Magnecor catalog and price list
Transcription
Magnecor catalog and price list
Effective 02/20169 APPLICATION LIST AND BUYERS GUIDE Electrosports-70 (7mm) Electrosports-80 (8mm) KV85 Competition (8.5mm) R-100 Racing (10mm) IGNITION CABLES Made in U.S.A. Ph: (248) 471-9505 Fax: (248) 471-9506 E-mail: [email protected] www.magnecor.com Magnecor, 24581 Crestview, Farmington Hills, Michigan 48335, USA Notes about this catalog Part numbers and vehicle applications: This catalog lists vehicles available in USA and Canada, although we list a number of non-USA models. There are some differences between vehicles sold in the US 50 states and Canada or Puerto Rico; we have tried to be exact as possible in our applications but there may be some vehicles available outside of the 50 US states that we have not listed. If you want cables for a car outside of USA/Canada, if your vehicle or engine is privately imported or if you need a custom wire set please provide as much information as possible about the application when you contact us. The part number for some vehicles is listed as "refer " - this means either we plan to add a set in the future and are leaving space in the catalog, or there is something special about the set that we have to discuss with you at the time of ordering. Some sets are only available in our KV85 Competition 8.5mm cable, even though the original size is 7mm; the reason is these engines sometimes experience serious EMI problems (particularly on modified engines) and KV85 cable is the best choice. Some Toyota engines, and some other vehicles, are supplied with 5mm diameter original cable. We do not manufacture a 5mm cable because we have found the only way to get proper EMI suppression and performance for modified engines is to use larger diameter conductors and insulation. Any engine with original 5mm cable will require some extra work to correctly fit and loom our larger size cables. The part numbers used in this catalog may be different to the part number sold by some dealers, who use their own part numbers on the box. Our UK and Australian assembly plants use different part numbering systems to USA. On-line version of this catalog: You can download a version of this catalog from our web site (http://www.magnecor.com - look in the "downloads" section). This file is in PDF format and requires the free Adobe Acrobat Reader (see link on our site). The online catalog is designed for easy navigation and, if loaded on a computer in your shop or store, can be more convenient to use than the printed catalog; it will be changed regularly so may be more up-to-date than the printed catalog. You have permission to include the PDF catalog as a download on your web site as long as you do not modify it in any way and you provide a link to our web site for updated versions. Technical or vehicle application advice: We are always willing to help with technical or vehicle application questions; please feel free to contact us by telephone, e-mail or fax. INDEX Magnecor Ignition Cable Sets & Individual Leads NOTES ABOUT THIS CATALOG. . . . . . . . . inside front cover CARS, TRUCKS, FARM, INDUSTRIAL Acura. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Alfa Romeo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 AM General, see Hummer AMC, American Motors, Nash, Rambler. . . . . . . . . . . . . . . . . . . . . . . . 1 Aston Martin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Asuna. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Audi. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Austin and Austin-Healey. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Austin-Healey, listed under Austin Bentley, listed under Rolls-Royce Bertone. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 BMW. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Buick. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Cadillac. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Checker. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Chery. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Chevrolet. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Chevrolet and GMC Trucks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Chrysler. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Citroën. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 Cosworth engines. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Daewoo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Daihatsu. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Daimler. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Datsun, listed under Nissan DeLorean. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 De Tomaso. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Dodge. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 Dodge Trucks and Plymouth Trucks. . . . . . . . . . . . . . . . . . . . . . . . . . 5 Eagle. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Edsel, listed under Ford Envoy, listed under Vauxhall Fargo Trucks, see Dodge Trucks Ferrari. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Fiat. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Ford. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Ford Trucks, Vans and SUVs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Ford (Australia). . . . . . . . . . . . . . . . . at end of catalog after back page Geo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 GMC Trucks, listed under Chevrolet Trucks Holden (Australia). . . . . . . . . . . . . . . at end of catalog after back page Honda. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Hudson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Hummer. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Hyundai. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Infiniti. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Innocenti. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 International Trucks, see IHC IHC (International Harvester) Trucks & Tractors. . . . . . . . . . . . . . . . 8 Isuzu. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Jaguar. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Jeep. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Jensen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Kia. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Lamborghini. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Lancia. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Land Rover, listed under Rover Lexus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Lincoln. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Lotus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Maserati. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Mazda. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Mercedes Benz. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Mercury. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Merkur. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 MG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Mini. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Mitsubishi. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Morgan. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Morris. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Nissan & Datsun. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Oldsmobile. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Opel. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Packard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Pantera. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Passport. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Peugeot. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Pininfarina, listed under Fiat Plymouth. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Plymouth Trucks, listed under Dodge Trucks Pontiac. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Porsche. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Rambler, listed under American Motors Range Rover, listed under Rover Renault. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Rolls-Royce and Bentley. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Rover, Range Rover, Land Rover. . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Saab. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Saturn. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Shelby Dodge. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Smart. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Sterling. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Studebaker. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Subaru. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Sunbeam. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Suzuki. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 Toyota. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 Triumph. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 TVR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Vauxhall and Envoy. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Volkswagen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Volvo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Workhorse. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Yugo. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 MOTORCYCLES Aprilia . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Big Dog . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 BMW. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 BSA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Buell. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1 Cagiva. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 Ducati. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 Harley Davidson. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7 Indian . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Laverda . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Moto Guzzi. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11\ MV Agusta. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Norton. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 Royal Enfield. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 Triumph . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Victory. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 RACE AND MODIFIED ENGINES Speed Shop Selections. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Circle Track Applications. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Universal Sets. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . R-100 10mm Wire Sets. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 18 19 20 MARINE Marine Engines - Inboard/Stern Drive. . . . . . . . . . . . . . . . . . . . . . . . . 19 Marine Engines - Outboard. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 PARTS AND ACCESSORIES Distributor, Coil and Spark Plug Boots. . . . . . . . . . . . . . . . . . . . . . . . 21 Distributor, Coil and Spark Plug Terminals. . . . . . . . . . . . . . . . . . . . 22 Ignition Cables. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 Misc. Accessories. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 INDIVIDUAL LEADS 8mm Individual Leads. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 KV85 8.5mm Individual Leads. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 R-100 10mm Individual Leads. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 ORDERING CUSTOM MAGNECOR CABLES. . . . . . . 28 RETAIL PRICE LIST FOR WIRE SETS. . . . . . . . . . . . . . . 29 CABLE SPECIFICATIONS Electrosports-70 7mm cable. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 Electrosports-80 8mm cable. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 KV85 Competition (8.5mm) and R-100 Racing (10mm) cables. . . 45 WARRANTY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . inside back cover Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ ACURA 2001-1992 2001-1990 1999-1997 1999-1996 1997-1992 1990-1986 1989-1988 1987-1986 1 Integra GS-R, Integra Type-R Integra, except GS-R & Type-R 3.0CL 2.2CL, 2.3CL, 1.6EL 1 2.5TL & Vigor Legend (2.5 & 2.7 engines) Integra 1 Integra 1 1 40232 40170 60178 40216 5003 6089 40125 40124 47232 47170 67178 47216 5703 6789 47125 47124 45232 45170 65178 45216 5503 6589 45125 45124 1993-1982 1981-1968 1979-1968 1972-1955 1970-1955 Spider 1750, 2000 GTV & Spider 1750, 2000 Alfetta & Berlina GTA, GTA Junior, GTA 1300 1300, 1600cc twin cam (except GTA models) -- 33" coil wire -- 23" coil wire -- 15" coil wire 164 (12 valve 3.0 V6 engine) GTV6, Milano, 75 (12 valve 3.0 V6 engine) Montreal (V8) 2600 series (6 cylinder) 40394 47394 45394 4073 4773 4573 40394 47394 45394 refer 4073 4773 4573 4004 4704 4504 4092 4792 4592 60169 60106 8094 60109 67169 67106 8794 67109 65169 65106 8594 65109 AM GENERAL - see HUMMER AMERICAN MOTORS, RAMBLER (except JEEP) After 1987 see EAGLE, also see RENAULT 1988-1955 1985-1984 1983-1980 1979-1977 1979-1967 1966-1956 6 cylinder, except flat head engines 4 cylinder engine (2.5 liter AMC engine) 4 cylinder engine (2.5 liter GM engine) 4 cylinder engine (2.0 liter) V8 V8 6018 4038 4048 4009 8024 8021 6718 -4748 4709 8724 8721 6518 4538 4548 4509 8524 8521 RSV1000R, 1000 Tuono (2 wire set) ETV1000 Caponord * ETV1000 Caponord ** RST1000 Futura * RST1000 Futura ** Pegaso 650IE * 2095 2064 2096 2092 2097 91051 2795 2764 2796 2792 2797 91751 2595 2564 2596 2592 2597 91551 APRILIA 2009-2004 2007-2001 2007-2001 2004-2001 2004-2001 2004-2001 * Fits original Sagem ignition coils only. Does not fit some aftermarket coils that look the same ** Only fits ignition coils marketed by “Auto Electrics USA” also mounted in factory location. ASTON MARTIN 2000-1993 2000-1988 2000-1988 1999-1993 1989-1986 1986-1969 1972-1957 V8 Vantage (5.3 twin supercharged engine) -- 987313 -Virage, V8 Coupé, V8 Volante (27” coil wires) -- 987320 -Virage, V8 Coupé, V8 Volante (17” coil wires) -- 987268 -DB7 i6 960283 967283 965283 V8 series 5 (with fuel injection) * 980286 987286 985286 DBS V8, V8 series 1-4 * 980269 987269 985269 DB4 (except GT), DB5, DB6, DBS with side-entry distributor cap, also you must re-use your original spark plug shrouds. Please inquire for new shrouds ** -967261 -1959-1953 DB2/4, MkIII 3.0, you must re-use your original spark plug shrouds. Please inquire for new shrouds ** . -967290 -* We have to re-use your original spark plug shrouds. Inquire for new shrouds. ** Will not fit engines with “acorn” type distributor or ignition coil connections 1 2 3 4 5 V6 engine (30 valve) V6 engine (12 valve) V8 engine 5 cylinder 10-valve engines 5 cylinder 20-valve non-Turbo (7A series) engs 5013 5713 5513 4022 4722 4522 4009 4709 4509 AUSTIN and AUSTIN-HEALEY 4 CYLINDER 1991-1969 1976-1973 1972-1953 1971-1953 1970-1956 Austin America, Metro, Moke, Mini 2 4000 4700 4500 Austin Marina 2 4074 4774 4574 Austin-Healey Sprite & 100/4 2 4000 4700 4500 Sprite, 100/4, Mini,1100,1800, A40/55/60/90 3 4787 -Austin A30, A35 3 4790 -- 60239 60104 80212 5001 5012 1975-1968 Austin-Healey 3000, 100/6 2 1968-1955 Austin-Healey 3000, 100/6 3 60230 67230 65230 -6758 -- BENTLEY, see ROLLS-ROYCE BERTONE, see FIAT BIG DOG MOTORCYCLES Fuel injected (VFI) engines Carbureted engines 20101 27101 25101 2002 2702 2502 BMW 4 CYLINDER (note: includes many models not sold in US or Canada) 1998-1992 1992-1989 1991-1985 1988-1981 1983-1962 318i.iS,ti (E36 models), Z3 w/M42 DOHC eng. 40247 47247 45247 318i,iS,iC (E30 models) w/M42 DOHC engine 40539 47539 45539 M3 (S14 engine) 40260 47260 45260 318i, 315, 316, 316i (M10 engine) 40295 47295 45295 All 4 cylinder 40295 47295 45295 6 CYLINDER (note: includes many models not sold in US or Canada) 1993-1985 535i, M535i 4 5 6065 6765 6565 1993-1982 325e, 325i, 523e, 525e, 528e, Z1 4 5 6067 6767 6567 1993-1989 M5 refer 1992-1985 635CSi, 735i, 745i,L7 4 5 6065 6765 6565 1990-1988 320i, 520i, 525i 4 5 6067 6767 6567 1988-1984 M5, M6, M635CSi 4 60174 67174 65174 1984-1982 533,633,733 - distributor at end of camshaft 4 5 6065 6765 6565 1984-1982 533,633,733 - distributor mounted in block 4 6064 6764 6564 1983-1977 320/6, 323i (E21), 520/6 (M20 engine) 4 refer 1981-1969 All, except 320/6, 323i & 5206 4 6064 6764 6564 12 CYLINDER 2001-1995 750iL, 850Ci with 5.4 engine 4 1995-1988 750i/iL, 850i/Ci/CSi with 5.0 & 5.6 engines 4 1038 1738 1538 refer BMW MOTORCYCLES 2008-1996 2006-1997 2006-1993 2003-2000 1995-1989 1995-1983 1995-1986 1995-1970 1969-1950 K1200 (except with coil-on-spark-plug ignition) 40475 R1100/1150/1200 with double ignition (oilheads only) R850/1100/1150/1200 with single ignition 2065 F650GS, F650GS Dakar, F650 Dakar 91050 K series (except K1200), 4 cyl. 16 valve engines40210 K series, 4 cylinder 8 valve engines 40209 K75 series, 3 cylinder 3008 R series, except R850/1100 (12 volt) 2732 R series with magneto ignition (6 volt) refer 47475 45475 refer 2765 2565 91750 91550 47210 47209 3708 2032 45210 45209 3508 2532 BSA MOTORCYCLES -- ignition coils mounted under seat -- ignition coils mounted under gas tank -- ignition coils mounted at lower/rear 2009 2709 2509 2010 2710 2510 2008 2708 2508 BUELL MOTORCYCLES AUDI 2001-1997 1998-1992 1994-1990 1992-1978 1992-1989 1992-1990 5 cylinder 20-valve Turbo (3B series) engines 1990-1973 80, 90, 4000, Fox, 4 cylinder 8 valve engine 1977-1969 Super 90, 100 KV85 8mm 7mm 8.5mm 6 CYLINDER 6 & 8 CYLINDER 1993-1987 1992-1981 1977-1971 1970-1962 Application 67239 67104 87212 5701 5712 65239 65104 85212 5501 5512 2010-2003 2009-2000 2002-1999 2002-1995 1993-1987 XB9, XB12 Blast M2, S3, X1 with fuel injection M2, S1, S2, S3 with carburetor RR1000, RR1200, RS1200, RSS1200 2057 91040 2048 2043 refer 2757 91740 2748 2743 2557 91540 2548 2543 For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 Push-in type distributor cap (standard distributor termination, terminal on spark plug wire pushes into distributor cap tower) Screw-in type distributor cap (spark plug wire with no boot or terminal is pushed into a hole in distributor cap, the wire is th en locked into place by a pointed screw). Sets can be most easily fitted into 2-part rectangular wire retainers if ordered in 7mm cable. We can fit wires into one piece cylindrical wire retainers at extra cost but we suggest wires are not fitted into them, as they are a major cause of wire failure. 2-piece retainers, to replace 1-piece, can be purchased from BMW dealers Our set is not fitted with a Pulse Generator, that is fitted to some sets - please let us know if you have one. The sensor needs to be modified for our larger cables. 1 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! ALFA ROMEO 4 CYLINDER (USA & Canada) Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ 4 CYLINDER 2.2 engines Century, Skylark, Somerset with 2.5 engine Skyhawk (OHC engine), VIN "1" 1 Skyhawk (OHV engine), VIN "K" & "M" 1 Skyhawk Turbo Century,Skylark,Somerset Skyhawk (except 1.8 fuel injected engine) Skyhawk, Skyhawk Turbo with 1.8 EFI engine 4051 4050 4051 4047 4047 4048 4047 4049 4751 4750 4751 4747 4747 refer 4747 -- 4551 4550 4551 4547 4547 4548 4547 4549 CADILLAC 4 CYLINDER 60273 60189 60189 60150 6032 60150 60207 6032 60114 6009 6009 60114 6040 60119 6009 6041 6009 6041 6009 6009 6041 6034 6034 6041 6034 6023 6054 6038 6023 -6031 6023 6015 60111 6005 67273 67189 67189 67150 6732 67150 67207 6732 67114 --67114 6740 ----------------6523 ---67111 6705 65273 65189 65189 65150 6532 65150 65207 6532 65114 6509 6509 65114 6540 65119 6509 6541 6509 6541 6509 6509 6541 6534 6534 6541 6534 6523 6554 6538 6523 8 CYLINDER 80229 80283 80205 8058 8028 8041 8034 8031 87229 87283 87205 8758 ----- 85229 85283 85205 8558 8528 8541 8534 8531 3.5 & 3.9 engines 3.8 engine 3.8 engine, except Le Sabre & Lucerne 3.8 engine, Le Sabre, Lucerne 3.1 & 3.4 engines 3.8, Park Ave & Riviera, except supercharged 3.8 eng, Park Ave & Riviera with supercharger 3.1 engine, Regal & Skylark 3.1 engine, Century 3.8 eng, Park Ave & Riviera with supercharger 3.8 engine (except 1995 Park Ave & Riviera) 3.1 engine 2.8 & 3.1 engines 3.3 engine 3.8 engine with Delco ignition coil pack 2 3.8 engine with Magnavox ignition coil pack 2 3.3 engine 3.8 engine, Electra, Le Sabre, Park Avenue 3.8 engine, Regal 3.8 engine, Reatta & Riviera 3.8 engine, Reatta & Riviera 3.0 engine, Le Sabre, Somerset, Skylark 3.8 engine, Century, Electra, Reatta, Riviera 3.8 engine, Le Sabre (VIN "C") 1 3.8 engine, Le Sabre (VIN "3") 1 3.8 engine, Regal, except Turbo Grand National, GNX, Regal Turbo 3 2.8 engine, Century & Skylark 3.0 engine, Century, Electra 3.8 engine (except Turbo) 6023 Grand National, Regal Turbo, Riviera Turbo All V6 engines (except Skylark with 2.8 engine) All with L6 engine All L6 engines 198, 225 V6 engines 6531 6523 6515 65111 6505 8 CYLINDER 2009 2008-2004 1996-1994 1993-1991 1990-1975 1987-1980 1981-1977 1980-1977 1979 Allure, LaCrosse Allure, LaCrosse, Rainier Roadmaster Roadmaster 260, 307 (5.0y), 350B, 350R, 403 engines 267, 305G, 305H engines 1 265, 301 engines 350H, 350J, 350X engines 1 305, 350L engines 1 -- except Skylark -- Skylark 1978 305, 350L engines 1 -- Century & Regal with 305 engine -- Century & Regal with 350L engine 1 -- Le Sabre & Skylark 1977 305, 350L engines 1 1976-1973 350, 400, 455 engines with HEI 1976-1964 300, 340, 350, 400, 430, 455 without HEI 1966-1957 364, 401, 425 engines 1 2 3 1 8041 8029 --- 8541 8529 8041 -8541 8042 -8542 8029 -8529 8029 -8529 8031 -8531 8009 8709 8509 8021 8721 8521 1987 Cimarron 1986-1982 Cimarron KV85 8mm 7mm 8.5mm 8015 8715 8515 80307 87307 85307 4051 4751 4551 4047 4747 4547 6 CYLINDER 1998-1996 1988-1987 1986-1985 1983-1980 2016-2015 2015-2009 2008-2007 2007-2006 2006-2002 2005-2004 2000-1999 1999-1995 1999-1998 1996-1994 1995-1989 1994-1993 1993-1990 1990-1986 1988-1986 1985-1984 1985 1984 1984 1983-1974 1980-1975 1974-1963 1962-1949 Catera Cimarron Cimarron All with V6 engine CTS-V (except 2015 model), Escalade CTS-V, Escalade (except 2015 Escalade) Escalade CTS-V (6.0 engine) Escalade (5.3 & 6.0 engines) CTS-V (5.7 engine) Escalade (5.7 engine) 4.6 engine, except 1998-1999 Seville 4.6 engine, Seville Fleetwood, 5.7 engine All with 4.5 and 4.9 engines All with 4.6 engine Brougham with 5.0 & 5.7 fuel injected engines Brougham with 5.0 carburetor engine All except Brougham Eldorado, Fleetwood Brougham, Seville DeVille, Fleetwood (except Brougham) Fleetwood & DeVille with front wheel drive Fleetwood & DeVille with rear wheel drive 250, 368, 425, 472, 500 engines with HEI 350 engine All without HEI All 60259 6039 6038 6023 67259 6739 6738 -- 65259 6539 6538 6523 80311 80229 80283 80283 80241 80229 80223 80214 80261 80205 8057 80216 8058 8028 8047 8033 8047 8047 8033 8033 8028 8027 80309 87311 87229 87283 87283 87241 87229 87223 87214 87261 87205 --8758 ---8747 ----8727 87309 85311 85229 85283 85283 85241 85229 85223 85214 85261 85205 8557 85216 8558 8528 8547 8533 8547 8547 8533 8533 8528 8527 85309 CAGIVA 2000-1998 Gran Canyon 900 2070 2770 2570 CHECKER 6 CYLINDER 1982-1981 1982-1980 1979-1975 1974-1965 1964-1959 231 V6 engine 229 V6 engine 250 L6 engine All All except flat head engine 6023 6021 6020 60111 6008 ---67111 6708 6523 6521 6520 65111 6508 8 CYLINDER 1982-1980 1979-1974 1974-1971 1970-1964 267, 305, 350 engines 350 engine with HEI 350 engine without HEI 283, 327, 350 engines 8041 -8541 8029 -8529 8059 8759 8559 8063 8763 8563 CHERY 2012-2003 QQ, 0.8 (372) engine, except t Marelli ignition 2012-2003 QQ, 1.1 (472) engine 3024 3724 3524 40560 47560 45560 CHEVROLET 3 CYLINDER (also see Geo) 2000-1989 Metro, Sprint 1988-1985 Sprint, except Turbo 1988-1987 Sprint Turbo 3007 3707 3507 3001 3701 3501 3003 3703 3503 4 CYLINDER 2011-2002 2010-2004 2010-2004 2009-1994 Aveo & Spark, 1.0 & 1.2 SOHC engines - see Daewoo Matiz Aveo, 1.6 engine (for USA, up to 2008 only) 40332 47332 45332 Optra (Canada/Mexico) 40323 47323 45323 Corsa, Meriva, Montana, Monza, Tornado (Mexico) 940532 947532 945532 For GM cars, the engine code is identified in 1995-81 by the 8th character and in 1980-72 by the 5th character of the VIN number , located on the dash of the vehicle Delco: ignition coil pack has 1 row of 6 terminals. Magnavox: ignition coil pack has 2 rows of 3 terminals Also see 10mm wire sets, page 19 2 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 6 CYLINDER 2011-2005 2009-2007 2006-1996 2006-1996 2005-1997 2005-1995 2003-1996 1996-1995 1996-1995 1995 1995-1993 1994 1993-1987 1993-1992 1992 1992 1991-1989 1991-1989 1991-1990 1991 1990-1989 1988-1985 1988-1986 1988 1988-1986 1987-1986 1987-1986 1986-1980 1986-1982 1985-1984 1985-1984 1983-1975 1976-1975 1974-1968 1967-1962 Application 1964-1961 215 engine 1953-1936 248, 263, 320 engines BUICK 1996-1993 1992-1987 1989-1987 1988-1987 1987 1986-1980 1986-1982 1986-1982 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year 8mm 7mm KV85 8.5mm CHEVROLET (continued) 4 CYLINDER (continued) 2002-1998 2001-1999 1999-1998 1998 1997-1987 1992-1987 1989-1986 1989-1987 1988 1988-1985 1987-1976 1986-1982 1986-1984 1985 1978 1977-1975 1976-1975 1974-1971 1970-1962 Cavalier, 2.2 liter engine Metro, 1.3 liter SOHC 16 valve engine Prizm Metro, 1.3 liter SOHC 16 valve engine 2.0 & 2.2 liter engines 2.5 liter engines Spectrum, except Turbo Spectrum Turbo Nova with 16 valve engine Nova, except 1988 16 valve engine Chevette Cavalier Camaro, Celebrity, Citation, Monza Spectrum Monza Monza, Vega (except Cosworth Vega Cosworth Vega (with original type spark plugs) Vega Chevy II, Nova 40108 40333 40299 40296 4051 4050 4056 4095 40115 4017 4014 4047 4048 4027 4015 4045 40533 40122 40138 47108 47333 47299 47296 4751 4750 4756 4795 47115 4717 -4747 -4727 ---47122 47138 45108 45333 45299 45296 4551 4550 4556 4595 45115 4517 4514 4547 4548 4527 4515 4545 45533 45122 45138 60273 60295 6032 60189 6032 60242 60149 60202 6032 6062 6083 6009 60167 60166 6040 6040 6038 6043 6013 6040 6039 6036 6038 60142 6023 6021 6020 6015 60111 6004 6008 67273 67295 6732 67189 6732 67242 67149 67202 6732 6762 6783 -67167 67166 6740 6740 6738 6743 6713 6740 6739 6736 6738 67142 ----67111 6704 6708 65273 65295 6532 65189 6532 65242 65149 65202 6532 6562 6583 6509 65167 65166 6540 6540 6538 6543 6513 6540 6539 6536 6538 65142 6523 6521 6520 6515 65111 6504 6508 80311 80229 80229 80283 80283 80229 80229 80143 80205 80154 80161 87311 87229 87229 87283 87283 87229 87229 87143 87205 87154 87161 85311 85229 85229 85283 85283 85229 85229 85143 85205 85154 85161 6 CYLINDER 2011-2004 2009-2005 2005-2004 2005-1998 2004-1996 2002-2000 1999-1995 1997-1996 1995-1994 1995-1990 1995-1993 1995-1992 1995 1994-1991 1994-1989 1993-1989 1993-1985 1993-1992 1990-1989 1988-1987 1988-1987 1988-1986 1986-1980 1985 1985-1978 1984-1978 1979-1978 1977-1975 1974-1963 1969-1961 1962-1940 3.5 & 3.9 engines 3.4 engine, Equinox 3.4 engine, Impala, Monte Carlo, Venture 3.8 engine, Impala, Lumina, Monte Carlo 3.1 & 3.4 engines (except 1996-1997 Z34) 3.8 engine, Camaro 3.8 engine, Camaro 3.4 engine, Lumina Z34 & Monte Carlo Z34 3.1 engine, except Lumina APV/Minivan 3.1 engine, Lumina APV & Lumina Minivan 3.4 engine, Camaro 3.8 engine, Lumina APV & Lumina Minivan 3.4 engine, Lumina Z34, Monte Carlo Z34 1 3.4 engine, Lumina Z34 2.8 & 3.1, Cavalier, Lumina (except Minivan) 2.8 & 3.1 engines, Beretta, Celebrity, Corsica 2.8 & 3.1 engines, Camaro 4.3 engine, Caprice 4.3 engine, Caprice 2.8 engine, Celebrity 2.8 engine, Beretta, Cavalier, Corsica 4.3 engine, Caprice, El Camino, Monte Carlo 173 2.8 V6 engine 260 4.3 V6 engine 196 & 231 V6 engines 229 & 200 V6 engines 250 L6 engine 250 L6 engine with HEI All except Corvair (includes 1962 Chevy II) Corvair All except Corvair & Chevy II 8 CYLINDER 2016-2014 2016-2010 2013-2009 2008-2005 2006-2003 2004-1997 2002-1998 1997-1993 1996-1994 1996-1992 1995-1989 1 2 3 4 Corvette (C7), Camaro (2016 only) Camaro (to 2015 only), Caprice, SS 2 Corvette Corvette, Impala, Monte Carlo 2 SSR Corvette 2 Camaro 2 Camaro Caprice & Impala SS Corvette, except ZR-1 Corvette ZR-1 Yearr Application KV85 8mm 7mm 8.5mm 1993-1989 1992-1989 1991-1987 1990-1987 1988-1987 Caprice (except 1989 & 1990 Station Wagon) 8058 Camaro 8058 Corvette, except ZR-1 8050 Caprice Station Wagon 8028 Caprice Sedan, El Camino & Monte Carlo (except Canada in 1987) 8052 1988-1987 Camaro (except 1987 Canada with carburetor) 8038 1987 Caprice Sedan,El Camino,Monte Carlo (Canada) 8092 1987 Camaro with carburetor (Canada) 8091 1986-1985 305 5.0F engine (with TPI) 2 8046 305 5.0G,H engines 3 8041 8028 307 5.0Y engine 3 350 5.7 engine, except Corvette 8041 Corvette 8050 1984-1982 All except Corvette 8041 Corvette (1984) 8006 Corvette (1982) 8004 1981 All, except Camaro & Corvette 8041 Camaro, except 301 (turbo) engine 8093 Camaro with 301 turbo engine 8053 Corvette 8004 1980 All, except Camaro & Corvette 8041 Camaro (except California) 8029 z Camaro (California) 8093 Corvette 8004 1979-1978 Camaro, Caprice, Impala, Nova 8029 El Camino, Malibu, Monte Carlo 8041 Monza 8093 Corvette 8004 1977 All, except Corvette 8029 Corvette 8003 1976-1973 262 engine 8093 305, 350, 400 with HEI, except Corvette 8029 350 engine with HEI, Corvette 8003 454 engine with HEI (including Corvette) 8002 1974-1965 396, 402, 427, 454 engines without HEI 8008 1974-1955 265, 283, 302, 307, 327, 350, 400 engines without HEI --- wires routed over valve cover 8059 --- wires routed under exhaust manifold 8063 1965-1958 348, 409 engines 8012 8758 8758 --- 8558 8558 8550 8528 8752 8738 8792 8791 --------------------------8708 8552 8538 8592 8591 8546 8541 8528 8541 8550 8541 8506 8504 8541 8593 8553 8504 8541 8529 8593 8504 8529 8541 8593 8504 8529 8503 8593 8529 8503 8502 8508 8759 8559 8763 8563 8712 8512 CHEVROLET TRUCKS and GMC TRUCKS 4 CYLINDER 2002-1999 2003-1998 1998 1997-1996 1995-1994 1993-1985 1985-1983 1985-1976 1975-1972 Tracker (1.6 engine) 2.2 engine Tracker S-10, S-15 etc., 2.2 engine 2.2 engine 2.5 engine 2.0 (GM) engine 1.9 (Isuzu) engine Luv 40333 40378 40139 40322 4051 4048 4047 4025 4011 47333 47378 47139 47322 4751 4748 -4725 4711 45333 45378 45139 45322 4551 4548 4547 4525 4511 6 CYLINDER 2016-2014 2014 2013-2007 2009-2005 2008-2005 2007-1999 2005-1996 1998-1995 1995-1992 1995-1990 1994-1988 1993-1985 1991-1978 4.3 engine (Sierra & Silverado) 60331 4.3 engine (Express & Savana) 60296 4.3 eng (for 2007; with distributorless ignition) 60296 3.4 engine, Equinox 60295 Uplander, 3.5 & 3.9 engines 60273 4.3 eng (for 2007; with distributor ignition only) 3 60152 3.4 engine (except Equinox) 6032 4.3 V6 - vertical distributor cap towers 6043 60152 - horizontal distributor cap towers 4 Lumina APV & Minivan with 3.8 engine 6009 Lumina APV & Minivan with 3.1 engine 6062 4.3 V6 engine (incl. Syclone & Typhoon) 4 6043 2.8 V6 engine 6038 250 4.1 & 292 4.8 L6 engines 6020 67331 65331 67296 65296 67296 65296 67295 65295 67273 65273 67152 65152 6732 6532 6743 6543 67152 65152 -6509 6762 6562 6743 6543 6738 6538 -6520 Some 1995 engines may have ignition coil mounted on left side of engine, for these order as for 1994 models. Please inquire if u nsure For GM cars, the engine code is identified in 1995-81 by the 8th character and in 1980-72 by the 5th character of the VIN number , located on the dash of the vehicle For engines fitted with JBA headers order part number 67214 (7mm cable), 60214 (8mm cable) or 65214 (KV85 8.5mm cable) For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 3 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! \ Application Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm CHEVROLET TRUCKS & GMC TRUCKS (continued) 6 CYLINDER (continued) 6043 60141 6043 60141 6036 6038 6021 6023 6015 60111 60274 6008 ----6736 ----67111 67274 6708 6543 65141 6543 65141 6536 6538 6521 6523 6515 65111 65274 6508 5.3 & 6.2 engines 80311 5.3,6.2 engines, Sierra & Silverado 80311 4.8,5.3,6.0,6.2, except 2014-15 as listed above 80241 8.1 engine 80276 4.8, 5.3, 6.0, 6.2 engines (except, 2007 Sierra Classic & 2007 Silverado Classic order as for 2006) 80283 4.8, 5.3, 6.0 engines, -- except Express, Savana, Envoy, Trailblazer2 80241 - Express & Savana (vans), Envoy & Trailblazer 80283 5.0 & 5.7 engines 80223 7.4 engine (with distributor ignition) 80224 7.4 engine (with distributorless ignition) 80277 6.0 & 7.0 engines (fuel injected only) 80108 7.4 engine -- Vertical distributor cap towers 80129 -- Horizontal distributor cap towers 80224 5.0 & 5.7 -- Vertical distributor cap towers 8060 -- Horizontal distributor cap towers 80223 7.4 engine (do not order 7mm for 1992-1993) 80129 5.0, 5.7 V8 (except 1994-1995 G & P series) 8060 5.0, 5.7 engines, G & P series 80144 366 6.0 & 427 7.0 (carburetor engines) 8049 454 7.4 engine (except C1500/K1500/454SS) 80129 454 7.4 engine, C1500,K1500,454SS models 8035 305 5.0, 350 5.7 -- Fuel injected (TBI) engines 8060 -- series 10-35 with carburetor 8029 -- All series 50-95 8030 454 7.4 engine with fuel injection 8035 454 7.4 engine with carburetor 8049 305 5.0, 350 5.7 engines -- El Camino & Caballero (USA) 8052 -- El Camino & Caballero (Canada) 8092 -- C,K,G,P,R & V series 10-35 with carburetor 8029 -- C,K,G,P,R & V series 10-35 with fuel injection 8060 -- All series 50-95 8030 454 7.4 engine -- C, K, R & V series 8035 -- P series (Fed., stainless steel exhaust) 8049 -- P series (California, cast iron exhaust) 8032 305 5.0, 350 5.7 engines -- Caballero & El Camino 8041 -- C, K series 10-35, except non-Calif. 