARTWORK/SCREEN CREATION CHARGES
• Screen Creation Charges apply for all Perma Print® Letters and Mascots
New Custom Artwork Creation
CSPAC2 - $200.00
New Stock Artwork Creation
PPSC - $50.00
Repeat Stock or Custom Artwork
PPSRC - $12.00
COLOR AVAILABILITY:
BO TX LG
LT OG VG AZ
K
DG AQ MB CB AF
R
Royal
A.F.A. Blue
Columbia Blue
Aqua
Marlin Blue
Dark Green
Aztec Gold
Kelly Green
Old Gold
Vegas Gold
Light Old Gold
Light Gold
Texas Orange
Scarlet
Burnt Orange
N
PU
Navy
S
Purple
C
Cardinal
Hot Pink
Light Pink
Dark Maroon
Blue Grey
Dark Brown
Silver Grey
PL SG BG DB DM HP LP
White
Black
136
W
Platinum
B
PERMA–PRINT® AND VAPORFUSION™ STOCK MASCOTS
PPMAS1 • One Color Mascot
PPMAS2 • Two Color Mascot
Stock Mascots offered in 1 or 2 colors. Must be ordered as pictured with the black portion as
one color and the white as the other color. If design or color specifications are altered, the art
is no longer stock and will be considered custom.
A1
EAGLE 1
H2
BIRD 8
BIRD 10
A3
RAM 1
BULLDOG 2
D4
BEAR 1
F6
F2
KNIGHT 2
STAR 5
G2
KNIGHT 3
E8
L29
BASEBALL 1
I30
LIGHTNING 2
D5
PANTHER 1
L26
PIRATE 8
C4
BRAVE 2
L18
PAW 15
WILDCAT 1
PIRATE 3
SPARTAN 2
PAW 1
G3
MISC 3
D6
COMIC TROJAN
D3
H18
PAW 11
J16
INSECT 3
H37
MISC 15
TIGER 1
PAW 2
DEVIL
A7
B6
C3
J35
I7
CARDINAL 1
G4
MUSTANG 2
A5
G6
G8
HORSE 9
F7
BULLDOG 3
PIRATE 2
H7
HORSE 8
E7
K3
BIRD 18
L6
HORSE 5
D7
N2
BIRD 14
B3
RAM 2
BULLDOG 1
J2
STAR 3
J37
MISC 17
J29
USFL
VaporFusion Only
US FLAG
These drawings are for illustration purposes only. Rawlings® expressly disclaims any rights in these mascot drawings. The customer is solely responsible
for obtaining permission or a license to use proprietary marks.
RAWLINGS.COM
137
PRO TWILL™ ORDERING INFORMATION
PRO TWILL™ LETTERS AND NUMBERS
NOTES: TAIL OPTIONS
• Choose Font Pg. 144-145
• Choose Letter Configuration Pg. 146 (N/A for Numbers)
• Choose Size (2"-12" in whole inch increments)
• Choose Colors (Up to 3 colors)
Script and Brush Script letters are priced per location, based on how
many letters, and number of colors.
S3C3 - $36.00
SCT2 - $7.00
SCT3 - $10.00
Numbers and other Letter Fonts are priced per digit, based on size and
number of colors.
SIZE
1-COLOR
2-COLORS
3-COLORS
2"-6"
T1C1 - $3.50
T1C2 - $5.50
T1C3 - $7.50
7"-12"
T2C1 - $5.50
T2C2 - $7.50
T2C3 - $9.50
PRO TWILL™ MONOGRAMS – Two or three interlocking/touching letters
• Choose Font Pg.144-145
• Choose Monogram Configuration Pg.146
• Choose Size
• Choose Colors
Twill Monograms are priced per location, based on quantity of garments
and number of colors.