350M 2 8041 -- C, K series 10-35, 350M engine (Federal) 2 8029 -- G, P series 10-35 8029 -- All series 50-95 8030 305 5.0, 350 5.7 engines -- Caballero, El Camino, C/K 10-35 8041 -- G, P series 10-35 8029 -- All series 50-95 8030 454 7.4 eng., stainless steel exhaust manifold 8049 454 7.4 engine, cast iron exhaust manifold 8032 366,427,454 with HEI (except 1985 454 engine) 8032 87311 87311 87241 87276 85311 85311 85241 85276 IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 8 CYLINDER 2015 2014 2015-2009 2009-2001 2008-2007 2006-1999 2002-1997 2000-1998 2000-1998 1998-1990 1997-1996 1996 1995-1992 1995-1992 1995-1994 1991-1986 1991-1990 1991-1990 1991-1988 1989-1988 1989-1988 1987 1987-1986 1986 1985-1983 1985 1985 1985-1977 1 2 3 4 87283 85283 87241 87283 87223 87224 87277 87108 87129 87224 8760 87223 87129 -87144 --------- 85241 85283 85223 85224 85277 85108 85129 85224 8560 85223 85129 8560 85144 8549 85129 8535 8560 8529 8530 8535 8549 8752 8792 ---- 8552 8592 8529 8560 8530 --- 8535 8549 8532 ------ 8541 8541 8529 8529 8530 ------- 8541 8529 8530 8549 8532 8532 KV85 8mm 7mm 8.5mm Application 1982-1981 267, 305, 350, 400 engines -- Caballero & El Camino 8041 -- C, K series 10-35, 305 engine 8041 -- C, K series 10-35, 350L engine 2 8041 8029 -- C, K series 10-35, 350M,P engines 2 -- G, P series 10-35 8029 -- All series 50-95 8030 1980-1978 267, 305, 350, 400 engines -- Caballero & El Camino 8041 -- C, K, G & P series 10-35 8029 -- All series 50-95 8030 1979-1974 403, 455 engines with HEI (GMC Motorhome) 8028 1977-1974 305, 350, 400 engines with HEI -- All series 10-35 8029 -- All series 50-95 8030 1976-1973 366, 402, 427, 454 engines -- All with HEI 8002 -- All without HEI 8008 1974-1955 265, 283, 307, 327, 350, 400 engines without HEI --- wires routed over valve cover 8059 --- wires routed under exhaust manifold 8063 1972-1963 366, 396, 402, 427, 454 engines 8008 1972-1960 637 (GMC V8) engine 8089 1965-1958 348, 409 engines 8012 1959-1955 287, 317, 336, 347 engines 8015 ------- 8541 8541 8541 8529 8529 8530 ----- 8541 8529 8530 8528 ---8708 8529 8530 8502 8508 8759 8763 8708 8789 8712 8715 8559 8563 8508 8589 8512 8515 40428 -40425 40428 40182 47428 -47425 47428 47182 45428 45231 45425 45428 45182 40231 40153 40177 40410 4039 4005 -47153 47177 47410 4739 4705 45231 45153 45177 45410 4539 4505 60237 60211 60233 6085 60122 6082 6014 6086 6022 60332 6008 67237 67211 67233 6785 67122 6782 6714 6786 6722 67332 6708 65237 65211 65233 6585 65122 6582 6514 6586 6522 65332 6508 80291 80290 8039 8022 8026 8013 80296 87291 -8739 8722 8726 8713 87296 85291 85290 8539 8522 8526 8513 85296 CHRYSLER 4 CYLINDER 2010-2001 2009-2003 2007-2001 2006-2001 2005-2001 2005-2001 2000-1995 1995-1991 1993-1992 1991-1989 1990-1982 1989-1982 PT Cruiser with 2.0, 2.4 engines, except Turbo PT Cruiser Turbo 3 PT Cruiser & Neon with 1.6 eninge (non-USA) Cirrus, Sebring Sedan/Convertible Sebring Coupe Neon 1.8/2.0/2.4 see DODGE NEON Cirrus, Sebring, Neon (DOHC engine) 3 Le Baron Phantom R/T, Spirit R/T DOHC (Mexico) TC by Maserati (16 valve engine) 2.2 & 2.5 engines (except TC by Maserati) 2.6 engine 6 CYLINDER 2010-2001 2008-2004 2005-1995 2000-1990 1997-1993 1997-1993 1995-1990 1989-1988 1983-1979 1981-1970 1978 3.3, 3.8 engines Crossfire 2.5, 2.7, 3.0 engine, Cirrus & Sebring 3.3, 3.8 engines (except Concorde & Intrepid) 3.5 V6 engine 3.3 engine, Concorde & Intrepid 3.0 engine 3.0 engine 225 engine 4 245 & 265 Hemi (Australia) 225 engine 8 CYLINDER 2009-2008 2005 1990-1979 1978-1971 1978-1973 1972-1959 1967-1957 Aspen (4.7 engine) 300C & Magnum, 5.7 engine 318, 360 engines 4 318 (LA-series), 360 engines 400, 440 engines 361, 383, 413, 426, 440 engines (except Hemi) 277, 301, 313, 318 (A-series), 326 engines CITROËN (please inquire for models not listed) 1994-1991 XM (3.0 litre 24 valve ZPJ4 engine) 1990-1984 CX 2500 (CXA) 960313 967313 965313 refer For GM cars, the engine code is identified in 1997-81 by the 8th character and in 1980-72 by the 5th character of the VIN number , located on the dash of the vehicle For aftermarket supercharged engines order part no. 85267 (8.5mm cable only), which has 3” added to all wires. For twin-turbo modifications order part no. 85278 For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 For 1979 engines: Most engines have the late style Chrysler Corp. ignition coil with an internal spark plug type connection for the coil wire. However, some engines have the earlier type coil. For these engines order as for 1978. Please inquire if unsure. 4 We can make custom sets to almost any specification - please inquire 1987-1984 4.3 engine -- C, K, G, R & V series (1987) -- C, K, G, R & V series (1986-85) -- Safari & Astro vans (1987-86) -- Safari & Astro vans (1985) -- Caballero & El Camino 1984-1982 173 2.8 V6 engine 1984-1980 229 3.8K,9 & 200 3.3 V6 engines 1 1984-1978 231 3.8A V6 engine 2 1977-1975 250, 292 L6 engines with HEI 1975-1963 All L6 engines without HEI 1974-1960 GMC 305, 351, 379, 401, 432, 478 V6 engines 1962-1946 All L6 engines Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm CITROËN (continued) 1983-1977 CX 2400 IE, Gti (fuel injected) refer 1982-1974 2CV 2041 2741 2541 1979-1974 CX2000,2200,2400, carbureted engines * -47120 -1975-1971 SM IE (2.7, 3.0 fuel injected engines) 60320 67320 65320 1972-1970 SM (2.7 carburetted engine) 60319 67319 65319 1975-1966 DS/ID series (with angled distributor cap) * -47482 -1975-1966 DS/ID series (with straight distributor cap) * refer 1965-1959 DS/ID series refer * Supplied without spark plug hole cover, extension or insulator. Cover available separately. COSWORTH ENGINES IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! DAEWOO 2013-2010 2011-2002 2011-2005 2008-2002 2008-2002 2008-1998 2006-1996 2005-1995 2002-1998 2001-1998 Aveo T250/T300, Matiz, 1.0 1.2 DOHC engines refer Aveo, Kalos, Matiz, 1.0 & 1.2 SOHC engines 40525 Matiz (M200/M250), 0.8 3-cylinder engine refer Aveo & Kalos T200/T250, 1.4/1.6 DOHC engine40332 Lacetti, Nubira J200/J250, Optra, 1.4,1.6 1.8 40526 Leganza, Nubira, 2.0 & 2.2 engines 40323 Musso/Rexton (incl. Ssang Yong), 3.2 engine 60226 Matiz (M100/M150), 0.8 3-cylinder engine 3014 Lanos, 1.6 engine 40332 Lanos, 1.5 engine 40366 47525 45525 47332 47526 47323 67226 3714 47332 47366 45332 45526 45323 65226 3514 45332 45366 3711 3704 47193 47157 3511 3504 45193 45157 DAIHATSU 1993-1987 1992-1977 1992-1988 1992-1988 Charade GTti & GTxx (CB70/CB80 engines) Charade, 3 cylinder eng (except GTti & GTxx) Rocky, Feroza, 1.6 litre16 valve engine Charade, 1.3 litre 16 valve engine 3011 3004 40193 40157 DELOREAN 1982-1981 DMC-12 6006 6706 6506 DE TOMASO 1988-1976 Innocenti Mini (3 cylinder Daihatsu engine) 1987-1967 289, 302, 351 V8 engines 3004 3704 3504 refer 1 2 3 4 Atos (Mexico) 40240 Attitude, Verna (Mexico) 40331 Caravan, Stratus Sedan, Stratus Convertible 1 40428 Stratus Coupe 40182 Neon (except SRT-4) & SX 2.0 1 40381 Neon SRT-4, Stratus R/T Turbo, 2.4 DOHC 1 2 -Neon & Stratus with 1.8 & 2.0 SOHC engine 1 40381 Neon & Stratus with 2.0 & 2.4 DOHC engs 1 2 40231 Caravan 1 2 40231 Avenger 1 2 40231 Neon & Stratus with SOHC engine 1 40223 2.2 & 2.5 engines (except 16 valve) 40153 Colt with 1.8 engine 40195 Colt, 1.5 engine (exc. 1991 Canada with carb.) 4056 Daytona IROC R/T, Spirit R/T (16 valve eng.) 2 40177 Colt Vista 4005 Colt, except Turbo 4005 Colt Turbo 40169 2.2 & 2.5 engines 4039 Conquest & Challenger 4005 Colt Turbo 4005 1.6 engine, except Colt 4040 2.6 engine 4005 Colt with 1.4 engine 4020 Colt with 1.6 engine (except turbo) 4020 1.7 engine Colt with 2.0 & 2.6 engines Omni & O24 Colt with 1.6 (“Silent Shaft” engine) 3 Colt with 1.6 engine (exc. Silent Shaft engine) 4 4031 4005 4032 4005 4009 4731 4705 4732 4705 4709 4531 4505 4532 4505 4509 67315 67237 67233 67102 6714 6785 67122 6782 6781 -6742 6792 6786 6722 6708 65315 65237 65233 65102 6514 6585 65122 6582 6581 65128 6542 6592 6586 6522 6508 8739 8722 8726 8713 87101 87296 8539 8522 8526 8513 85101 85296 6 CYLINDER 2011-2009 2010-2001 2005-1994 2001-1992 2000-1990 2000-1990 1997-1993 1997-1993 1996-1991 1996-1991 1992-1991 1991-1990 1989-1987 1986-1979 1978-1975 1974-1960 3.7 V6 engine 60315 3.3, 3.8 engines 60237 2.5, 2.7, 3.0 V6 engine, Avenger & Stratus 60233 3.9 V6 (please inqure for 1992 Canada models) 60102 3.0 V6 engine (except Monaco & Stealth) 6014 3.3, 3.8 V6 engine (except Intrepid) 6085 Intrepid with 3.5 engine 60122 Intrepid with 3.3 engine 6082 Stealth (except 24 valve engine) 6081 Stealth ES,R/T,R/T Turbo, with 24 valve engine -Monaco, distributorless ignition 6042 Monaco, with distributor ignition 6092 3.0 engine, all cars 6086 225 engine 6022 All 6008 All refer 8 CYLINDER 1990-1979 1978-1964 1978-1973 1972-1958 1971-1966 1967-1957 All cars (for trucks, see Dodge Trucks) 8039 273, 318 (LA-series), 340, 360 engines 8022 400, 440 engines 8026 350,361,383,400,413,426 (exc. Hemi),440 8013 426 Hemi 4 80101 277, 301, 303, 313, 318 (A-series), 326 engines 80296 10 CYLINDER 2014-2008 2006-2003 2005-1996 2002-1996 2002-1996 1996-1992 Viper SRT-10, SRT Viper 1034 1734 1534 Viper SRT-10 1028 -1528 Viper GTS-R (with front-mounted ignition coil) 1055 -1555 Viper GTS (except GTS-R), GT2, ACR 2 1011 -1511 Viper RT/10, ignition coil mounted at rear 2 1011 -1511 Viper RT/10, ignition coil under intake manifold 21009 -1509 DODGE TRUCKS and PLYMOUTH TRUCKS 4 CYLINDER DODGE (cars only) 4 CYLINDER 2010-2001 2010-2004 2007-2001 2005-2001 2005-2001 2005-2003 2000-1999 2000-1995 2000-1996 2000-1995 1998-1994 1995-1991 1995-1993 1995-1991 1993-1991 1991-1984 1990-1985 1990-1989 1990-1981 1989-1978 1988-1984 1986-1983 1985-1981 1984-1979 1984-1980 1983-1980 1980-1976 1979-1978 1979-1977 1977-1971 KV85 8mm 7mm 8.5mm Application 47240 47331 -47182 -------47153 47195 4756 47177 4705 4705 47169 4739 4705 4705 4740 4705 4720 4720 45240 45331 45428 45182 45381 45231 45381 45231 45231 45231 45223 45153 45195 4556 45177 4505 4505 45169 4539 4505 4505 4540 4505 4520 4520 2007-2001 2002-1996 2000-1996 1995-1991 1993-1979 1990-1982 1987-1984 Caravan, Voyager 1 Dakota Caravan, Voyager 1 2 Caravan, Dakota, Voyager Ram 50, Raider, D50, Arrow Pickup 2.2 & 2.5 engines 2.6 engine 40428 40155 40231 40153 4005 4039 4005 -47155 -47153 4705 4739 4705 45428 45155 45231 45153 4505 4539 4505 3.7 V6 engine 60315 3.3, 3.8 engines 60237 3.9 V6 (please inqure for 1992 Canada models) 60102 3.3, 3.8 V6 engines 6085 3.0 V6 engine 6014 3.9 V6 engine 6019 Raider (3.0 V6 engine) 6014 3.0 V6 engine (except Raider) 6086 225 L6 engine 6022 All 6008 Slant 6 refer 67315 67237 67102 6785 6714 6719 6714 6786 6722 6708 65315 65237 65102 6585 6514 6519 6514 6586 6522 6508 87291 ----- 85291 1528 85272 1505 85219 6 CYLINDER 2012-2009 2010-2001 2003-1992 2000-1990 2000-1990 1991-1987 1990-1987 1989-1987 1987-1979 1978-1975 1974-1960 8 and 10 CYLINDER 2012-2008 2006-2004 2005-2003 2003-1994 2003-1992 4.7 V8 engine Ram SRT10 5.7 V8 8.0 V10 5.2, 5.9 V8 (except 1992 5.9 order as for 1991) 80291 1028 80272 1005 80219 If you are using Denso ITV22 or equivalent spark plugs order 47454 (7mm), 40454 (8mm) or 45454 (KV85 8.5mm) since the stock set will not fit!. For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 Silent shaft engines have the distributor mounted horizontally into the engine, non-silent shaft (older) engines have the distrib utor mounted into the engine block. This set is for engines fitted with commonly used spark plugs, such as Champion C63YC or similar with a 50mm height from gasket seal to top of spark plug. For engines fitted with factory spark plugs with a 59mm height, a different set has to be supplied. Please inquire if unsure 5 We can make custom sets to almost any specification - please inquire BD series engines Please inquire 1994-1992 Ford Sierra/Escort RS Cosworth (Green cam cover) -- -- 945472 1992-1986 Ford Sierra RS Cosworth (Red cam cover) --- 945471 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm Yearr 5.2 & 5.9 engines with fuel injection 5.2 & 5.9 engines with carburetor 440 engine 273, 318 (LA-series), 360 engines 361, 400, 413, 440 engines 361, 383, 400, 413 engines 277,301,303,313,318 (A-series),326 engines 80118 8039 8040 8022 8026 8013 80296 87118 8739 8740 8722 8726 8713 87296 85118 8539 8540 8522 8526 8513 85296 FIAT US specification models IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! Scrambler refer Multistrada 1200 refer Superbike 899, 1199, 1299 & Panigale-R -Diavel (will not fit 2011-13 models) refer Monster 1200 refer Monster 821 refer Multistrada 1200 (will not fit 2010-12 models) refer Monster 696, 795, 796 & 1100 Evo 2082 Hypermotard 796 & 1100 Evo 2082 Monster 1100 2081 SportClassic,GT1000,Sport 1000,PaulSmart LE 2081 Hypermotard 1100 2081 Multistrada 1000 & 1100 2081 Monster S2R 1000 2085 Monster 695 & S2R 800 2070 Supersport 620, 800 -ST3 2084 Monster 600/620/750/800/900, MH900e -Multistrada 620 2082 Supersport 1000 2086 Monster 1000 2087 ST4, ST4S 2094 Superbike 996R & 998 2062 ST2 2080 Superbike 748,851,888,916,996 (except 996R) 2049 Supersport 600, 750, 900 - fuel injected 2054 Supersport 600, 750, 900 - carbureted -906 Paso & 907ie 2070 2798 2008-2005 2002-1996 1976-1960 1973-1966 2582 2582 2581 2581 2581 2581 2585 2570 -2584 -2582 2586 2587 2594 2562 2580 2549 2554 -2570 Talon, except turbo 40231 Talon with Turbo 40257 Summit, 1.5 engine 4056 Summit, 1.8 & 2.4 eng (except 1992 2.4 eng) 40195 Talon, 2000GTX with 2.0 DOHC engine 40169 Talon, Vista, 2000GTX, 1.8 & 2.0 SOHC engine 4005 Summit with 1.6 & 2.4 SOHC engines 4005 Summit with DOHC engine 40169 Medallion 40123 Premier 4038 -47257 4756 47195 47169 4705 4705 47169 47123 4738 45231 45257 4556 45195 45169 4505 4505 45169 45123 4538 Vision with 3.5 engine Vision with 3.3 engine Premier, with distributorless ignition Premier, with distributor Eagle Wagon 60122 6082 6042 6092 60220 67122 6782 6742 6792 67220 65122 6582 6542 6592 65220 4564 4510 4510 4565 4565 4592 45113 Idea,Palio,Strada, 1.8 8-valve engines (Mexico) 940532 947532 945532 Brava, Palio, Siena, Strada 1.6 16v (Mexico) refer 500 (with vertical distributor cap towers) 2005 2705 2505 Dino (V6) 6050 6750 6550 For European Fords, please inquire For Australian Fords, see extra listing at the end of this catalog 4 CYLINDER 2016-2011 2015-2013 2015-2012 2012-2001 2004-1995 2004-1997 1998 1997-1993 1996-1991 1996-1991 1996-1988 1994-1991 1994-1984 1992-1988 1992-1988 1990-1981 1990-1984 1988-1983 1983-1977 1980-1978 1976-1974 1974-1971 1974-1968 Fiesta (1.6 engine, Ti-VCT) 40505 47505 Fiesta (1.6 engine, Ti-VCT non0-USA) 40505 47505 Focus (1.5 & 1.6 engine, Ti-VCT non-USA) 40505 47505 Courier,Fiesta,Ikon,Ka (Mexico), 1.6 SOHC eng 40518 47518 Contour, Escort ZX2, Focus with 2.0 liter DOHC engine -- wires attached to ignition coils with plastic clip 40227 47227 -- wires not attached to coils with plastic clip 40382 47382 Escort, Focus with 2.0 liter SOHC engine -- wires attached to ignition coils with plastic clip 40302 --- wires not attached to coils with plastic clip 40402 -Probe, 2.0 engine 40300 47300 Probe, 2.0 engine 1 40245 47245 Escort, 1.8 DOHC engine 40167 47167 Escort, 1.9 SOHC engine 40181 -Aspire & Festiva 4077 4777 Mustang 40202 -Tempo & Taurus 4042 -Probe, 2.2 engine, except turbo 40105 47105 Probe GT, 2.2 turbocharged engine 4027 4727 Escort & EXP 4018 -LTD, Mustang, Thunderbird (except Turbo) 4041 -Mustang Turbo, Thunderbird Turbo 1 --2.3 engine (except turbocharged engines) 4013 -Fiesta (USA specification only) 4046 -Mustang & Pinto with 2.3 engine 4069 4769 Pinto with 2.0 engine 4004 4704 Pinto,Cortina, 1.6 (exc. Cortina GT twin cam) 4084 4784 45505 45505 45505 45518 45227 45382 45302 45402 45300 45245 45167 45181 4577 45202 4542 45105 4527 4518 4541 45190 4513 4546 4569 4504 4584 6 CYLINDER 2010-2005 2007-2001 2004-2001 2003-2000 2002-1992 2000-1995 2000-1994 6 CYLINDER 1996-1993 1996-1993 1992-1991 1992-1988 1988 4764 4710 4710 4765 4765 4792 47113 FORD (cars only) EAGLE 4 CYLINDER 1998-1995 1998-1995 1996-1991 1996-1992 1994-1990 1994-1989 1990-1989 1990-1989 1990-1988 1989-1988 4064 4010 4010 4065 4065 4092 40113 non-USA models (inquire for engines not mentioned) -- 2782 2782 2781 2781 2781 2781 2785 2770 2755 2784 2755 2782 2786 2787 2794 2762 2780 2749 2754 2755 2770 X1/9, 128, 138, Strada (US specification) 124 Spider, Coupe, 1.8 & 2.0 engines Brava with fuel injection 131 & Brava with carburetor 124 with 1.6 engine 124 with 1.4 engine 850 FERRARI 2003-1992 1999-1994 1994-1989 1991-1986 1990-1982 456, 550 refer 355 (F355), 3.5 V8 980308 987308 985308 348, Mondial t, 3.4 V8 80237 87237 85237 Testarossa (re-use original spark plug boot & tube) 1719 * -308, 328, Mondial, 3.0 & 3.2 V8 (QV), you must re-use original spark plug boot & tube -87236 * -1989-1985 412 (with 2 distributors) -1737 * -1985-1972 365 GT4 2+2, 400GT, 400GTi (with 2 distributors) -- 1741 * -1983-1974 308, Mondial, 2 valve V8 (re-use original spark plug boot and tube) -- GT4, GTB, GTS (carbureted), with 2 distributors -- 87293 --- GTBi,GTSi,Mondial (injected) with 2 distributors -- 87227 --- GT4, GTB, GTS with 1 distributor 80262 87262 85262 2000-1996 1999-1996 1997-1993 1997-1994 1995-1994 1995-1988 1995-1986 1995-1993 1995-1989 1994-1990 6 Mustang, 4.0 V6 60257 Taurus, 3.0 12 valve engine 60252 Mustang, 3.8 V6 60248 Taurus, 3.0 24 valve engine 60270 Taurus, 3.0 Flex Fuel 60137 Contour, SVT Contour, 2.5 V6 engine 60153 Mustang, 3.8 V6, please note ignition coil location - front of engine (1994-early 1999) 60120 - left of engine (early 1999-2000) 60224 Taurus, 3.0 12 valve engine (except Flex Fuel) 60193 Taurus, 3.0 24 valve engine 60194 Probe GT, 2.5 V6 engine 60129 Thunderbird, except Super Coupe 60120 Thunderbird Super Coupe 60138 Taurus, 3.8 engine 6073 Taurus, 3.0 engine (except SHO and Flex Fuel) 6033 Taurus SHO, 3.2 engine (automatic trans.) -Taurus SHO, 3.0 engine (manual trans.) -Tempo & Probe, 3.0 engine 6033 ----------67129 -------- 65257 65252 65248 65270 65137 65153 65120 65224 65193 65194 65129 65120 65138 6573 6533 65173 65133 6533 We can make custom sets to almost any specification - please inquire 1989-1971 1988-1974 1981-1978 1978-1975 1975-1971 1973-1968 1973-1955 DUCATI 2016-2015 2016-2015 2016-2012 2016-2014 2016-2014 2016-2014 2014-2013 2014-2008 2012-2010 2010-2008 2010-2006 2009-2008 2009-2003 2009-2006 2008-2005 2007-2003 2007-2004 2006-1994 2006 2006-2003 2005-2003 2005-1999 2004-2001 2003-1997 2003-1991 2002-1998 1998-1991 1992-1989 KV85 8mm 7mm 8.5mm 1974-1968 Dino 206, 246, V6 engine 6050 6750 6550 * You can purchase factory style red silicone tubing to fit over 7mm cable if your original tubing is not in good condition, part number is SLV5 - order by the foot DODGE & PLYMOUTH TRUCKS (continued) 8 and 10 CYLINDER (continued) 1991-1988 1989-1979 1979 1978-1964 1978-1973 1972-1958 1967-1957 Application Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm FORD (continued) 6 CYLINDER (continued) 1993-1989 1993-1989 1988-1984 1986-1982 1983-1977 1979-1977 1976-1960 1976-1974 1972-1952 Thunderbird, except Super Coupe Thunderbird Super Coupe 3.8 V6 engines, fuel injected except Taurus All V6 engines with carburetor 200 3.3, 250 4.1 L6 engines 171 2.8 V6 engine (with Duraspark ignition) 144, 170, 200, 250 L6 engines 171 2.8 V6 engine (Mustang & Pinto) 223, 240 engines 6071 -6571 6074 -6574 6028 -6528 6026 -6526 6016 -6516 6017 -6517 6018 6718 6518 6011 6711 6511 6010 6710 6510 IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 2011-1998 4.6 V8 SOHC (2 valve/cyl) V8 engines with coil-on-spark-plug ignition, replacement spark plug boots and spring assemblies available 1999-1994 Crown Victoria with 4.6 engine 80189 -85189 1998-1996 Mustang GT (4.6 SOHC engine) 80220 -85220 1998-1996 SVT Mustang Cobra (4.6 DOHC engine) 80225 -85225 1997-1994 Thunderbird with 4.6 engine 80188 -85188 1995 Mustang Cobra-R (5.8 engine) 8087 -8587 1995-1986 Mustang with 5.0 engine 80149 -85149 1993-1991 Thunderbird with 5.0 engine 8086 -8586 1993-1992 Crown Victoria with 4.6 engine 80164 -85164 1991-1986 Crown Victoria with 5.0 engine 8045 -8545 1991-1986 Crown Victoria with 5.8 engine 8036 -8536 1988-1986 Thunderbird with 5.0 engine 8043 -8543 1985-1984 302 5.0 & 351 5.8 engines, male coil tower 8043 -8543 1985-1977 255, 302 & 351W engines, female coil tower 8036 -8536 1979-1977 351M, 400 engines 8037 -8537 1979-1977 460 engine 8073 -8573 1976-1962 221, 260, 289, 302, 351W engines 8007 8707 8507 1976-1968 351C/M/Boss, 400, 429 (except Boss), 460 V8 8014 8714 8514 1971-1958 332,352,360,361,390,406,410,427,428 engines 8014 8714 8514 1962-1964 239, 256, 272, 292, 312 engines (Y-block) 8000 8700 8500 1954-1949 239, 255 flathead V8 engines refer 1948-1946 239 flathead V8 engine refer Ranger, 2.3 engine EcoSport (Mexico), 2.0 engine EcoSport (Mexico), 1.6 engine Escape, 2.0 engine Ranger, 2.3, 2.5 engines Ranger Ranger (except with distributor ignition) Aerostar,Bronco II,Ranger, 2.3 fuel injected Bronco II, Ranger with 2.0, 2.3 carburetor Courier with 2.3 engine Courier with 1.8 & 2.0 engines 40413 40453 40518 40382 40310 40202 40201 4041 4013 4069 4003 47413 47453 47518 47382 -----4769 4703 45413 45453 45518 45382 45310 45202 45201 4541 4513 4569 4503 6 CYLINDER 2011-2002 2010-2006 2010-2002 2008-2001 2008-2001 2007-2004 2005-2002 2003-2001 2002-1994 2001 2001-1997 2001-1997 2000-1997 2000-1998 2000-1999 2000-1997 1 4.0 engine, Ranger Explorer Sport Trac Explorer (except Sport Trac & 2002-03 Sport) 4.2 engine, E/F series trucks 3.0 engine, Ranger 3.9, 4.2 engines, Freestar Explorer Sport (2002-03 only) & Sport Trac Windstar, 3.8 engine Windstar, 3.0 engine 4.0 SOHC V6 engine, Explorer & Ranger -- ignition coils on right (passenger) side -- ignition coils on left (driver) side of engine 4.0 OHV V6 engine 4.0 SOHC V6 (export Explorer w/RHD) 4.0 SOHC V6 engine (except export Explorer) 3.0 engine, Ranger 3.8 engine, Windstar 4.2 engine 3.8 engine, Windstar 3.0 engine, Aerostar 4.0 V6 engine, Explorer, Aerostar, Ranger 300 4.9 L6 (1977; with Duraspark ignition only) 3.0 V6 engine, Ranger 3.0 V6, Aerostar/Ranger (except 1995 Ranger) 2.8 & 2.9 V6 engines, Bronco II & Ranger 3.0 V6 engine, Aerostar 2.8 V6 engine, Aerostar 3.8 V6 engine 223, 240, 262, 300 engines 144, 170, 200, 250 engines KV85 8mm 7mm 8.5mm 60139 60123 6091 6030 60123 6090 6029 6033 6052 6026 6010 6018 ----------6710 6718 65139 65123 6591 6530 65123 6590 6529 6533 6552 6526 6510 6518 8 & 10 CYLINDER 2015-2010 6.2 V8 80295 87295 85295 2013-1997 6.8 V10 and 4.6 & 5.4 V8 SOHC (2 valve/cyl) with coil-on-spark-plug ignition, replacement spark plug boots and spring assemblies available 2001-1998 5.0 engine, Explorer --85270 1999-1997 4.6 & 5.4 engines (except coil on plug ignition) 80189 -85189 1998-1993 5.8 engine (except F150 Lightning) 8088 -8588 1998-1989 7.5 engine 80228 -85228 1998-1991 6.1, 7.0 engines with male coil tower 80228 -85228 1997 5.0 engine, Explorer (late 1997 models) 1 --85231 1997-1996 5.0 engine, Explorer (all 1996 and early 1997) 1 --85230 1996-1994 5.0 engine, F-series pickups & Bronco 8086 -8586 1996-1994 5.0 engine, E-series vans 8088 -8588 1995-1977 370 6.1, 429 7.0 engs with female coil tower 8073 -8573 1995-1993 F-150 Lightning (5.8 engine) 8087 -8587 1993-1988 5.0, 5.8 engines 8088 -8588 1988-1978 460 7.5 engines 8073 -8573 1987-1984 302 5.0 & 351 5.8 engines, male coil tower 8043 -8543 1987-1977 255, 302, 351W engines, female coil tower 8036 -8536 1982-1977 351M, 400 engines with Duraspark ignition 8037 -8537 1982-1958 352,359,360,361,389,390,391,475,477,534 V8 8014 8714 8514 1976-1968 351C, 351M, 400, 429, 460 engines 8014 8714 8514 1976-1962 221, 260, 289, 302, 351W 8007 8707 8507 GEO, for 1998 onwards see CHEVROLET FORD TRUCKS, SUVS and VANS 4 CYLINDER 2011-2001 2008-2004 2007-2001 2004-2001 2000-1995 1994-1992 1991-1989 1988-1985 1988-1982 1982-1977 1982-1972 1998-1994 1998-1996 1996-1990 1996-1977 1997-1995 1995-1991 1992-1983 1990-1986 1986 1983-1982 1976-1952 1974-1960 Application 1997-1989 1997-1992 1997-1993 1997-1994 1995-1989 1993-1989 1993-1990 1992-1990 1989 Metro, 3 cylinder engine Metro, 4 cylinder engine Prizm Tracker with1.6 liter 16 valve engine Tracker, except 16 valve engine Storm (except GSi), Spectrum Turbo Storm GSi (16 valve DOHC engine) Prizm GSi Spectrum, except Turbo ---------- 65257 65258 65258 65256 65254 65297 65257 65253 6579 60197 60257 60196 60198 60197 60231 60222 60195 --------- 65197 65257 65196 65198 65197 65231 65222 65195 3707 47129 47251 47139 4707 4795 47215 47249 4756 3507 45129 45251 45139 4507 4595 45215 45249 4556 GMC (see CHEVROLET TRUCKS and GMC TRUCKS) HARLEY DAVIDSON Street 500 & Street 750 (XG500 & XG750) models 2015-2014 All 60257 60258 60258 60256 60254 60297 60257 60253 6079 3007 40129 40251 40139 4007 4095 40215 40249 4056 refer Dyna & Softail with Twin Cam engines 2015-1999 Twin cam engines (except FXCW & FXS) 2015-2008 FXCW/FXCWC “Rocker”, FXS & FXSB 2045 2745 2545 2074 2774 2574 Touring & Trike models with Twin Cam engines 2015-2009 All 2008-1999 All 2075 2775 2575 2046 2746 2546 Evolution & Shovelhead (except Sportster) All with ignition coil mounted at rear/leftside Evolution engines, 1984 only, with front mount coil Evolution engines, 1985 on, front mounted ignition coil Shovelhead with front mounted ignition coil FXR models, ignition coil mounted between cylinders 2001 2013 2011 2003 2002 2701 2713 2711 2703 2702 2501 2513 2511 2503 2502 2771 2790 2740 2711 2744 2571 2590 2540 2511 2544 Sportster, XL & XR (Evolution & Ironhead engines) 2015-2007 2012-2008 2006-2004 2003-1986 2003-1998 XL models XR1200, XR1200X XL models XL models, except 1998-2003 XL1200S XL1200S (Sportster Sport) 2071 2090 2040 2011 2044 For 1997: For “early” engines, wires for cylinders 7 & 8 (driver side, rear) are routed around the front of the engine. F or “late” engines, around the back of the engine 7 We can make custom sets to almost any specification - please inquire 8 CYLINDER Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm HARLEY-DAVIDSON Sportster, XL & XR (continued) 1985-1965 Ironhead, ignition coils mounted under gas tank 2016 2716 2516 1985-1965 Ironhead with ignition coils mounted under seat 2012 2712 2512 1969-1957 Ironhead engines with magneto ignition 2008 2708 2508 2002-1998 1999-1998 1997-1994 1997-1992 1997-1995 1991-1990 1989-1985 1985-1984 1983-1976 47216 67178 47216 47171 67146 47163 47159 47160 4730 45216 65178 45216 45171 65146 45163 45159 45160 4530 INDIAN MOTORCYCLES 40232 40216 40216 40164 40125 40164 4062 40161 4060 4030 40117 47232 47216 47216 47164 47125 47164 4762 47161 4760 4730 47117 45232 45216 45216 45164 45125 45164 4562 45161 4560 4530 45117 INNOCENTI del Sol VTEC (DOHC VTEC engine) 1 del Sol Si (SOHC VTEC engs) 1 del Sol S 1 del Sol S 1 40232 40216 40216 40164 47232 47216 47216 47164 45232 45216 45216 45164 Prelude VTEC/SR/Type SH (2.2 DOHC eng.) 1 Prelude S (2.2 SOHC engine) 1 Prelude Si, SE & SR (2.3 DOHC engine) 1 Prelude Si, SE, SR Prelude S All All 40188 40171 40172 40162 40131 40159 4030 47188 47171 47172 47162 47131 47159 4730 45188 45171 45172 45162 45131 45159 4530 CR-V 40170 Odyssey 40216 Odyssey 1 40171 Passport V6 eng. (exc. 1996 with direct ignition) 60180 Passport with 4 cylinder engine 4098 47170 47216 47171 67180 4798 45170 45216 45171 65180 4598 Civic Si, Si-R (DOHC VTEC engne) All, except 1999-2000 Civic Si/Si-R 1 Civic EX, Si, VX (SOHC VTEC engs) 1 Civic CX, DX, LX (non-VTEC engs) 1 D16A8/A9 DOHC engines (not sold in USA) Civic & CRX (D15B1/2/6, D16A6 engines) 1 Civic Si & CRX Si ( fuel injected engines) 1 Civic & CRX with carburetor (see note 2) 2 Civic & CRX with carburetor (see note 2) 2 Civic 1300, Civic 1500 Civic 1200 del Sol (see above for Civic & CRX) 1997-1993 1997-1992 1997-1996 1995-1992 Prelude 2001-1993 1996-1992 1996-1992 1991-1988 1990-1988 1987-1983 1982-1979 CR-V, Odyssey, Passport 2001-1997 1998 1997-1995 1996-1994 1996-1994 HUDSON 1956-1955 352 V8 1956-1948 202, 232, 262, 308 6 cylinder 80321 87321 85321 60343 67343 65343 HUMMER 2010-2009 2008 2007-2002 1996-1995 H2 & H3 H2 & H3 H2 (6.0 engine) H1 (5.7 engine) 80229 80283 80241 8060 87229 87283 87241 8760 85229 85283 85241 8560 HYUNDAI 2012-1996 2008-1999 2006-2003 2006-1996 Elantra, Tiburon, Tucson (2.0 4 cylinder) Sonata,Tiburon,Tucson,Santa Fe, 2.5 & 2.7 V6 XG350, Santa Fe, 3.5 V6 engine Accent (1.5, 1.6 liter 16 valve engines) -- 4 spark plug wire system -- 2 spark plug wire system (in USA - to 12/96) 2006-1999 Sonata, Santa Fe, 2.4 liter 4 cylinder engine 2002-1995 Accent (1.5 liter 12 valve engine) 1 1 2 40275 47275 45275 60238 67238 65238 60308 67308 65308 40331 40346 40448 40240 47331 47346 47448 47240 45331 45346 45448 45240 2016-2014 2013-2008 2003-2002 2003-2001 2001-1999 KV85 8mm 7mm 8.5mm XG300, XG350 60307 Sonata, 3.0 V6 engine 6081 Sonata, 4 cylinder 16 valve engine 1 40169 Elantra 1 40169 Scoupe 1 40200 Excel 4005 Scoupe, Sonata (4 cyl., exc. 1992), Pony,Stellar 4005 Excel 4020 40216 60178 40216 40171 60146 40163 40159 40160 4030 2.3 liter 4 cylinder 3.0 litre V6 VTEC engine 2.2 litre 4 cylinder SOHC VTEC engines 1 2.2 litre 4 cylinder non-VTEC engines 1 2.7 litre V6 engine All 1 All (except 1985 fuel injected models) All (except 1985 with carburetor) All Civic and CRX (see below for del Sol) 2000-1999 2000-1996 1995-1992 1995-1992 1992-1986 1991-1988 1987-1985 1987-1985 1986-1984 1983-1975 1979-1973 2002-2001 1998-1990 1998-1992 1995-1992 1995-1993 1994-1990 1992-1983 1989-1986 Application Chief, Chieftan (Thunder Stroke 111 engine) Chief (Powerplus 105 engine) Chief (Powerplus 100 engine) Scout & Spirit Chief refer 2067 2066 2002 2001 67307 6781 47169 47169 47200 4705 4705 4720 65307 6581 45169 45169 45200 4505 4505 4520 2767 2766 2702 2701 2567 2566 2502 2501 INFINITI 2002-1991 G20 2000-1997 QX4 1992-1990 M30 1988-1983 Mini (3 cylinder Daihatsu engine) 40196 47196 45196 60155 67155 65155 6060 -6560 3004 3704 3504 INTERNATIONAL HARVESTER (IHC) 4 & 6 CYLINDER 1980-1978 1980-1961 1976-1950 1975-1969 4 cyl, male distributor cap towers 4 cyl, female distributor cap towers 372, 406, 450, 501 L6 engines 232, 258 L6 engines 4066 4067 6010 6008 4766 4767 6710 6708 4566 4567 6510 6508 8064 8055 8054 8016 8024 8764 8755 8754 8716 8724 8564 8555 8554 8516 8524 4056 40215 4095 4027 4025 4756 47215 4795 4727 4725 4556 45215 4595 4527 4525 4095 40215 40212 4044 40154 4795 47215 47212 4744 47154 4595 45215 45212 4544 45154 8 CYLINDER 1984-1964 1984-1977 1982-1977 1982-1975 1976-1972 266,304,345,392,female distributor cap towers 304,345,392 V8, male distributor cap towers 404, 446, male distributor cap towers 404, 446 female distributor cap towers 400 (AMC/Jeep) engine ISUZU, OPEL ISUZU, ASUNA (CANADA) I-Mark, Opel Isuzu 1989-1986 1989 1989-1987 1985 1985-1975 I-Mark (except all Turbo and 1989 RS) I-Mark RS (DOHC engine) I-Mark Turbo I-Mark, 1.5 eng. (front wheel drive) I-Mark , 1.8 eng. (rear wheel drive), Opel Isuzu Isuzu Impulse, Isuzu Stylus, Asuna Sunfire 1993-1991 1993-1990 1993-1991 1989-1985 1987-1985 Stylus, SOHC (12 valve) engine Impulse,Stylus,Sunfire, DOHC (except Turbo) Impulse Turbo, DOHC turbocharged engine Impulse (2.3 engine and 2.0 turbo engine) Impulse (2.0 non-turbo engine) Trucks, SUVs, Amigo, Oasis, Hombre, Pickup, Rodeo,Trooper 2007-2003 2006-2005 2003-1996 2003-1998 2002-1996 2001-1998 1999-1998 1997-1996 1997-1996 1997-1986 1996-1992 1996-1993 1996-1992 Trucks, 5.3, 6.0 V8 (except 2005-06 Ascender) Ascender, 5.3 engine Trucks, 5.7 V8 2.2 liter 4 cylinder (Rodeo, Amigo) 4.3 V6 engine (Hombre) 2.2 liter 4 cylinder (Hombre) 2.3 liter 4 cylinder (Oasis) 2.2 liter 4 cylinder (Hombre) 2.2 liter 4 cylinder (Oasis) 2.3 & 2.6 liter 4 cylinder engines Trooper with 3.2 DOHC V6 engine Rodeo with 3.2 DOHC V6 engine Rodeo, Trooper with 3.2 SOHC V6 engine -- Ignition coils mounted at rear of engine -- Ignition coils mounted at front of engine 1996-1993 NPR & W series trucks, 5.7 V8 engine 1993-1989 2.8 & 3.1 V6 engines 1988-1981 1.8 & 1.9 liter 4 cylinder engines 80241 80283 80223 40363 60152 40378 40216 40322 40171 4098 60181 60180 87241 87283 87223 47363 67152 47378 47216 47322 47171 4798 67181 67180 85241 85283 85223 45363 65152 45378 45216 45322 45171 4598 65181 65180 60183 60249 8060 6062 4025 67183 67249 -6762 4725 65183 65249 8560 6562 4525 For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 1985-86 carbureted Honda Civic/CRX have distributor caps with either vertical or horizontal distributor cap towers. We refer to "vertical" and "horizontal" as the direction of the towers when cap is fitted to the engine. Vertical towers (point upwards): order as for 1987. Horizontal towers (point to the side): order as for 1984. 8 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! HOLDEN - see extra listing at the end of this catalogue HONDA Accord Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ JAGUAR XJ12 with Nippondenso distributorless ignition 1010 -XJ12, XJS V12 with Marelli ignition 1008 -XJ6, XJS, XJR (3.2, 3.6, 4.0 engines) 60170 -XJ220 960323 967323 XJS, XJ12 V12 with HE engine & Lucas ignition 1007 -XJ6 with 2.9 SOHC engine (non-USA engine) 60327 67327 XJ6 etc., 2.8, 3.4, 4.2 6 cylinder engines 6000 6700 XJ12, XJC & XJS V12 (except HE) 1001 1701 XJ12, E-type, XKE, V12 with carburetor 1002 1702 E-Type, XKE, 3.8 & 4.2, Push-in type * -- 967334 All Screw-in (Acorn) type * refer 1510 1508 65170 965323 1507 65327 6500 1501 1502 -- IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! * "Push-in" & "Screw-in " refer to the style of distributor cap and ignition coil, if you are unsure what these terms mean, or both are not the same on your engine, please inquire. Not supplied with wire conduit, but can be fitted into your original These are not reproduction "restoration" sets. JEEP 4 CYLINDER 2006-2002 2002-1991 1990-1984 1983-1980 1971-1949 1955-1944 2.4 engine, Liberty, TJ & Wrangler 2.5 engine 2.5 engine (AMC engine) 2.5 engine (GM engine) “Hurricane” engine flat head engine 40400 40155 4038 4048 40493 refer 47400 47155 4738 -47493 45400 45155 4538 4548 45493 60315 60294 6095 6044 60220 6038 6008 6005 67315 67294 6795 6744 67220 -6708 6705 65315 65294 6595 6544 65220 6538 6508 6505 80291 80290 80219 80260 8024 8009 87291 87290 87219 87260 8724 8709 85291 85290 85219 85260 8524 8509 6 CYLINDER 2012-2009 2011-2007 1999-1991 1990-1987 1990-1975 1986-1984 1974-1965 1971-1965 3.7 V6 engine Wrangler with 3.8 V6 4.0 engine (does not fit 1999 Grand Cherokee) 4.0 engine 232 3.8 & 258 4.2 L6 engines 173 2.8 V6 engine 232 & 258 L6 engines 225 V6 engine 8 CYLINDER 2009-2008 2005 2001-1992 1991-1986 1985-1971 1971-1968 Commander & Grand Cherokee, 4.7 engine Grand Cherokee, 5.7 engine All All 304, 360, 401 engines 350 engine JENSEN, JENSEN-HEALEY 1976-1975 1976-1972 `1976-1971 1971-1967 `1970-1966 Jensen GT Jensen-Healey Interceptor Mk III, with 440 V8 Interceptor FF (383 V8) Interceptor Mk I & II, with 383 V8 40513 47513 45513 4080 4780 4580 refer refer refer Soul, Spectra & Sportage with 2.0 engine Optima, Magentis, Sportage with 2.5 & 2.7 V6 Optima & Magentis, 2.4 liter 4 cylinder Amanti, 3.5 V6 engine Sorento, 3.5 V6 engine Sedona, 3.5 V6 Rio, Spectra, 1.5, 1.6 DOHC engines Sephia & Spectra with 1.8 DOHC engine Sportage, 2.0 DOHC engine Sephia with SOHC engine Sephia with DOHC engine Sportage with 2.0 SOHC engine 40275 60238 40448 60308 60309 60307 40446 40383 40433 40166 40238 40347 KIA 2012-2004 2008-2001 2006-2001 2006-2004 2006-2003 2005-2002 2005-2001 2004-1998 2002-1995 1997-1994 1997-1995 1997-1995 47275 67238 47448 67308 67309 67307 47446 47383 47433 47166 47238 47347 45275 65238 45448 65308 65309 65307 45446 45383 45433 45166 45238 45347 LAMBORGHINI 1999-1996 1995-1994 1978-1968 1977-1972 Diablo (5.7 engine with distributorless ignition) refer Diablo (5.7 engine with distributor) refer V12 with 2 distributors -1735 -Urraco P111/P200/P250 (2.0 & 2.5 V8) 80282 87282 85282 LANCIA 1995-1983 Delta HF Turbo/Integrale/4WD/Evo (8v & 16v) refer 1982-1980 Beta, Coupe, Zagato, 2.0 fuel injected engine * 40134 47134 45134 1 2 1979 1978-1976 1976-1970 1976-1970 Application Beta, Coupe, Zagato, 2.0 carbureted engine * Beta, Scorpion with 1.8 engine * Fulvia 1600HF S2 (side entry distributor cap) Fulvia 1600HF S2 ( top entry distributor cap) KV85 8mm 7mm 8.5mm 4092 4792 4592 4010 4710 4510 940523 947523 945523 940522 947522 945522 * may only fit USA-specification cars LAND ROVER, see ROVER LAVERDA 2000-1997 750 1999-1994 650 & 668 2015 2715 2515 2004 2704 2504 LEXUS 2005-1998 2000-1996 1998-1991 1998-1990 1997-1996 1995-1992 1991-1990 GS300, SC300 (from 1999 only), IS300 ES300 GS300 (to 1997 only), SC300 LS400, SC400 LX450 ES300 ES250 60282 60212 60157 80207 60234 60156 60116 67282 67212 67157 87207 67234 67156 67116 65282 65212 65157 85207 65234 65156 65116 2011-1998 Town Car & Navigator with coil-on-spark-plug ignition, replacement spark plug boots and spring assemblies available 1998-1994 Town Car (exc. 1998 with coil-on-plug ignition) 80189 -1997-1993 Mark VIII 80221 -1997-1995 Continental with 4.6 engine 80222 -1993-1991 Town Car with 4.6 engine 80164 -1994-1988 Continental (V6 engine) 6073 -1992-1986 Continental (V8 engine) & Mark VII 8043 -1990-1986 Town Car with 5.0 engine 8045 -1985-1984 302 (5.0) with male coil tower 8043 -1985-1977 302 (5.0), 351 (5.8) with female coil tower 8036 -1982 Continental (V6 engine) 6026 -1979-1977 400 engine 8037 -1978-1977 460 engine 8073 -1976-1958 All 8014 8714 1957-1952 All 8000 8700 1951-1949 337 flathead V8 8090 8790 85189 85221 85222 85164 6573 8543 8545 8543 8536 6526 8537 8573 8514 8500 8590 LINCOLN LOTUS 2005-2001 2005-2001 2004-1996 2004-1996 2003-2000 Elise Series 2 (Rover engine), except 111S 40469 47469 45469 Elise 111S & Sport 111 Series 2 (Rover VVC) 40494 47494 45494 Esprit V8 --- 985284 Esprit GT3 refer 340R, Exige Series 1 -- distributorless ignition 40409 47409 45409 -- with distributor ignition 40326 47326 45326 2001-1996 Elise Series 1, except 111S 40326 47326 45326 2000-1999 Elise 111S Series 1 40327 47327 45327 1995-1989 Esprit, Esprit Turbo (late S3S4) 40292 47292 45292 1992-1989 Elan M100 (except non-Turbo with distributor) 40286 47286 45286 1992-1989 Elan M100 non-Turbo with distributor ignition 40215 47215 45215 1988-1982 Esprit Turbo (S3) 40293 47293 45293 1981-1974 Eclat, Elite, Esprit S1/S2 40294 47294 45294 1975-1962 1.6 twin cam, push-in type distributor cap 1 - supplied with 17” coil wire -- wires routed over cam cover (top-entry cap) 40204 47204 45204 -- wires routed over cam cover (side-entry cap) refer -- wires routed around back of engine (top-entry cap) 40114 47114 45114 -- wires routed around back of engine (side-entry cap) 40552 47552 45552 For all above sets you may need a custom coil wire - please inquire at time of ordering 1975-1962 1.6 Lotus twin cam engines, screw-in type distributor cap 2 -- wires routed over top of cam cover -4790 --- wires routed around back of engine -4791 -1971-1967 Europa, except Twin Cam 4011 4711 4511 1965-1956 Elite with screw-in type distributor cap 2 -4787 -- MASERATI 1996-1989 1993-1989 1992-1982 1983-1976 1983-1972 1987-1967 Shamal (V8) 2.24v, 4.24v (24 valve V6 engine) Biturbo, Karif, 222, 228, 430 (18 valve engine) Merak with 1 ignition coil Merak with 2 ignition coils V8 engines refer refer 6048 6748 6548 60265 67265 65265 6049 6749 6549 refer Push-in type distributor cap (standard distributor termination, terminal on spark plug wire pushes into distributor cap tower) Screw-in type distributor cap (spark plug wire with no boot or terminal is pushed into a hole in distributor cap, the wire is th en locked into place by a pointed screw) 9 We can make custom sets to almost any specification - please inquire 1997-1994 1995-1989 1994-1988 1994-1992 1992-1981 1990-1984 1987-1970 1982-1975 1974-1971 1971-1961 1968-1948 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ 40435 40405 60284 40287 40109 47435 47405 67284 47287 47109 45435 45405 65284 45287 45109 40517 47517 45517 4002 4702 4502 4035 4735 4535 refer IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 4 CYLINDER B2300, 2.3 engine MX-5 Miata (1.8 engine) MX-5 Miata (1.6 engine) - non-USA engine Tribute, 2.0 engine Mazda 6 Mazda 3, Protegé (2.0 engine) Protegé, 1.6 engine MX-6 & 626 B2300, B2500 Pickup (except 2001 B2300) Protegé, 1.8 engine MX-5 Miata Protegé with 1.8 engine Protegé with 1.5 engine MX-6 , 626 1 MX-3 (DOHC engine) Protegé, MX-3 & 323 with SOHC engine Protegé with DOHC engine B2300 Pickup MPV Pickup, all except 1987-88 carbureted B2600 626 & MX-6 (except Turbo) 626 Turbo & MX-6 Turbo 323 (exc. Turbo), GLC Sedan, GLC Hatchback 323 Turbo (DOHC engine) B2600 pickup with carburetor 626, 616, 808 (except 1975-80 808) GLC Station Wagon (rear wheel drive) All; except Pickup, 626 and 1974-71 808 40413 40399 40168 40382 40453 40403 40519 40300 40310 40245 40168 40238 40244 40245 40238 40166 40167 40202 40102 4003 40105 4027 4077 40165 4005 4003 4034 4034 47413 47399 47168 47382 47453 47403 47519 47300 -47245 47168 47238 47244 47245 47238 47166 47167 -47102 4703 47105 4727 4777 47165 4705 4703 4734 4734 45413 45399 45168 45382 45453 45403 45519 45300 45310 45245 45168 45238 45244 45245 45238 45166 45167 45202 45102 4503 45105 4527 4577 45165 4505 4503 4534 4534 60257 60254 60241 60247 60153 60197 60196 60129 60123 60276 60129 6091 6090 6003 -60130 60143 --67241 -67153 --67129 -67276 67129 --6703 67162 67130 67143 65257 65254 65241 65247 65153 65197 65196 65129 65123 65276 65129 6591 6590 6503 -65130 65143 6 CYLINDER B4000 B3000 626, MX-6 with 2.5 V6 engine MPV (wires attached to coils with boot only) MPV (wires attached to coils with a plastic clip) B4000 pickup (with SOHC engine) B4000 pickup (with OHV engine) Millenia with 2.5 V6 engine B3000 pickup, distributorless ignition MPV 626, MX-6 with 2.5 V6 engine B4000 pickup & Navajo B3000 pickup, with distributor ignition MPV, 929 (except 24 valve engine) 929 with 24 valve engine MX-3 (1.8 liter V6 engine) 929 with 24 valve engine MERCEDES BENZ 4 CYLINDER 2012-2006 2001-1996 1996-1994 1993-1985 1 2 A & B 150/160/170/200/200T (M266 engine) C230 (to 2001), SLK230 (to 1999) C220 190E 2.3-16, 190E 2.5-16 (16 valve engine) 940515 947515 945515 40388 47388 45388 40256 47256 45256 40230 47230 45230 KV85 8mm 7mm 8.5mm 40103 47103 45103 4085 4785 4585 6 CYLINDER 2007-1998 2004-1997 1999-1993 1993-1990 1993-1986 1985-1971 1975-1967 1975-1967 1975-1954 1975-1954 2.6, 2.8, 3.2, 3.7 (M112) V6 engines 2.8 (M104.900) V6 engine (V280 Vito modeLs) 2.8, 3.2, 3.6 (M104) L6, distributorless ignition 3.0, 3.2, 3.4 (M104) engine, with distributor 190E-2.6, 260, 300 series (except 24 valve) 280 series, M110 (DOHC) engine 280 series, M130 (SOHC) carburetor engine 280 series, M130 (SOHC) fuel injected engine 220, 230 & 250 series with fuel injection 200, 220, 230 & 250 series with carburetor 60211 refer 60226 60161 6084 6047 6001 6002 6002 6001 67211 65211 67226 67161 6784 6747 6701 6702 6702 6701 65226 65161 6584 6547 6501 6502 6502 6501 87302 87240 87211 87147 85302 85240 85211 85147 8768 87265 8768 8751 8568 85265 8568 8551 47227 47382 47227 -47167 --47165 4777 ----4769 4704 4784 45227 45382 45227 45302 45167 45181 4542 45165 4577 4518 45190 4541 4513 4569 4504 4584 ----67225 ------67160 ------ 65258 65297 65252 65270 65225 65247 65197 65153 65193 65137 65194 65160 65120 6571 6573 6533 6533 8 CYLINDER 2011-2003 2011-1997 1995-1992 1991-1986 1991-1986 1985-1980 1985-1976 1979-1975 1975-1969 1975-1969 SLR McLaren (supercharged M155 engine) 4.3, 5.0, 5.4 (M113) V8 4.2, 5.0 (M119) V8 (except direct ignition) 420, 500, 560 series 5.6, 6.0 V8 with AMG 32 valve head 5.0 ,5.4 V8 with AMG 32 valve head 350, 380, 450, 500, post type distributor cap 2 6.9 V8 - post type distributor cap 2 3.5 & 4.5 V8 with post type distributor cap 2 3.5 & 4.5 V8 with push-in type distributor cap 2 80302 80240 80211 80147 refer refer 8068 80265 8068 8051 12 CYLINDER 1995-1991 6.0 (M120) V12 refer MERCURY 4 CYLINDER 2002-1999 Cougar, Mystique -- wires attached to ignition coils with plastic clip 40227 -- wires not attached to coils with plastic clip 40382 1998-1995 Mystique 40227 1999-1997 Tracer 40302 1996-1991 Tracer LTS, 1.8 engine 40167 1996-1991 Tracer with 1.9 engine 40181 1994-1984 Topaz & Sable 4042 1994-1991 Capri 40165 1990-1987 Tracer 4077 1988-1981 Lynx & LN7 4018 1986-1983 2.3 engine, Capri Turbo & Cougar Turbo 1 -1986-1983 2.3 eng, except Turbo (male ignition coil tower) 4041 1984-1977 2.3 engine (female ignition coil tower) 4013 1976-1974 Bobcat & Capri with 2.3 engine 4069 1976-1972 Capri with 2.0 engine 4004 1972-1970 Capri with 1.6 engine 4084 6 CYLINDER 2010-2002 2007-2004 2005-2001 2005-2001 2002-1998 2002-2001 2001-1998 2000-1995 2000-1996 2000-1993 2000-1996 1998-1993 1997-1994 1995-1989 1995-1988 1995-1986 1994-1992 Mountaineer, 4.0 engine 60258 Monterey 60297 Sable, 3.0 12 valve engine 60252 Sable, 3.0 24 valve engine 60270 Villager (3.3 engine) 60225 Cougar 60247 Mountaineer 60197 Cougar & Mystique, 2.5 engine 60153 Sable, 3.0 12 valve (except Flex-Fuel vehicle) 60193 Sable, 3.0 Methanol/Gasoline Flex Fuel Vehicle 60137 Sable, 3.0 24 valve V6 60194 Villager (3.0 engine) 60160 Cougar (distributorless ignition) 60120 Cougar (with distributor) 6071 Sable, 3.8 engine 6073 Sable, 3.0 V6 except 1993-95 Flex Fuel Vehicle 6033 Topaz, 3.0 V6 6033 For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 For "post type" distributor caps, the distributor connection on each spark plug wire must be pushed over a terminal at the distributor cap. For "push-in type" distributor caps the distributor connection on each spark plug wire is pushed into the distributor cap tower 10 We can make custom sets to almost any specification - please inquire RX8 1 RX7 (FD, Series 7 & 8) - non-USA engine 1 Cosmo with 20B (3 rotor) engine - non-USA RX7 1 RX7 1 RX7 (FC) with distributor ignition and power steering - non-USA engine 1985-1979 RX7 1 1979-1968 RX2, RX3, RX4, RX5 (with single distributor) 1976-1968 R100, RX2, RX3, RX4 (with twin distributors) 2011-2003 2002-1996 1996-1990 1995-1993 1992-1986 1988-1986 2010-2001 2007-2001 2002-1998 2001-2000 2001-2000 2000 2000-1997 2000-1995 2000-1995 1999-1996 1997-1993 1996-1991 1995-1994 1995-1987 1994-1992 1994-1992 1991-1990 Application 1993-1980 190E (except 16 valve engine), 200, 230 1979-1954 180, 190, 219, 200, 220, 230 series MAZDA ROTARY 2010-2001 2005-2001 2005-2001 2004-2001 2004-2002 2004-2001 2003-1999 2002-1998 2001-1995 2000-1999 2000-1990 1998-1995 1998-1995 1997-1993 1996-1994 1994-1990 1994-1990 1994 1994-1989 1993-1972 1992-1988 1992-1988 1989-1981 1989-1988 1988-1987 1987-1971 1985-1981 1980-1967 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year \ Application 8mm 7mm KV85 8.5mm Cougar XR7 (supercharged), 1990-1989 1 Capri, Cougar, Marquis, V6 engine & EFI Capri,Cougar,Marquis, V6 engine & carburetor 200 3.3, 250 4.1 L6 engines 2.8 V6 engine with Duraspark ignition 2.8 V6 engines without Duraspark ignition 144, 170, 200, 250 L6 engines 223, 240 L6 engines 6074 -6574 6028 -6528 6026 -6526 6016 -6516 6017 -6517 6011 6711 6511 6018 6718 6518 6010 6710 6510 IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! MERKUR 6025 -- --- 6525 MG (for more recent models, see ROVER) "Push-in" type distributor caps 2 Midget 1500 MGB (except V8) MGB V8 Midget MK I, II, III & IV MGC 4089 4074 80190 4000 6069 4789 4774 87190 4700 6769 4589 4574 85190 4500 6569 "Screw-in" or “Screw-on” (aka Acorn) type distributor caps 3 1974-1955 1970-1967 1960-1958 1955-1945 1100,1300,A,B,Midget,Magnette (exc. Y series) -MGC (6 cylinder) -MGA Twin Cam -TC, TD, TF, YA, YB, YT with screw on (“acorn”) type distributoutor connection. We can supply wires re-using your original “acorns” at a lower price . -- Screw-on “acorn” type igniton coil connection ---Push in type ignition coil connection -- 4787 -6758 -47534 -- 2005-2000 2005-2000 1999-1995 1999-1995 1999-1996 1994-1989 1994-1989 3.0 liter V6 2.4 liter 4 cylinder SOHC engine Eclipse GS-T & GSX (Turbocharged engines) 1 Eclipse GS & RS (except GS Spyder) Eclipse GS Spyder (2.4 engine) 1.8 (SOHC) engines 2.0 (DOHC) engines 1 60233 40182 40257 40231 40431 4005 40169 947554 -947555 -- 2008-2001 Mini, 1.4 engine (non-USA engine) 40425 47425 45425 2008-2002 Mini, 1.6 engine (Cabrio & Convertible) 40425 47425 45425 2006-2001 Mini, 1.6 engine (except Cabrio & Convertible) 40425 47425 45425 MITSUBISHI 3000GT, Diamante 1996-1992 1.8 & 2.4 liter, except 1992 2.4 litre engine 1992 2.4 liter engine 40195 47195 45195 4005 4705 4505 Galant, Lancer (USA/Canada only) 2007-1999 2006-2003 2005-1999 1998-1993 1995-1993 1992-1989 1992-1985 1990-1988 2.0, 2.4 litre SOHC engines (except Mivec) Lancer Evolution (2.0 DOHC engine) 3.0 litre 24 valve SOHC V6 engine (USA) 2.0 & 2.4 SOHC 16 valve engines 2.0 & 2.4 DOHC 16 valve engines 1 2.0 litre 4 cylinder DOHC engine 1 2.0 & 2.4 litre 4 cylinder SOHC engines V6 engine (Galant Sigma) 40182 40423 60233 40239 40257 40169 4005 6081 47182 47423 67233 47239 47257 47169 4705 6781 45182 45423 65233 45239 45257 45169 4505 6581 40182 40344 4056 40195 40169 4005 47182 47344 4756 47195 47169 4705 45182 45344 4556 45195 45169 4505 Mirage (USA/Canada) 2002-1997 2001-1999 1998-1991 1996-1993 1992-1989 1990-1985 1.8 liter 16 valve engine 1.5 liter 12 valve engine 1.5 liter 12 valve engine 1.8 liter 16 valve engine 1.6 liter 16 valve engine (incl. Mirage Turbo) 1 All except 1989 & 1990 Mirage Turbo Endeavor, Outlander, Montero Sport, Pickup, Raider, Van 2009 2008-2003 2008-2001 2005-2003 1999-1997 2000-1997 1996-1994 1996-1995 1996-1983 1995-1989 Raider (3.7 engine) Montero (3.8 engine) Montero & Montero Sport (3.0, 3.5 V6 engines) Outlander (2.4 engine) Montero Sport (2.4 liter 4 cylinder) Montero & Montero Sport (3.0 & 3.5 V6 engine) Montero (3.5 V6 engine) Montero (3.0 V6 engine) 4 cylinder engines 3.0 liter V6 engines (Montero; up to 1994 only) 60315 refer 60236 40182 40489 60209 60186 60233 4005 6014 2008-1996 1996-1992 1999-1996 1996-1993 1996-1994 Lancer Evolution IV-IX (2 wire set) 40423 Lancer Evolution I-III (4 wire set) 40536 Mirage Cyborg etc (2G), 1.6 DOHC 4G92 Mivec40562 Mirage Cyborg etc (1G). 1.6 DOHC 4G92 Mivec40452 4G63 DOHC, with NGK BK series spark plugs (16mm hex) or equivalent (26mm hole in cam cover) 40289 1994-1989 4G63 DOHC, with NGK BP series spark plugs (21mm hex) or equivalent (30mm hole in cam cover) 40169 1994-1989 4G63 DOHC with “Cyclone” intake manifold 40385 60185 67185 65185 --65128 6081 6781 6581 2013-2011 2006-2004 2004-1996 2000-1990 1990-1968 67236 47182 47489 67209 67186 67233 4705 6714 47423 47536 47562 47452 65236 45182 45489 65209 65186 65233 4505 6514 45423 45536 45562 45452 47289 45289 47169 45169 47385 45385 3-Wheeler - factory 7mm wires are already Magnecor Roadster, 3.0 V6 - Series 1 only 960324 -+8 with 4.0 & 4.6 V8 & GEMS ignition 80142 87142 +8 with 3.9 & 4.6 V8 & distributor ignition 80191 87191 +8 with 3.5 V8 (carburetted or injected) 80193 87193 965324 85142 85191 85193 MORRIS 1972-1968 Mini, Moke etc 2 1970-1953 Minor, Oxford, Cowley, except flat head 3 1968-1958 Mini, Mini-Cooper, 1100, 1300, 1800 3 4000 4700 4500 4790 -4787 -- MOTO GUZZI V11, 1100 Sport, Quota 1100, California to 2005 (1100cc) 2052 2752 2552 V10 Centauro, Daytona Racing/RS (992cc) 2050 2750 2550 MV AGUSTA 2005-1999 F4 750 series, F4 AGO, F4 Tamburini, F4 1000S 3 67315 65315 Lancer/Colt/Mirage/Galant (models not sold in USA/Canada) 1992-1983 Precis (except 1987-89), Cordia, Starion, Tredia 4005 4705 4505 2 65233 45182 45257 45231 45431 4505 45169 Expo (USA/Canada only) Cordia, Precis, Starion, Tredia 1 67233 47182 47257 -47431 4705 47169 MORGAN MINI 2004-1997 Diamante with 24 valve 3.5 V6 engine 1999-1991 3000GT & Diamante, 24 valve 3.0 V6 engine 1999-1992 3000GT & Diamante, 12 valve 3.0 V6 engine 4020 4720 4520 refer For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 Push-in type distributor cap (standard distributor termination, terminal on spark plug wire pushes into distributor cap tower) Screw-in type distributor cap (spark plug wire with no boot or terminal is pushed into a hole in distributor cap, the wire is th en locked into place by a pointed screw) 11 We can make custom sets to almost any specification - please inquire 2011-1998 4.6 SOHC (2 valve) V8 engines with coil-on-spark-plug ignition, replacement spark plug boots and spring assemblies available. 2001-1998 Mountaineer --85270 1997-1994 Grand Marquis with 4.6 engine 80189 -85189 1997 Mountaineer (late 1997, see note 1, page 7) 80231 -85231 1997 Mountaineer (early 1997, see note 1, page 7) 80230 -85230 1997-1994 Cougar with 4.6 engine 80188 -85188 1993-1991 Cougar with 5.0 engine 8086 -8586 1993-1992 Grand Marquis with 4.6 engine 80164 -85164 1991-1986 Grand Marquis with 5.0 engine 8045 -8545 1991-1986 Grand Marquis with 5.8 engine 8036 -8536 1988-1986 Capri & Cougar 8043 -8543 1985-1984 255, 302, 351W engines with male coil tower 8043 -8543 1985-1977 255, 302, 351W engines with female coil tower 8036 -8536 1979-1977 351M, 400 engines 8037 -8537 1978-1977 460 engine 8073 -8573 1976-1962 221, 260, 289, 302, 351W engines 8007 8707 8507 1976-1968 351C/M/Boss, 400, 429 (except Boss), 460 V8 8014 8714 8514 1971-1958 332,352,360,361,390,406,410,427,428 engines 8014 8714 8514 1962-1954 256, 272, 292, 312, 368 engines 8000 8700 8500 1961-1958 383, 430 engines 8014 8714 8514 1954-1949 239, 255 flathead V8 engines refer 1948-1946 239 flathead V8 engine refer 1980-1975 1980-1967 1976-1973 1974-1967 1970-1967 KV85 8mm 7mm 8.5mm Eclipse (USA/Canada only) 8 CYLINDER 1989-1987 Scorpio 1989-1985 XR4Ti 1 Application 1989-1987 Precis MERCURY (continued) 6 CYLINDER (continued) 1990-1989 1988-1984 1986-1982 1983-1977 1979-1977 1977-1972 1976-1960 1969-1956 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ 2004-1998 2001-1993 2001-1991 2000-1991 1998-1991 1998-1990 1991-1984 1990-1989 1990-1989 1990-1989 1989-1987 1989-1986 1989-1986 1988-1984 1988-1982 1986 1986-1980 1985-1982 1983-1980 1982-1970 1981-1976 1980 1979-1968 1971-1968 1970-1958 1968-1958 Frontier, Xterra 40301 Altima 40221 Sentra, 200SX, NX2000 with 2.0 engine 40196 Sentra, 200SX, NX1600 with 1.6 engine 40222 240SX 40220 Pickup & Stanza 4099 Micra 40528 Sentra & Pulsar (except 16 valve Pulsar) 40191 240SX 40118 Axxess 4099 Pickup, Pathfinder & Van (except Axxess) 8066 Stanza Sedan & Hatchback 8061 Stanza Wagon, Multi 8023 200SX 8062 310,Sentra,Pulsar (except 16 valve engine) 40528 D21 series Pickup (newer body style) 8066 Pickup (except 1986 D21 series) 8083 Stanza 8023 200SX & 510 (two spark plugs per cylinder) 8083 210, B210, B110 & 1200 4011 310 & F10 4010 Pickup,200SX,510 (one spark plug per cylinder) 4009 510, 610, 710, Pickup (except 1300 engine) 4009 2000cc engine (SRL-311) refer 1200,1300,1600cc (except 510), except below 4011 All with screw-in type distributor cap -- 47301 47221 47196 47222 47220 4799 47528 47191 47118 4799 -8761 8723 8762 47528 -8783 8723 8783 4711 4710 4709 4709 45301 45221 45196 45222 45220 4599 45528 45191 45118 4599 8566 8561 8523 8562 45528 8566 8583 8523 8583 4511 4510 4509 4509 4711 4511 4790 -- 6 CYLINDER (USA & Canada, see below for some non-US models) 2004-1996 2004-2001 2003-1998 1998-1993 1995-1990 1994-1989 1989-1984 1989-1986 1988-1987 1988-1985 1984-1970 3.3 engine, except Quest and supercharged 3.3 supercharged engine (Xterra, Frontier) Quest (3.3 engine) Quest (3.0 engine) Pickup & Pathfinder (3.0 engine) Maxima (except 1992-94 24 valve engine) 300ZX Pickup & Pathfinder 200SX Maxima Maxima, 240Z, 260Z, 280Z, 280ZX, 810 60155 60299 60225 60160 60126 60125 6060 6060 60127 6061 6024 67155 67299 67225 67160 67126 67125 6760 -67127 6761 6724 65155 65299 65225 65160 65126 65125 6560 6560 65127 6561 6524 Various non-USA/Canada models FJ20E, FJ20ET, FJ24 engines. Supplied with new spark plug hole cover but not with coil wire (that must be ordered separately). Also can be supplied without hole cover if you want to re-use your old one. -- Top-entry distributor cap, straight distributor connection 940545 947545 945545 -- Top-entry distributor cap, 900 distributor connection 940546 947546 945546 -- Side-entry distributor cap, straight distributor connection 940547 947547 945547 1999-1988 Patrol 4.2 & 4.5 engine 60187 67187 65187 1997-1990 Patrol, 3.0 RB30S engine 60266 67266 65266 2002-1993 Silvia/200SX (S14/S15) & 180SX (S13), SR20DE RWD 40530 47530 45530 2002-1993 March/Micra (K11), 1.0 & 1.3 engines 40334 47334 45334 2000-1997 SR16VE and SR20VE engines refer 1994-1991 Silvia/200SX (S13), with SR20DE RWD 40461 47461 45461 1994-1990 Pulsar/SunnyGTI-R, (N14), SR20DET AWD 40544 47544 45544 1987-1961 Patrol, 4.0 engine 6077 6777 6577 1987-1980 Patrol, 2.8 engine 60188 67188 65188 NORTON MOTORCYCLES 2014-2009 Commando 961 2004-1968 Commando, VR880 1970-1958 88, 99, 650, Atlas, Mercury with coil ignition 20102 27102 25102 2006 2706 2506 2007 2707 2507 OLDSMOBILE 4 CYLINDER 1997-1993 2.2 liter engines 1992-1988 Calais & Ciera (except Quad 4 engine) 1988-1987 Firenza with 2.0 "K" OHV engine 1 1 2 3 4051 4751 4551 4050 4750 4550 4047 4747 4547 1988-1987 1987-1984 1986-1982 1986-1982 1983-1979 1979-1978 1977-1976 Application KV85 8mm 7mm 8.5mm Firenza with 2.0 "1" OHC engine 1 4051 4751 4551 Calais, Ciera, Omega 4048 4748 4548 Firenza, 1.8 carburetor engine & all 2.0 engines 4047 4747 4547 Firenza with 1.8 fuel injected engine 4049 -4549 Ciera, Omega, Starfire (with crossflow head) 4048 -4548 Starfire except crossflow head (VIN "1") 1 4015 -4515 Starfire 4045 -4545 6 CYLINDER 2004-1996 3.4 engine, Alero & Silhouette 2001-1995 4.3 V6 engine, Bravada -- vertical distributor cap towers (some 1995) -- horizontal distributor cap towers (1995-2001) 1999-1998 3.8 engine, Intrigue 1999-1995 3.8 engine, 88 & 98 except supercharged 1999-1996 3.8 engine, 88 & 98 with supercharger 1999-1997 3.1 engine 1996 3.4 engine, Cutlass 1995-1990 3.1 engine, Silhouette 1995-1992 3.8 engine, Silhouette 1995 3.8 engine, 88 & 98 with supercharger 1996-1994 3.1 engine, Acheiva 1996-1994 3.1 engine, Ciera & Cutlass 1995 3.4 engine, Cutlass 2 1994-1991 3.4 engine, Cutlass 1994-1993 3.8 engine, 88 & 98 1994-1991 4.3 engine, Bravada 1993-1988 2.8 & 3.1 engines, Ciera & Cutlass 3 1993-1992 3.3 engine 1992-1989 3.8 V6, 88 & 98 (except supercharged) 1992-1991 3.8 V6, 98 (supercharged), Toronado, Troféo 1991-1989 3.3 engine 1990-1988 3.8 engine, Toronado & Troféo 1988-1985 3.0 engine, Calais 1988-1986 3.8 engine, Ciera 1988 Delta 88, 98 & Toronado with 3.8 "C" engine 1 1988 Delta 88 & 98 with 3.8 "3" engine 1 1987 2.8 engine, Firenza 1987-1986 3.8 engine with distributorless ignition 1986-1977 3.8 engine with distributor ignition 1986-1985 2.8 engine, Ciera, Firenza 1986-1982 3.0 engine, Ciera, 98 1984-1980 Omega 1980-1975 Starfire & Omega, V6 (except 1980 Omega) 1976-1975 All L6 engines 1974-1966 All L6 engines 1965-1964 225 V6 engine 6032 6732 6532 6043 60152 60189 60150 60207 6032 60202 6062 6009 6009 6032 60114 60167 60166 6009 6043 6040 60119 6041 6009 6009 6041 6034 6034 6041 6034 6039 6034 6023 6038 6023 6038 6023 6015 60111 6005 6743 67152 67189 67150 67207 6732 67202 6762 --6732 67114 67167 67166 -6743 6740 ---------6739 --6738 ----67111 6705 6543 65152 65189 65150 65207 6532 65202 6562 6509 6509 6532 65114 65167 65166 6509 6543 6540 65119 6541 6509 6509 6541 6534 6534 6541 6534 6539 6534 6523 6538 6523 6538 6523 6515 65111 6505 80215 8058 8028 8028 8041 8034 8041 8029 8093 8029 8041 8042 8029 8028 8031 8028 8012 8015 87215 8758 --------------8712 8715 85215 8558 8528 8528 8541 8534 8541 8529 8593 8529 8541 8542 8529 8528 8531 8528 8512 8515 8 CYLINDER 1999-1995 1993-1991 1990-1988 1987-1977 1987-1980 1979-1977 1979-1978 1979-1978 1979 1978 1977 1976-1974 1976-1975 1974 1974-1949 1964-1961 Aurora Custom Cruiser Custom Cruiser, Cutlass Supreme 260, 307, 350 ”R”, 403 engines 1 267, 305 engines 301 engine 305 engine -- Cutlass -- Omega -- Starfire 350 “L “ engine, Omega 1 350 “L “ engine, Cutlass 1 350 “L “ engine, Cutlass 1 305, 350 “L “ engines 1 260,350,455 with HEI, except 350 Omega Omega, 350 engine with HEI Omega, 350 engine with HEI All without HEI (except 215 engine) 215 engine For GM cars, the engine code is identified in 1995-81 by the 8th character and in 1980-72 by the 5th character of the VIN number , located on the dash of the vehicle Some 1995 engines may have ignition coil mounted on left side of engine, for these order as for 1994 models. Please inquire if u nsure 1993 Cutlass with 3.1M engine (for VIN code information see note 1, above) should be ordered as for 1994 12 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! NISSAN and DATSUN 4 CYLINDER (USA & Canada, see below for some non-US models) Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ OPEL (US specification, please inquire for other models) 1979-1976 Opel by Isuzu, Buick Opel (1.8 engine) 1975-1967 GT,Kadett,Manta with 1.5 & 1.9 engines 1970-1962 GT & Kadett with 1.1 engine 4025 4725 4525 4086 4786 4586 4004 4704 4504 PACKARD 1957-1955 320, 352, 374 V8 engines 1954-1946 8 cylinder flat head engines 1949-1946 6 cylinder flat head engines 80321 87321 85321 80119 87119 85119 60112 67112 65112 PANTERA 1987-1971 351C engine 8014 8714 8514 1991-1989 Optima 4049 4749 4549 IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! US and Canadian specification models 405 (except Mi16), XU9 series 8 valve engine 405 Mi16, XU9 series 16 valve engine 505 (except Turbo), 2.2 liter ZDJ series engine 505 Turbo, 2.2 liter N9T series Turbo engine 505 with V6 engine 505 with 2.0 (XN series) engine 504 & 404 604 with one ignition coil 604 with dual ignition coils 40100 40203 40110 40137 refer 40151 40186 6006 6078 47100 47203 47110 47137 45100 45203 45110 45137 47151 47186 6706 6778 45151 45186 6506 6578 Other models (please inquire for models not mentioned) 1998-1991 306 XSi, 406, 605, 806 (2.0 litre XU10J engine) 40269 47269 45269 1996-1987 205GTi/CTi, 309GTi, 1.6 & 1.9 litre 8 valve engines -- with distributor (female distributor cap towers) 40263 47263 45263 -- with distributor (male distributor cap towers) 40264 47264 45264 -- distributorless ignition 40265 47265 45265 1996-1988 106,205,206,309,405 with TU series 1.0, 1.1, 1.3, 1.4, 1.6 litre engines -- with distributor 40270 47270 45270 -- with distributorless ignition 40271 47271 45271 1992-1988 309, 405 with 1.9 litre 16 valve engine 40203 47203 45203 PLYMOUTH 4 CYLINDER 2004-2001 2000-1999 2000-1995 1998-1994 1995-1991 1994-1990 1994-1990 1994-1991 1994-1992 1992-1984 1990-1984 1990-1989 1990-1981 1989-1978 1987-1981 1986-1983 1984-1979 1983-1980 1979-1978 1977-1976 1977-1973 1973-1971 Voyager 1 Neon & Breeze with 2.0 SOHC engine 1 Neon,Breeze,Voyager 2.0,2.4 DOHC eng. 1 2 Neon & Breeze with 2.0 SOHC engine 1 2 Acclaim, Sundance, Voyager Laser with 1.8 SOHC engine Laser RS, Laser RS Turbo (2.0 DOHC engine) Colt,1.5 eng.