# OF PIECES
1-COLOR
2-COLORS
3-COLORS
1-5 Garments
M1C1 - $16.00
M1C2 - $20.00
M1C3 - $24.00
6-48 Garments
M2C1 - $9.00
M2C2 - $13.00
M2C3 - $17.00
49+ Garments
M3C1 - $8.50
M3C2 - $12.50
M3C3 - $16.50
PRO TWILL™ ARTWORK/SCREEN CREATION CHARGES
• Cutting Charges apply for all Pro Twill™ orders
New Custom Artwork Creation
CSPAC2 - $200.00
New Stock Artwork Creation
PPTC - $70.00
Repeat Artwork or Stock Numbers Only
RTC - $32.00
138
PU
S3C2 - $30.00
SCT1 - $4.00
Purple
N
S3C1 - $24.00
Add Tail
Navy
R
11+ Letters
COLOR AVAILABILITY:
Royal
DG AQ MB CB
S2C3 - $30.00
Columbia Blue
K
S2C2 - $24.00
Kelly Green
LT OG VG
S2C1 - $18.00
Vegas Gold
BO TX TO LG
6-10 Letters
S
S1C3 - $24.00
Marlin Blue
Aqua
Dark Green
Old Gold
Light Old Gold
Light Gold
Tennessee Orange
Texas Orange
Burnt Orange
Scarlet
C
3-COLORS
S1C2 - $18.00
Cardinal
W SG DB DM HP LP
2-COLORS
S1C1 - $12.00
Light Pink
Hot Pink
Dark Maroon
Dark Brown
Silver Grey
White
B
1-COLOR
1-5 Letters
Black
GR
# OF LETTERS
Graphite
⁄8" BRAID,
PATTERN #3
PU
LG
S
S
R
R
R
N
N
N
B
N
STOCK TRIMS
B
W
LG
PU
W - White
W
S
VG - Vegas Gold
SG - Silver Grey
GR - Graphite
S
B
BO
S - Scarlet
R - Royal
PU - Purple
R
R
N - Navy Blue
DM - Dark Maroon
R
W
B
CB
LG - Light Gold
N
LG
DG - Dark Green
K - Kelly Green
N
W
N
CB - Columbia Blue
C - Cardinal
BO - Burnt Orange
⁄8" PIPING,
PATTERN #1
1
B - Black
B
N
S
S
3
PU OG VG
Vegas Gold
N
Navy
R
Royal
DG AQ MB CB AF
RIBKNIT™ COLOR CHART
A.F.A. Blue
Old Gold
Purple
Columbia Blue
Marlin Blue
Aqua
K
Kelly Green
LT
Light Old Gold
TX BO TO LG
Dark Green
Light Gold
Tennessee Orange
Burnt Orange
S
Scarlet
C
Cardinal
W SG BG DB DM HP LP
Texas Orange
Light Pink
Hot Pink
Dark Maroon
Dark Brown
Blue Grey
Silver Grey
B
Black
GR
White
Graphite
RAWLINGS.COM
139
STOCK EMBROIDERY ORDERING INFORMATION
EMBROIDERED LETTERS AND NUMBERS
NOTES:
• Choose Font and Configuration Pg. 141
• Choose Size (3⁄8", 1⁄2", 5⁄8", 3⁄4", 1", 1 1⁄2")
• Choose Colors (1 or 2 Colors, 2nd color is outline)
• No set up charge for stock embroidery.
Pay only the application charge.
• One color or two color letters and numbers.
• Letters can be in one or two lines in
conjunction with the stock embroidery.
• Lettering is limited to one line above and one line
below stock design.
Embroidered letter and numbers are priced per location, based on
quantity of garments.
LINE 1
LINE 2
1-48 Garments
$7.00
$7.00
49+ Garments
$5.00
$5.00
COLOR AVAILABILITY:
$8.00
$14.00
$20.00
49+ Garments
$6.00
$12.00
$18.00
EMBROIDERY DIGITIZING CHARGES
• Digitizing Charges apply for all New Custom Embroidery
SIZE
2" x 2"
3.5" x 3.5"
4"
APPROX STITCHES
1-4,999
$60.00
5,000-9,999
$130.00
10,000+
$200.00
Vegas Gold
140
Dark Green
Old Gold
Light Old Gold
Tennessee Orange
Scarlet
Light Gold
Burnt Orange
Cardinal
Light Pink
B
Digitizing charge does not apply when Stock Font, Configuration and/or Mascots are used
Fees waived for custom artwork if a digitized file is provided, and no modifications are necessary
N
1-48 Garments
R
4"x4" (Custom only)
DG MB CB
3.5"x3.5"
K
2"x2"
Kelly Green
Marlin Blue
BO TO LG
# OF PIECES
Columbia Blue
S
Embroidered Mascots are priced per location, based on quantity of garments.