(except 1991 Canada with carb.) Colt & Colt Vista (except 1992 with 2.4 engine) Colt Vista, except 1.8 engine in 1992 Colt, Colt Turbo (except 1989-1990 Turbo) Colt Turbo 2.2 & 2.5 engines Conquest, Sapporo, Arrow 2.6 engine 1.6 engine (except Colt) Colt (except Turbo & Vista), Champ 1.7 engine Horizon & TC3 Arrow with 1.6 silent shaft engine & 2.0 eng. Arrow,,Cricket 1.6 (except silent shaft engine) Cricket with 1.5 engine 40428 40381 40231 40223 40153 4005 40169 4056 40195 4005 4005 40169 4039 4005 4005 4040 4020 4031 4032 4005 4009 4011 3.0 V6 engine Prowler 3.0 V6 engine 225 L6 engine 3 All All KV85 8mm 7mm 8.5mm 6014 60122 6086 6022 6008 refer 6714 67122 6786 6722 6708 6514 65122 6586 6522 6508 318, 360 engines 3 8039 273, 318 (LA-series), 340, 360 engines 8022 400, 440 engines 8026 350,361,383,400,413,426 (except Hemi),440 8013 426 Hemi 4 80101 277, 301, 303, 313 (A-series), 318, 326 engines 80296 8739 8722 8726 8713 87101 87296 8539 8522 8526 8513 85101 85296 8 CYLINDER 1989-1979 1978-1964 1978-1973 1972-1958 1971-1966 1967-1957 PONTIAC 3 CYLINDER PEUGEOT (please inquire for models not listed) 1992-1989 1992-1989 1991-1985 1991-1985 1989-1987 1988-1979 1979-1961 1981-1979 1978-1976 2000-1990 1998-1997 1989-1987 1983-1979 1978-1975 1974-1960 Application ----47153 4705 47169 4756 47195 4705 4705 47169 4739 4705 4705 4740 4720 4731 4732 4705 4709 4711 45428 45381 45231 45223 45153 4505 45169 4556 45195 4505 4505 45169 4539 4505 4505 4540 4520 4531 4532 4505 4509 4511 2011-1998 1999-1989 1988-1987 1988-1985 Matiz/Matiz G2, see Daewoo Firefly Firefly Turbo Firefly, except Turbo 3007 3707 3507 3003 3703 3503 3001 3701 3501 4 CYLINDER 2009-2005 2002-1998 1999 1998 1997-1992 1997-1995 1994-1992 1993-1987 1991-1987 1991-1987 1991-1987 1989-1986 1989-1987 1987-1981 1986-1979 1986-1982 1986-1982 1979-1977 1977-1975 1963-1961 G3, Wave 40332 Sunfire 40108 Firefly 40333 Firefly 40296 Firefly 40129 Sunfire 4051 Sunbird 40179 Le Mans 4049 Tempest (except Quad 4 engine) 4051 Sunbird, Sunbird Turbo, Grand Am Turbo 4047 6000, Fiero & Grand Am (except Turbo) 4050 Sunburst, except Turbo 4056 Sunburst Turbo 4095 1000, T1000, Acadian 4014 2.5 (exc 1979 models without crossflow head) 4048 Sunbird & 2000 (except 1.8 fuel injected eng). 4047 Sunbird,Sunbird Turbo,2000, 1.8 fuel inj. engine4049 2.5 engine (non-crossflow head) 4015 All with 140 2.3 engine 4045 195 engine refer 47332 47108 47333 47296 47129 4751 47179 4749 4751 4747 4750 4756 4795 --4747 ---- 45332 45108 45333 45296 45129 4551 45179 4549 4551 4547 4550 4556 4595 4514 4548 4547 4549 4515 4545 67295 67273 67189 6732 6732 67189 67207 67242 67150 67149 -67202 6783 6762 -67167 67166 65295 65273 65189 6532 6532 65189 65207 65242 65150 65149 6509 65202 6583 6562 6509 65167 65166 6 CYLINDER 2009-2006 2009-2005 2008-1997 2005-1996 2005-1995 2005-2001 2003-1996 2002-2000 2000-1995 1999-1995 1995 1996 1995-1993 1995-1990 1995-1992 1995 1994-1991 3.4 engine, Torrent 3.5 & 3.9 engines 3.8 engine, Grand Prix 3.4 engine (except 1996 Grand Prix) 3.1 engine, Grand Am & Grand Prix 3.8 engine, Bonneville, except supercharged 3.8 engine, Bonneville, with supercharger 3.8 engine, Firebird 3.8 engine, Bonneville, except supercharged 3.8 engine, Firebird 3.8 engine, Bonneville with supercharger 3.4 engine, Grand Prix 3.4 engine, Firebird 3.1 engine, Trans Sport 3.8 engine, Trans Sport 3.4 engine, Grand Prix 5 3.4 engine, Grand Prix 60295 60273 60189 6032 6032 60189 60207 60242 60150 60149 6009 60202 6083 6062 6009 60167 60166 6 CYLINDER 2003-2001 Voyager, 3.3, 3.8 engines 2000-1990 Voyager, 3.3, 3.8 engines 1 2 3 4 5 60237 67237 65237 6085 6785 6585 if you are using Denso ITV22 or equivalent spark plugs order 47454 (7mm), 40454 (8mm) or 45454 (KV85 8.5mm) since the stock set will not fit! For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 For 1979 engines: Most engines have the late style Chrysler Corp. ignition coil with an internal spark plug type connection for the coil wire. However, some engines have the earlier type coil. For these engines order as for 1978. Please inquire if unsure. This set is for engines fitted with commonly used spark plugs, such as Champion C63YC or similar with a 50mm height from gasket seal to top of spark plug. For engines fitted with factory spark plugs with a 59mm height, a different set has to be supplied. Please inquire if unsure Some 1995 engines may have ignition coil mounted on left side of engine, for these order as for 1994 models. Please inquire if u nsure 13 We can make custom sets to almost any specification - please inquire PASSPORT (CANADA) Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year 8mm 7mm KV85 8.5mm PONTIAC (continued) 6 CYLINDER (continued) 1994 1994 1994-1993 1994-1991 1993-1992 1993-1987 1992-1985 1992-1989 1992 1989 1989 1988-1987 1988 1988-1987 1987-1985 1987-1985 1987-1986 1985 1986-1980 1984-1976 1984-1980 1979-1978 1977-1975 1974-1963 3.1 engine, Grand Prix 3.1 engine, Grand Am 3.8 engine, Bonneville 3.1 engine, Sunbird 3.3 engine, Grand Am 2.8 & 3.1 engines, Grand Prix & 6000 Firebird (except 1989 Turbocharged engine) Bonneville (except 1992 supercharged engine) Bonneville SSEi, supercharged engine Firebird Turbo 1 Firebird Turbo (fitted with ATR 3” down pipe) 2 Bonneville, except 1988 SE & SSE models Bonneville SE & Bonneville SSE Fiero Grand Am Bonneville,Grand Prix,Parisienne, 3.8 engine Bonneville,Grand Prix,Parisienne, 4.3 engine Parisienne with 4.3 engine 173 2.8 V6 engine 231 & 252 V6 engines 229 V6 engine 250 L6 engine (Canada only) 250 L6 engine All (Canada, with Chevrolet engine) 60114 6032 6009 6040 60119 6040 6038 6041 6009 6054 -6034 6041 6038 6034 6023 6036 60142 6038 6023 6021 6020 6015 60111 67114 6732 -6740 -6740 6738 ------6738 --6736 67142 -----67111 65114 6532 6509 6540 65119 6540 6538 6541 6509 6554 65217 6534 6541 6538 6534 6523 6536 65142 6538 6523 6521 6520 6515 65111 G8 2 80229 G8, Grand Prix & GTO (except 5.7 emgine) 2 80283 GTO (5.7 engine) 2 80229 Firebird 2 80229 Firebird 80143 Firebird 8058 Firebird (except 1987 Canadian with carburetor) 8038 Firebird with carburetor, Canada 1987 8091 Grand Prix, USA 8052 Grand Prix, Canada 8092 Safari Wagon, Parisienne 8028 V8 with carburetor, except 307 8041 Firebird with TPI 8046 Parisienne,Safari Wagon, 307 5.0 "Y" engine 3 8028 265, 301 engines, except 301 Turbo 8034 301 engine, Firebird Turbo 8053 267, 305, 350L engines (except 305 Firebird) 3 8041 305 eng.,Firebird (except 1980 non-California) 8093 305 eng., Firebird (1980 non-California models) 8029 307, 350R engines 3 8028 350X engine 3 8031 301, 400 engines 8034 350X engine 3 8031 350R, 403 engines 3 8028 4 305, 350L (except models as listed below ) 8029 3 305, 350L engines, Grand Le Mans 8041 305, 350L engines, Grand Prix (1979) 3 8041 305, 350L engines, Grand Prix (1978) 3 8029 305 engine, Le Mans 8041 350L engine, Le Mans (1979) 3 8041 350L engine, Le Mans (1978) 3 8042 305 engine, Sunbird 8093 301, 350P, 400 engines 8034 350R, 403 engines 8028 305, 350L engines 8029 260 engine 8028 350, 400, 455 V8, except Phoenix & Ventura 4 8034 350 engine, Phoenix & Ventura 8031 87229 87283 87229 87229 87143 8758 8738 8791 8752 8792 ----------------------------- 85229 85283 85229 85229 85143 8558 8538 8591 8552 8592 8528 8541 8546 8528 8534 8553 8541 8593 8529 8528 8531 8534 8531 8528 8529 8541 8541 8529 8541 8541 8542 8593 8534 8528 8529 8528 8534 8531 8 CYLINDER 2009 2008-2005 2005-2004 2002-1998 1997-1993 1992-1989 1988-1987 1986-1982 1981-1980 1979-1978 1977 1976-1975 1 2 3 4 5 Yearr KV85 8mm 7mm 8.5mm Application 1974-1955 307 engine, Ventura (1971-74) 350, 400, 455 engines with HEI 4 V8 engines (except 307) without HEI 4 8059 8759 8559 8034 -8534 8015 8715 8515 PORSCHE 4 CYLINDER 1995-1992 1991-1987 1989-1982 1988-1985 1985-1976 1983-1978 1976 1976-1973 1976-1970 1969-1949 1963-1957 968 944S, 944S2 (16 valve engine) 944 (except 944S & 944S2), 944 Turbo (951) 924S, 2.5 engine 924 (except Turbo & Carrera), 2.0 engine 924 Turbo (931,932), 924 Carrera GT, 2.0 eng. 912E 914 (2.0) 914 (1.7, 1.8 engines) 912, 356 (except Carrera) 356 Carrera -- crankshaft-driven distributor & 600 v-drive -- crankshaft-driven distributor & 900 v-drive -- camshaft-driven distributor 40236 40235 40192 40192 4008 4082 40442 40442 4023 4026 ---- 47236 47235 47192 47192 4708 4782 47442 47442 4723 4726 45236 45235 45192 45192 4508 4582 45442 45442 4523 4526 47438 -47439 -47441 -- 6 CYLINDER 1998-1997 1998-1993 1998-1993 1993 1993-1988 1992-1991 1989-1984 1989-1985 1984 1983-1965 911 (993) Turbo S refer 911 (993) Turbo (except Turbo S) 60301 911 (993) Carrera, Targa 60275 911 (964) Turbo (3.6 engine) 1 60240 911 (964) Carrera 2, Carrera 4 5 refer 911 (964) Turbo (3.3 engine) 1 60108 911 (930) Turbo 1 6094 911 Carrera (3.2 engine) 1 60108 911 Carrera (3.2 engine) 1 60121 911, 914-6, 930 (single spark plug engines) 1 -- ignnition coil mounted on fan shroud 6094 -- up to 1969 with ignition coil at left side 60336 1974-1973 911 Carrera RSR, 2.8, 3.0 factory twin plug eng 60322 1968-1967 911R, 2.0 fuel injected factory twin plug engine 60335 67301 65301 67275 65275 67240 65240 67108 6794 67108 67121 65108 6594 65108 65121 6794 67336 67322 67335 6594 65336 65322 65335 80218 80217 80202 80162 87218 87217 87202 87162 85218 85217 85202 85162 Fuego,R18i,Medallion,Sportwagon, 2.2 engine 40123 Alliance & Encore with 1.7 & 2.0 engines 4043 Alliance & Encore with 1.4 engine 40107 Fuego, Fuego Turbo & R18i with 1.6 engine 4093 Alliance & Encore with 1.4 engine 4037 Le Car,R5 (for Turbo see “other models” below) 40106 R15TS, R17 Gordini, R17TS (hemi head eng.) 4093 R12, R15TL, R16, R17TL 4037 R8, R10, Caravelle, Dauphine, Floride 40106 47123 4743 47107 4793 4737 47106 4793 4737 47106 45123 4543 45107 4593 4537 45106 4593 4537 45106 47559 47551 --67203 47150 47282 45559 45551 45492 45460 65203 45150 45282 8 CYLINDER 1995-1989 1988-1985 1985-1982 1984-1980 928 (32 valve engine) 928 (32 valve engine) 928 (with two distributors, except 32 valve) 928 (with one distributor) RAM TRUCKS , see DODGE TRUCKS RANGE ROVER, see ROVER RENAULT US and Canadian specification models 1990-1983 1987-1985 1987-1985 1985-1980 1984-1983 1984-1977 1980-1972 1977-1969 1972-1956 Other models (non-USA models) 2006-2005 2006-2002 2007-2004 2004-1999 1992-1983 1992-1985 1985-1982 Twingo (1.2 16 valve D4F engine - Mexico) 40559 Logan, Symbol (Mexico), 1.4, 1.6 engines 40551 Clio Sport (2.0 F4R engine), 182HP engine -Clio Sport (2.0 F4R engine), 172HP engine -Alpine V6 Turbo, R25 V6 Turbo (Z7U engine) 60203 R5 GT Turbo (1.4 engine, not Hemi-head eng.) 40150 R5 Turbo 2 (hemi-head engine) 40282 For 10mm wire sets see "R-100 10mm IGNITION CABLE SETS", page 19 For engines with aftermarket headers order part number 87259 (7mm cable), 80259 (8mm cable) or 85259 (KV85 8.5mm cable) - set has 45o angle spark plug boots For GM cars, the engine code is identified in 1995-81 by the 8th character and in 1980-72 by the 5th character of the VIN number , located on the dash of the vehicle With Pontiac engines. For Canadian models with Chevrolet engines, please inquire Note: this set currently only works for engines without the lower heat shields installed 14 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! \ Application Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm Yearr KV85 8mm 7mm 8.5mm Application \ SMART 2012-2001 Bentley with 6¾ litre V8 twin turbo engine refer 2002-1994 6¾ litre V8, normally aspirated & single turbo, with distributorless ignition -- with chassis numbers 50001-57000 80374 87374 85374 -- with chassis numbers 57001 and above 80275 87275 85275 2002-1998 Rolls-Royce Silver Seraph (5.4 liter V12) refer 1994-1989 Engines with twin distributors 80250 87250 85250 1989-1965 Engines with single distributor, except with “acorn” type distributor cap -- fuel injected engines, 1987-1989 80172 87172 85172 -- fuel injected engines, 1981-1986 80175 87175 85175 -- carbureted engines, up to 1986 80174 87174 85174 1976-1965 All with "acorn"-type distrib. cap & coil termination refer 1965-1962 Silver Cloud III & S3 -refer 1963-1959 Silver Cloud II & S2, side-entry distributor cap -87257 -1963-1959 Silver Cloud II & S2, top-entry (not “acorn”) distrib cap 87258 -1960-1950 6 cylinder engines -67281 -- ROVER, RANGE ROVER, LAND ROVER 4 CYLINDER (most of these are not USA/Canada vehicles) 2005-2000 2002-2000 2001-1995 2000-1995 1997-1993 2000-1980 1985-1958 1972-1966 1958-1948 1958-1948 MG F/TF/ZR/ZS/ZT, except VVC (2 wire set) MG TF/ZR, VVC engine (2 wire set) MGF VVC (4 wire set, distributorless ignition) MGF, except VVC (with distributor ignition) Rover 220 Turbo, 220 Coupe Mini, Metro (A-series engine) Land Rover 2,25/2.5, push-in type distrib. cap Rover 2000TC Land Rover 1.6/2.0, push in type distrib. cap Land Rover 1.6/2.0, screw-in type distrrib. cap 40469 40494 40327 40326 40325 4000 40133 40241 40553 -- 47469 47494 47327 47326 47325 4700 47133 47241 47553 4790 45469 45494 45327 45326 45325 4500 45133 45241 45553 -- 6 CYLINDER 2008-2005 LR3, Discovery 3, 4.0 V6 engine 2005-2002 Freelander, 2.5 V6 engine 1980-1967 2.6 litre 6 cylinder engines 60298 67298 65298 60264 67264 65264 60136 67136 65136 8 CYLINDER (Land Rover & Range Rover except where noted) 2004-1999 1999-1995 1996-1989 1995-1993 1989-1980 1982-1976 1975-1968 4.0, 4.6 V8 (except Discovery series I) 4.0, 4.6 V8 (except Discovery Series II) 3.9, 4.2 V8 MG RV8 3.5 V8 fuel injected engines 3.5 V8 carbureted engines All V8 80242 80142 80196 80316 80190 80192 80190 87242 87142 87196 87316 87190 87192 87190 85242 85142 85196 85316 85190 85192 85190 ROYAL ENFIELD 2010-1991 350c 500 “cast iron” engines - 21” wire 1021 1721 1521 SAAB 2009-2005 2006-2005 2003-1994 1997-1994 1993-1985 1989-1981 1981-1975 1981-1978 1980-1978 1974-1969 1974-1965 1968-1965 1965-1962 1965-1955 9-7X (5.3, 6.0 V8 engines) 9-2X (2.5 engine, except Turbo) 900, 9-3 (4 cylinder, except with Direct Ignition) V6 engine 900, 9000, 16 valve eng (except Direct Ignition) 900, 90 with 8 valve engine (H engine) 99 (except Turbo) 99 Turbo 900 (including Turbo) 99 95, 96, Sonnett with V4 engine 95, 96, Sport, 3 cylinder (long nose) Sport, GT 850, Monte Carlo 850 (bull nose) 93, 95, 96, GT 750 (bull nose) 80283 40456 40237 60272 40194 40127 40521 40520 40520 4068 4070 3022 3021 3023 87283 47456 47237 67272 47194 47127 47521 47520 47520 4768 4770 3722 3721 3723 85283 45456 45237 65272 45194 45127 45521 45520 45520 4568 4570 3522 3521 3523 Aura, Vue, Relay with 3.5 & 3.9 engines SC, SC1, SL, SL1, SW1 (8 valve engine) SC2, SL2, SW2 (16 valve engine) 16 valve engine, with non-metallic valve cover 1 16 valve engine, with aluminum valve cover 1 SC2, SL2, SW2 (16 valve engine) 60273 40136 40207 40207 40226 40226 67273 47136 47207 47207 47226 47226 65273 45136 45207 45207\ 45226 45226 2007-1998 599 & 698cc. Does not fit USA market cars 3016 3716 3516 SSANGYONG (see DAEWOO) STERLING 1991-1987 825, 827 6089 6789 6589 STUDEBAKER 1964-1962 1966-1965 1964-1961 1956-1955 Avanti All 6 cylinder All 6 cylinder 352 V8 80243 6018 6008 80321 87243 6718 6708 87321 85243 6518 6508 85321 SUBARU USA/Canada models 2011-2005 Forester & Impreza (2.5 engine, except Turbo) --45456 2009-2005 Legacy & Outback (except Turbo & 2005 “low emissions” engine) --45456 2006-2005 Baja (2.5 engine) --45350 2005-2004 Legacy & Outback, 2.5 EJ259 low emissions “PZEV” engine 45487 2004-2000 2.2, 2.5 engines (except 2004 “low emissions” engine) -45350 1999 2.2, 2.5 engines (except Legacy with 2.5 engine) --45350 1999-1997 2.5 litre DOHC engine, Legacy (engine has solid lifters, see below) -- with female ignition coil towers --45339 -- with male ignition coil towers --45340 1998 2.5 litre DOHC engine, Impreza RS & Forester --45339 1997-1996 2.5 litre DOHC engine, Legacy (engine has hydraulic lifters, see below) --45337 1998-1995 1.8 and 2.2 litre SOHC engines -- with male ignition coil towers --45277 -- with female ignition coil towers --45180 1994-1990 Impreza & Legacy, 1.8, 2.2 engines 40180 47180 45180 1993-1985 Leone/Loyale/L-Series/Omega with 1.8 SOHC (EA-82) engines -- All (except Turbo & XT) 4075 4775 4575 -- Turbocharged engines (except XT) 4053 4753 4553 -- XT & XT Turbo (except XT6) 4054 4754 4554 1993-1987 Justy 3002 3702 3502 1993-1984 Leone (3rd generation) with 1.6 EA-71 engine not a USA/Canada model 40504 47504 45504 1991-1988 XT6 (6 cylinder engine) 6066 6766 6566 1987-1985 Brat, Hatchback (except RX) - OHV engines 4052 4752 4552 1984-1967 All 4 cylinder 4052 4752 4552 Other models 2001-1996 2.0, 2.5 litre DOHC engines sold outside North America -- boot in cam cover oval shaped -- female ignition coil towers --45337 -- male ignition coil towers --45338 -- boot in cam cover teardrop shaped, ignition coils mounted centrally -- female ignition coil towers --45339 -- male ignition coil towers --45340 -- boot in cam cover teardrop shaped, ignition coils offset from center -- male ignition coil towers (coils offset to right *) -- -45415 -- male ignition coil towers (coils offset to left *) -- -45529 * when facing the engine SATURN 2009-2005 2002-1991 2002-1997 1996-1994 1996-1994 1993-1991 1 2 3 Oval shaped boot (hydraulic lifters) Teardrop shaped boot (solid lifters) SUNBEAM, HILLMAN 1976-1956 All, except Imp & Stiletto 2 1976-1956 All, except Imp & Stiletto 3 1968-1964 Tiger 40112 47112 45112 -4790 -8007 8707 8507 To identify valve covers: Aluminum valve cover is silver in color and non-metallic valve cover is black in color. These wire sets are not interchangeable Push-in type distributor cap (standard distributor termination, terminal on spark plug wire pushes into distributor cap tower) , will not fit “acorn” style distributor cap Screw-in type distributor cap (spark plug wire with no boot or terminal is pushed into a hole in distributor cap, the wire is th en locked into place by a pointed screw) 15 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! ROLLS-ROYCE and BENTLEY Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 3.0 V6 (1MZFE) engine (except Avalon) 4 cylinder (5SFE) 3.0 V6 (1MZFE) engine 4 cylinder (5SFE) 3.0 liter V6 (3VZFE) engine 2.5 liter V6 (2VZFE) engine 4 cylinder (2SELC) engine 60212 40298 60212 40255 60156 60116 -- 67212 47298 67212 47255 67156 67116 4783 65212 45298 65212 45255 65156 65116 -- Celica, Corona, plus 1967 and earlier 4 cylinder engines 1998-1994 1999-1992 1998-1994 1993-1992 1991-1990 1991-1990 1989-1988 1989-1986 1986 1985-1975 1974-1958 Celica, Corona with 3SGE (ST202) - non-USA! 40516 Celica, 2.2 (5SFE) engine, 1992 (see note) 1 40255 Celica, 1.8 (7AFE) engine 40251 Celica All-Trac Turbo, 2.0 (3SGTE) engine 40253 Celica, 2.2 (5SFE) engine 40250 Celica All-Trac Turbo, 2.0 (3SGTE) engine 40198 Celica All-Trac Turbo, 2.0 (3SGTE) engine 40173 Celica GT-S (3SGELC engine) 40174 Celica, except Celica GT-S (2SELC engine) -All (US models) 4036 All (US models) 4011 47516 47255 47251 47253 47250 47198 47173 47174 4783 4736 4711 45516 45255 45251 45253 45250 45198 45173 45174 -4536 4511 47299 47251 47249 47116 47115 4717 4796 4772 -4728 45299 45251 45249 45116 45115 4517 4596 4572 4529 4528 Corolla, Corolla FX, Starlet , Carina - USA/Canada 1999-1998 1997-1993 1991-1990 1989-1988 1988-1987 1988-1983 1987-1985 1984-1981 1982-1971 1979-1968 Corolla (1ZZFE engine) 40299 Corolla (4AFE, 7AFE engines) 40251 Corolla GT-S (4AGE engine, AE92) 40249 Corolla GT-S (4AGE engine, AE92) 40116 Corolla FX16 (4AGELC, AE82, FWD models) 40115 Corolla, Corolla FX with 4AC & 4ALC engines 4017 Corolla GT-S (4AGEC, AE86, RWD models) 4096 Starlet (4KC/4KE engines) 4072 Corolla & Carina,1.6 (2TC) & 1.8 (3TC) engines 4029 Corolla with 1.1 & 1.2 engines 4028 Cressida, Crown, Mark II 1992-1989 1988-1985 1984-1983 1982-1968 All with 3.0 (7MGE) engine All with 2.8 (5MGE) engine All with 2.8 (5MGE) engine Cressida,Crown,Mark II with 6 cylinder engines 6088 6788 6588 6080 6780 6580 6075 6775 6575 6076 -6576 Landcruiser 2007-1998 1997-1993 1992-1988 1987-1981 1980-1978 1977-1973 1972-1958 1 2 3 KV85 8mm 7mm 8.5mm FZJ100/105 (non USA models), 4.5 engine FZJ80 & FZJ70 models, 4.5 litre 1FZFE engine FJ62 and FJ80 models, 3FE engine FJ40 and FJ60 models, 2F engine FJ40 and FJ55 models, 2F engine FJ40 and FJ55 models, F/2F engines FJ40 and FJ55 models 60317 60234 6035 6046 60113 6077 60215 67317 67234 6735 -67113 6777 67215 65317 65234 6535 6546 65113 6577 65215 1995-1992 1995-1992 1992-1990 1991-1990 1989-1988 1989-1985 MR2 non-Turbo (5SFE eng),for 1992 see note 2 40255 MR2 Turbo (3SGTE engine),for 1992 see note 3 40253 MR2 Turbo (3SGTE engine),for 1992 see note 3 40175 MR2 non-Turbo (5SFE engine) 2 40250 supercharged engine 40183 All, except supercharged engine 40115 47255 47253 47175 47250 47183 47115 45255 45253 45175 45250 45183 45115 Paseo 1999-1995 Paseo (for 1995: distributorless ignition only) 1995-1992 Paseo (for 1995: with distributor only) 40213 47213 45213 40252 47252 45252 Previa, Sienna, Van 2000-1998 Sienna 1997-1990 Previa 1990-1984 Van (3YEC, 4YEC engines) 60212 67212 65212 40248 47248 45248 -4794 -- RAV4 2000-1998 RAV4 1997-1996 RAV4 40298 47298 45298 40255 47255 45255 Supra, Celica Supra, 2000GT 2002-1998 1997-1993 1992-1987 1992-1986 1986-1982 1982-1979 1970-1967 Supra except Turbo (2JZGE, 1998 only in USA) 60282 Supra, except Turbo (2JZ-GTE) 60157 Supra Turbo (7MGTE engine) 6093 All with 3.0 (7MGE) engine, except Turbo 6087 All with 2.8 (5MGE) engine 6075 All with 2.6 (4ME) & 2.8 (5ME) engines 6076 2000GT refer 67282 67157 6793 6787 6775 -- 65282 65157 6593 6587 6575 6576 All 40213 All 40262 Tercel Station Wagon (3AC engine) 4017 Tercel (exc. Canada with breaker point ignition) 4017 Tercel 4071 Trucks, Pickups (see above for Previa, Sienna and Van) 2003-1995 3.4 (5VZ-FE) V6 engine 60216 2000-1994 2.4 (2RZ-FE), 2.7 (3RZ-FE) DOHC engines -- 4-Runner & 4WD Tacoma (1997-on) 40297 -- T-100 & 2WD Tacoma (1998-on) 40297 -- 4-Runner & 4WD Tacoma (to-1996) 40279 -- T-100 & 2WD Tacoma (to-1997) 40279 1995-1993 2.4 (22RE) 4 cylinder engine 40254 1995-1992 3.0 (3VZ-E) V6 engine 60158 1992-1975 2.2 & 2.4 (20R, 22R series) 4 cylinder engine 4036 1991-1988 3.0 (3VZ-E) V6 engine 6070 1974-1958 Pickup, Hilux (8RC, 18RC and earlier) 4011 47213 47262 4717 4717 4771 45213 45262 4517 4517 4571 Tercel 1999-1995 1994-1993 1988-1987 1986-1983 1982-1980 67216 65216 47297 47297 47279 47279 47254 67158 4736 6770 4711 45297 45297 45279 45279 45254 65158 4536 6570 4511 Miscellaneous non-USA engines 1983-1970 2TG engines (for these sets, coil wire must be ordered separately). These sets intended for use with factory type spark plugs, please inquire if using more modern ones -- Wires routed over valve cover 40507 47507 45507 -- Wires routed around front of valve cover 40508 47508 45508 1982-1973 18RG engines refer 1987-1982 3T-GTE & 4T-GTE engines - supplied without coil wire, which must be ordered separately 40531 47531 45531 1998-1992 Corolla, Tercel, Corsa, Cynos (EL43,EL44,EL54), Starlet (EP82,EP91) with 4E-FTE/FE, 5E-FTE/FE and 5mm diameter factory wires -- distributor ignition 40401 47401 45401 -- distributorless ignition 40213 47213 45213 1998-1994 Celica/Carina/Corona with 2.0 3SGE engine 40497 47497 45497 1998-1991 4AGE 20 valve “black” & “silver top” engines (with 19” coil wire) -- with stock distributor cap and ignition coil. 40328 47328 45328 -- distributor cap relocated to front of engine 40561 47561 45561 1995-1989 4AGZE supercharged, distributorless ignition (AE92 & AE101 Corolla/Sprinter) 40283 47283 45283 1991-1986 1G-GTE (Soarer, Supra, Chaser, Mark 2 etc.) 60292 67292 65292 For 1992 Celica GT Convertible: For engines where ignition coil is mounted outside of distributor cap, order as for 1991 models For 1992 models please note:For 1992 models with square shaped boot in valve cover order as for 1993. If they are round, order as for 1991 For 1992 models please note: For engines with 5mm diameter factory wires order as for 1993. For engines with 7mm diameter factory wires order as for 1991 16 We can make custom sets to almost any specification - please inquire 1.3,1.5,1.6,1.8 DOHC M-series (non-USA) 940548 947548 945548 Swift+ (Swift Plus) 40332 47332 45332 Forenza & Reno 40323 47323 45323 Esteem, Swift, Vitara (1.3, 1.6 engines) 40333 47333 45333 Esteem & Swift 40296 47296 45296 Sidekick, X-90, Vitara, 1.6 SOHC 16 valve 40139 47139 45139 Esteem, Cultus, Baleno, 1.6 SOHC 16 valve 40228 47228 45228 Swift, 1.3 liter 4 cylinder SOHC engine 40129 47129 45129 Vitara,Sierra,SJ410,SJ413 (except 16 valve) 4007 4707 4507 Samurai, Sidekick (except 16 valve) 4007 4707 4507 Swift GT/GTi, Baleno, 1.3 DOHC engine 40229 47229 45229 Swift, 3 cylinder engine 3007 3707 3507 Forsa, Swift 3001 3701 3501 LJ80, LJ81, SJ20, ST20/80/90 (4 cylinder) 40490 47490 45490 LJ50, LJ55, SJ10, SJ30 (3 cylinder) 3017 3717 3517 LJ20 (2 cylinder, water-cooled) 2073 2773 2573 LJ10 (2 cylinder, air-cooled) refer TOYOTA (US/Canada models, except where noted) Camry, Solara and Avalon 2002-2000 2001-1997 1999-1996 1996-1992 1993-1992 1991-1989 1986-1983 Application MR2 SUZUKI 2010-2000 2008-2004 2007-2004 2001-1999 1998 1998-1992 1997-1995 1997-1989 1997-1980 1995-1986 1995-1989 1994-1989 1988-1982 1984-1977 1983-1975 1976-1972 1972-1970 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm \ TRIUMPH 4 CYLINDER 1981-1980 1981-1975 1981-1969 1980-1973 1980-1972 1980-1972 1968-1958 40484 4063 4089 --- 47484 45484 4763 4563 4789 4589 947483 -refer 4791 -- 4089 4789 4589 -4790 -4078 4778 4578 -4790 -- IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 6 CYLINDER 1976-1965 carbureted engines (includes all USA models) 6057 6757 6557 1975-1969 fuel injected engines (some non-USA models) 60221 67221 65221 8 CYLINDER 1981-1980 TR8 with carburetor 1981-1980 TR8 with fuel injection 1977-1971 Stag 80193 87193 85193 80191 87191 85191 80111 87111 85111 TRIUMPH MOTORCYCLES 2008-2003 2 cylinder engines (with carburetor) Unit twins from 1962 with coil ignition -- coils mounted under seat -- coils mounted under gas tank 2072 2772 2572 2009 2709 2509 2010 2710 2510 TVR 2002-1992 1993-1991 1993-1986 1991-1984 1988-1980 1988-1980 1979-1972 1979-1972 1977-1971 1971-1967 Chimaera, Griffith (V8) S3,S4 (with male distributor cap towers) S,S1,S2,S3,S4 (female distributor cap towers) Tasmin, 350 ,450 series, V8 engines 280i, Tasmin (supplied with 13” coil wire) 280i, Tasmin (supplied with 33” coil wire) 3000 series, Taimar (with 22” coil wire) 3000 series, Taimar (with 34” coil wire) 2500 series Vixen (1600cc Ford engine) 980300 987300 985300 60329 60328 80285 60171 60280 60140 60286 6057 4084 67329 67328 87285 67171 67280 67140 67286 6757 4784 65329 65328 85285 65171 65280 65140 65286 6557 4584 4792 4784 4792 4711 4592 4584 4592 4511 VAUXHALL, ENVOY 1979-1970 1969-1963 1969-1968 1967-1957 Cavalier,Firenza,Victor (4 cylinder OHC engine) 4092 Vauxhall Viva, Envoy Epic (4 cylinder) 4084 All (except Epic & Viva) with 4 cyl. OHC engine 4092 All (except Epic & Viva) with 4 cyl. OHV engine 4011 VICTORY MOTORCYCLES 2016-2008 All 2007-2002 All 2001-1999 All 2076 2776 2576 2069 2769 2569 refer VOLKSWAGEN 4 CYLINDER 2010-2007 2007-2001 2003-1999 2002-1999 Golf City & Jetta City (Canada), 2.0 engine 40463 2.0, without distributor, (AVH,AZG,BBW, BEV) * 40463 2.0, without distributor, (AEG) * 40356 2.0 engine with distributor (ABA) 3 4019 47463 47463 47356 4719 45463 45463 45356 4519 * For engines with distributorless ignition: If you are not sure of your engine code one way to identify is to look at the design of the ignition coil. For AEG engines the ignition coil towers are on the 4 corners of the coil. For AVH, AZG, BBW & BEV engines the ignition coil towers are in a single row. 1998-1985 1.6, 1.8, 2.0 liter 8 valve engines (USA) 3 4019 4719 4519 1993-1974 Fox, Dasher, Quantum 4022 4722 4522 1991-1983 Vanagon (water-cooled) 4021 4721 4521 1989-1986 1.8 & 2.0 liter 16 valve engines 3 40126 47126 45126 1984-1980 Vanagon (air-cooled) 4023 4723 4523 1984-1975 Jetta, Rabbit, Rabbit Pickup, Scirocco 3 4019 4719 4519 1979-1949 Beetle, Thing, Karmann Ghia, type 1 3 4001 4701 4501 1979-1971 Bus, Van, 1700,1800,2000 air-cooled engines 4023 4723 4523 1 2 Application KV85 8mm 7mm 8.5mm 1974-1961 Fastback, Squareback, Karmann Ghia, type 3 4016 4716 4516 1974-1971 Type 4, 411, 412 4023 4723 4523 1971-1955 Bus, Van with 1200, 1500, 1600 engines 3 4001 4701 4501 5 CYLINDER 1998-1992 Eurovan 1989-1982 Quantum 5011 5711 5511 5001 5701 5501 6 CYLINDER 2010-2009 2005-1998 2003-1997 2002-1999 1999-1998 1997-1993 1995-1991 Routan, 3.8 engine Passat with 30 valve V6 engine Eurovan Golf IV & Jetta IV with 12 valve V6 V6 (12 valve), except Golf IV and Jetta IV * V6 engine, distributorless ignition * V6 with distributor (USA to early 1993 only) * 60237 60239 60300 refer 60228 60228 60227 67237 65237 67239 65239 67300 65300 67228 65228 67228 65228 67227 65227 * NOTE FOR VW 12 VALVE V6 ENGINES: The factory wire looms on these engines easily accept 7mm cable. The looms can be modified to fit 8 or 8.5mm cable by filing off the tabs that hold the wires into the loom. ALSO NOTE that spark plug wires on 12 valve V6 engines MUST be fitted to, and removed from, the spark plugs using the correct Volkswagen tool, otherwise damage to your spark plug wires is likely. Please note that the tool supplied with new cars is plastic and only lasts a few uses before it becomes unuseable, so an aftermarket metal tool (available from Volkswagen dealers and tool/parts suppliers) should be used. PLEASE ALSO NOTE that even if the correct metal tool is used it is easy to damage the wires unless care is taken. Our warranty does not cover damage to spark plug wires resulting from this poor design by Volkswagen. VOLVO 240/260/140/120 series, and all models up to 1974 1993-1981 1982-1976 1980-1976 1975 1975-1969 1974-1960 240 series, DL, GL, GLT, GT, 4 cylinder 260 series & GLE, 2.8 V6 engine 240 series, 242, 244, 245, DL, GL, GLT, GT 242, 244, 245 164, 164E All 4 cylinder 4006 6006 4012 40152 60118 40152 4706 6706 4712 47152 67118 47152 4506 6506 4512 45152 65118 45152 740 series 1992-1989 740 (except 1989-1990 GLE) 1990-1989 740 GLE (16 valve engine) 1988-1985 All 40303 47303 45303 40135 47135 45135 40303 47303 45303 760 series, 780 series 1991-1985 1990-1987 1986-1983 1984-1983 760 Turbo,780 Turbo,Coupe, 4 cylinder engine 760 & 780 with V6 engine 760 & 780 with V6 engine 760 Turbo 40303 -6006 4006 47303 67115 6706 4706 45303 -6506 4506 850 series, C70, S70, V70 2002-1993 850, C70, S70, V70 (20 valve engine) 1997-1993 850 (10 valve engine, Canada only) 5009 5709 5509 refer 940 series 1995-1993 1995-1993 1995-1993 1992-1991 1992-1991 940 (camshaft driven distributor) 940 (except camshaft driven distributor) 940 Turbo 940 (except GLE) 940 GLE (16 valve engine) 40303 40205 40303 40303 40135 47303 47205 47303 47303 47135 45303 45205 45303 45303 45135 S40, V40 2004-2000 1.9 liter engine Marine see MARINE ENGINES - INBOARD, page 18 40436 47436 45436 WORKHORSE 2011-2008 2009-2001 2005-2000 2005-1999 2003-2002 4.8, 6.0 engines 8.1 engine 5.7 engine 7.4 engine 4.3 engine 80241 80276 80223 80277 60152 87241 87276 87223 87277 67152 85241 85276 85223 85277 65152 YUGO 1991-1990 All with fuel injection 1990-1986 All with carburetor 40148 47148 45148 4011 4711 4511 Push-in type distributor cap (standard distributor termination, terminal on spark plug wire pushes into distributor cap tower) Screw-in type distributor cap (spark plug wire with no boot or terminal is pushed into a hole in distributor cap, the wire is th en locked into place by a pointed screw) 17 We can make custom sets to almost any specification - please inquire TR7 (ignition coil mounted on fender) TR7 (ignition coil mounted on firewall) Spitfire Dolomite Sprint (with side-entry distributor cap) Dolomite 1850 (with top-entry distributor cap) Dolomite 1850 (with side-entry distributor cap) Spitfire, Herald, Estate Wagon, 1200, 1300 -- push-in type distributor caps 1 -- screw-in type distributor cap 2 1967-1952 TR2, TR3, TR4 -- push-in type distributor caps 1 -- screw-in type distributor cap 2 Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application 8mm 7mm KV85 8.5mm Yearr \ IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! conventional type (female towers) CHRYSLER, DODGE, PLYMOUTH 273, 318, 340, 360 V8 A-series engines. -- with 90o distributor ends, wires routed over valve cover -- with straight distrib ends, wires routed over valve cover CHRYSLER, DODGE, PLYMOUTH 361, 383, 400, 413, 426 (except Hemi), 440 V8 B & RB-series engines. -- Wires routed around front of valve cover. Straight distributor boots. Spark plugs 1,2,3,4,7 supplied with 90o boots, 5,6,8 with straight. 