Navy
Royal
C
• Choose a Stock Embroidery Mascot Pg.142
• Choose Logo Size: 2" or 3.5"
• Choose Colors (Color sequence specified below each logo)
OR
• Send us your Mascot
• Choose size (1"-4", in ½" increments)
• Specify Colors to be used, and description of where each color is to be applied
• Digitizing Charge applicable for new custom artwork
W SG DB DM HP LP
EMBROIDERED MASCOTS
Purple
LT OG VG
PU
# OF PIECES
Hot Pink
Dark Maroon
Dark Brown
Silver Grey
White
Black
STOCK EMBROIDERY OPTIONS
Lettering Configurations Offered
STRAIGHT
ARCH TEXT
REVERSE ARCH
BRIDGED ARCH
Specify end and
center height
REVERSE BRIDGED ARCH
Specify end and center height
STOCK EMBROIDERY LETTERING/NUMBERING STYLES OFFERED
Arizona
One or two colors
Bold Block
One, two or three colors
Connecticut
One, two or three colors
Fancy
One, two or three colors
Fancy Block
One, two or three colors
Maryland
One, two or three colors
Miami
One or two colors
Old English*
One, two or three colors
Pinline Full Block
Two colors only
Fabric does not show through letters. Inside and outside colors must be the same.
Brush Script*
One, two or three colors
Full Block
One, two or three colors
Plain Block
One, two or three colors
Script*
One, two or three colors
* Standard rule for Old English, Brush Script, and Script is the first letter is upper case and all other letters are lower
case. Ex: High School – must specify if all upper case letters are requested.
RAWLINGS.COM
141
STOCK EMBROIDERY DESIGNS
1. Fill
2. Outlines w/Satin
Border
Lt. Gold
Black
1. Body
2. Collar
3. Eyes, Teeth, Collar Spikes
4. Detail, Outline
Red
White
Lt. Gold
Black
1. Mouth
2. Teeth, Eyes
3. Body
4. Nose, Detail
COUGAR-112
1. Mouth
2. Teeth, Eyes
3. Body
4.Nose, Outline, Detail
Silver
Scarlet
White
Black
1. Body
2. Mouth
3. Tongue, Collar
4. Eyes, Teeth
5. Detail, Outline
Scarlet
White
Black
Silver
1. Outline
2. Ears, Face
3. Mouth
4. Eyes
5. Detail, Outline
GALLOPING MUSTANG-133
White
Black
1. Body
2. Outline
Silver
Black
Scarlet
White
Black
HUSKY-149
PANTHER-132
MUSTANG-111
1. Body
2. Detail, Outline
BULLDOG-148
BULLDOG-122
PAW PRINT-106
Vegas Gold
Black
LONGHORN-121
1. Body
TROJAN-134
Black
FIGHTING HORNET-130
1. Wings, Hands, Teeth
Center of Eye
2. Face, Arms, Body, Stinger
3. Antenna, Outside of Eye
Stripes, Detail
White
Lt. Gold
Black
1. Silhouette Fill
Scarlet
Scarlet
Lt. Gold
White
Black
CARDINAL-120
1. Face
2. Beak, Eye
3. Head
Black
Lt. Gold
Scarlet
Silver
Vegas Gold
Lt. Gold
Black
1. Face
2. Helmet
3. Feathers
4. Outline
WILDCAT-135
1. Body
2. Detail, Outline
3. Whiskers, Teeth
Lt. Gold
Black
White
CHIEF-146
RAM-154
Vegas Gold
Silver
Black
Vegas Gold
Silver
White
Black
1. Face
2. Head Band
3. Feathers
4. Beads
5. Detail, Outline
Vegas Gold
Old Gold
Cardinal
Black
1. Face
2. Bandana, Earring
3. Hat, Shirt
4. Knife, Skull, Crossbones
5. Detail, Outline
SPARTAN-113
CROSSED BATS
W/BASEBALL-137
1. Bat Fill
2. Ball Fill
3. Outline, Details
1. Mouth
2. Head
3. Teeth, Highlights, Eyes
Part of Nose, Fur
4. Whiskers, Nose, Eyes
1. Horns
2. Body
3. Eye
4. Detail, Outline
VIKING-136
1. Helmet
2. Face
3. Hair, Horn, Mustache
4. Detail, Outline
Scarlet
Lt. Gold
Black
White
TIGER HEAD-110
Vegas Gold
Silver
Scarlet
White
Black