15" coil wire80121 87121 85121 -- Wires routed around front of valve cover. 90o distrib. and spark plug boots.15" coil wire 80169 87169 85169 CHRYSLER, DODGE, PLYMOUTH 426 Hemi engine HEI type (male towers) -- Engine fitted with aftermarket spark plugs, such as Champion C63YC or similar with a 50mm height from gasket seal to top of spark plug. 80101 87101 85101 -- Engine fitted with factory spark plugs with a 59mm height from gasket seal to top of spark plug. These plugs are not available as new parts 80197 87197 85197 CHEVROLET 265, 283, 302, 305, 307, 327, 350, 400 cu. in. small block V8 engines with headers. With 90o distributor and spark plug boots. For sets supplied without coil wires (as noted below), coil wires must be ordered separately. See pages 25-27 of this application guide for individual coil wires WIRES ROUTED OVER TOP OF VALVE COVERS -- HEI type distributor cap (no coil wire supplied) 8074 -8574 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coils towers) 8059 8759 8559 WIRES ROUTED UNDER EXHAUST MANIFOLDS/HEADERS -- HEI type distributor cap (no coil wire supplied) 8004 -8504 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers) 8063 8763 8563 WIRES ROUTED THROUGH BRACKETS & LOOMS RUNNING ALONG SIDE OF VALVE COVER -- HEI type distributor cap (no coil wire supplied) 8075 -8575 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers) 8076 8776 8576 WIRES FOR THE REAR 4 CYLINDERS ROUTED AROUND THE BACK OF THE ENGINE AND WIRES FOR THE FRONT 4 CYLINDERS ROUTED ACROSS THE TOP OF THE INTAKE MANIFOLD -- HEI type distributor cap (no coil wire supplied) 80126 -85126 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers) 80127 87127 85127 CHEVROLET 366, 396, 402, 427, 454 cu. in. big block V8 engines with headers. With 90o distributor boots and with either straight or 45 o spark plug boots. For sets supplied without coil wires (as noted below), coil wires must be ordered separately. See pages 25-27 of this application guide for individual coil wires. WIRES ROUTED OVER TOP OF VALVE COVERS -- HEI type distributor cap (no coil wire supplied), straight spark plug boots 8002 --- HEI type distributor cap (no coil wire supplied), 45o angle spark plug boots 80112 --- Conventional type distributor cap (supplied with 13" coil wire to conventional coil towers), straight spark plug boots 8008 8708 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers), 80113 87113 45o angle spark plug boots WIRES ROUTED THROUGH BRACKETS & LOOMS RUNNING ALONG SIDE OF VALVE COVER -- HEI type distributor cap (no coil wire supplied), straight spark plug boots 8056 -- 1 80107 87107 85107 8022 8722 8522 8502 85112 8508 85113 8556 Supplied without coil wire. Order coil wire separately if required, see pages 25-27 18 FORD 221, 260, 289, 302, 351W V8 engines. Standard pre-1977 engines with later type distributor cap. Supplied with two 13" coil wires to suit coils with both male and female towers (other coil wires can be ordered separately). 80150 -85150 FORD 332,351C,352,360,361,406,410,427,428,429,460 V8 pre-1977 engines with later type distributor cap. Supplied with two 13" coil wires to suit coils with both male and female towers (other coil wires can be ordered separately). 80151 -85151 VOLKSWAGEN Type 1 air cooled engines. For competition applications where the air shroud is removed. Supplied with 90 o spark plug and distributor boots. With standard Bosch type ignition coil, supplied with a 15" coil wire -- with original type distributor cap 40184 47184 45184 -- distributor cap fitted with aftermarket HEI type towers 40187 47187 45187 CIRCLE TRACK APPLICATIONS PLEASE NOTE that there is such a large variety of coil positions and types so these sets are supplied without coil wires, coil wires must be ordered separately. See pages 25-27 of catalog for information. CHEVROLET small block V8 engines with standard under-chassis headers with wires routed over top of valve covers 1 -- With HEI 80136 -- Without HEI 80131 CHEVROLET small block V8 engines with standard under-chassis headers with wires routed along side of valve covers. 1 -- With HEI 80139 -- Without HEI 80138 CHEVROLET small block V8 engines with standard late style upswept headers with wires routed under the headers. 1 -- With HEI 80137 -- Without HEI 80132 CHEVROLET small block V8 engines with stock Ram Horn type cast iron manifolds 1 -- With HEI 80134 -- Without HEI 80133 --- 85136 85131 --- 85139 85138 --- 85137 85132 --- 85134 85133 We can make custom sets to almost any specification - please inquire . In this section, distributor cap and coil tower types are listed as follows: KV85 8mm 7mm 8.5mm -- HEI type distributor cap (no coil wire supplied), 45o angle spark plug boots 80114 -85114 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers), straight spark plug boots 8065 8765 8565 -- Conventional type distributor cap (supplied with 13" coil wire to suit conventional coil towers), 45o angle spark plug boots 80115 87115 85115 SPEED SHOP SELECTIONS Sets include the most common lengths we encounter. With modified engines there can always be variations in lengths due to different routing of wires, location of wire separators, brackets, looms, ignition coil location, header design etc. We can also supply custom tailored sets to the customer's sizes. Also see pages 25-27 of this catalog for Individual coil wires and spark plug wires. Many of these sets are sold in 7 and 8mm cable, but they may not be suitable for some high output ignition systems and/or electronic fuel or engine management systems as well as not having a high enough heat rating for some applications. If in doubt order KV85 8mm or R-100 10mm cable, or contact Magnecor or your Magnecor distributor. Application Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year Application KV85 8.5mm 8mm 7mm \ MARINE ENGINES - INBOARD These sets include the most common lengths we encounter. There can always be variations due to engine modifications, make of boat, ignition coil location, wire routing etc. There is enough length in most of these wire sets to fit engines converted for reverse rotation. These sets will fit marine engines with marine type exhaust manifolds, for engines with automotive type headers (or for engines not mentioned) please order from the Automotive section of this catalog or contact Magnecor or your Magnecor distributor. Distributor cap and coil tower types are listed as follows: HEI type (male towers) IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! 4 CYLINDER MERCRUISER 224 cu. in. engine MERCRUISER MCM 110,120,140, conventional distrib cap MERCRUISER 3.0 engine, HEI type distributor cap OMC 3.0 engine, 1990-92, with HEI type distributor cap OMC 3.0 eng., 1990-92, conventional type distributor cap OMC 2.3 engine, 1987-91 OMC All 1967-89 (except 1987-89 2.3 engine) UNIVERSAL Atomic 4 (with 9” length coil wire) VOLVO PENTA 4 cylinder SOHC engines, 1975-91 40189 40138 40119 4097 40138 40128 40138 40380 40348 47189 47138 -4797 47138 47128 47138 47380 47348 45189 45138 45119 4597 45138 45128 45138 45380 45348 6 CYLINDER MERCRUISER MCM 165 and earlier Chevrolet L6 engines 60111 67111 65111 MERCRUISER, O.M.C., VOLVO PENTA V6 engines 1980-91, conventional distributor cap 60103 67103 65103 MERCRUISER & OMC V6 engines, HEI type distrib. cap 6072 -6572 8 CYLINDER CHEVROLET 283,307,327,350,conventional distributor cap 8099 8799 8599 CHEVROLET 305, 350 engines, HEI type distributor cap 1 80100 -85100 CHEVROLET 366,396,427,454,482 engines with conventional distributor cap --wires routed directly down from distributor 80117 87117 85117 -- wires routed behind engine, after first going back from distributor 80176 87176 85176 CHEVROLET 366, 396, 427, 454, 482, 502 engines with HEI type distributor cap 1 -- wires routed directly down from distributor 8096 -8596 -- wires routed behind engine, after first going back from distributor 80177 -85177 OMC King Cobra engines with distributorless ignition refer FORD 351, 460 etc. V8 engines with conventional ignition 8099 8799 8599 MARINE ENGINES - OUTBOARD Evinrude, Johnson, OMC outboard motors, 1985 onwards -- 3 cylinder outboard engines, 1999-85 3009 3709 3509 -- 4 cylinder V4 outboard engines, 1999-85 40214 47214 45214 -- 6 cylinder V6 outboard engines, 1999-85 60131 67131 65131 -- 8 cylinder V8 outboard engines, 1999-85 80182 87182 85182 Mercury Marine (with ignition coils as pictured at left) 2 cylinder engines 3 cylinder engines 4 cylinder engines 6 cylinder (V6) engines 6 cylinder (L6) engines 2053 3018 40432 60218 60251 2753 3718 47432 67218 67251 2553 3518 45432 65218 65251 Mercury Marine (with ignition coils as pictured at left) 3 cylinder engine 4 cylinder engines V6 engines 3009 3709 3509 40214 47214 45214 60131 67131 65131 UNIVERSAL SETS 1 Supplied without coil wire. Order coil wire separately if required, see pages 25-27 19 Application KV85 8mm 7mm 8.5mm Sets have spark plug end terminated with boot attached, distributor & coil boots supplied loose with set. Heat shrink numbering sleeves & wire separators also included with each set. These sets include enough wire is to fit the longest applications, hence there will often be a lot of wasted wire. We can also supply custom tailored sets, which are often your best choice - please inquire. 2 CYLINDER Boots and terminals are supplied For both straight & 90 o coil ends 90o spark plug ends, supplied with two 24" wires -- with female coil towers -- with male coil towers Straight spark plug ends, supplied with two 24" wires -- with female coil towers -- with male coil towers 2021 2721 2521 2028 2728 2528 2018 2718 2518 2029 2729 2529 4 CYLINDER Spark plug wire lengths are 33,33,43,49" with a 31" coil wire Straight spark plug boots, non-HEI type straight distrib boots40144 Straight spark plug boots, non-HEI 90o distributor boots 40140 Straight spark plug boots, HEI type 90o distributor boots 40143 90o spark plug boots, non-HEI type straight distributor boots 40147 90o spark plug boots, non-HEI 90o distributor boots 40145 90o spark plug boots, HEI type 90o distributor boots 40146 47144 47140 -47147 47145 -- 45144 45140 45143 45147 45145 45146 6 CYLINDER Spark plug wire lengths are 29,37,37,49,53,57" with a 31" coil wire Straight spark plug boots, non-HEI type straight distrib boots6098 Straight spark plug boots, non-HEI 90o distributor boots 6096 Straight spark plug boots, HEI type 90o distributor boots 6097 90o spark plug boots, non-HEI type straight distributor boots 60101 90o spark plug boots, non-HEI 90o distributor boots 6099 90o spark plug boots, HEI type 90o distributor boots 60100 6798 6796 -67101 6799 -- 6598 6596 6597 65101 6599 65100 8 CYLINDER Spark plug wire lengths 37,37,41,49,49,53,57,57" with a 31" coil wire Straight spark plug boots, non-HEI type straight distrib boots8079 Straight spark plug boots, non-HEI 90o distributor boots 8077 Straight spark plug boots, HEI type 90o distributor boots 8078 90o spark plug boots, non-HEI type straight distributor boots 8082 90o spark plug boots, non-HEI 90o distributor boots 8080 90o spark plug boots, HEI type 90o distributor boots 8081 115o spark plug boots, non-HEI type straight distrib boots 80158 115o spark plug boots, non-HEI 90o distributor boots 80156 115o spark plug boots, HEI type 90o distributor boots 80157 8779 8777 -8782 8780 -87158 87156 -- 8579 8577 8578 8582 8580 8581 85158 85156 85157 R-100 10mm IGNITION CABLE SETS UNIVERSAL 10mm IGNITION CABLE SETS The following sets are supplied with the spark plug end terminated with the boot attached, all distributor and coil boots are supplied loose with the set. Heat shrinkable numbering sleeves are included with each set. The lengths of each spark plug and coil wire are the same as for the Universal 7mm, 8mm and 8.5mm sets 4 cylinder, with straight spark plug boots. HEI distributor and coil boots 4 cylinder, with straight spark plug boots. Non-HEI 90o distributor boots 4 cylinder, with 90o spark plug boots. HEI distributor and coil boots 4 cylinder, with 90o spark plug boots. Non-HEI 90o distributor boots 6 cylinder, with straight spark plug boots. HEI distributor and coil boots 6 cylinder, with straight spark plug boots. Non-HEI 90o distributor boots 6 cylinder, with 90o spark plug boots. HEI distributor and coil boots 6 cylinder, with 90o spark plug boots, non-HEI 90o distributor boots 8 cylinder, with straight spark plug ends. HEI distributor and coil boots 8 cylinder, with straight spark plug boots. Non-HEI 90o distributor boots 8 cylinder, with 90o spark plug boots. HEI distributor and coil boots 8 cylinder, with 90o spark plug boots. Non-HEI 90o distributor boots 8 cylinder, with 115o spark plug boots. HEI type distributor boots 8 cylinder, with 115o spark plug boots. Non-HEI 90o distributor boots 49143 49140 49146 49145 6997 6996 69100 6999 8978 8977 8981 8980 89157 89156 We can make custom sets to almost any specification - please inquire conventional type (female towers) Yearr Vehicle Applications for Magnecor Ignition Cable Sets New applications in RED - Updated applications in BLUE Year 8mm 7mm KV85 8.5mm ISUZU -- Impulse & Stylus, DOHC non-Turbo engines 1990-1993 -- I-Mark RS (DOHC engine), 1989 Application KV85 8mm 7mm 8.5mm MAZDA -- 323 Turbo, 1988-1989 -- MX5 Miata -- MX6 & 626 4 cylinder, 1993-1997 -- Protege, DOHC engine, 1990-1994 -- RX8 -- RX7 (non-USA models), 1997-1999 -- RX7 (FD), 1993-1995 -- RX7 (FC), 1986-1992 -- RX7, 1979-1985 MERCURY and MERKUR see FORD MITSUBISHI (USA/Canada) -- Eclipse Turbo, 1995-1999 -- Eclipse, DOHC engine 1989-1994 -- Galant, DOHC engine 1993-1995 -- Galant & Mirage, DOHC engine 1989-1992 NISSAN/DATSUN -- 240Z, 260Z, 280Z/ZX, 1970-84 -- 240SX, 1991-98 -- 300ZX, 1984-1989 -- Sentra, 200SX, NX2000, 2.0 DOHC engine 1991-2000 -- Sentra, 200SX, NX1600, 1.6 DOHC engine, 1991-2000 PONTIAC -- Firebird Turbo, 1989 -- Firebird Turbo, 1989 (with ATR 3” down pipe) -- Firebird V8, 1989-1992 PORSCHE -- 924S (2.5 engine), 1985-1988 -- 944 (except 944S & 944S2), 944 Turbo (951), 1983-1989 -- 911 Turbo (3.6 engine), 1993-1994 -- 911 Turbo (3.3 engine), 1991-1992 -- 911 Turbo (3.3 engine), 1984-1989 -- 911 Carrera (3.2 engine), 1985-1989 -- 911 Carrera (3.2 engine), 1984 -- 911 series, 914-6, 930, 1965-1983 TOYOTA -- Corolla GT-S (4AGE, US models), 1988-89 -- Corolla FX16 (4AGELC engine, US models), 1987-88 -- Corolla GT-S rear wheel drive (4AGEC, US models), 1985-87 -- MR2, 1985-89 (except supercharged engine) -- (Supra, 1982-1986, 2.8 (5MGE) engine -- Supra, except Turbo, 1986-1992, 3.0 (7MGE) engine VOLKSWAGEN -- 8 valve engines, Golf, Rabbit etc. -- 16 valve engines (up to 1991) -- Type 1 air-cooled engines (Beetle etc.) FULLY TAILORED 10mm IGNITION CABLE SETS. These are only popular sets; if the set you want is not listed here please inquire - we may be able to supply something. ACURA -- Integra (except GS-R & Type-R), 1990-2001 -- Integra GS-R,/Type-R 1992-2001 -- Integra, 1988-1989 -- Integra, 1986-1987 BUICK -- Grand National, GNX & Regal Turbo, 1986 & 1987 -- Grand National, 1984-1985 CHEVROLET -- ZR-1 Corvette, 1989-1995 -- Corvette, except ZR-1, 1985-1991 -- Camaro V8, 1989-1992 -- Nova, 16 valve engine, 1988 G.M.C. Syclone & Typhoon, 1991-1993 DODGE, EAGLE, PLYMOUTH 4 CYLINDER -- Talon with Turbo, 1995-2000 -- Talon & Eclipse (DOHC engine), 1989-1994 -- Daytona IROC R/T, Spirit R/T,16 valve 2.2 engine, 1991-1993 -- Neon, Stratus, 2.0 SOHC engine, 1994-1998 -- Neon,Stratus,Talon (except Turbo), 2.0,2.4 DOHC engines, 1995-2001 8 CYLINDER -- Trucks with 5.2 & 5.9 "Magnum" V8 engines, 1992-2000 10 CYLINDER -- Viper RT/10 Roadster, up to 1996 -- Viper GT-S Coupe (1996-2002), RT/10 Roadster (1997-2002) FORD, MERCURY, MERKUR 4 CYLINDER -- Ford Escort GT, Mercury Tracer LTS, DOHC engines 1991-1996 -- Mercury Capri (DOHC engine), 1991-1994 -- 2.3 liter OHC 4 cylinder turbocharged engines 6 CYLINDER -- Ford Thunderbird Super Coupe, 1989-1993 -- Ford Thunderbird Super Coupe, 1994-1995 -- Mercury Cougar XR7 (supercharged engine), 1989-1990 8 CYLINDER -- 5.0 Mustang, 1986-1995 -- 5.8 F150 Lightning truck, 1993-1995 HARLEY DAVIDSON (up to 1998, inquire for 1999 and later) -- rear/leftside mounted ignition coil, from 1965 -- FXR models (coil mounted between cylinders) -- FLH,FLT, shovelhead engines, with front mount ignition coil -- Evolution Sportster, Evolution FLT/FLH/Electra Glide etc. HONDA -- Accord, 1998-2002 (all 4 cylinder) -- Accord, 1992-1997 (except 1994-1997 EX) -- Accord EX 1994-1997 (4 cylinder VTEC engine) -- Accord, 1990-1991 -- Civic Si & CRX Si, 1985-1987 -- Civic & CRX (except VTEC engines), 1988-1995 -- Civic EX, VX, Si, del Sol Si, (SOHC VTEC engines), 1992-1995 -- Civic & del Sol (except DOHC engines), 1996-2000 -- Civic del Sol VTEC (1993-1997), Civic Si (1999-2000) -- Prelude S, 1992-1996 -- Prelude Si, SE & SR, 1992-1996 -- Prelude Si & SE, 1988-1991 -- Prelude VTEC, SH, SR-V (2.2 liter DOHC VTEC), 1993-2000 HYUNDAI -- Accent, except GT (up to 2000) -- Elantra (Hyundai DOHC engine), Tiburon, 1996-2000 -- Elantra (Mitsubishi DOHC engine), 1993-1995 -- Scoupe, 1993-1995 -- Sonata (Mitsubishi DOHC engine), 1992-1998 Yearr 49170 49232 49125 49124 6954 6931 89161 8950 8958 49115 6943 49257 49169 49177 49223 49231 89219 1909 1911 49167 49165 49190 6974 69138 6974 89149 8987 2901 2902 2903 2911 49165 49168 49245 49167 49435 49405 49287 49109 4902 49257 49169 49257 49169 6924 49220 6960 49196 49222 6954 69217 8958 49192 49192 69240 69108 6994 69108 69121 6994 49116 49115 4996 49115 6975 6987 4919 49126 4901 CIRCLE TRACK APPLICATIONS in 10mm See "CIRCLE TRACK APPLICATIONS" on page 18 for full description of these sets 49216 49171 49216 49163 4962 49164 49216 49216 49232 49171 49172 49162 49188 CHEVROLET small block V8 engines with standard under-chassis headers with wires routed over top of valve covers. -- With HEI -- Without HEI CHEVROLET small block V8 engines with standard under-chassis headers with wires routed along side of valve covers. -- With HEI -- Without HEI CHEVROLET small block V8 engines with standard late style upswept headers with wires routed under the headers. -- With HEI -- Without HEI CHEVROLET small block V8 engines with stock Ram Horn type cast iron manifolds. -- With HEI -- Without HEI 49240 49275 49169 49200 49169 49215 49215 20 89136 89131 89139 89138 89137 89132 89134 89133 We can make custom sets to almost any specification - please inquire IMPORTANT NOTE: We manufacture spark plug wire sets in the USA and UK, however both factories use the same part numbers for different vehicle applications. If you use these part numbers to order from the UK factory please inform them as to the source of the part number, otherwise you will get the wrong set - and if you are ordering from the US factory please let us know if you got your part number from the UK catalog! \ Application Magnecor ignition cable, parts and accessories Many other parts are available, these are only some popular items. Please inquire. DISTRIBUTOR AND COIL BOOTS DB1 DB1-J Straight distributor boots. Black or blue (DB1) or Black or red (DB1-J) EPDM. Use with 7 to 8.5mm cable. Use with terminals T1, T7 or T9. DB2 90o distributor boot. Black, blue or red EPDM. Use with 7 to 10mm cable. Use with terminals T3, T3-L or T8. DB2-J 90o distributor boot. Black or blue EPDM. Use with 7 to 8.5mm cable. Use with terminal T1. DB5 90o distributor and coil boot for HEI applications. Black or red EPDM. Use with 7 to 10mm cable. Use with terminal T4 CB3 90o coil boot. Black EPDM. Use with 7 to 8mm cable. Use with terminals T3, T3-L (also with T4 & T8 for some European engines) CB4 90o coil boot. Red silicone. Use with 7 to 10mm cable. CB5 Use with terminal T3-L CB6 Straight coil boots. Black EPDM. Use with 7 to 8.5mm cable. Use with terminals T1 or T9 SPARK PLUG BOOTS SP2 Straight spark plug boot, 62mm long. Black or orange silicone. Use with 7 to 8.5 mm cable. Use with terminals T2-A or T115 SP4 SP4-HT 90o spark plug boot. Black silicone (SP4) or red high temp. silicone (SP4-HT). Use with 7 to 10mm cable. Use with terminal T4 SP6-S Straight spark plug boot for Toyota. Black silicone. For Corolla/Starlet/Van with 3KC, 3YEC, 4KC, 4YEC engines Use with 7 to 10mm cable. Use with terminals T2-A or T115 SP7 Straight spark plug boot. Black EPDM. For early Volvo & Peugeot V6 (includes De Lorean Use with 7 to 8.5mm cable, Use with terminals T2-A or T115 SP42 Straight spark plug boot. Black silicone For late Volvo & Peugeot V6 plus Eagle Premier & Dodge Monaco. Use with 7-8.5mm cable. Use Terminal T5-Z SP8 VW1 SP8-L 65mm spark plug boot combination for VW air cooled engines SP8 is black silicone boot & VW1 is black air seal. Use with 7 to 10mm cable. Use with terminals T2-A or T115 Straight spark plug boots, SP8-L is 98mm long, SP8-S is 80mm long. Black, Blue, Orange silicone (all colors not always available). Use with 7-10mm cable For SP8-L Use with terminal T5 or bendable terminal T5-Z. For SP8-S use with terminals T2-A, T115 or bendable terminal T5-Z SP8-S 21 Magnecor ignition cable, parts and accessories Many other parts are available, these are only some popular items. Please inquire. SPARK PLUG BOOTS (continued) SP9 Straight spark plug boot with end grip. SP9 is 98mm long smooth boot and SP9-E is 87mm long GM style boot. Black silicone. Use with 7 to 10mm cable, Use with terminal T5 or T5-Z SP9-E SP11 Straight spark plug boot with end grip. 110mm long. Black silicone (SP11) or red silicone (SP11-R). Use with 7 to 10mm cable. Use with terminal T5 or bendable terminal T5-Z SP11-S SP11-S-HT SP115 SP115-HT Straight spark plug boot with end grip, 88mm long. Black silicone (SP11-S) or red high temperature silicone (SP11-S-HT). Use 7 to 10mm cable. Use with terminals T12, T14 or bendable terminal T5-Z 115o spark plug boot. Black silicone (SP115-L) or red high temperature silicone (SP115-HT). Use with 7 to 10mm cable. Use with terminal T115 or T5-Z SP16 Straight spark plug boot with end grip. 76mm long. Black silicone. Use with 7-10mm cable.Use with terminal T12, T14 or bendable terminal T5-Z SP1716 Angle spark plug boot, 100mm long (65mm below angle and 35mm above angle). Black silicone. Use with 7 to 8.5mm cable, Use with terminals T2-A or T115 TERMINALS (see boot section for terminal applications) T1 Straight distributor and coil terminal. Brass. Use with 7 to 8.5mm cable. T2-A 30mm straight spark plug terminal with extended 14mm crimp surface. Use with 7mm to 10mm cable T3 90o distributor and coil terminal. Stainless steel. Use with 7 to 10mm cable. T3-L 90o extra long distributor and coil terminal, 5mm longer than T3. Brass. Use with 7 to 10mm cable. T4 90o spark plug or HEI/Duraspark distributor & coil terminal. Stainless steel. Use with 7 to 10mm cable, T5 52mm straight spark plug terminal. Stainless steel. Use with 7 to 10mm cable. T5-Z 45mm straight spark plug terminal, safely bendable inside boot. Stainless steel. Use with 7 to 10mm cable. T7 Distributor terminal for Chrysler Corp. engines requiring pronged connector. Stainless steel. Use with 7 to 8.5mm cable. TERMINALS (continued) 22 Magnecor ignition cable, parts and accessories Many other parts are available, these are only some popular items. Please inquire. T8 90o distributor and coil terminal. Stainless steel with brass insert. Used on Audi, BMW, Volvo, VW and other distributor caps & coils with push-over terminal posts, universal design fits earlier type connections, 7 to 10mm cable T9 Straight distributor and coil terminal. Brass. Used on Audi, BMW, Volvo, VW distributor caps & coils with push-over posts, universal design will also fit earlier type connections. Use with 7 to 10mm cable T12 40mm straight spark plug terminal. Stainless steel. Use with 7 to 10mm cable. T14 35mm straight spark plug terminal. Stainless steel. Use with 7 to 10mm cable. T16 50mm straight coil terminal. Brass. Bends inside DB4-F boot. Used on Ford distributorless ignition systems and some Toyota applications. Use with 7 to 8.5mm cable. T115 26mm straight spark plug terminal. Stainless steel. Use with 7 to 10mm cable. SPT1 Spark plug ferrule, SAE connection. When screwed on to the top of Bosch spark plugs and some Mercedes Benz distributor caps (that both have a threaded connector), this terminal enables standard spark plug terminals to be used. 10mm in height, equivalent to Bosch 1243 345 005. MAGNECOR IGNITION CABLES (Bulk) SCS7 Electrosports-70 7mm Ignition Cable (see Pages 41-42 for more information) 7mm outside diameter Metallic Inductance EMI Suppressed 1.32mm CN20 chrome-nickel conductor Black high temperature/high strength EVA jacket bonded to EPDM insulator Order SCS7-50 for 50 ft, SCS7-100 for 100 ft (lengths) or order any length you need SCS8 Electrosports-80 8mm Ignition Cable (see Pages 43-44 for more information) 8mm outside diameter Metallic Inductance RFI Suppressed 1.75mm CN20 chrome-nickel conductor Blue high temperature/high strength silicone jacket with EPDM insulator and fiberglass braiding Order SCS8-50 for 50 ft, SCS8-100 for 100 ft (lengths) or order any length you need KV85 (version 5) 8.5mm Competition Ignition Cable (see Pages 45-46 for more information) 8.5mm outside diameter Metallic Inductance EMI and RFI Suppressed 2.5mm FM 200T stainless steel conductor Red high temperature, high tear strength silicone rubber (entire construction) Order KV85-50 for 50 ft, KV85-100 for 100 ft (lengths) or order any length you need R-100 (version 3) 10mm Racing Ignition Cable (see Pages 45-46 for more information) 10mm outside diameter Metallic Inductance EMI and RFI Suppressed 2.5mm FM 200T stainless steel conductor Red high temperature, high tear strength silicone rubber (entire construction) Order R100-50 for 50 ft, R100-100 for 100 ft (lengths) or order any length you need CCS7 7mm Unsuppressed Solid Conductor Cable 7mm outside diameter Unsuppressed stranded tin-plated copper conductor Black silicone jacket with EPDM insulator and fiberglass braiding, jacket is unprinted Order CCS7-50-U for 50 ft, CCS7-100-U for 100 ft or order any length you need 23 Magnecor ignition cable, parts and accessories Many other parts are available, these are only some popular items. Please inquire. MISCELLANEOUS ACCESSORIES Wire Separators THESE MAY NOT BE AVAILABLE, PLEASE INQUIRE BEFORE ORDERING Feature locking design and suit 7mm, 8mm and KV85 8.5mm. The separators are available in 2, 3 and 4 hole versions. Separators are made of black nylon. Order WS1-3 for 3 separators (1 of each type), WS1-75 for 75 (25 of each) or WS1-150 for 150 (50 of each) or order any amount you need. Heat Shrinkable Numbering Sleeves Polyolefin heat shrinkable numbering and lettering sleeves. Can be used with 7mm, 8mm, 8.5mm or 10mm cables, but can only be fitted to cable before boots and terminals are fitted. White in color with black printing. Styles: 1 2 3 4 5 6 7 8 A B C D A1 A2 A3 A4 A5 A6 B1 B2 B3 B4 B5 B6 are always available SLV1 orders a heat shrink sleeve SLV2 orders a heat shrink sleeve fitted to a wire by Magnecor Crimping Tool Heavy professional duty terminal crimping tool. Tool steel jaws (not mild steel or aluminum) crimp terminals to ignition cable as professionally as a production crimping machine. 290mm long, 1.5lb weight. CATALOG CONTINUED NEXT PAGE 24 8mm INDIVIDUAL LEADS PART NUMBERING SYSTEM First letter refers to the individual lead style (see illustrations of styles at right). Last two numbers refer to the length, in inches. For 8mm individual leads the numeral "8" goes before the length and after the style, to distinguish them from 8.5mm leads. EXAMPLE: A 811 will order an 'A' style 11 inch 8mm lead NOTE: 'H' style coil wires suit all Chrysler V8 & L6 and 3.9 V6 engines from 1979 to 1990 and 3.0 V6 engines from 1987 to 1989 (except Dodge Raider) - with original equipment ignition coil. 'Y' style coil wires suit Chrysler 1.7, 2.2 & 2.5 liter 4 cylinder engines and 1.6 engine (except Japanese engines) from 1979 to 1990 with original equipment ignition coil. See Price List for popular lengths. Other individual lead styles and lengths (not listed) can be ordered. Individual leads can also be ordered in 7mm cable. Please inquire if unsure of application. See page 26 for KV85 8.5mm leads. See page 27 for R-100 10mm leads. 25 KV85 8.5mm NDIVIDUAL LEADS PART NUMBERING SYSTEM First letter refers to the individual lead style (see illustrations of styles at right). Last two numbers refer to the length, in inches. EXAMPLE: A11 will order an 'A' style 11 inch 8.5mm lead NOTE: 'H' style coil wires suit all Chrysler V8 & L6 and 3.9 V6 engines from 1979 to 1990 and 3.0 V6 engines from 1987 to 1989 (except Dodge Raider) - with original equipment ignition coil. 'Y' style coil wires suit Chrysler 1.7, 2.2 & 2.5 liter 4 cylinder engines and 1.6 engine (except Japanese engines) from 1979 to 1990 with original equipment ignition coil. See Price List for popular lengths. Other individual lead styles and lengths (not listed) can be ordered. See page 25 for 8mm leads. See page 27 for R-100 10mm leads. 26 R-100 10mm INDIVIDUAL LEADS PART NUMBERING SYSTEM First letter and next 2 numbers refer to the individual lead style (see illustrations of styles at right). Last two numbers refer to the length, in inches. EXAMPLE: R1009 will order an 'R10' style 9 inch 10mm lead R2157 will order an 'R21' style 57 inch lead See Price List for popular lengths. Other individual lead styles and lengths (not listed) can be ordered on request. Please inquire if unsure of application. See page 25 for 8mm leads. See page 26 for KV85 8.5mm leads. 27 Ordering Custom Magnecor Cables INDIVIDUAL CABLES See diagrams pages 25, 26, and 27 for selection of spark plug and coil lead style numbers. Choose a style, length and cable type. UNIVERSAL SETS Universal sets include leads with spark plug boots and terminals already attached, as well as loose distributor boots and terminals. R-100 10mm universal sets cannot be supplied with straight distibutor boots and terminals because cable diameter is too large to fit into caps. For more information, or to place an order, contact your local Distributor or Magnecor One coil lead is also supplied with attached distributor boot and metal terminal. For coil end - loose HEI and push-in metal terminals and coil boots are included. Heat shrinkable numbers and wire separators are also included. TAILORED SETS FOR SPECIAL APPLICATIONS Magnecor can make sets to suit a particular engine, even to original equipment sizes if required. However, if R-100 10mm size cable is specified, care should be taken to allow for more space to accomodate its bulky size. Also, please understand we can only rely on the information supplied by you as to the correct cable lengths, as well as the suitability of the boots and terminals you want fitted to any cables ordered. There is no minimum order for either sets or individual leads. See page 19 How to measure to order specific length Magnecor ignition cables When measuring existing ignition wires, measure from spark plug metal terminal end to distributor or coil metal terminal end (see diagram). MEASURE FROM SPARK PLUG TERMINAL END TO DISTRIBUTOR TERMINAL END length has been established is the most accurate way to arrive at the correct wire lengths. It is best to remove ignition wires from at least the spark plugs before measuring if wires are difficult to reach. If no ignition wires are fitted to engine - establish lengths by using tubing, covered wire or old ignition wires to make a temporary connection from the distributor to the spark plugs. A dressmaker's tape or flexible tubing or covered wire (which can be laid against the existing ignition wire) that can be easily measured after the Using this method will also help ascertain the best possible wire positioning along the entire length of the proposed ignition wire routing. 28 When measuring for R-100 10mm Ignition Cables in particular, remember to take into account that the physical bulk of 10mm Ignition Cable might necessitate longer wire lengths in order to go around corners and accessories. Also, fitting R-100 10mm Ignition Cable into original equipment tubes and brackets might not be possible. However, due to its exceptional flexibility, R-100 10mm Ignition Cable will squeeze into many aftermarket 8mm or larger wire separators. Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) Ignition cable sets ____ _________ 1001. . . . . . 117.70 1002. . . . . . 119.90 1003. . . . . . 132.00 1004. . . . . . 125.40 1005. . . . . . 122.10 1006. . . . . . 183.70 1007. . . . . . 145.20 1008. . . . . . 156.20 1009. . . . . . 151.80 1010. . . . . . 168.30 1011. . . . . . 168.30 1012. . . . . . 508.20 1013. . . . . . 510.40 1015. . . . . . 119.90 1020. . . . . . 575.30 1021. . . . . . . 11.00 1028. . . . . . 184.80 1031. . . . . . . 12.08 1033. . . . . . 426.80 1034. . . . . . 163.90 1038. . . . . . 295.90 1039. . . . . . 573.10 1044. . . . . . . . 7.04 1045. . . . . . . . 8.07 1046. . . . . . . . 8.69 1047. . . . . . . . 9.31 1301. . . . . . 170.50 1302. . . . . . 177.10 1303. . . . . . 231.00 1304. . . . . . 205.70 1305. . . . . . 205.70 1306. . . . . . 300.30 1307. . . . . . 231.00 1308. . . . . . 236.50 1309. . . . . . 231.00 1310. . . . . . 246.40 1311. . . . . . 244.20 1312. . . . . . 817.30 1313. . . . . . 822.80 1315. . . . . . 217.80 1321. . . . . . . 18.70 1323. . . . . . . 16.34 1324. . . . . . . 15.40 1328. . . . . . 264.00 1333. . . . . . 488.40 1334. . . . . . 216.70 1336. . . . . . . 32.44 1338. . . . . . 345.40 1339. . . . . . 645.70 1352. . . . . . . 13.75 1501. . . . . . 161.70 1502. . . . . . 168.30 Part Number Price ($US) 1503. . . . . . 220.00 1504. . . . . . 195.80 1505. . . . . . 195.80 1506. . . . . . 286.00 1507. . . . . . 220.00 1508. . . . . . 224.40 1509. . . . . . 220.00 1510. . . . . . 233.20 1511. . . . . . 233.20 1512. . . . . . 777.70 1513. . . . . . 783.20 1515. . . . . . 207.90 1516. . . . . . 468.60 1520. . . . . . 723.80 1521. . . . . . . 17.60 1524. . . . . . . 16.36 1526. . . . . . . 27.50 1528. . . . . . 250.80 1529. . . . . . . 22.17 1533. . . . . . 460.90 1534. . . . . . 205.70 1538. . . . . . 328.90 1539. . . . . . 614.90 1544. . . . . . . . 7.59 1552. . . . . . . 11.98 1605. . . . . . 306.90 1609. . . . . . 328.90 1611. . . . . . 347.60 1628. . . . . . 380.60 1634. . . . . . 286.00 1701. . . . . . 107.80 1702. . . . . . 110.00 1703. . . . . . 123.20 1704. . . . . . 116.60 1705. . . . . . 118.80 1706. . . . . . 173.80 1709. . . . . . 144.10 1710. . . . . . 166.10 1712. . . . . . 496.10 1713. . . . . . 498.30 1715. . . . . . 111.10 1718. . . . . . 830.50 1719. . . . . . 202.40 1720. . . . . . 550.00 1721. . . . . . . . 9.90 1722. . . . . . 206.80 1727. . . . . . . . 7.70 1730. . . . . . . . 5.83 1732. . . . . . . 12.03 1733. . . . . . 418.00 1735. . . . . . 232.10 1737. . . . . . 203.50 1738. . . . . . 278.30 1739. . . . . . 555.50 1741. . . . . . 213.40 1743. . . . . . . 33.00 Part Number Price ($US) 1744. . . . . . . . 6.99 1748. . . . . . . . 7.10 1749. . . . . . . 27.00 1753. . . . . . . . 8.36 1901. . . . . . 214.50 1905. . . . . . 291.50 1907. . . . . . 295.90 1909. . . . . . 312.40 1911. . . . . . 331.10 1928. . . . . . 361.90 1934. . . . . . 271.70 1944. . . . . . . . 8.42 2001. . . . . . . 36.30 2002. . . . . . . 36.30 2003. . . . . . . 36.30 2004. . . . . . . 36.30 2005. . . . . . . 28.60 2006. . . . . . . 18.70 2007. . . . . . . 19.80 2008. . . . . . . 36.30 2009. . . . . . . 24.20 2010. . . . . . . 19.80 2011. . . . . . . 36.30 2012. . . . . . . 26.40 2013. . . . . . . 22.00 2014. . . . . . . 22.00 2015. . . . . . . 45.10 2016. . . . . . . 36.30 2017. . . . . . . 24.20 2018. . . . . . . 26.40 2019. . . . . . . 44.00 2020. . . . . . . 51.70 2021. . . . . . . 25.30 2022. . . . . . . 19.80 2023. . . . . . . 20.90 2024. . . . . . . 19.80 2025. . . . . . . 19.80 2026. . . . . . . 20.90 2027. . . . . . . 20.90 2028. . . . . . . 26.40 2029. . . . . . . 28.60 2030. . . . . . . 47.30 2031. . . . . . . 55.00 2032. . . . . . . 57.20 2033. . . . . . . 34.10 2034. . . . . . . 24.20 2035. . . . . . . 47.30 2036. . . . . . . 18.70 2037. . . . . . . 24.20 2039. . . . . . . 18.70 2040. . . . . . . 40.70 2041. . . . . . . 23.10 2043. . . . . . . 36.30 2044. . . . . . . 74.80 2045. . . . . . . 40.70 2046. . . . . . . 40.70 Part Number Price ($US) 2047. . . . . . . 23.10 2048. . . . . . . 36.30 2049. . . . . . . 63.80 2050. . . . . . . 34.10 2051. . . . . . . 23.10 2052. . . . . . . 60.50 2053. . . . . . . 15.40 2054. . . . . . . 36.30 2057. . . . . . . 40.70 2061. . . . . . . 67.10 2062. . . . . . . 60.50 2064. . . . . . . 69.30 2065. . . . . . 134.20 2066. . . . . . . 36.30 2067. . . . . . . 36.30 2068. . . . . . . 40.70 2069. . . . . . . 38.50 2070. . . . . . . 53.90 2071. . . . . . . 53.90 2072. . . . . . . 61.60 2073. . . . . . . 60.50 2074. . . . . . . 40.70 2075. . . . . . . 46.20 2076. . . . . . . 53.90 2080. . . . . . . 57.20 2081. . . . . . 188.10 2082. . . . . . . 53.90 2084. . . . . . 111.10 2085. . . . . . 192.50 2087. . . . . . 188.10 2089. . . . . . . 41.80 2090. . . . . . . 53.90 2092. . . . . . . 71.50 2094. . . . . . 180.40 2095. . . . . . . 64.90 2096. . . . . . . 69.30 2097. . . . . . . 71.50 2301. . . . . . . 44.00 2302. . . . . . . 44.00 2303. . . . . . . 44.00 2304. . . . . . . 44.00 2305. . . . . . . 49.50 2306. . . . . . . 26.40 2307. . . . . . . 29.70 2308. . . . . . . 44.00 2309. . . . . . . 40.70 2310. . . . . . . 28.60 2311. . . . . . . 44.00 2312. . . . . . . 41.80 2313. . . . . . . 35.20 2314. . . . . . . 36.30 2315. . . . . . . 52.80 2316. . . . . . . 44.00 2317. . . . . . . 37.40 2318. . . . . . . 41.80 2319. . . . . . . 70.40 Part Number Price ($US) 2320. . . . . . . 89.10 2321. . . . . . . 39.60 2322. . . . . . . 29.70 2323. . . . . . . 31.90 2324. . . . . . . 27.50 2325. . . . . . . 28.60 2326. . . . . . . 33.00 2327. . . . . . . 34.10 2328. . . . . . . 41.80 2329. . . . . . . 42.90 2330. . . . . . . 74.80 2331. . . . . . . 92.40 2332. . . . . . . 84.70 2333. . . . . . . 60.50 2334. . . . . . . 44.00 2335. . . . . . . 49.50 2336. . . . . . . 29.70 2337. . . . . . . 39.60 2339. . . . . . . 28.60 2340. . . . . . . 46.20 2341. . . . . . . 37.40 2343. . . . . . . 44.00 2344. . . . . . . 93.50 2345. . . . . . . 46.20 2346. . . . . . . 46.20 2347. . . . . . . 39.60 2348. . . . . . . 39.60 2349. . . . . . . 84.70 2350. . . . . . . 45.10 2351. . . . . . . 38.50 2352. . . . . . . 89.10 2353. . . . . . . 20.90 2354. . . . . . . 56.10 2357. . . . . . . 46.20 2361. . . . . . . 89.10 2364. . . . . . . 79.20 2365. . . . . . 171.60 2366. . . . . . . 38.50 2367. . . . . . . 38.50 2368. . . . . . . 46.20 2370. . . . . . . 61.60 2371. . . . . . . 68.20 2372. . . . . . . 68.20 2373. . . . . . . 78.10 2374. . . . . . . 46.20 2375. . . . . . . 53.90 2376. . . . . . . 68.20 2380. . . . . . . 67.10 2381. . . . . . 227.70 2382. . . . . . . 61.60 2384. . . . . . 127.60 2385. . . . . . 236.50 2387. . . . . . 227.70 2389. . . . . . . 55.00 2390. . . . . . . 68.20 2391. . . . . . . 49.50 29 Part Number Price ($US) 2392. . . . . . . 81.40 2394. . . . . . 261.80 2395. . . . . . . 77.00 2396. . . . . . . 79.20 2397. . . . . . . 81.40 2501. . . . . . . 41.80 2502. . . . . . . 41.80 2503. . . . . . . 41.80 2504. . . . . . . 41.80 2505. . . . . . . 47.30 2506. . . . . . . 25.30 2507. . . . . . . 28.60 2508. . . . . . . 41.80 2509. . . . . . . 39.60 2510. . . . . . . 27.50 2511. . . . . . . 41.80 2512. . . . . . . 39.60 2513. . . . . . . 34.10 2514. . . . . . . 34.10 2515. . . . . . . 50.60 2516. . . . . . . 41.80 2517. . . . . . . 35.20 2518. . . . . . . 39.60 2519. . . . . . . 67.10 2520. . . . . . . 84.70 2521. . . . . . . 38.50 2522. . . . . . . 28.60 2523. . . . . . . 29.70 2524. . . . . . . 26.40 2525. . . . . . . 27.50 2526. . . . . . . 30.80 2527. . . . . . . 33.00 2528. . . . . . . 39.60 2529. . . . . . . 41.80 2530. . . . . . . 70.40 2531. . . . . . . 88.00 2532. . . . . . . 80.30 2533. . . . . . . 58.30 2534. . . . . . . 41.80 2535. . . . . . . 47.30 2536. . . . . . . 27.50 2537. . . . . . . 37.40 2539. . . . . . . 27.50 2540. . . . . . . 44.00 2541. . . . . . . 35.20 2543. . . . . . . 41.80 2544. . . . . . . 89.10 2545. . . . . . . 44.00 2546. . . . . . . 44.00 2547. . . . . . . 37.40 2548. . . . . . . 41.80 2549. . . . . . . 80.30 2550. . . . . . . 42.90 2551. . . . . . . 36.30 2552. . . . . . . 84.70 2553. . . . . . . 20.90 Part Number Price ($US) 2554. . . . . . . 53.90 2556. . . . . . . 50.60 2557. . . . . . . 44.00 2558. . . . . . . 36.30 2561. . . . . . . 85.80 2562. . . . . . . 75.90 2564. . . . . . . 74.80 2565. . . . . . 162.80 2566. . . . . . . 41.80 2567. . . . . . . 41.80 2568. . . . . . . 44.00 2569. . . . . . . 46.20 2570. . . . . . . 57.20 2571. . . . . . . 63.80 2572. . . . . . . 64.90 2573. . . . . . . 73.70 2574. . . . . . . 44.00 2575. . . . . . . 50.60 2576. . . . . . . 63.80 2580. . . . . . . 63.80 2581. . . . . . 216.70 2582. . . . . . . 57.20 2584. . . . . . 121.00 2585. . . . . . 224.40 2587. . . . . . 216.70 2588. . . . . . . 63.80 2589. . . . . . . 51.70 2590. . . . . . . 63.80 2591. . . . . . . 46.20 2592. . . . . . . 77.00 2594. . . . . . 248.60 2595. . . . . . . 72.60 2596. . . . . . . 74.80 2597. . . . . . . 77.00 2601. . . . . . . 56.10 2602. . . . . . . 56.10 2603. . . . . . . 56.10 2611. . . . . . . 56.10 2623. . . . . . . 39.60 2625. . . . . . . 35.20 2627. . . . . . . 38.50 2632. . . . . . . 79.20 2689. . . . . . . 63.80 2691. . . . . . . 60.50 2694. . . . . . 282.70 2701. . . . . . . 35.20 2702. . . . . . . 35.20 2703. . . . . . . 35.20 2704. . . . . . . 35.20 2705. . . . . . . 26.40 2706. . . . . . . 17.60 2707. . . . . . . 18.70 2708. . . . . . . 35.20 2709. . . . . . . 22.00 2710. . . . . . . 18.70 2711. . . . . . . 35.20 Part Number Price ($US) 2712. . . . . . . 25.30 2713. . . . . . . 20.90 2714. . . . . . . 20.90 2715. . . . . . . 44.00 2716. . . . . . . 35.20 2717. . . . . . . 23.10 2718. . . . . . . 25.30 2719. . . . . . . 41.80 2720. . . . . . . 47.30 2721. . . . . . . 23.10 2722. . . . . . . 18.70 2723. . . . . . . 19.80 2724. . . . . . . 18.70 2725. . . . . . . 18.70 2726. . . . . . . 19.80 2727. . . . . . . 19.80 2728. . . . . . . 25.30 2729. . . . . . . 26.40 2730. . . . . . . 45.10 2731. . . . . . . 50.60 2732. . . . . . . 56.10 2733. . . . . . . 30.80 2734. . . . . . . 23.10 2735. . . . . . . 35.20 2736. . . . . . . 17.60 2737. . . . . . . 22.00 2738. . . . . . . 17.60 2739. . . . . . . 18.70 2740. . . . . . . 39.60 2741. . . . . . . 22.00 2742. . . . . . . 17.60 2743. . . . . . . 35.20 2744. . . . . . . 71.50 2745. . . . . . . 39.60 2746. . . . . . . 39.60 2747. . . . . . . 20.90 2748. . . . . . . 35.20 2749. . . . . . . 62.70 2750. . . . . . . 29.70 2751. . . . . . . 22.00 2752. . . . . . . 59.40 2753. . . . . . . 14.30 2754. . . . . . . 34.10 2755. . . . . . . 45.10 2757. . . . . . . 39.60 2759. . . . . . . 47.30 2760. . . . . . . 45.10 2761. . . . . . . 64.90 2762. . . . . . . 58.30 2763. . . . . . . 37.40 2764. . . . . . . 67.10 2765. . . . . . 130.90 2766. . . . . . . 35.20 2767. . . . . . . 35.20 2768. . . . . . . 35.75 2769. . . . . . . 37.40 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 2770. . . . . . . 51.70 2771. . . . . . . 51.70 2772. . . . . . . 59.40 2773. . . . . . . 58.30 2774. . . . . . . 39.60 2775. . . . . . . 45.10 2776. . . . . . . 51.70 2780. . . . . . . 56.10 2781. . . . . . 185.90 2782. . . . . . . 51.70 2783. . . . . . . 72.60 2784. . . . . . 107.80 2785. . . . . . 189.20 2787. . . . . . 185.90 2789. . . . . . . 40.70 2790. . . . . . . 51.70 2792. . . . . . . 69.30 2794. . . . . . 177.10 2795. . . . . . . 62.70 2796. . . . . . . 67.10 2797. . . . . . . 69.30 2901. . . . . . . 52.80 2902. . . . . . . 52.80 2903. . . . . . . 52.80 2908. . . . . . . 52.80 2911. . . . . . . 52.80 2923. . . . . . . 37.40 2925. . . . . . . 34.10 2927. . . . . . . 36.30 2932. . . . . . . 75.90 2943. . . . . . . 52.80 2945. . . . . . . 64.90 2946. . . . . . . 67.10 2949. . . . . . 115.50 2989. . . . . . . 60.50 2991. . . . . . . 57.20 2994. . . . . . 268.40 3001. . . . . . . 44.00 3002. . . . . . . 41.80 3003. . . . . . . 41.80 3004. . . . . . . 45.10 3005. . . . . . . 61.60 3006. . . . . . . 22.00 3007. . . . . . . 85.80 3008. . . . . . . 70.40 3009. . . . . . . 26.40 3010. . . . . . . 44.00 3011. . . . . . . 72.60 3012. . . . . . . 33.00 3013. . . . . . . 92.40 3014. . . . . . . 45.10 3015. . . . . . . 42.90 3016. . . . . . 166.10 3017. . . . . . . 37.40 3018. . . . . . . 25.30 3020. . . . . . 146.30 Part Number Price ($US) 3301. . . . . . . 77.00 3302. . . . . . . 66.00 3303. . . . . . . 73.70 3304. . . . . . . 75.90 3305. . . . . . . 71.50 3306. . . . . . . 34.10 3307. . . . . . 108.90 3308. . . . . . . 85.80 3309. . . . . . . 36.30 3310. . . . . . . 66.00 3311. . . . . . 115.50 3312. . . . . . . 51.70 3313. . . . . . 146.30 3314. . . . . . . 78.10 3315. . . . . . . 73.70 3316. . . . . . 193.60 3317. . . . . . . 62.70 3318. . . . . . . 34.10 3501. . . . . . . 72.60 3502. . . . . . . 62.70 3503. . . . . . . 70.40 3504. . . . . . . 71.50 3505. . . . . . . 67.10 3506. . . . . . . 31.90 3507. . . . . . 103.40 3508. . . . . . . 82.50 3509. . . . . . . 35.20 3510. . . . . . . 62.70 3511. . . . . . 110.00 3512. . . . . . . 49.50 3513. . . . . . 139.70 3514. . . . . . . 74.80 3515. . . . . . . 70.40 3516. . . . . . 185.90 3517. . . . . . . 59.40 3518. . . . . . . 33.00 3520. . . . . . 166.10 3701. . . . . . . 40.70 3702. . . . . . . 39.60 3703. . . . . . . 39.60 3704. . . . . . . 41.80 3705. . . . . . . 60.50 3706. . . . . . . 22.00 3707. . . . . . . 83.60 3708. . . . . . . 68.20 3709. . . . . . . 25.30 3710. . . . . . . 41.80 3711. . . . . . . 70.40 3712. . . . . . . 29.70 3713. . . . . . . 90.20 3714. . . . . . . 41.80 3714. . . . . . . 41.80 3716. . . . . . 163.90 3717. . . . . . . 35.20 3718. . . . . . . 24.20 3719. . . . . . 103.40 Part Number Price ($US) 3720. . . . . . 141.90 3911. . . . . . 133.10 3917. . . . . . . 68.20 3920. . . . . . 202.40 4000. . . . . . . 50.60 4001. . . . . . . 80.30 4002. . . . . . . 60.50 4003. . . . . . . 53.90 4004. . . . . . . 91.30 4005. . . . . . . 95.70 4006. . . . . . . 78.10 4007. . . . . . 101.20 4008. . . . . . . 60.50 4009. . . . . . . 52.80 4010. . . . . . . 69.30 4011. . . . . . . 67.10 4012. . . . . . . 58.30 4013. . . . . . . 66.00 4014. . . . . . . 59.40 4015. . . . . . . 36.30 4016. . . . . . . 80.30 4017. . . . . . . 88.00 4018. . . . . . 100.10 4019. . . . . . . 97.90 4020. . . . . . 107.80 4021. . . . . . . 67.10 4022. . . . . . . 48.40 4023. . . . . . . 99.00 4024. . . . . . . 42.90 4025. . . . . . . 60.50 4026. . . . . . . 85.80 4027. . . . . . . 91.30 4028. . . . . . . 52.80 4029. . . . . . 113.30 4030. . . . . . . 53.90 4031. . . . . . . 45.10 4032. . . . . . . 49.50 4033. . . . . . . 53.90 4034. . . . . . . 52.80 4035. . . . . . . 53.90 4036. . . . . . . 50.60 4037. . . . . . . 51.70 4038. . . . . . . 49.50 4039. . . . . . . 69.30 4040. . . . . . . 51.70 4041. . . . . . . 60.50 4042. . . . . . . 53.90 4043. . . . . . . 51.70 4044. . . . . . . 66.00 4045. . . . . . . 51.70 4046. . . . . . . 52.80 4047. . . . . . . 52.80 4048. . . . . . . 58.30 4049. . . . . . . 57.20 4050. . . . . . . 51.70 4051. . . . . . . 75.90 Part Number Price ($US) 4052. . . . . . . 46.20 4053. . . . . . . 55.00 4054. . . . . . . 56.10 4055. . . . . . . 61.60 4056. . . . . . . 45.10 4057. . . . . . . 53.90 4058. . . . . . . 68.20 4059. . . . . . . 46.20 4060. . . . . . . 57.20 4061. . . . . . . 99.00 4062. . . . . . . 71.50 4063. . . . . . . 78.10 4064. . . . . . . 47.30 4065. . . . . . . 77.00 4066. . . . . . . 56.10 4067. . . . . . . 56.10 4068. . . . . . . 96.80 4069. . . . . . . 78.10 4070. . . . . . . 75.90 4071. . . . . . . 45.10 4072. . . . . . . 51.70 4073. . . . . . . 91.30 4074. . . . . . . 74.80 4075. . . . . . . 52.80 4076. . . . . . . 55.00 4077. . . . . . . 66.00 4078. . . . . . . 66.00 4079. . . . . . . 71.50 4080. . . . . . . 67.10 4081. . . . . . . 49.50 4082. . . . . . . 61.60 4084. . . . . . . 99.00 4085. . . . . . . 51.70 4086. . . . . . . 56.10 4087. . . . . . . 86.90 4088. . . . . . . 34.10 4089. . . . . . . 61.60 4090. . . . . . . 50.60 4091. . . . . . . 57.20 4092. . . . . . . 89.10 4093. . . . . . . 49.50 4095. . . . . . . 52.80 4096. . . . . . 128.70 4097. . . . . . . 55.00 4098. . . . . . . 72.60 4099. . . . . . . 56.10 4300. . . . . . . 80.30 4301. . . . . . 123.20 4302. . . . . . 108.90 4303. . . . . . . 88.00 4304. . . . . . 114.40 4305. . . . . . 126.50 4306. . . . . . 122.10 4307. . . . . . 113.30 4308. . . . . . . 97.90 4309. . . . . . . 96.80 Part Number Price ($US) 4310. . . . . . 103.40 4311. . . . . . 101.20 4312. . . . . . 103.40 4313. . . . . . 121.00 4314. . . . . . 107.80 4315. . . . . . . 55.00 4316. . . . . . 123.20 4317. . . . . . 101.20 4318. . . . . . 116.60 4319. . . . . . 113.30 4320. . . . . . 125.40 4321. . . . . . 102.30 4322. . . . . . . 78.10 4323. . . . . . 126.50 4324. . . . . . . 74.80 4325. . . . . . 105.60 4326. . . . . . 125.40 4327. . . . . . 122.10 4328. . . . . . . 89.10 4329. . . . . . 125.40 4330. . . . . . 103.40 4331. . . . . . . 73.70 4332. . . . . . . 82.50 4333. . . . . . . 91.30 4334. . . . . . . 96.80 4335. . . . . . 100.10 4336. . . . . . 101.20 4337. . . . . . . 80.30 4338. . . . . . . 72.60 4339. . . . . . . 94.60 4340. . . . . . . 93.50 4341. . . . . . 111.10 4342. . . . . . . 89.10 4343. . . . . . 126.50 4344. . . . . . 107.80 4345. . . . . . . 85.80 4346. . . . . . . 93.50 4347. . . . . . . 90.20 4348. . . . . . 106.70 4349. . . . . . . 94.60 4350. . . . . . . 97.90 4351. . . . . . 104.50 4352. . . . . . . 74.80 4353. . . . . . . 91.30 4354. . . . . . . 94.60 4355. . . . . . . 95.70 4356. . . . . . . 71.50 4357. . . . . . . 95.70 4358. . . . . . 106.70 4359. . . . . . . 78.10 4360. . . . . . . 95.70 4361. . . . . . 113.30 4362. . . . . . 122.10 4363. . . . . . 102.30 4364. . . . . . . 75.90 4365. . . . . . . 89.10 30 Part Number Price ($US) 4366. . . . . . 100.10 4367. . . . . . 102.30 4368. . . . . . 111.10 4369. . . . . . . 99.00 4370. . . . . . . 88.00 4371. . . . . . . 73.70 4372. . . . . . . 84.70 4373. . . . . . 114.40 4374. . . . . . 106.70 4375. . . . . . . 85.80 4376. . . . . . 104.50 4377. . . . . . 102.30 4378. . . . . . 102.30 4379. . . . . . 119.90 4380. . . . . . 128.70 4381. . . . . . . 84.70 4382. . . . . . 102.30 4384. . . . . . 111.10 4385. . . . . . . 90.20 4386. . . . . . . 94.60 4389. . . . . . . 60.50 4392. . . . . . 111.10 4393. . . . . . . 72.60 4395. . . . . . . 83.60 4396. . . . . . 149.60 4397. . . . . . 106.70 4398. . . . . . 132.00 4399. . . . . . . 91.30 4500. . . . . . . 77.00 4501. . . . . . 116.60 4502. . . . . . 103.40 4503. . . . . . . 83.60 4504. . . . . . 108.90 4505. . . . . . 119.90 4506. . . . . . 115.50 4507. . . . . . 107.80 4508. . . . . . . 93.50 4509. . . . . . . 92.40 4510. . . . . . . 97.90 4511. . . . . . . 95.70 4512. . . . . . . 97.90 4513. . . . . . 115.50 4514. . . . . . 103.40 4515. . . . . . . 52.80 4516. . . . . . 116.60 4517. . . . . . . 96.80 4518. . . . . . 111.10 4519. . . . . . 107.80 4520. . . . . . 118.80 4521. . . . . . . 97.90 4522. . . . . . . 73.70 4523. . . . . . 115.50 4524. . . . . . . 71.50 4525. . . . . . 100.10 4526. . . . . . 118.80 4527. . . . . . 115.50 Part Number Price ($US) 4528. . . . . . . 84.70 4529. . . . . . 118.80 4530. . . . . . . 97.90 4531. . . . . . . 70.40 4532. . . . . . . 79.20 4533. . . . . . . 86.90 4534. . . . . . . 92.40 4535. . . . . . . 95.70 4536. . . . . . . 95.70 4537. . . . . . . 77.00 4538. . . . . . . 68.20 4539. . . . . . . 86.90 4540. . . . . . . 89.10 4541. . . . . . 105.60 4542. . . . . . . 85.80 4543. . . . . . 119.90 4544. . . . . . 102.30 4545. . . . . . . 82.50 4546. . . . . . . 89.10 4547. . . . . . . 85.80 4548. . . . . . 101.20 4549. . . . . . . 90.20 4550. . . . . . . 93.50 4551. . . . . . . 99.00 4552. . . . . . . 70.40 4553. . . . . . . 86.90 4554. . . . . . . 90.20 4555. . . . . . . 91.30 4556. . . . . . . 68.20 4557. . . . . . . 91.30 4558. . . . . . 101.20 4559. . . . . . . 74.80 4560. . . . . . . 91.30 4561. . . . . . 107.80 4562. . . . . . 115.50 4563. . . . . . . 95.70 4564. . . . . . . 72.60 4565. . . . . . . 84.70 4566. . . . . . . 95.70 4567. . . . . . . 97.90 4568. . . . . . 105.60 4569. . . . . . . 93.50 4570. . . . . . . 83.60 4571. . . . . . . 69.30 4572. . . . . . . 80.30 4573. . . . . . 108.90 4574. . . . . . 101.20 4575. . . . . . . 81.40 4576. . . . . . 100.10 4577. . . . . . . 96.80 4578. . . . . . . 96.80 4579. . . . . . 114.40 4580. . . . . . 122.10 4581. . . . . . . 80.30 4582. . . . . . . 97.90 4584. . . . . . 105.60 Part Number Price ($US) 4585. . . . . . . 85.80 4586. . . . . . . 90.20 4589. . . . . . . 97.90 4592. . . . . . 105.60 4593. . . . . . . 69.30 4595. . . . . . . 79.20 4596. . . . . . 137.50 4597. . . . . . 101.20 4598. . . . . . 125.40 4599. . . . . . . 86.90 4601. . . . . . 110.00 4602. . . . . . 123.20 4605. . . . . . 136.40 4607. . . . . . 136.40 4619. . . . . . 159.50 4620. . . . . . 136.40 4629. . . . . . 179.30 4639. . . . . . 132.00 4641. . . . . . 122.10 4651. . . . . . 149.60 4656. . . . . . 106.70 4662. . . . . . 147.40 4676. . . . . . 123.20 4696. . . . . . 198.00 4700. . . . . . . 48.40 4701. . . . . . . 79.20 4702. . . . . . . 57.20 4703. . . . . . . 50.60 4704. . . . . . . 89.10 4705. . . . . . . 94.60 4706. . . . . . . 75.90 4707. . . . . . . 99.00 4708. . . . . . . 57.20 4709. . . . . . . 48.40 4710. . . . . . . 68.20 4711. . . . . . . 66.00 4712. . . . . . . 55.00 4716. . . . . . . 79.20 4717. . . . . . . 85.80 4719. . . . . . . 95.70 4720. . . . . . 105.60 4721. . . . . . . 63.80 4722. . . . . . . 46.20 4723. . . . . . . 97.90 4724. . . . . . . 40.70 4725. . . . . . . 56.10 4726. . . . . . . 84.70 4727. . . . . . . 89.10 4728. . . . . . . 50.60 4729. . . . . . 111.10 4730. . . . . . . 50.60 4731. . . . . . . 41.80 4732. . . . . . . 46.20 4733. . . . . . . 50.60 4734. . . . . . . 48.40 4735. . . . . . . 51.70 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 4736. . . . . . . 48.40 4737. . . . . . . 49.50 4738. . . . . . . 47.30 4739. . . . . . . 67.10 4740. . . . . . . 47.30 4743. . . . . . . 48.40 4744. . . . . . . 63.80 4747. . . . . . . 50.60 4748. . . . . . . 53.90 4749. . . . . . . 53.90 4750. . . . . . . 47.30 4751. . . . . . . 73.70 4752. . . . . . . 41.80 4753. . . . . . . 51.70 4754. . . . . . . 52.80 4755. . . . . . . 58.30 4756. . . . . . . 41.80 4758. . . . . . . 64.90 4759. . . . . . . 44.00 4760. . . . . . . 52.80 4761. . . . . . . 97.90 4762. . . . . . . 68.20 4763. . . . . . . 77.00 4764. . . . . . . 45.10 4765. . . . . . . 74.80 4766. . . . . . . 51.70 4767. . . . . . . 52.80 4768. . . . . . . 93.50 4769. . . . . . . 75.90 4770. . . . . . . 74.80 4771. . . . . . . 42.90 4772. . . . . . . 50.60 4773. . . . . . . 89.10 4774. . . . . . . 73.70 4775. . . . . . . 50.60 4776. . . . . . . 51.70 4777. . . . . . . 64.90 4778. . . . . . . 64.90 4779. . . . . . . 67.10 4780. . . . . . . 64.90 4781. . . . . . . 47.30 4782. . . . . . . 58.30 4783. . . . . . . 41.80 4784. . . . . . . 96.80 4785. . . . . . . 48.40 4786. . . . . . . 51.70 4787. . . . . . . 83.60 4788. . . . . . . 31.90 4789. . . . . . . 60.50 4790. . . . . . . 47.30 4791. . . . . . . 53.90 4792. . . . . . . 86.90 4793. . . . . . . 47.30 4794. . . . . . . 47.30 4795. . . . . . . 50.60 4796. . . . . . 126.50 Part Number Price ($US) 4797. . . . . . . 51.70 4798. . . . . . . 69.30 4799. . . . . . . 52.80 4900. . . . . . 100.10 4901. . . . . . 155.10 4902. . . . . . 117.70 4903. . . . . . 123.20 4905. . . . . . 129.80 4906. . . . . . 134.20 4907. . . . . . 129.80 4908. . . . . . 140.80 4909. . . . . . 135.30 4911. . . . . . 103.40 4916. . . . . . 117.70 4919. . . . . . 151.80 4920. . . . . . 129.80 4922. . . . . . 111.10 4927. . . . . . 155.10 4928. . . . . . 104.50 4929. . . . . . 171.60 4935. . . . . . 115.50 4936. . . . . . 112.20 4939. . . . . . 122.10 4941. . . . . . 116.60 4951. . . . . . 143.00 4954. . . . . . 121.00 4956. . . . . . 102.30 4957. . . . . . 130.90 4960. . . . . . 119.90 4962. . . . . . 140.80 4976. . . . . . 117.70 4977. . . . . . 115.50 4982. . . . . . 145.20 4995. . . . . . 110.00 4996. . . . . . 189.20 5001. . . . . . 151.80 5002. . . . . . . 80.30 5003. . . . . . 108.90 5004. . . . . . . 99.00 5005. . . . . . 180.40 5006. . . . . . 116.60 5007. . . . . . 123.20 5008. . . . . . 261.80 5009. . . . . . 261.80 5010. . . . . . 191.40 5011. . . . . . . 82.50 5012. . . . . . 183.70 5013. . . . . . 194.70 5014. . . . . . 209.00 5015. . . . . . 223.30 5301. . . . . . 178.20 5302. . . . . . 127.60 5303. . . . . . 157.30 5304. . . . . . 143.00 5305. . . . . . 255.20 5306. . . . . . 150.70 Part Number Price ($US) 5307. . . . . . 160.60 5308. . . . . . 342.10 5309. . . . . . 341.00 5310. . . . . . 275.00 5311. . . . . . 132.00 5312. . . . . . 260.70 5313. . . . . . 281.60 5501. . . . . . 169.40 5502. . . . . . 121.00 5503. . . . . . 149.60 5504. . . . . . 136.40 5505. . . . . . 243.10 5506. . . . . . 144.10 5507. . . . . . 152.90 5508. . . . . . 325.60 5509. . . . . . 324.50 5510. . . . . . 261.80 5511. . . . . . 126.50 5512. . . . . . 247.50 5513. . . . . . 268.40 5514. . . . . . 236.50 5515. . . . . . 245.14 5701. . . . . . 149.60 5702. . . . . . . 75.90 5703. . . . . . 105.60 5704. . . . . . . 94.60 5705. . . . . . 295.90 5706. . . . . . 114.40 5707. . . . . . 121.00 5708. . . . . . 258.50 5709. . . . . . 258.50 5710. . . . . . 305.80 5711. . . . . . . 80.30 5712. . . . . . 179.30 5713. . . . . . 191.40 5714. . . . . . 204.60 5715. . . . . . 218.90 5901. . . . . . 199.10 5905. . . . . . 313.50 5909. . . . . . 350.90 5912. . . . . . 293.70 5913. . . . . . 312.40 6000. . . . . . . 71.50 6001. . . . . . . 59.40 6002. . . . . . . 66.00 6003. . . . . . . 79.20 6004. . . . . . . 73.70 6005. . . . . . . 73.70 6006. . . . . . . 81.40 6007. . . . . . . 55.00 6008. . . . . . . 62.70 6009. . . . . . . 71.50 6010. . . . . . . 59.40 6011. . . . . . . 68.20 6012. . . . . . . 77.00 6013. . . . . . . 77.00 Part Number Price ($US) 6014. . . . . . . 96.80 6015. . . . . . . 79.20 6016. . . . . . . 63.80 6017. . . . . . . 72.60 6018. . . . . . . 67.10 6019. . . . . . . 67.10 6020. . . . . . . 57.20 6021. . . . . . . 79.20 6022. . . . . . . 61.60 6023. . . . . . . 72.60 6024. . . . . . 115.50 6025. . . . . . . 74.80 6026. . . . . . . 85.80 6027. . . . . . . 79.20 6028. . . . . . . 84.70 6029. . . . . . . 75.90 6030. . . . . . . 