KNIGHT ON HORSE-156
1. Horse
2. Knight, Armor
3. Detail, Outline
CARDINAL-139
1. Body
2. Beak
3. Detail, Outline
4. Eye
Scarlet
Teal
White
Lt. Gold
Black
PIRATE-145
Vegas Gold
Lt. Gold
Kelly
Silver
Black
EAGLE-100
BEAR-159
Vegas Gold
White
Black
1. Background
2. Detail, Outline
Vegas Gold
Black
1. Body
2. Head, Tail Feathers
3. Beak, Feet
4. Detail, Outline
Brown
White
Lt. Gold
Black
These drawings are for illustration purposes only. Rawlings® expressly disclaims any rights in these mascot drawings. The customer is solely responsible for
obtaining permission or a license to use proprietary marks.
DNI DESIGNS
PAW PRINT – 106B
142
1. Paw Fill
2. Outlines with satin border
BULLDOG – 122B
1. Logo Fill
2. Detail, Outline
CARDINAL – 120B
1. Face
2. Beak and Eye
3. Head
TIGER HEAD – 110B
1. Logo Fill
2. Detail, Outline
COUGAR – 112B
1. Logo Fill
2. Detail, Border
LETTERING PLACEMENT
1C
3C
Right Side
Left Side
1
1C
2
3
3C
4
5
6
Upper Right Chest – 7" down from shoulder seam
Upper Right Chest – Centered above lowest point of collar seam
Upper Center Chest – 1½" down from neck trim or between 2nd and 3rd buttons
Upper Left Chest – 7" down from shoulder seam
Upper Left Chest – Centered above lowest part of collar seam
Middle Right – 1" below name
Front Center – 1" below name
Middle Left – 1" below name
DNI
N
DNI PLACEMENT
for artwork only when the
DNI is standard on a jersey
34
14
30
30N
34
1
⁄2" Below Collar Seam
Full Back – 6" below collar seam
On Jersey – 2" down from cowl seam
Full Back – 8" below collar seam
to allow space for name plates
1" Below Center Back #’s
16
17
25
(L/R) – 1⁄2" Above Sleeve Seam
(L/R) Center Sleeve
(L/R) Side of Jersey Inside Insert
centered top to bottom
2T - Lettering in Tail
FRONT
Right Side
Left Side
33B
20
21
22
23
Upper Right Front – 6" down from raw edge top
Upper Left Front – 6" down from raw edge top
Lower Right Front – 2" up from hem and 2" in from side seam
Lower Left Front – 2" up from hem and 2" in from side seam
Back
24
27
28
33B
(L/R) Lower Side 2" up from bottom edge
(L/R) Side of Short centered from top to bottom
(L/R) Upper Side of Short 3" down from top of short
Back Tunnel Loop – Embroidery on custom pants only
RAWLINGS.COM
143
Anaheim
One, two or three colors
(No Perma-Print)
Anaheim†
One, two or three colors
(No Perma-Print)
Arizona
One or two colors
Arizona
One or two colors
Adult: 3", 4", 6", 8" and 10"
Youth: 3", 4" and 6"
Bold Block
One, two or three colors
Bold Block†
One, two or three colors
Perma Print – 1 or 2 colors only
Brush Script*
One, two or three colors
Brush Script†
One or two colors
Connecticut
One, two or three colors
Connecticut
One, two or three colors
Perma Print – 1 or 2 colors only
Fancy
One, two or three colors
Fancy†
One, two or three colors
Perma Print – 1 or 2 colors only
Fancy Block
One, two or three colors
Fancy Block
One, two or three colors
(No Perma Print)
Full Block
One, two or three colors
Full Block†
One, two or three colors
Perma Print – 1 or 2 colors only
Full Block Shadow
Two or three colors
Full Block Shadow
Two or three colors
144
* Standard rule for Times Bold, Old English, Brush Script, and Script is the first letter is upper case and all other letters are lower case.