71.50 6031. . . . . . . 73.70 6032. . . . . . . 90.20 6033. . . . . . . 77.00 6034. . . . . . . 73.70 6035. . . . . . . 70.40 6036. . . . . . . 81.40 6037. . . . . . . 77.00 6038. . . . . . . 86.90 6039. . . . . . . 83.60 6040. . . . . . . 78.10 6041. . . . . . . 71.50 6042. . . . . . 144.10 6043. . . . . . . 77.00 6044. . . . . . . 57.20 6045. . . . . . . 78.10 6046. . . . . . . 66.00 6047. . . . . . . 92.40 6048. . . . . . . 86.90 6049. . . . . . . 86.90 6050. . . . . . . 66.00 6052. . . . . . . 72.60 6053. . . . . . . 63.80 6054. . . . . . 104.50 6055. . . . . . . 75.90 6056. . . . . . . 68.20 6057. . . . . . . 90.20 6058. . . . . . . 71.50 6059. . . . . . . 80.30 6060. . . . . . 105.60 6061. . . . . . . 97.90 6062. . . . . . . 75.90 6063. . . . . . 117.70 6064. . . . . . . 97.90 6065. . . . . . 119.90 6066. . . . . . . 83.60 6067. . . . . . 119.90 6069. . . . . . . 57.20 6070. . . . . . . 81.40 6071. . . . . . . 81.40 Part Number Price ($US) 6072. . . . . . . 69.30 6073. . . . . . . 86.90 6074. . . . . . 107.80 6075. . . . . . 116.60 6076. . . . . . . 82.50 6077. . . . . . . 61.60 6078. . . . . . . 88.00 6079. . . . . . . 82.50 6080. . . . . . . 78.10 6081. . . . . . . 78.10 6082. . . . . . . 69.30 6083. . . . . . . 68.20 6084. . . . . . . 80.30 6085. . . . . . 113.30 6086. . . . . . . 79.20 6087. . . . . . 129.80 6088. . . . . . 128.70 6089. . . . . . 141.90 6090. . . . . . . 79.20 6091. . . . . . 103.40 6092. . . . . . 165.00 6093. . . . . . 132.00 6094. . . . . . 189.20 6095. . . . . . . 96.80 6096. . . . . . 104.50 6097. . . . . . 104.50 6098. . . . . . . 99.00 6099. . . . . . . 95.70 6300. . . . . . 136.40 6301. . . . . . 106.70 6302. . . . . . 113.30 6303. . . . . . 133.10 6304. . . . . . 140.80 6305. . . . . . 123.20 6306. . . . . . 124.30 6307. . . . . . . 91.30 6308. . . . . . 105.60 6309. . . . . . 132.00 6310. . . . . . . 99.00 6311. . . . . . 114.40 6312. . . . . . 140.80 6313. . . . . . 137.50 6314. . . . . . 133.10 6315. . . . . . 101.20 6316. . . . . . . 95.70 6317. . . . . . 124.30 6318. . . . . . 111.10 6319. . . . . . 121.00 6320. . . . . . . 91.30 6321. . . . . . 151.80 6322. . . . . . 100.10 6323. . . . . . 130.90 6324. . . . . . 135.30 6325. . . . . . 137.50 6326. . . . . . 158.40 6327. . . . . . 139.70 31 Part Number Price ($US) 6328. . . . . . 156.20 6329. . . . . . 138.60 6330. . . . . . 118.80 6331. . . . . . 128.70 6332. . . . . . 128.70 6333. . . . . . 144.10 6334. . . . . . 140.80 6335. . . . . . 122.10 6336. . . . . . 146.30 6337. . . . . . 136.40 6338. . . . . . 145.20 6339. . . . . . 156.20 6340. . . . . . 141.90 6341. . . . . . 136.40 6342. . . . . . 177.10 6343. . . . . . 136.40 6344. . . . . . . 88.00 6345. . . . . . 143.00 6346. . . . . . 123.20 6347. . . . . . 154.00 6348. . . . . . 143.00 6349. . . . . . 150.70 6350. . . . . . 121.00 6352. . . . . . 130.90 6353. . . . . . . 95.70 6354. . . . . . 138.60 6355. . . . . . 136.40 6356. . . . . . 126.50 6357. . . . . . 126.50 6359. . . . . . 138.60 6360. . . . . . 157.30 6361. . . . . . 139.70 6362. . . . . . 132.00 6363. . . . . . 205.70 6364. . . . . . 158.40 6365. . . . . . 158.40 6366. . . . . . 148.50 6367. . . . . . 160.60 6369. . . . . . . 89.10 6370. . . . . . 147.40 6371. . . . . . 154.00 6372. . . . . . 119.90 6373. . . . . . 156.20 6374. . . . . . 179.30 6375. . . . . . 141.90 6376. . . . . . 145.20 6377. . . . . . 106.70 6378. . . . . . 139.70 6379. . . . . . 147.40 6380. . . . . . 136.40 6381. . . . . . 124.30 6382. . . . . . 118.80 6383. . . . . . 118.80 6384. . . . . . 143.00 6385. . . . . . 133.10 6386. . . . . . 129.80 Part Number Price ($US) 6387. . . . . . 237.60 6388. . . . . . 229.90 6389. . . . . . 211.20 6390. . . . . . 148.50 6391. . . . . . 140.80 6392. . . . . . 212.30 6393. . . . . . 242.00 6394. . . . . . 257.40 6395. . . . . . 112.20 6396. . . . . . 183.70 6397. . . . . . 183.70 6398. . . . . . 178.20 6399. . . . . . 176.00 6500. . . . . . 129.80 6501. . . . . . 101.20 6502. . . . . . 107.80 6503. . . . . . 127.60 6504. . . . . . 133.10 6505. . . . . . 116.60 6506. . . . . . 118.80 6507. . . . . . . 88.00 6508. . . . . . 100.10 6509. . . . . . 125.40 6510. . . . . . . 94.60 6511. . . . . . 110.00 6512. . . . . . 134.20 6513. . . . . . 130.90 6514. . . . . . 126.50 6515. . . . . . . 95.70 6516. . . . . . . 91.30 6517. . . . . . 118.80 6518. . . . . . 104.50 6519. . . . . . 114.40 6520. . . . . . . 86.90 6521. . . . . . 144.10 6522. . . . . . . 95.70 6523. . . . . . 124.30 6524. . . . . . 128.70 6525. . . . . . 130.90 6526. . . . . . 150.70 6527. . . . . . 133.10 6528. . . . . . 149.60 6529. . . . . . 132.00 6530. . . . . . 113.30 6531. . . . . . 123.20 6532. . . . . . 123.20 6533. . . . . . 136.40 6534. . . . . . 134.20 6535. . . . . . 116.60 6536. . . . . . 139.70 6537. . . . . . 129.80 6538. . . . . . 138.60 6539. . . . . . 149.60 6540. . . . . . 135.30 6541. . . . . . 129.80 6542. . . . . . 169.40 Part Number Price ($US) 6543. . . . . . 129.80 6544. . . . . . . 83.60 6545. . . . . . 136.40 6546. . . . . . 116.60 6547. . . . . . 147.40 6548. . . . . . 136.40 6549. . . . . . 144.10 6550. . . . . . 115.50 6552. . . . . . 124.30 6553. . . . . . . 91.30 6554. . . . . . 132.00 6555. . . . . . 129.80 6556. . . . . . 119.90 6557. . . . . . 119.90 6559. . . . . . 132.00 6560. . . . . . 150.70 6561. . . . . . 133.10 6562. . . . . . 125.40 6563. . . . . . 195.80 6564. . . . . . 150.70 6565. . . . . . 150.70 6566. . . . . . 140.80 6567. . . . . . 152.90 6569. . . . . . . 85.80 6570. . . . . . 140.80 6571. . . . . . 146.30 6572. . . . . . 114.40 6573. . . . . . 148.50 6574. . . . . . 171.60 6575. . . . . . 134.20 6576. . . . . . 138.60 6577. . . . . . 101.20 6578. . . . . . 133.10 6579. . . . . . 140.80 6580. . . . . . 129.80 6581. . . . . . 118.80 6582. . . . . . 113.30 6583. . . . . . 113.30 6584. . . . . . 136.40 6585. . . . . . 125.40 6586. . . . . . 124.30 6587. . . . . . 225.50 6588. . . . . . 218.90 6589. . . . . . 201.30 6590. . . . . . 141.90 6591. . . . . . 134.20 6592. . . . . . 202.40 6593. . . . . . 229.90 6594. . . . . . 245.30 6595. . . . . . 106.70 6596. . . . . . 174.90 6597. . . . . . 174.90 6598. . . . . . 170.50 6599. . . . . . 167.20 6624. . . . . . 183.70 6631. . . . . . 147.40 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 6643. . . . . . 168.30 6654. . . . . . 163.90 6660. . . . . . 193.60 6674. . . . . . 227.70 6675. . . . . . 198.00 6687. . . . . . 290.40 6691. . . . . . 201.30 6693. . . . . . 358.60 6694. . . . . . 311.30 6695. . . . . . 147.40 6696. . . . . . 234.30 6697. . . . . . 225.50 6699. . . . . . 223.30 6700. . . . . . . 66.00 6701. . . . . . . 56.10 6702. . . . . . . 61.60 6703. . . . . . . 74.80 6704. . . . . . . 71.50 6705. . . . . . . 66.00 6706. . . . . . . 78.10 6707. . . . . . . 51.70 6708. . . . . . . 61.60 6710. . . . . . . 55.00 6711. . . . . . . 63.80 6712. . . . . . . 71.50 6713. . . . . . . 71.50 6714. . . . . . . 95.70 6718. . . . . . . 63.80 6719. . . . . . . 61.60 6722. . . . . . . 61.60 6724. . . . . . 113.30 6732. . . . . . . 89.10 6735. . . . . . . 66.00 6736. . . . . . . 73.70 6738. . . . . . . 81.40 6739. . . . . . . 77.00 6740. . . . . . . 72.60 6742. . . . . . 138.60 6743. . . . . . . 70.40 6744. . . . . . . 56.10 6745. . . . . . . 72.60 6747. . . . . . . 86.90 6748. . . . . . . 82.50 6749. . . . . . . 81.40 6750. . . . . . . 60.50 6751. . . . . . . 79.20 6753. . . . . . . 63.80 6755. . . . . . . 69.30 6756. . . . . . . 62.70 6757. . . . . . . 89.10 6758. . . . . . . 70.40 6759. . . . . . . 70.40 6760. . . . . . 101.20 6761. . . . . . . 94.60 6762. . . . . . . 71.50 6763. . . . . . 108.90 Part Number Price ($US) 6764. . . . . . . 92.40 6765. . . . . . 118.80 6766. . . . . . . 78.10 6767. . . . . . 113.30 6768. . . . . . . 75.90 6769. . . . . . . 55.00 6770. . . . . . . 75.90 6775. . . . . . 107.80 6776. . . . . . . 77.00 6777. . . . . . . 58.30 6778. . . . . . . 82.50 6779. . . . . . . 77.00 6780. . . . . . . 72.60 6781. . . . . . . 73.70 6782. . . . . . . 64.90 6783. . . . . . . 63.80 6784. . . . . . . 75.90 6785. . . . . . 111.10 6786. . . . . . . 74.80 6787. . . . . . 119.90 6788. . . . . . 116.60 6789. . . . . . 136.40 6790. . . . . . . 71.50 6792. . . . . . 158.40 6793. . . . . . 129.80 6794. . . . . . 184.80 6795. . . . . . . 95.70 6796. . . . . . . 95.70 6798. . . . . . . 91.30 6799. . . . . . . 86.90 6900. . . . . . 187.00 6906. . . . . . 166.10 6914. . . . . . 173.80 6924. . . . . . 176.00 6928. . . . . . 190.30 6931. . . . . . 140.80 6932. . . . . . 173.80 6938. . . . . . 158.40 6939. . . . . . 195.80 6940. . . . . . 169.40 6943. . . . . . 160.60 6954. . . . . . 155.10 6960. . . . . . 183.70 6964. . . . . . 193.60 6965. . . . . . 189.20 6974. . . . . . 217.80 6975. . . . . . 189.20 6987. . . . . . 276.10 6991. . . . . . 191.40 6993. . . . . . 341.00 6994. . . . . . 297.00 6995. . . . . . 139.70 6996. . . . . . 223.30 6997. . . . . . 214.50 6999. . . . . . 213.40 8000. . . . . . . 99.00 Part Number Price ($US) 8001. . . . . . 102.30 8002. . . . . . . 95.70 8003. . . . . . 104.50 8004. . . . . . 101.20 8005. . . . . . . 97.90 8006. . . . . . . 96.80 8007. . . . . . . 97.90 8008. . . . . . 104.50 8009. . . . . . 105.60 8010. . . . . . . 99.00 8011. . . . . . . 91.30 8012. . . . . . . 86.90 8013. . . . . . 102.30 8014. . . . . . 110.00 8015. . . . . . . 88.00 8016. . . . . . 105.60 8017. . . . . . . 96.80 8018. . . . . . 102.30 8019. . . . . . 102.30 8020. . . . . . . 90.20 8021. . . . . . . 90.20 8022. . . . . . . 85.80 8023. . . . . . . 99.00 8024. . . . . . 100.10 8025. . . . . . 101.20 8026. . . . . . 103.40 8027. . . . . . . 99.00 8028. . . . . . . 93.50 8029. . . . . . . 90.20 8030. . . . . . 102.30 8031. . . . . . . 95.70 8032. . . . . . . 97.90 8033. . . . . . . 96.80 8034. . . . . . . 89.10 8035. . . . . . 107.80 8036. . . . . . 101.20 8037. . . . . . 103.40 8038. . . . . . 102.30 8039. . . . . . . 91.30 8040. . . . . . 103.40 8041. . . . . . . 97.90 8042. . . . . . . 92.40 8043. . . . . . 108.90 8044. . . . . . . 96.80 8045. . . . . . 102.30 8046. . . . . . 102.30 8047. . . . . . 104.50 8048. . . . . . 105.60 8049. . . . . . 102.30 8050. . . . . . 129.80 8051. . . . . . 121.00 8052. . . . . . 104.50 8053. . . . . . . 88.00 8054. . . . . . 103.40 8055. . . . . . 104.50 8056. . . . . . 102.30 Part Number Price ($US) 8057. . . . . . . 95.70 8058. . . . . . 100.10 8059. . . . . . . 94.60 8060. . . . . . 103.40 8061. . . . . . . 92.40 8062. . . . . . 103.40 8063. . . . . . 107.80 8064. . . . . . 106.70 8065. . . . . . 108.90 8066. . . . . . 103.40 8067. . . . . . . 93.50 8068. . . . . . 125.40 8069. . . . . . 121.00 8070. . . . . . 105.60 8071. . . . . . . 95.70 8072. . . . . . 101.20 8073. . . . . . 111.10 8074. . . . . . . 90.20 8075. . . . . . . 99.00 8076. . . . . . 103.40 8077. . . . . . 138.60 8078. . . . . . 138.60 8079. . . . . . 132.00 8080. . . . . . 126.50 8081. . . . . . 130.90 8082. . . . . . 123.20 8083. . . . . . . 95.70 8084. . . . . . 103.40 8085. . . . . . 106.70 8086. . . . . . 101.20 8087. . . . . . 110.00 8088. . . . . . 108.90 8089. . . . . . . 80.30 8090. . . . . . . 84.70 8091. . . . . . . 95.70 8092. . . . . . 100.10 8093. . . . . . . 93.50 8094. . . . . . . 96.80 8095. . . . . . . 91.30 8096. . . . . . 100.10 8097. . . . . . 115.50 8098. . . . . . 104.50 8099. . . . . . 101.20 8300. . . . . . 192.50 8301. . . . . . 198.00 8302. . . . . . 183.70 8303. . . . . . 194.70 8304. . . . . . 185.90 8305. . . . . . 171.60 8306. . . . . . 174.90 8307. . . . . . 176.00 8308. . . . . . 191.40 8309. . . . . . 194.70 8310. . . . . . 178.20 8311. . . . . . 170.50 8312. . . . . . 177.10 Part Number Price ($US) 8313. . . . . . 190.30 8314. . . . . . 188.10 8315. . . . . . 165.00 8316. . . . . . 190.30 8317. . . . . . 173.80 8318. . . . . . 187.00 8319. . . . . . 188.10 8320. . . . . . 168.30 8321. . . . . . 166.10 8322. . . . . . 159.50 8323. . . . . . 174.90 8324. . . . . . 185.90 8325. . . . . . 184.80 8326. . . . . . 194.70 8327. . . . . . 178.20 8328. . . . . . 178.20 8329. . . . . . 159.50 8330. . . . . . 189.20 8331. . . . . . 183.70 8332. . . . . . 177.10 8333. . . . . . 183.70 8334. . . . . . 166.10 8335. . . . . . 199.10 8336. . . . . . 192.50 8337. . . . . . 195.80 8338. . . . . . 184.80 8339. . . . . . 163.90 8340. . . . . . 198.00 8341. . . . . . 182.60 8342. . . . . . 165.00 8343. . . . . . 201.30 8344. . . . . . 171.60 8345. . . . . . 193.60 8346. . . . . . 193.60 8347. . . . . . 196.90 8348. . . . . . 191.40 8349. . . . . . 191.40 8350. . . . . . 177.10 8351. . . . . . 206.80 8352. . . . . . 191.40 8353. . . . . . 161.70 8354. . . . . . 195.80 8355. . . . . . 199.10 8356. . . . . . 198.00 8357. . . . . . 187.00 8358. . . . . . 178.20 8359. . . . . . 166.10 8360. . . . . . 185.90 8361. . . . . . 157.30 8362. . . . . . 189.20 8363. . . . . . 199.10 8364. . . . . . 195.80 8365. . . . . . 204.60 8366. . . . . . 184.80 8367. . . . . . 163.90 8368. . . . . . 214.50 32 Part Number Price ($US) 8369. . . . . . 192.50 8370. . . . . . 210.10 8371. . . . . . 182.60 8372. . . . . . 185.90 8373. . . . . . 206.80 8374. . . . . . 159.50 8375. . . . . . 182.60 8376. . . . . . 189.20 8377. . . . . . 249.70 8378. . . . . . 249.70 8379. . . . . . 242.00 8380. . . . . . 238.70 8381. . . . . . 243.10 8382. . . . . . 235.40 8383. . . . . . 178.20 8384. . . . . . 191.40 8385. . . . . . 187.00 8386. . . . . . 188.10 8387. . . . . . 181.50 8388. . . . . . 202.40 8389. . . . . . 134.20 8390. . . . . . 155.10 8391. . . . . . 179.30 8392. . . . . . 183.70 8393. . . . . . 168.30 8394. . . . . . 163.90 8395. . . . . . 165.00 8396. . . . . . 184.80 8397. . . . . . 194.70 8398. . . . . . 193.60 8399. . . . . . 182.60 8500. . . . . . 182.60 8501. . . . . . 188.10 8502. . . . . . 174.90 8503. . . . . . 185.90 8504. . . . . . 177.10 8505. . . . . . 163.90 8506. . . . . . 167.20 8507. . . . . . 167.20 8508. . . . . . 182.60 8509. . . . . . 184.80 8510. . . . . . 169.40 8511. . . . . . 162.80 8512. . . . . . 168.30 8513. . . . . . 181.50 8514. . . . . . 179.30 8515. . . . . . 157.30 8516. . . . . . 181.50 8517. . . . . . 165.00 8518. . . . . . 178.20 8519. . . . . . 179.30 8520. . . . . . 160.60 8521. . . . . . 158.40 8522. . . . . . 151.80 8523. . . . . . 167.20 8524. . . . . . 177.10 Part Number Price ($US) 8525. . . . . . 176.00 8526. . . . . . 185.90 8527. . . . . . 169.40 8528. . . . . . 169.40 8529. . . . . . 151.80 8530. . . . . . 180.40 8531. . . . . . 174.90 8532. . . . . . 169.40 8533. . . . . . 174.90 8534. . . . . . 158.40 8535. . . . . . 189.20 8536. . . . . . 182.60 8537. . . . . . 187.00 8538. . . . . . 176.00 8539. . . . . . 156.20 8540. . . . . . 189.20 8541. . . . . . 173.80 8542. . . . . . 157.30 8543. . . . . . 192.50 8544. . . . . . 163.90 8545. . . . . . 184.80 8546. . . . . . 184.80 8547. . . . . . 188.10 8548. . . . . . 182.60 8549. . . . . . 182.60 8550. . . . . . 169.40 8551. . . . . . 196.90 8552. . . . . . 181.50 8553. . . . . . 154.00 8554. . . . . . 185.90 8555. . . . . . 189.20 8556. . . . . . 188.10 8557. . . . . . 178.20 8558. . . . . . 169.40 8559. . . . . . 158.40 8560. . . . . . 177.10 8561. . . . . . 149.60 8562. . . . . . 180.40 8563. . . . . . 189.20 8564. . . . . . 187.00 8565. . . . . . 194.70 8566. . . . . . 176.00 8567. . . . . . 156.20 8568. . . . . . 204.60 8569. . . . . . 182.60 8570. . . . . . 200.20 8571. . . . . . 173.80 8572. . . . . . 177.10 8573. . . . . . 196.90 8574. . . . . . 151.80 8575. . . . . . 174.90 8576. . . . . . 180.40 8577. . . . . . 237.60 8578. . . . . . 237.60 8579. . . . . . 231.00 8580. . . . . . 227.70 Part Number Price ($US) 8581. . . . . . 231.00 8582. . . . . . 224.40 8583. . . . . . 169.40 8584. . . . . . 182.60 8585. . . . . . 178.20 8586. . . . . . 179.30 8587. . . . . . 172.70 8588. . . . . . 192.50 8589. . . . . . 128.70 8590. . . . . . 147.40 8591. . . . . . 170.50 8592. . . . . . 174.90 8593. . . . . . 160.60 8594. . . . . . 156.20 8595. . . . . . 157.30 8596. . . . . . 176.00 8597. . . . . . 184.80 8598. . . . . . 184.80 8599. . . . . . 173.80 8606. . . . . . 229.90 8608. . . . . . 256.30 8650. . . . . . 225.50 8658. . . . . . 224.40 8660. . . . . . 228.80 8677. . . . . . 332.20 8678. . . . . . 319.00 8680. . . . . . 316.80 8681. . . . . . 320.10 8686. . . . . . 278.30 8687. . . . . . 242.00 8688. . . . . . 266.20 8700. . . . . . . 89.10 8701. . . . . . . 92.40 8703. . . . . . 104.50 8705. . . . . . . 89.10 8707. . . . . . . 91.30 8708. . . . . . . 96.80 8709. . . . . . . 97.90 8710. . . . . . . 91.30 8711. . . . . . . 83.60 8712. . . . . . . 80.30 8713. . . . . . . 90.20 8714. . . . . . 103.40 8715. . . . . . . 81.40 8716. . . . . . . 97.90 8717. . . . . . . 91.30 8718. . . . . . . 95.70 8719. . . . . . . 95.70 8720. . . . . . . 82.50 8721. . . . . . . 80.30 8722. . . . . . . 78.10 8723. . . . . . . 93.50 8724. . . . . . . 93.50 8725. . . . . . . 94.60 8726. . . . . . . 91.30 8727. . . . . . . 92.40 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 8738. . . . . . . 93.50 8739. . . . . . . 84.70 8740. . . . . . . 91.30 8747. . . . . . . 96.80 8748. . . . . . . 92.40 8749. . . . . . . 93.50 8751. . . . . . 112.20 8752. . . . . . . 96.80 8753. . . . . . . 82.50 8754. . . . . . . 95.70 8755. . . . . . . 97.90 8758. . . . . . . 92.40 8759. . . . . . . 88.00 8760. . . . . . . 92.40 8761. . . . . . . 86.90 8762. . . . . . . 96.80 8763. . . . . . . 99.00 8764. . . . . . . 99.00 8765. . . . . . 101.20 8766. . . . . . . 86.90 8767. . . . . . . 86.90 8768. . . . . . 116.60 8769. . . . . . 113.30 8770. . . . . . . 95.70 8771. . . . . . . 86.90 8772. . . . . . . 89.10 8776. . . . . . . 95.70 8777. . . . . . 127.60 8778. . . . . . 127.60 8779. . . . . . 119.90 8780. . . . . . 114.40 8781. . . . . . 118.80 8782. . . . . . 111.10 8783. . . . . . . 90.20 8784. . . . . . . 94.60 8785. . . . . . 100.10 8787. . . . . . 105.60 8788. . . . . . 106.70 8789. . . . . . . 74.80 8790. . . . . . . 78.10 8791. . . . . . . 88.00 8792. . . . . . . 91.30 8794. . . . . . . 90.20 8795. . . . . . . 84.70 8797. . . . . . 107.80 8798. . . . . . . 91.30 8799. . . . . . . 93.50 8902. . . . . . 222.20 8904. . . . . . 240.90 8906. . . . . . 218.90 8907. . . . . . 228.80 8908. . . . . . 244.20 8912. . . . . . 224.40 8913. . . . . . 243.10 8914. . . . . . 239.80 8922. . . . . . 210.10 Part Number Price ($US) 8928. . . . . . 210.10 8929. . . . . . 207.90 8934. . . . . . 198.00 8935. . . . . . 228.80 8938. . . . . . 215.60 8949. . . . . . 226.60 8950. . . . . . 215.60 8956. . . . . . 229.90 8958. . . . . . 214.50 8959. . . . . . 209.00 8960. . . . . . 217.80 8965. . . . . . 245.30 8973. . . . . . 248.60 8974. . . . . . 210.10 8975. . . . . . 257.40 8976. . . . . . 245.30 8977. . . . . . 315.70 8978. . . . . . 303.60 8980. . . . . . 302.50 8981. . . . . . 304.70 8986. . . . . . 265.10 8987. . . . . . 231.00 8988. . . . . . 253.00 20101. . . . . . 41.80 23101. . . . . . 55.00 25101. . . . . . 51.70 26101. . . . . . 63.80 27101. . . . . . 40.70 29101. . . . . . 60.50 40100. . . . . . 60.50 40101. . . . . . 62.70 40102. . . . . . 55.00 40103. . . . . . 59.40 40104. . . . . . 80.30 40105. . . . . . 52.80 40106. . . . . . 42.90 40107. . . . . . 44.00 40108. . . . . . 67.10 40109. . . . . . 97.90 40110. . . . . . 50.60 40111. . . . . . 41.80 40112. . . . . . 48.40 40113. . . . . . 58.30 40114. . . . . . 49.50 40115. . . . . 139.70 40116. . . . . 139.70 40117. . . . . . 53.90 40118. . . . . . 84.70 40119. . . . . . 57.20 40120. . . . . . 73.70 40121. . . . . . 55.00 40122. . . . . . 44.00 40123. . . . . . 55.00 40124. . . . . . 93.50 40125. . . . . . 82.50 40126. . . . . 176.00 Part Number Price ($US) 40127. . . . . . 94.60 40128. . . . . . 55.00 40129. . . . . . 52.80 40130. . . . . . 36.30 40131. . . . . . 51.70 40132. . . . . . 37.40 40133. . . . . . 73.70 40134. . . . . . 82.50 40135. . . . . . 81.40 40136. . . . . . 79.20 40137. . . . . . 64.90 40138. . . . . . 39.60 40139. . . . . . 84.70 40140. . . . . . 71.50 40141. . . . . . 50.60 40143. . . . . . 71.50 40144. . . . . . 68.20 40145. . . . . . 64.90 40146. . . . . . 67.10 40147. . . . . . 62.70 40148. . . . . . 49.50 40149. . . . . . 57.20 40150. . . . . . 66.00 40151. . . . . 105.60 40152. . . . . . 94.60 40153. . . . . . 69.30 40154. . . . . . 61.60 40155. . . . . . 69.30 40156. . . . . . 44.00 40157. . . . . 101.20 40158. . . . . . 57.20 40159. . . . . . 63.80 40160. . . . . . 53.90 40161. . . . . . 66.00 40162. . . . . . 88.00 40163. . . . . . 83.60 40164. . . . . . 84.70 40165. . . . . 108.90 40166. . . . . . 55.00 40167. . . . . 113.30 40168. . . . . 105.60 40169. . . . . 112.20 40170. . . . . . 84.70 40171. . . . . . 91.30 40172. . . . . . 91.30 40173. . . . . 119.90 40174. . . . . . 91.30 40175. . . . . 141.90 40176. . . . . . 61.60 40177. . . . . . 50.60 40178. . . . . . 58.30 40179. . . . . . 50.60 40180. . . . . . 82.50 40181. . . . . . 69.30 40182. . . . . . 91.30 40183. . . . . 129.80 Part Number Price ($US) 40184. . . . . . 48.40 40185. . . . . . 57.20 40186. . . . . 101.20 40187. . . . . . 49.50 40188. . . . . . 99.00 40189. . . . . . 49.50 40190. . . . . . 79.20 40191. . . . . . 73.70 40192. . . . . . 80.30 40193. . . . . . 96.80 40194. . . . . . 94.60 40195. . . . . . 89.10 40196. . . . . 150.70 40197. . . . . . 92.40 40198. . . . . 136.40 40199. . . . . . 51.70 40200. . . . . . 96.80 40201. . . . . 129.80 40202. . . . . 132.00 40203. . . . . . 81.40 40204. . . . . . 56.10 40205. . . . . . 58.30 40206. . . . . . 62.70 40207. . . . . . 78.10 40208. . . . . 101.20 40209. . . . . . 88.00 40210. . . . . . 92.40 40211. . . . . . 51.70 40212. . . . . 130.90 40213. . . . . 133.10 40214. . . . . . 33.00 40215. . . . . 132.00 40216. . . . . 128.70 40217. . . . . . 80.30 40219. . . . . 155.10 40220. . . . . 135.30 40221. . . . . 130.90 40222. . . . . 130.90 40223. . . . . . 86.90 40224. . . . . . 97.90 40225. . . . . 160.60 40226. . . . . . 69.30 40227. . . . . . 99.00 40228. . . . . . 92.40 40229. . . . . 166.10 40230. . . . . . 93.50 40231. . . . . . 83.60 40232. . . . . . 83.60 40233. . . . . . 91.30 40234. . . . . . 61.60 40235. . . . . 121.00 40236. . . . . 121.00 40237. . . . . . 83.60 40238. . . . . 111.10 40239. . . . . . 86.90 40240. . . . . . 80.30 Part Number Price ($US) 40241. . . . . . 52.80 40242. . . . . 108.90 40243. . . . . 138.60 40244. . . . . 127.60 40245. . . . . 128.70 40246. . . . . 100.10 40247. . . . . 136.40 40248. . . . . 179.30 40249. . . . . 184.80 40250. . . . . 184.80 40251. . . . . 176.00 40252. . . . . 211.20 40253. . . . . 184.80 40254. . . . . . 81.40 40255. . . . . 183.70 40256. . . . . 114.40 40257. . . . . 110.00 40258. . . . . 185.90 40259. . . . . . 85.80 40260. . . . . 209.00 40261. . . . . . 51.70 40262. . . . . 107.80 40263. . . . . 105.60 40264. . . . . 122.10 40265. . . . . 149.60 40266. . . . . 105.60 40267. . . . . . 60.50 40268. . . . . 112.20 40269. . . . . 110.00 40270. . . . . 117.70 40271. . . . . 155.10 40272. . . . . . 90.20 40273. . . . . . 64.90 40274. . . . . . 62.70 40275. . . . . 139.70 40276. . . . . . 86.90 40277. . . . . . 85.80 40278. . . . . 104.50 40279. . . . . 182.60 40280. . . . . 244.20 40281. . . . . . 52.80 40282. . . . . 132.00 40283. . . . . 106.70 40284. . . . . . 51.70 40286. . . . . 139.70 40287. . . . . . 84.70 40288. . . . . . 53.90 40289. . . . . 119.90 40290. . . . . . 82.50 40291. . . . . 110.00 40292. . . . . . 79.20 40293. . . . . . 89.10 40294. . . . . 104.50 40295. . . . . 107.80 40296. . . . . . 89.10 40297. . . . . 180.40 33 Part Number Price ($US) 40298. . . . . 181.50 40299. . . . . 178.20 40300. . . . . 130.90 40301. . . . . 138.60 40302. . . . . . 69.30 40303. . . . . . 95.70 40304. . . . . . 91.30 40308. . . . . . 63.80 40309. . . . . 115.50 40310. . . . . 143.00 40311. . . . . . 71.50 40312. . . . . . 68.20 40313. . . . . . 75.90 40314. . . . . 128.70 40315. . . . . . 50.60 40316. . . . . 176.00 40317. . . . . . 52.80 40318. . . . . . 46.20 40319. . . . . 157.30 40320. . . . . 161.70 40321. . . . . . 68.20 40322. . . . . . 55.00 40323. . . . . 174.90 40324. . . . . 284.90 40325. . . . . 128.70 40326. . . . . 134.20 40327. . . . . 138.60 40328. . . . . 145.20 40329. . . . . 194.70 40330. . . . . 183.70 40331. . . . . 146.30 40332. . . . . 106.70 40333. . . . . . 42.90 40334. . . . . 132.00 40335. . . . . 137.50 40337. . . . . 156.20 40338. . . . . 156.20 40339. . . . . 156.20 40340. . . . . 156.20 40341. . . . . . 58.30 40342. . . . . . 51.70 40343. . . . . 115.50 40344. . . . . . 48.40 40345. . . . . 176.00 40346. . . . . . 91.30 40347. . . . . . 64.90 40348. . . . . . 63.80 40351. . . . . . 62.70 40352. . . . . . 92.40 40353. . . . . . 57.20 40354. . . . . . 61.60 40355. . . . . 188.10 40356. . . . . . 61.60 40357. . . . . 100.10 40358. . . . . . 94.60 40359. . . . . . 90.20 Part Number Price ($US) 40362. . . . . 110.00 40363. . . . . 181.50 40364. . . . . 160.60 40365. . . . . 149.60 40366. . . . . . 62.70 40367. . . . . . 56.10 40368. . . . . . 59.40 40369. . . . . . 64.90 40370. . . . . . 80.30 40371. . . . . . 56.10 40372. . . . . 150.70 40373. . . . . . 69.30 40374. . . . . 113.30 40376. . . . . 104.50 40377. . . . . . 93.50 40378. . . . . . 60.50 40379. . . . . . 82.50 40380. . . . . . 37.40 40381. . . . . . 86.90 40382. . . . . 102.30 40383. . . . . . 58.30 40384. . . . . 122.10 40385. . . . . 116.60 40387. . . . . . 60.50 40388. . . . . . 82.50 40394. . . . . . 57.20 40396. . . . . 223.30 40397. . . . . 209.00 40398. . . . . . 91.30 40399. . . . . 102.30 40400. . . . . . 85.80 40401. . . . . 220.00 40402. . . . . . 69.30 40403. . . . . 102.30 40404. . . . . 134.20 40405. . . . . . 94.60 40407. . . . . 145.20 40409. . . . . 134.20 40410. . . . . 165.00 40411. . . . . . 56.10 40412. . . . . . 38.50 40413. . . . . 106.70 40414. . . . . 106.70 40415. . . . . 163.90 40416. . . . . 134.20 40417. . . . . 116.60 40418. . . . . 117.70 40419. . . . . . 71.50 40421. . . . . . 52.80 40422. . . . . . 57.20 40423. . . . . . 94.60 40425. . . . . . 92.40 40428. . . . . . 94.60 40429. . . . . . 51.70 40430. . . . . . 51.70 40431. . . . . 176.00 Part Number Price ($US) 40432. . . . . . 34.10 40433. . . . . . 75.90 40435. . . . . . 71.50 40436. . . . . . 99.00 40437. . . . . 129.80 40442. . . . . . 99.00 40443. . . . . . 61.60 40446. . . . . 125.40 40447. . . . . . 52.80 40448. . . . . . 58.30 40449. . . . . . 93.50 40452. . . . . . 83.60 40453. . . . . 106.70 40454. . . . . . 83.60 40456. . . . . 145.20 40461. . . . . 150.70 40463. . . . . . 71.50 40469. . . . . . 47.30 40471. . . . . 243.10 40475. . . . . . 92.40 40480. . . . . 135.30 40481. . . . . 135.30 40484. . . . . . 78.10 40489. . . . . . 89.10 40490. . . . . . 69.30 40492. . . . . 190.30 40493. . . . . . 52.80 40494. . . . . . 47.30 40495. . . . . . 57.20 40496. . . . . . 67.10 40497. . . . . 184.80 40504. . . . . . 55.00 40505. . . . . 107.80 40507. . . . . 155.10 40508. . . . . 166.10 40511. . . . . . 89.10 40513. . . . . . 67.10 40514. . . . . 107.80 40516. . . . . 184.80 40517. . . . . . 66.00 40518. . . . . . 69.30 40519. . . . . 100.10 40520. . . . . . 99.00 40521. . . . . . 99.00 40525. . . . . 100.10 40526. . . . . 106.70 40530. . . . . 150.70 40531. . . . . 316.80 40533. . . . . 111.10 40536. . . . . 112.20 40539. . . . . 136.40 40540. . . . . 136.40 40541. . . . . . 99.00 40544. . . . . 150.70 40550. . . . . . 91.30 40551. . . . . . 82.50 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 40552. . . . . . 72.60 40553. . . . . . 73.70 43100. . . . . 102.30 43101. . . . . . 86.90 43102. . . . . . 89.10 43103. . . . . 106.70 43104. . . . . 110.00 43105. . . . . . 86.90 43106. . . . . . 64.90 43107. . . . . . 69.30 43108. . . . . 102.30 43109. . . . . 104.50 43110. . . . . . 80.30 43111. . . . . . 63.80 43112. . . . . . 89.10 43113. . . . . 103.40 43114. . . . . . 92.40 43115. . . . . 163.90 43116. . . . . 163.90 43117. . . . . 102.30 43118. . . . . 105.60 43119. . . . . 104.50 43120. . . . . 114.40 43121. . . . . . 85.80 43122. . . . . . 70.40 43123. . . . . . 86.90 43124. . . . . 138.60 43125. . . . . 118.80 43126. . . . . 217.80 43127. . . . . 112.20 43128. . . . . 105.60 43129. . . . . . 93.50 43131. . . . . . 86.90 43133. . . . . 101.20 43134. . . . . 103.40 43135. . . . . 119.90 43136. . . . . 100.10 43137. . . . . 112.20 43138. . . . . . 66.00 43139. . . . . 130.90 43140. . . . . 123.20 43141. . . . . . 85.80 43143. . . . . 123.20 43144. . . . . 119.90 43145. . . . . 117.70 43146. . . . . 119.90 43147. . . . . 115.50 43148. . . . . . 83.60 43149. . . . . . 88.00 43150. . . . . 112.20 43151. . . . . 132.00 43152. . . . . 107.80 43153. . . . . . 94.60 43154. . . . . 103.40 43155. . . . . . 91.30 43156. . . . . . 74.80 Part Number Price ($US) 43157. . . . . 168.30 43158. . . . . . 89.10 43159. . . . . 105.60 43160. . . . . . 90.20 43161. . . . . 111.10 43162. . . . . 126.50 43163. . . . . 124.30 43164. . . . . 123.20 43165. . . . . 121.00 43166. . . . . . 91.30 43167. . . . . 125.40 43168. . . . . 119.90 43169. . . . . 146.30 43170. . . . . 125.40 43171. . . . . 134.20 43172. . . . . 133.10 43173. . . . . 148.50 43174. . . . . 119.90 43175. . . . . 194.70 43176. . . . . . 99.00 43177. . . . . . 94.60 43178. . . . . . 95.70 43179. . . . . . 92.40 43180. . . . . 122.10 43181. . . . . 111.10 43182. . . . . 122.10 43183. . . . . 150.70 43184. . . . . . 79.20 43185. . . . . . 90.20 43186. . . . . 127.60 43187. . . . . . 83.60 43188. . . . . 144.10 43189. . . . . . 84.70 43190. . . . . 106.70 43191. . . . . 108.90 43192. . . . . 118.80 43193. . . . . 161.70 43194. . . . . 132.00 43195. . . . . 121.00 43196. . . . . 177.10 43197. . . . . . 86.90 43198. . . . . 155.10 43199. . . . . . 78.10 43200. . . . . 110.00 43201. . . . . 202.40 43202. . . . . 206.80 43203. . . . . 119.90 43204. . . . . 103.40 43205. . . . . 103.40 43206. . . . . 110.00 43207. . . . . 111.10 43208. . . . . 150.70 43209. . . . . 110.00 43210. . . . . 116.60 43211. . . . . 111.10 43212. . . . . 161.70 Part Number Price ($US) 43213. . . . . 166.10 43214. . . . . . 47.30 43215. . . . . 161.70 43216. . . . . 170.50 43217. . . . . 115.50 43219. . . . . 215.60 43220. . . . . 170.50 43221. . . . . 158.40 43222. . . . . 161.70 43223. . . . . 102.30 43224. . . . . 128.70 43225. . . . . 181.50 43226. . . . . 102.30 43227. . . . . 130.90 43228. . . . . 123.20 43229. . . . . 195.80 43230. . . . . 125.40 43231. . . . . 101.20 43232. . . . . 117.70 43233. . . . . 122.10 43234. . . . . . 96.80 43235. . . . . 163.90 43236. . . . . 167.20 43237. . . . . 112.20 43238. . . . . 126.50 43239. . . . . 112.20 43240. . . . . 103.40 43241. . . . . . 79.20 43242. . . . . 148.50 43243. . . . . 170.50 43244. . . . . 158.40 43245. . . . . 157.30 43246. . . . . 132.00 43247. . . . . 165.00 43248. . . . . 256.30 43249. . . . . 319.00 43250. . . . . 271.70 43251. . . . . 254.10 43252. . . . . 281.60 43253. . . . . 256.30 43254. . . . . 146.30 43255. . . . . 273.90 43256. . . . . 154.00 43257. . . . . 143.00 43258. . . . . 262.90 43259. . . . . 129.80 43260. . . . . 281.60 43261. . . . . . 90.20 43262. . . . . 185.90 43263. . . . . 121.00 43264. . . . . 145.20 43265. . . . . 166.10 43266. . . . . 132.00 43267. . . . . 103.40 43268. . . . . 139.70 43269. . . . . 136.40 Part Number Price ($US) 43270. . . . . 143.00 43271. . . . . 172.70 43272. . . . . 