Ex: High School – must specify if all upper case letters are requested.
† Marked number fonts also available in a 2" size for Perma Print®
Maryland
One, two or three colors
Maryland
One, two or three colors
Perma Print – 1 or 2 colors only
Method
One, two or three colors
(No Perma-Print)
Method†
One, two or three colors
(No Perma-Print)
Miami
One, two or three colors
Miami 47 - Trim Version†
One, two or three colors
Perma Print – 1 or 2 colors only
NCAA®
One or two colors
Pinline Full Block
Two colors only
Fabric does not show through letters. Inside and outside colors must be the same.
Pinline Full Block
Two colors only
Fabric does not show through letters. Inside and outside colors must be the same.
Plain Block
One, two or three colors
Plain Block†
One, two or three colors
Perma Print – 1 or 2 colors only
Pro Block
One or two colors
(Perma-Print only)
Fabric shows through letters. Inside and outside colors can be different.
Pro Block
One or two colors
(Perma-Print only)
Fabric shows through letters. Inside and outside colors can be different.
Times Bold*
One, two or three colors
Times Bold
One, two or three colors
Perma Print – 1 or 2 colors only
Old English*
One, two or three colors
Script*
One, two or three colors
* Standard rule for Times Bold, Old English, Brush Script, and Script is the first letter is upper case and all other letters are lower case.
Ex: High School – must specify if all upper case letters are requested.
† Marked number fonts also available in a 2" size for Perma Print®
RAWLINGS.COM
145
LETTERING CONFIGURATIONS
Please specify lettering configuration when ordering
STRAIGHT
SLANTED
VERTICAL ARCH
ANGLED
BRIDGED ARCH
STEP DOWN & TOUCHING
Specify each letter size
STEP DOWN & INTERLOCKING
Specify each letter size
STEP DOWN & OVERLAPPING
Specify each letter size
INTERLOCKING
Specify each letter size
STEP DOWN
Specify each letter size
146
WASHING GUIDE
DO WASH UNIFORMS PRIOR TO FIRST USE AND IMMEDIATELY AFTER EACH USE. Naturally
occurring PH levels in sweat may cause dye migration in first use. We recommend a detergent
similar to Tide™ for cold water to help decrease the chance of this happening. Prior to washing
in cool water, turning the garments inside out will help preserve Twill, Perma-Print®,
and Embroidery. Clasping Velcro® prior to washing may help prevent snagging or picking.
DO NOT WASH UNIFORMS WITH OTHER ITEMS. Bleeding may occur.
DO NOT USE BLEACH. Bleach will deteriorate fabric fibers and may cause color loss.
DO NOT OVERLOAD WASHER OR DRYER. Hang dry is recommended for best results. In the dryer,
overloading may cause the uniforms to stick together, especially those with Perma-Print® ink.
Remove garments immediately after both wash and dry cycles. To avoid static and lint build-up,
use an anti-static agent such as Bounce® Dryer Sheets.
DO NOT EXPOSE UNIFORMS TO HIGH HEAT. Excessive heat is the enemy of your uniform. Heat
presses, ironing, dry cleaning, or heat transfers may cause dye migration and may break down fabric
fibers. Also excessive heat, especially in dryers, can cause shrinkage above normal tolerances, cause
Perma-Print® ink to crack, and Twill to wrinkle. If you use a dryer, please use a “damp dry” or “air dry”
setting.
DO STORE IN A DRY, ROOM TEMPERATURE AREA, AWAY FROM DIRECT SUNLIGHT. Excessive
sunlight may cause discoloration.
Heavily soiled garments (grass, dirt, clay mud), pre-treatment is recommended
• Spray on products such as Spray’n Wash®, Shout®, or ESPRO® cleaner have been tested with
positive results.
• Products such as Stick Stain® or Shout Gel® can be used for stubborn stains.
• For blood stains, it is best to rinse in room temperature water as soon as possible, and if
necessary, soak in room temperature water before washing. One of the above pre-treatments
can also be used, or an oxygen based laundry booster such as Oxy Clean® can also be used.
• For ink stains, use hair spray as soon as possible. Delaying the application of hair spray may
decrease results. Spray on stain and rub until the ink is gone. Wash as normal.
RAWLINGS.COM
147
SALESMAN LIST
NITTOLO, MICHAEL
1906 Robin Hood Drive
Wall, NJ 07719
732.449.3757
732.449.9766 Fax
[email protected]
NJ
CORPORATE HEADQUARTERS
510 Maryville University Drive,
Suite 110
St. Louis, MO 63141 USA
Toll Free (800) RAWLINGS
Toll Free Fax (800) 468-7767
(314) 819-2800
TEAM SALES – NORTH REGION
BIALIS, GREG – VP, TEAM SALES
NORTH REGION
510 Maryville University Drive,
Suite 110
St. Louis, MO 63141
314.819.8256
314.819.2987 Fax
[email protected]
BIEG, DAN
3721 Edwards Road
St. Louis, MO 63125
314.845.1536
314.845.9602 Fax
[email protected]
EASTERN MO, SOUTHERN IL
BRINKMAN, JEFF
1915 Sweet Cider Road
Fort Wayne, IN 46818
260.490.9697 Phone/Fax option
419.388.9390 Cell
[email protected]
IN, MI, OH
CZERWIEN, CHRIS
1617 Fair Oak Drive
Rochester Hills, MI 48309
248.608.1275
248.608.1276 Fax
[email protected]
MI
DICKERSON, DAVE
779 Harvest Ridge Drive
Avon, IN 46123
317.272.2052 Fax option
[email protected]
IN
KAMLAY, TOM
5235 Yale Drive
Franklin, WI 53132
414.282.9949 Fax option
[email protected]
WI
MAUCHAN, JON
314 West 5th
West Islip, NY 11795
631.669.0307 Phone/Fax option
631.903.3376 Cell
[email protected]
LONG ISLAND, BROOKLYN
MURRAY, BILL
9839 Log House Court
Gaithersburg, MD 20882
301.515.9839
301.515.0625 Fax
[email protected]
DC, DE, MD, EASTERN PA,
MURPHY, JOHN
7973 Spartan Dr.
Youngstown, Ohio 44512
330.758.5093
330.758.5094 Fax
[email protected]
SOUTHERN OH, SOUTHWESTERN
PA, WV
NICKELL, J.W.
232 Bartholomew Blvd
Jeffersonville, IN 47130
812.725.0706
[email protected]
KY
OLSON, DAN
18 Lookout Ridge Road
New Milford, CT 06776
860.350.8843
860.350.8854 Fax
[email protected]
WESTERN CT,
NEW YORK CITY, BRONX
PHELPS, DAN
1206 Benton Street
Anoka, MN 55303
763.754.3906 Fax option
[email protected]
MN, ND, SD
SAHLI, COLIN
1856 N. Halsted St. Unit G (Garden)
Chicago, IL 60614
312.643.0410
773.341.7524 Fax
[email protected]
NORTHERN IL
SANCES, PAUL
68 Rhode Island Road
Lakeville, MA 02347
508.923.0797 Fax option
[email protected]
EASTERN MA, ME, NH
SCHMIDT, JONAH
125 Orchard E.
North Syracuse, NY 13213
314.494.0009
888.494.6179 Fax
[email protected]
UPSTATE NY
VINCENT, TIMOTHY
195 Arch Road
Avon, CT 06001
860.673.7073 Fax option
[email protected]
VT, WESTERN MA,
EASTERN CT, RI
WILLIAMS, JERRY
330.757.0070
330.757.7464 Fax
[email protected]lings.com
NORTHERN OH, NORTHWESTERN PA
TEAM SALES - SOUTH REGION
KIRBY, RANDY - VP, TEAM SALES
SOUTH REGION
2501 Alta Vista Court
Granbury, TX 76049
817.279.6445
[email protected]
ADELMAN, SHANDY
20703 Tallow Chase Lane
Spring, TX 77379
832.717.0867 Fax option
[email protected]
SOUTHEAST TX, LA
ARENDT, JAMIE
249 S. Denise St.
Coats, NC 27521
919.868.0712 Phone
[email protected]
RALEIGH, NC; VA
BOWMAN, TIM
1032 Roadrunner Road
Argyle, TX 76226
214.850.1510
940.240.9770 Fax
[email protected]
CENTRAL TX
CASTANEDA, AARON
1483 Spectrum
Irvine, CA 92618
714.287.1114 Cell
714.388.3760 Fax
[email protected]
CENTRAL CA, SOUTHERN NV
COHEN, STEVEN
1915 Hampton Drive
Lebanon, TN 37087
205.910.4590
[email protected]
AR, TN
DRESCH, MICHAEL (BUBBA)
26134 Kingbird Cove
San Antonio, TX 78260
210.884.9798
210.579.1374 Fax
[email protected]
WEST TX
DUNN, JUSTIN
4304 NW 61st Court
Kansas City, MO 64151
816.505.2457
816.527.8065 Fax
[email protected]
WESTERN MO, KS, OK, NE
FAHRNEY, DAVE
503 Burns Circle
San Ramon, CA 94583
925.519.5814 Cell
925.828.5693 Fax
[email protected]
NORTHERN CA, NORTHERN NV
FREEMAN, WILLIAM (BILL)
7865 SE Heritage Blvd.
Hobe Sound, FL 33455
321.200.5233 Cell
772.600.7464 Phone/Fax option
[email protected]
ORLANDO & SOUTH FL
HAYNES, STEVE
NorthStar Sales Group, LLC
12110 Business Boulevard
Suite 6, Box 347
Eagle River, AK 99577
907.243.0144
907.243.1854 Fax
[email protected]
AK
JEFFS, RAY
13710 NW 49th Ave.
Vancouver, WA 98685
518.683.8080 Cell
[email protected]
OR, WA, NORTHERN ID
LIVELY, SCOTT
2115 Rock Creek Drive
Nampa, ID 83686
208.989.5726
208.467.1383 Fax
[email protected]
SOUTHERN ID, MT, UT, WY
OKAMOTO, DARRELL
IZUO BROTHERS, LIMITED
1235 So. Beretania Street
Honolulu, HI 96814
808.591.8488
808.591.9387 Fax
[email protected]
HI
PAYTES, NORMAN
1500 Ashley Creek Drive
Matthews, NC 28105
704.321.7940
704.321.7032 Fax
[email protected]
NC, SC
WHITE, JIM
5237 English Way
Birmingham, AL 35242
205.317.7049
205.639.1480 Fax
[email protected]
AL, MS, FL (PANHANDLE)
INSTITUTIONAL SALES
BRACCI, DAVE - DIRECTOR
2533 S. Coast Hwy., Ste 223
Cardiff, CA 92007
760.943.0837
760.943.7219 Fax
[email protected]
BENNETT, BOBBY
1566 Argule
Atlanta, GA 30318
770.490.7912
[email protected]
SOUTHEAST
PETERSON, ERIK
24791 Via Lagunaria
Laguna Nigel, CA 92677
949.643.0756
[email protected]
WEST COAST
CORPORATE PREMIUM SALES
MEYER, BARBARA
510 Maryville University Drive
Suite 110
St. Louis, MO 63141 USA
314.819.2795
314.819.2995 Fax
[email protected]
INTERNATIONAL SALES
ROBERT, RALPH
Director of International Sales
510 Maryville University Drive,
Suite 110
St. Louis, MO 63141 USA
314.819.2813
314.819.2990 Fax
[email protected]
RAWLINGS® CANADA
HEAD OFFICE
RANDY BEATTY,
GENERAL MANAGER
131 Savannah Oaks Dr.
Brantford, Ontario N3V 1E8
519.750.1380 800.741.7205
519.750.1390 800.741.7206 Fax
[email protected]
DEBBIE BERARDI,
SALES OPERATIONS MANAGER
519.750.1380
519.750.1390 Fax
[email protected]
JASON SHIPLEY, CANADIAN
BUSINESS UNIT MANAGER –
BRAND/PRODUCT/MARKETING
519.7501380
519.750.1390 Fax
[email protected]
NATIONAL ACCOUNTS
KEVIN JACKSON
416.840.4999
416.840.4596 Fax
[email protected]
CENTRAL ONTARIO
RAY, TODD
345 Ebenezer Road
Fayetteville, GA 30215
770.856.4784
888-613-4710 Fax
[email protected]
GA, JACKSONVILLE, FL
RABJOHN SPORTS
JASON RABJOHN
61-3480 Upper Middle Road
Burlington, ON L7M 4R7
416.898.7389
800.741.7206 Fax
[email protected]
VANKLEECK, AARON
Denver, CO
314.520.8250
[email protected]
CO, NM
EASTERN ONTARIO
WECKERLE, STEVE
714 Via Nublado
San Clemente, CA 92672
949.275.0727 Phone
949.388.6201 Fax
[email protected]
SOUTHERN CA, AZ
JOHN CASEY MARKETING
JOHN CASEY
99 Broadview Ave.
Pointe-Claire, QC H9R 3Z3
514.952.1891
514.426.3333 Fax
[email protected]
SOUTH WESTERN ONTARIO
OPYC ENTERPRISES
DEAN OPYC
43 Coventry Drive
Kitchener, ON N2A 1N2
519.893.3839
519.893.2028 Fax
[email protected]
EASTERN QUEBEC
AGENCE FREDERIC TURGEON INC.
66 des Bordages
Beauport (Qué.)
G1C 6J8
cell: 418-573-5932
Fax: 418-660-1833
email: [email protected]
WESTERN QUEBEC
AGENCE SPORTIVE TAG
MARTIN BLANCHET
4555 Boul de la Grande-Allee
Broisbriand, QC J7H 1M8
450.434.8651 x303
450.818.7998 Fax
[email protected]
ONTARIO LAKEHEAD,
MANITOBA, SASKATCHEWAN
H&W RECREATIONAL MARKETING
BRENT HOBDAY, BARRY HOBDAY,
SANDRA HOBDAY
26022 Melrose Rd
RM of Springfield, MB R0E 0K0
204.444.3909
204.444.3902 Fax
[email protected]
[email protected]
[email protected]
ALBERTA
LOWRY SALES AB LTD.
CASEY RUPTASH, ASHLEY MCNEIL
7- 5622 Burleigh Cr SE
Calgary, AB T2H 1Z8
403.291.1455
403.291.1676 Fax
LOWRY SALES (EDM)
5407-82 Avenue NW
Edmonton, AB T6B 2J6
780.461.3494
780.461.7368 Fax
[email protected],
[email protected],
BRITISH COLUMBIA
SHADOW AGENCY INC.
ROB HAYEUR, MATT WELSH,
STEVE MCINTYRE
123-11782 Hammersmith Way
Richmond, BC V7A 5E2
604.275.7734
604.275.7735 Fax
[email protected]
[email protected]
[email protected]
ATLANTIC CANADA
DOUCETTE SPORTS AGENCY
KEVIN DOUCETTE
173 Millennium Blvd.
Moncton NB E1E 2G7
506.852.3174
506.852.3185 Fax
[email protected]

Similar documents