118.80 43273. . . . . . 96.80 43274. . . . . 106.70 43275. . . . . 172.70 43276. . . . . 126.50 43277. . . . . 126.50 43278. . . . . 136.40 43279. . . . . 272.80 43280. . . . . 293.70 43281. . . . . . 89.10 43282. . . . . 169.40 43283. . . . . 141.90 43284. . . . . . 74.80 43285. . . . . 100.10 43286. . . . . 177.10 43287. . . . . 107.80 43288. . . . . . 93.50 43289. . . . . 156.20 43290. . . . . 123.20 43291. . . . . 141.90 43292. . . . . 132.00 43293. . . . . 145.20 43294. . . . . 158.40 43295. . . . . 180.40 43296. . . . . 134.20 43297. . . . . 268.40 43298. . . . . 270.60 43299. . . . . 269.50 43300. . . . . 199.10 43301. . . . . 173.80 43302. . . . . 111.10 43303. . . . . 134.20 43304. . . . . 117.70 43305. . . . . 196.90 43308. . . . . 108.90 43309. . . . . 147.40 43310. . . . . 218.90 43311. . . . . 117.70 43312. . . . . 114.40 43313. . . . . 126.50 43314. . . . . 198.00 43315. . . . . . 95.70 43316. . . . . 243.10 43317. . . . . . 92.40 43318. . . . . . 84.70 43319. . . . . 210.10 43320. . . . . 194.70 43321. . . . . 115.50 43322. . . . . 105.60 43323. . . . . 239.80 43324. . . . . 387.20 43325. . . . . 176.00 43326. . . . . 179.30 43327. . . . . 188.10 Part Number Price ($US) 43328. . . . . 217.80 43329. . . . . 272.80 43330. . . . . 248.60 43331. . . . . 180.40 43332. . . . . 116.60 43333. . . . . . 64.90 43334. . . . . 167.20 43335. . . . . 188.10 43337. . . . . 196.90 43338. . . . . 196.90 43339. . . . . 196.90 43340. . . . . 196.90 43341. . . . . . 93.50 43342. . . . . . 84.70 43343. . . . . 198.00 43344. . . . . . 78.10 43345. . . . . 235.40 43346. . . . . 117.70 43347. . . . . 102.30 43348. . . . . 107.80 43351. . . . . 114.40 43352. . . . . 122.10 43353. . . . . . 91.30 43354. . . . . 100.10 43355. . . . . 251.90 43356. . . . . . 96.80 43357. . . . . 130.90 43358. . . . . 130.90 43359. . . . . 127.60 43362. . . . . 155.10 43363. . . . . 246.40 43364. . . . . 210.10 43365. . . . . 201.30 43366. . . . . . 99.00 43367. . . . . . 91.30 43368. . . . . . 91.30 43369. . . . . 108.90 43370. . . . . 117.70 43371. . . . . . 97.90 43372. . . . . 177.10 43373. . . . . 115.50 43374. . . . . 141.90 43376. . . . . 141.90 43377. . . . . 122.10 43378. . . . . 114.40 43379. . . . . 115.50 43380. . . . . . 58.30 43381. . . . . 102.30 43382. . . . . 129.80 43384. . . . . 178.20 43385. . . . . 152.90 43387. . . . . 111.10 43388. . . . . . 92.40 43394. . . . . 104.50 43396. . . . . 306.90 43397. . . . . 281.60 34 Part Number Price ($US) 43398. . . . . 123.20 43399. . . . . 144.10 43400. . . . . 103.40 43401. . . . . 292.60 43402. . . . . 111.10 43403. . . . . 144.10 43404. . . . . 179.30 43405. . . . . 112.20 43407. . . . . 217.80 43409. . . . . 179.30 43410. . . . . 217.80 43411. . . . . 103.40 43413. . . . . 139.70 43414. . . . . 135.30 43415. . . . . 205.70 43416. . . . . 179.30 43417. . . . . 194.70 43418. . . . . 182.60 43419. . . . . 121.00 43420. . . . . . 92.40 43421. . . . . . 93.50 43423. . . . . 128.70 43425. . . . . 102.30 43428. . . . . 106.70 43431. . . . . 235.40 43432. . . . . . 46.20 43433. . . . . 111.10 43435. . . . . 108.90 43436. . . . . 124.30 43442. . . . . 126.50 43443. . . . . 104.50 43446. . . . . 163.90 43448. . . . . . 81.40 43449. . . . . 128.70 43452. . . . . 114.29 43453. . . . . 139.70 43454. . . . . 101.20 43463. . . . . 111.10 43469. . . . . . 80.30 43475. . . . . 116.60 43480. . . . . 170.50 43481. . . . . 170.50 43484. . . . . 102.30 43489. . . . . 121.00 43490. . . . . 103.40 43493. . . . . . 96.80 43494. . . . . . 64.90 43497. . . . . 256.30 43504. . . . . . 91.30 43505. . . . . 129.80 43507. . . . . 179.30 43508. . . . . 193.60 43511. . . . . 111.10 43513. . . . . 128.70 43514. . . . . 129.80 43516. . . . . 256.30 Part Number Price ($US) 43517. . . . . 118.80 43518. . . . . 107.80 43519. . . . . 132.00 43520. . . . . 113.30 43521. . . . . 113.30 43524. . . . . 105.05 43525. . . . . 168.30 43526. . . . . 116.60 43531. . . . . 401.50 43533. . . . . 193.60 43536. . . . . 146.30 43539. . . . . 165.00 43540. . . . . 165.00 43541. . . . . 178.20 43544. . . . . 177.10 43550. . . . . 114.40 43551. . . . . 115.50 43552. . . . . 104.50 43553. . . . . 101.20 45100. . . . . . 96.80 45101. . . . . . 82.50 45102. . . . . . 84.70 45103. . . . . 102.30 45104. . . . . 104.50 45105. . . . . . 82.50 45106. . . . . . 61.60 45107. . . . . . 66.00 45108. . . . . . 96.80 45109. . . . . 100.10 45110. . . . . . 75.90 45111. . . . . . 61.60 45112. . . . . . 84.70 45113. . . . . . 97.90 45114. . . . . . 88.00 45115. . . . . 151.80 45116. . . . . 151.80 45117. . . . . . 97.90 45118. . . . . 102.30 45119. . . . . 100.10 45120. . . . . 108.90 45121. . . . . . 81.40 45122. . . . . . 67.10 45123. . . . . . 83.60 45124. . . . . 132.00 45125. . . . . 113.30 45126. . . . . 206.80 45127. . . . . 106.70 45128. . . . . 101.20 45129. . . . . . 89.10 45131. . . . . . 83.60 45133. . . . . . 95.70 45134. . . . . . 99.00 45135. . . . . 114.40 45136. . . . . . 96.80 45137. . . . . 106.70 45138. . . . . . 62.70 Part Number Price ($US) 45139. . . . . 124.30 45140. . . . . 117.70 45141. . . . . . 82.50 45143. . . . . 117.70 45144. . . . . 114.40 45145. . . . . 112.20 45146. . . . . 114.40 45147. . . . . 110.00 45148. . . . . . 79.20 45149. . . . . . 83.60 45150. . . . . 107.80 45151. . . . . 125.40 45152. . . . . 102.30 45153. . . . . . 86.90 45154. . . . . . 99.00 45155. . . . . . 88.00 45156. . . . . . 71.50 45157. . . . . 159.50 45158. . . . . . 85.80 45159. . . . . 101.20 45160. . . . . . 85.80 45161. . . . . 105.60 45162. . . . . 119.90 45163. . . . . 117.70 45164. . . . . 117.70 45165. . . . . 114.40 45166. . . . . . 86.90 45167. . . . . 119.90 45168. . . . . 112.20 45169. . . . . 138.60 45170. . . . . 118.80 45171. . . . . 127.60 45172. . . . . 127.60 45173. . . . . 141.90 45174. . . . . 114.40 45175. . . . . 184.80 45176. . . . . . 94.60 45177. . . . . . 90.20 45178. . . . . . 91.30 45179. . . . . . 88.00 45180. . . . . 116.60 45181. . . . . 106.70 45182. . . . . 115.50 45183. . . . . 138.60 45184. . . . . . 75.90 45185. . . . . . 85.80 45186. . . . . 121.00 45187. . . . . . 79.20 45188. . . . . 136.40 45189. . . . . . 80.30 45190. . . . . 101.20 45191. . . . . 103.40 45192. . . . . 112.20 45193. . . . . 154.00 45194. . . . . 125.40 45195. . . . . 115.50 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 45196. . . . . 168.30 45197. . . . . . 83.60 45198. . . . . 172.70 45199. . . . . . 74.80 45200. . . . . 104.50 45201. . . . . 192.50 45202. . . . . 196.90 45203. . . . . 114.40 45204. . . . . . 97.90 45205. . . . . . 97.90 45206. . . . . 105.60 45207. . . . . 105.60 45208. . . . . 143.00 45209. . . . . 104.50 45210. . . . . 111.10 45211. . . . . 105.60 45212. . . . . 154.00 45213. . . . . 158.40 45214. . . . . . 45.10 45215. . . . . 154.00 45216. . . . . 162.80 45217. . . . . 110.00 45219. . . . . 205.70 45220. . . . . 162.80 45221. . . . . 150.70 45222. . . . . 154.00 45223. . . . . . 97.90 45224. . . . . 122.10 45225. . . . . 172.70 45226. . . . . . 97.90 45227. . . . . 125.40 45228. . . . . 117.70 45229. . . . . 187.00 45230. . . . . 118.80 45231. . . . . . 95.70 45232. . . . . 112.20 45233. . . . . 116.60 45234. . . . . . 92.40 45235. . . . . 156.20 45236. . . . . 159.50 45237. . . . . 106.70 45238. . . . . 119.90 45239. . . . . 106.70 45240. . . . . . 96.80 45241. . . . . . 75.90 45242. . . . . 140.80 45243. . . . . 162.80 45244. . . . . 150.70 45245. . . . . 150.70 45246. . . . . 125.40 45247. . . . . 157.30 45248. . . . . 244.20 45249. . . . . 303.60 45250. . . . . 258.50 45251. . . . . 242.00 45252. . . . . 268.40 Part Number Price ($US) 45253. . . . . 244.20 45254. . . . . 138.60 45255. . . . . 260.70 45256. . . . . 146.30 45257. . . . . 136.40 45258. . . . . 250.80 45259. . . . . 123.20 45260. . . . . 268.40 45261. . . . . . 86.90 45262. . . . . 177.10 45263. . . . . 114.40 45264. . . . . 138.60 45265. . . . . 158.40 45266. . . . . 125.40 45267. . . . . . 97.90 45268. . . . . 133.10 45269. . . . . 130.90 45270. . . . . 136.40 45271. . . . . 165.00 45272. . . . . 113.30 45273. . . . . 106.70 45274. . . . . 115.50 45275. . . . . 165.00 45276. . . . . 121.00 45277. . . . . 121.00 45278. . . . . 130.90 45279. . . . . 259.60 45280. . . . . 279.40 45281. . . . . . 84.70 45282. . . . . 161.70 45283. . . . . 134.20 45284. . . . . . 71.50 45285. . . . . . 94.60 45286. . . . . 169.40 45287. . . . . 102.30 45288. . . . . . 89.10 45289. . . . . 148.50 45290. . . . . 116.60 45291. . . . . 135.30 45292. . . . . 125.40 45293. . . . . 137.50 45294. . . . . 151.80 45295. . . . . 171.60 45296. . . . . 128.70 45297. . . . . 255.20 45298. . . . . 258.50 45299. . . . . 256.30 45300. . . . . 189.20 45301. . . . . 165.00 45302. . . . . 106.70 45303. . . . . 128.70 45304. . . . . 112.20 45305. . . . . 187.00 45308. . . . . 103.40 45309. . . . . 140.80 45310. . . . . 209.00 Part Number Price ($US) 45311. . . . . 112.20 45312. . . . . 108.90 45313. . . . . 121.00 45314. . . . . 188.10 45315. . . . . . 91.30 45316. . . . . 231.00 45317. . . . . . 88.00 45318. . . . . . 80.30 45319. . . . . 200.20 45320. . . . . 184.80 45321. . . . . 110.00 45322. . . . . 101.20 45323. . . . . 228.80 45324. . . . . 368.50 45325. . . . . 167.20 45326. . . . . 170.50 45327. . . . . 179.30 45328. . . . . 207.90 45329. . . . . 259.60 45330. . . . . 236.50 45331. . . . . 172.70 45332. . . . . 111.10 45333. . . . . . 61.60 45334. . . . . 159.50 45335. . . . . 179.30 45337. . . . . 187.00 45338. . . . . 187.00 45339. . . . . 187.00 45340. . . . . 187.00 45341. . . . . . 89.10 45342. . . . . . 80.30 45343. . . . . 189.20 45344. . . . . . 73.70 45345. . . . . 224.40 45346. . . . . 111.10 45347. . . . . . 96.80 45348. . . . . 102.30 45349. . . . . 150.70 45350. . . . . 138.60 45351. . . . . 108.90 45352. . . . . 119.90 45353. . . . . . 86.90 45354. . . . . . 94.60 45355. . . . . 239.80 45356. . . . . . 92.40 45357. . . . . 124.30 45358. . . . . 124.30 45359. . . . . 122.10 45362. . . . . 148.50 45363. . . . . 235.40 45364. . . . . 200.20 45365. . . . . 191.40 45366. . . . . . 93.50 45367. . . . . . 86.90 45368. . . . . . 86.90 45369. . . . . 103.40 Part Number Price ($US) 45370. . . . . 112.20 45371. . . . . . 93.50 45372. . . . . 168.30 45373. . . . . 110.00 45374. . . . . 135.30 45375. . . . . . 78.10 45376. . . . . 135.30 45377. . . . . 116.60 45378. . . . . 108.90 45379. . . . . 110.00 45380. . . . . . 55.00 45381. . . . . . 97.90 45382. . . . . 124.30 45383. . . . . . 72.60 45384. . . . . 169.40 45385. . . . . 146.30 45386. . . . . 166.10 45387. . . . . 105.60 45388. . . . . . 88.00 45389. . . . . 220.00 45391. . . . . 173.80 45392. . . . . 150.70 45394. . . . . 100.10 45395. . . . . 130.90 45396. . . . . 281.60 45397. . . . . 268.40 45398. . . . . 116.60 45399. . . . . 136.40 45400. . . . . . 99.00 45401. . . . . 279.40 45402. . . . . 106.70 45403. . . . . 136.40 45404. . . . . 170.50 45405. . . . . 106.70 45406. . . . . 168.30 45407. . . . . 207.90 45409. . . . . 170.50 45410. . . . . 207.90 45411. . . . . . 97.90 45413. . . . . 133.10 45414. . . . . 128.70 45415. . . . . 195.80 45416. . . . . 170.50 45417. . . . . 185.90 45418. . . . . 173.80 45419. . . . . 115.50 45420. . . . . . 88.00 45421. . . . . . 89.10 45422. . . . . 129.80 45423. . . . . 122.10 45424. . . . . . 95.70 45425. . . . . 108.90 45426. . . . . 133.10 45427. . . . . 122.10 45428. . . . . 101.20 45429. . . . . . 93.50 Part Number Price ($US) 45430. . . . . . 93.50 45431. . . . . 224.40 45432. . . . . . 44.00 45433. . . . . 105.60 45434. . . . . 114.40 45435. . . . . 103.40 45436. . . . . 118.80 45440. . . . . 143.00 45442. . . . . 119.90 45443. . . . . . 97.90 45444. . . . . . 99.00 45445. . . . . 235.40 45446. . . . . 156.20 45448. . . . . . 77.00 45449. . . . . 121.00 45450. . . . . 161.70 45451. . . . . . 79.20 45452. . . . . 107.80 45453. . . . . 133.10 45454. . . . . . 95.70 45455. . . . . 144.10 45456. . . . . 159.50 45457. . . . . 302.50 45458. . . . . 302.50 45459. . . . . 302.50 45460. . . . . 207.90 45461. . . . . 182.60 45462. . . . . . 85.80 45463. . . . . 105.60 45465. . . . . 100.10 45466. . . . . 102.30 45467. . . . . 148.50 45468. . . . . 132.00 45469. . . . . . 80.30 45470. . . . . . 92.40 45471. . . . . 266.20 45472. . . . . 266.20 45473. . . . . 168.30 45474. . . . . 141.90 45475. . . . . 111.10 45476. . . . . 140.80 45477. . . . . 201.30 45478. . . . . 201.30 45479. . . . . 163.90 45480. . . . . 162.80 45481. . . . . 162.80 45484. . . . . . 95.70 45486. . . . . 216.70 45487. . . . . 159.50 45488. . . . . . 67.10 45489. . . . . 115.50 45490. . . . . . 97.90 45491. . . . . 141.90 45492. . . . . 211.20 45493. . . . . . 92.40 45494. . . . . . 75.90 35 Part Number Price ($US) 45497. . . . . 244.20 45498. . . . . 100.60 45499. . . . . 100.60 45500. . . . . 172.70 45502. . . . . 229.43 45503. . . . . . 91.30 45504. . . . . . 86.90 45505. . . . . 125.40 45507. . . . . 170.50 45508. . . . . 183.70 45509. . . . . 168.30 45510. . . . . 144.10 45511. . . . . 105.60 45513. . . . . 122.10 45514. . . . . 125.40 45516. . . . . 244.20 45517. . . . . 112.20 45518. . . . . 102.30 45519. . . . . 125.40 45520. . . . . 107.80 45521. . . . . 107.80 45525. . . . . 158.40 45526. . . . . 111.10 45529. . . . . 195.80 45530. . . . . 182.60 45531. . . . . 381.70 45533. . . . . 183.70 45535. . . . . 138.60 45536. . . . . 138.60 45537. . . . . . 61.04 45538. . . . . 100.10 45539. . . . . 157.30 45540. . . . . 157.30 45541. . . . . 169.40 45542. . . . . 149.60 45544. . . . . 168.30 45549. . . . . 145.20 45550. . . . . 108.90 45551. . . . . 110.00 45552. . . . . . 97.90 45553. . . . . . 95.70 46101. . . . . 100.10 46108. . . . . 140.80 46109. . . . . 123.20 46115. . . . . 200.20 46116. . . . . 200.20 46118. . . . . 155.10 46123. . . . . 108.90 46124. . . . . 221.10 46125. . . . . 209.00 46126. . . . . 250.80 46136. . . . . 140.80 46139. . . . . 179.30 46140. . . . . 157.30 46143. . . . . 150.70 46145. . . . . 149.60 Part Number Price ($US) 46146. . . . . 151.80 46150. . . . . 160.60 46161. . . . . 123.20 46162. . . . . 228.80 46163. . . . . 206.80 46164. . . . . 210.10 46165. . . . . 183.70 46166. . . . . 133.10 46167. . . . . 193.60 46168. . . . . 163.90 46169. . . . . 217.80 46170. . . . . 206.80 46171. . . . . 227.70 46172. . . . . 225.50 46175. . . . . 278.30 46177. . . . . 110.00 46182. . . . . 156.20 46188. . . . . 231.00 46190. . . . . 121.00 46192. . . . . 157.30 46193. . . . . 243.10 46195. . . . . 187.00 46196. . . . . 223.30 46198. . . . . 281.60 46200. . . . . 147.40 46207. . . . . 180.40 46215. . . . . 225.50 46216. . . . . 202.40 46220. . . . . 228.80 46223. . . . . 125.40 46226. . . . . 178.20 46227. . . . . 210.10 46228. . . . . 171.60 46231. . . . . 119.90 46232. . . . . 211.20 46238. . . . . 177.10 46239. . . . . 174.90 46240. . . . . 150.70 46245. . . . . 235.40 46251. . . . . 311.30 46253. . . . . 323.40 46257. . . . . 215.60 46269. . . . . 177.10 46275. . . . . 205.70 46276. . . . . 210.10 46281. . . . . 110.00 46285. . . . . 132.00 46287. . . . . 127.60 46289. . . . . 237.60 46290. . . . . 209.00 46305. . . . . 248.60 46308. . . . . 140.80 46309. . . . . 222.20 46311. . . . . 136.40 46312. . . . . 135.30 46313. . . . . 147.40 Part Number Price ($US) 46315. . . . . 111.10 46324. . . . . 529.10 46328. . . . . 244.20 46332. . . . . 178.20 46334. . . . . 209.00 46335. . . . . 253.00 46344. . . . . 116.60 46352. . . . . 200.20 46354. . . . . 126.50 46356. . . . . 137.50 46357. . . . . 199.10 46368. . . . . 126.50 46373. . . . . 144.10 46381. . . . . 125.40 46387. . . . . 122.10 46419. . . . . 173.80 46420. . . . . 124.30 46425. . . . . 151.80 46428. . . . . 139.70 46449. . . . . 194.70 46454. . . . . 119.90 46463. . . . . 157.30 46507. . . . . 228.80 46508. . . . . 243.10 46517. . . . . 136.40 46525. . . . . 203.50 46526. . . . . 178.20 46536. . . . . 217.80 47100. . . . . . 57.20 47101. . . . . . 58.30 47102. . . . . . 51.70 47103. . . . . . 57.20 47104. . . . . . 79.20 47105. . . . . . 49.50 47106. . . . . . 40.70 47107. . . . . . 41.80 47108. . . . . . 66.00 47109. . . . . . 95.70 47110. . . . . . 48.40 47111. . . . . . 39.60 47112. . . . . . 45.10 47113. . . . . . 53.90 47114. . . . . . 45.10 47115. . . . . 137.50 47116. . . . . 137.50 47117. . . . . . 50.60 47118. . . . . . 82.50 47120. . . . . . 69.30 47121. . . . . . 52.80 47122. . . . . . 41.80 47123. . . . . . 52.80 47124. . . . . . 90.20 47125. . . . . . 79.20 47126. . . . . 151.80 47127. . . . . . 93.50 47128. . . . . . 50.60 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 47129. . . . . . 49.50 47130. . . . . . 33.00 47131. . . . . . 48.40 47132. . . . . . 34.10 47133. . . . . . 72.60 47134. . . . . . 79.20 47135. . . . . . 79.20 47136. . . . . . 77.00 47137. . . . . . 60.50 47138. . . . . . 36.30 47139. . . . . . 82.50 47140. . . . . . 66.00 47141. . . . . . 46.20 47144. . . . . . 62.70 47145. . . . . . 59.40 47147. . . . . . 57.20 47148. . . . . . 47.30 47149. . . . . . 55.00 47150. . . . . . 62.70 47151. . . . . 104.50 47152. . . . . . 92.40 47153. . . . . . 67.10 47154. . . . . . 58.30 47155. . . . . . 64.90 47156. . . . . . 40.70 47157. . . . . . 79.20 47158. . . . . . 53.90 47159. . . . . . 61.60 47160. . . . . . 50.60 47161. . . . . . 63.80 47162. . . . . . 85.80 47163. . . . . . 80.30 47164. . . . . . 81.40 47165. . . . . 101.20 47166. . . . . . 51.70 47167. . . . . 104.50 47168. . . . . 103.40 47169. . . . . 108.90 47170. . . . . . 82.50 47171. . . . . . 88.00 47172. . . . . . 88.00 47173. . . . . 116.60 47174. . . . . . 90.20 47175. . . . . 140.80 47176. . . . . . 59.40 47177. . . . . . 47.30 47178. . . . . . 55.00 47179. . . . . . 47.30 47180. . . . . . 79.20 47182. . . . . . 88.00 47183. . . . . 127.60 47184. . . . . . 45.10 47185. . . . . . 52.80 47186. . . . . 100.10 47187. . . . . . 46.20 47188. . . . . . 88.00 Part Number Price ($US) 47189. . . . . . 46.20 47190. . . . . . 58.30 47191. . . . . . 70.40 47192. . . . . . 79.20 47193. . . . . . 80.30 47194. . . . . . 91.30 47195. . . . . . 86.90 47196. . . . . 147.40 47197. . . . . . 89.10 47198. . . . . 135.30 47199. . . . . . 49.50 47200. . . . . . 94.60 47203. . . . . . 78.10 47204. . . . . . 52.80 47205. . . . . . 55.00 47206. . . . . . 59.40 47207. . . . . . 74.80 47208. . . . . . 95.70 47209. . . . . . 85.80 47210. . . . . . 90.20 47211. . . . . . 49.50 47212. . . . . 129.80 47213. . . . . 130.90 47214. . . . . . 33.00 47215. . . . . 130.90 47216. . . . . 127.60 47217. . . . . . 78.10 47218. . . . . 177.10 47219. . . . . 152.90 47220. . . . . 133.10 47221. . . . . 128.70 47222. . . . . 128.70 47223. . . . . . 84.70 47224. . . . . . 95.70 47225. . . . . 156.20 47226. . . . . . 67.10 47227. . . . . . 96.80 47228. . . . . . 90.20 47229. . . . . 163.90 47230. . . . . . 91.30 47231. . . . . . 82.50 47232. . . . . . 81.40 47234. . . . . . 59.40 47235. . . . . 117.70 47236. . . . . 117.70 47237. . . . . . 82.50 47238. . . . . 108.90 47239. . . . . . 85.80 47240. . . . . . 78.10 47241. . . . . . 50.60 47242. . . . . 106.70 47243. . . . . 136.40 47244. . . . . 125.40 47245. . . . . 126.50 47246. . . . . . 97.90 47247. . . . . 134.20 Part Number Price ($US) 47248. . . . . 177.10 47249. . . . . 182.60 47250. . . . . 183.70 47251. . . . . 174.90 47252. . . . . 188.10 47253. . . . . 182.60 47254. . . . . . 79.20 47255. . . . . 182.60 47256. . . . . 112.20 47257. . . . . 106.70 47258. . . . . 184.80 47259. . . . . . 82.50 47260. . . . . 205.70 47261. . . . . . 48.40 47262. . . . . 105.60 47263. . . . . 103.40 47264. . . . . 117.70 47265. . . . . 148.50 47266. . . . . 103.40 47267. . . . . . 57.20 47268. . . . . 103.40 47269. . . . . 108.90 47270. . . . . 114.40 47271. . . . . 155.10 47272. . . . . . 88.00 47273. . . . . . 62.70 47274. . . . . . 61.60 47275. . . . . 138.60 47276. . . . . . 83.60 47277. . . . . . 82.50 47278. . . . . 102.30 47279. . . . . 181.50 47280. . . . . 242.00 47281. . . . . . 51.70 47282. . . . . 130.90 47283. . . . . 101.20 47284. . . . . . 48.40 47286. . . . . 136.40 47287. . . . . . 81.40 47288. . . . . . 50.60 47289. . . . . 118.80 47290. . . . . . 81.40 47291. . . . . 107.80 47292. . . . . . 75.90 47293. . . . . . 85.80 47294. . . . . 101.20 47295. . . . . 105.60 47296. . . . . . 84.70 47297. . . . . 179.30 47298. . . . . 179.30 47299. . . . . 177.10 47300. . . . . 128.70 47301. . . . . 136.40 47303. . . . . . 92.40 47304. . . . . . 90.20 47308. . . . . . 59.40 Part Number Price ($US) 47309. . . . . 111.10 47311. . . . . . 68.20 47312. . . . . . 66.00 47313. . . . . . 72.60 47314. . . . . 126.50 47315. . . . . . 47.30 47316. . . . . 170.50 47317. . . . . . 48.40 47318. . . . . . 42.90 47319. . . . . 155.10 47320. . . . . 159.50 47321. . . . . . 62.70 47322. . . . . . 51.70 47323. . . . . 173.80 47324. . . . . 280.50 47325. . . . . 126.50 47326. . . . . 130.90 47327. . . . . 135.30 47328. . . . . 141.90 47329. . . . . 193.60 47330. . . . . 180.40 47331. . . . . 145.20 47332. . . . . 102.30 47333. . . . . . 40.70 47334. . . . . 130.90 47335. . . . . 134.20 47336. . . . . 166.10 47337. . . . . 148.50 47338. . . . . 148.50 47339. . . . . 148.50 47340. . . . . 148.50 47341. . . . . . 56.10 47342. . . . . . 49.50 47343. . . . . 114.40 47344. . . . . . 46.20 47345. . . . . 167.20 47346. . . . . . 90.20 47347. . . . . . 61.60 47348. . . . . . 60.50 47351. . . . . . 61.60 47353. . . . . . 55.00 47354. . . . . . 59.40 47355. . . . . 183.70 47356. . . . . . 59.40 47357. . . . . . 97.90 47358. . . . . . 92.40 47359. . . . . . 86.90 47362. . . . . . 96.80 47363. . . . . 179.30 47364. . . . . 158.40 47365. . . . . 146.30 47366. . . . . . 60.50 47367. . . . . . 52.80 47368. . . . . . 58.30 47369. . . . . . 60.50 47370. . . . . . 79.20 Part Number Price ($US) 47372. . . . . 147.40 47373. . . . . . 64.90 47374. . . . . 105.60 47376. . . . . 101.20 47377. . . . . . 91.30 47378. . . . . . 57.20 47379. . . . . . 81.40 47380. . . . . . 35.20 47381. . . . . . 84.70 47382. . . . . . 99.00 47383. . . . . . 52.80 47384. . . . . 118.80 47385. . . . . 114.40 47388. . . . . . 81.40 47390. . . . . . 96.80 47394. . . . . . 53.90 47396. . . . . 199.10 47397. . . . . 205.70 47398. . . . . . 86.90 47399. . . . . 101.20 47400. . . . . . 83.60 47401. . . . . 193.60 47403. . . . . 101.20 47404. . . . . 130.90 47405. . . . . . 92.40 47407. . . . . 141.90 47409. . . . . 130.90 47410. . . . . 160.60 47411. . . . . . 52.80 47412. . . . . . 42.90 47413. . . . . 102.30 47414. . . . . 101.20 47415. . . . . 155.10 47416. . . . . 130.90 47417. . . . . 113.30 47418. . . . . 106.70 47419. . . . . . 68.20 47421. . . . . . 49.50 47423. . . . . . 90.20 47425. . . . . . 88.00 47428. . . . . . 93.50 47429. . . . . . 47.30 47430. . . . . . 47.30 47431. . . . . 167.20 47432. . . . . . 33.00 47433. . . . . . 71.50 47435. . . . . . 68.20 47436. . . . . . 95.70 47438. . . . . 251.90 47439. . . . . 260.70 47441. . . . . 287.10 47442. . . . . . 97.90 47443. . . . . . 60.50 47446. . . . . 121.00 47448. . . . . . 55.00 47449. . . . . . 91.30 36 Part Number Price ($US) 47452. . . . . . 80.30 47453. . . . . 102.30 47454. . . . . . 82.50 47456. . . . . 141.90 47461. . . . . 148.50 47463. . . . . . 69.30 47464. . . . . . 40.70 47469. . . . . . 45.10 47475. . . . . . 90.20 47480. . . . . 133.10 47481. . . . . 133.10 47482. . . . . . 67.10 47483. . . . . . 97.90 47484. . . . . . 77.00 47485. . . . . . 93.50 47489. . . . . . 86.90 47490. . . . . . 68.20 47492. . . . . 187.00 47493. . . . . . 48.40 47494. . . . . . 45.10 47495. . . . . . 57.20 47497. . . . . 182.60 47504. . . . . . 51.70 47505. . . . . 104.50 47506. . . . . . 84.70 47507. . . . . 152.90 47508. . . . . 163.90 47511. . . . . . 86.90 47512. . . . . . 94.60 47513. . . . . . 64.90 47514. . . . . 104.50 47516. . . . . 182.60 47517. . . . . . 62.70 47518. . . . . . 67.10 47519. . . . . . 97.90 47520. . . . . . 97.90 47521. . . . . . 97.90 47525. . . . . . 96.80 47526. . . . . 102.30 47530. . . . . 148.50 47531. . . . . 309.10 47533. . . . . 107.80 47534. . . . . . 83.60 47536. . . . . 108.90 47539. . . . . 134.20 47540. . . . . 134.20 47541. . . . . . 92.40 47543. . . . . . 58.30 47544. . . . . 147.40 47550. . . . . . 89.10 47551. . . . . . 81.40 47552. . . . . . 67.10 47553. . . . . . 72.60 49101. . . . . . 94.60 49108. . . . . 134.20 49109. . . . . 117.70 Part Number Price ($US) 49115. . . . . 191.40 49116. . . . . 190.30 49118. . . . . 148.50 49123. . . . . 103.40 49124. . . . . 211.20 49125. . . . . 199.10 49126. . . . . 239.80 49136. . . . . 135.30 49139. . . . . 171.60 49140. . . . . 149.60 49143. . . . . 144.10 49145. . . . . 143.00 49146. . . . . 144.10 49150. . . . . 154.00 49152. . . . . 126.50 49153. . . . . 122.10 49159. . . . . 161.70 49161. . . . . 116.60 49162. . . . . 218.90 49163. . . . . 196.90 49164. . . . . 200.20 49165. . . . . 174.90 49166. . . . . 126.50 49167. . . . . 184.80 49168. . . . . 156.20 49169. . . . . 207.90 49170. . . . . 196.90 49171. . . . . 216.70 49172. . . . . 214.50 49175. . . . . 265.10 49177. . . . . 104.50 49181. . . . . 158.40 49182. . . . . 148.50 49188. . . . . 220.00 49190. . . . . 114.40 49192. . . . . 149.60 49193. . . . . 232.10 49195. . . . . 178.20 49196. . . . . 213.40 49198. . . . . 268.40 49200. . . . . 139.70 49207. . . . . 171.60 49215. . . . . 214.50 49216. . . . . 193.60 49220. . . . . 218.90 49221. . . . . 210.10 49222. . . . . 202.40 49223. . . . . 119.90 49226. . . . . 169.40 49227. . . . . 200.20 49228. . . . . 163.90 49231. . . . . 114.40 49232. . . . . 201.30 49236. . . . . 190.30 49238. . . . . 168.30 49239. . . . . 167.20 Part Number Price ($US) 49240. . . . . 141.90 49245. . . . . 224.40 49247. . . . . 188.10 49251. . . . . 295.90 49253. . . . . 308.00 49257. . . . . 205.70 49269. . . . . 169.40 49274. . . . . 140.80 49275. . . . . 195.80 49276. . . . . 200.20 49281. . . . . 104.50 49285. . . . . 125.40 49287. . . . . 121.00 49289. . . . . 226.60 49290. . . . . 199.10 49295. . . . . 160.60 49303. . . . . 185.90 49305. . . . . 236.50 49308. . . . . 134.20 49309. . . . . 212.30 49311. . . . . 129.80 49312. . . . . 128.70 49313. . . . . 140.80 49315. . . . . 105.60 49324. . . . . 504.90 49328. . . . . 233.20 49332. . . . . 170.50 49334. . . . . 227.70 49335. . . . . 240.90 49344. . . . . 111.10 49350. . . . . 190.30 49352. . . . . 191.40 49354. . . . . 119.90 49356. . . . . 132.00 49357. . . . . 189.20 49360. . . . . 113.30 49361. . . . . 118.80 49366. . . . . 118.80 49368. . . . . 121.00 49373. . . . . 137.50 49374. . . . . 163.90 49375. . . . . 114.40 49381. . . . . 119.90 49382. . . . . 179.30 49385. . . . . 215.60 49387. . . . . 116.60 49393. . . . . 167.20 49399. . . . . 150.70 49405. . . . . 121.00 49419. . . . . 166.10 49420. . . . . 117.70 49425. . . . . 145.20 49428. . . . . 133.10 49435. . . . . 123.20 49449. . . . . 185.90 49452. . . . . 173.80 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 49454. . . . . 114.40 49456. . . . . 213.40 49463. . . . . 149.60 49471. . . . . 376.20 49472. . . . . 376.20 49474. . . . . 180.40 49489. . . . . 178.20 49505. . . . . 179.30 49507. . . . . 217.80 49508. . . . . 231.00 49514. . . . . 179.30 49517. . . . . 129.80 49525. . . . . 193.60 49526. . . . . 170.50 49535. . . . . 190.30 49536. . . . . 207.90 49539. . . . . 188.10 49540. . . . . 188.10 49544. . . . . 213.40 60100. . . . . . 97.90 60101. . . . . . 91.30 60102. . . . . . 91.30 60103. . . . . . 77.00 60104. . . . . 191.40 60105. . . . . 152.90 60106. . . . . 156.20 60107. . . . . 138.60 60108. . . . . 224.40 60109. . . . . . 71.50 60110. . . . . . 81.40 60111. . . . . . 97.90 60112. . . . . . 74.80 60113. . . . . . 73.70 60114. . . . . . 78.10 60115. . . . . 154.00 60116. . . . . 187.00 60117. . . . . 152.90 60118. . . . . . 73.70 60119. . . . . . 81.40 60120. . . . . 110.00 60121. . . . . 201.30 60122. . . . . 207.90 60123. . . . . 125.40 60124. . . . . . 70.40 60125. . . . . 170.50 60126. . . . . 162.80 60127. . . . . 151.80 60128. . . . . 179.30 60129. . . . . 247.50 60130. . . . . 247.50 60131. . . . . . 48.40 60132. . . . . 121.00 60133. . . . . 192.50 60134. . . . . . 88.00 60135. . . . . 135.30 60136. . . . . . 90.20 Part Number Price ($US) 60137. . . . . . 97.90 60138. . . . . 102.30 60139. . . . . 101.20 60140. . . . . . 83.60 60141. . . . . . 69.30 60142. . . . . . 72.60 60143. . . . . 168.30 60144. . . . . 108.90 60145. . . . . . 58.30 60146. . . . . 134.20 60147. . . . . 139.70 60148. . . . . . 70.40 60149. . . . . 132.00 60150. . . . . . 77.00 60151. . . . . 102.30 60152. . . . . 100.10 60153. . . . . 151.80 60154. . . . . 193.60 60155. . . . . 193.60 60156. . . . . 289.30 60157. . . . . 294.80 60158. . . . . 116.60 60160. . . . . 169.40 60161. . . . . 178.20 60162. . . . . 214.50 60163. . . . . 147.40 60164. . . . . 236.50 60165. . . . . 249.70 60166. . . . . 168.30 60167. . . . . 162.80 60168. . . . . 265.10 60169. . . . . 213.40 60170. . . . . 212.30 60171. . . . . 106.70 60172. . . . . 569.80 60173. . . . . 212.30 60174. . . . . 216.70 60175. . . . . 217.80 60176. . . . . 440.00 60177. . . . . . 86.90 60178. . . . . 182.60 60179. . . . . 213.40 60180. . . . . 218.90 60181. . . . . 220.00 60182. . . . . 172.70 60183. . . . . 215.60 60184. . . . . 155.10 60185. . . . . 170.50 60186. . . . . 108.90 60187. . . . . . 78.10 60188. . . . . . 81.40 60189. . . . . 115.50 60191. . . . . 251.90 60193. . . . . 105.60 60194. . . . . 155.10 60195. . . . . 113.30 Part Number Price ($US) 60196. . . . . . 99.00 60197. . . . . 108.90 60198. . . . . 111.10 60199. . . . . 294.80 60200. . . . . . 83.60 60201. . . . . . 96.80 60202. . . . . 174.90 60203. . . . . 154.00 60204. . . . . . 71.50 60205. . . . . . 94.60 60206. . . . . . 80.30 60207. . . . . . 79.20 60209. . . . . 206.80 60210. . . . . . 61.60 60211. . . . . 176.00 60212. . . . . 129.80 60214. . . . . 100.10 60215. . . . . . 69.30 60216. . . . . 111.10 60218. . . . . . 59.40 60219. . . . . 187.00 60220. . . . . 101.20 60221. . . . . . 61.60 60222. . . . . 104.50 60224. . . . . 121.00 60225. . . . . 172.70 60226. . . . . 105.60 60227. . . . . 204.60 60228. . . . . 195.80 60230. . . . . . 79.20 60231. . . . . 132.00 60233. . . . . 192.50 60234. . . . . 191.40 60236. . . . . 227.70 60237. . . . . . 97.90 60238. . . . . 215.60 60239. . . . . 192.50 60240. . . . . 221.10 60241. . . . . 247.50 60242. . . . . . 80.30 60247. . . . . 146.30 60248. . . . . 121.00 60249. . . . . 217.80 60250. . . . . . 82.50 60251. . . . . . 66.00 60252. . . . . 113.30 60253. . . . . 104.50 60254. . . . . 132.00 60256. . . . . 123.20 60257. . . . . 110.00 60258. . . . . 116.60 60259. . . . . 262.90 60264. . . . . 122.10 60265. . . . . . 78.10 60266. . . . . . 82.50 60270. . . . . 155.10 Part Number Price ($US) 60271. . . . . 212.30 60272. . . . . 262.90 60273. . . . . . 75.90 60274. . . . . . 97.90 60275. . . . . 579.70 60276. . . . . . 79.20 60280. . . . . 107.80 60282. . . . . 174.90 60284. . . . . 133.10 60285. . . . . . 97.90 60286. . . . . . 86.90 60287. . . . . 167.20 60292. . . . . 180.40 60294. . . . . 124.30 60295. . . . . 126.50 60296. . . . . 130.90 60297. . . . . 123.20 60298. . . . . 111.10 60299. . . . . 136.40 60300. . . . . 195.80 60301. . . . . 232.10 60305. . . . . 215.60 60307. . . . . 134.20 60308. . . . . 134.20 60309. . . . . 134.20 60313. . . . . 155.10 60315. . . . . 114.40 60317. . . . . 191.40 60318. . . . . . 92.40 60319. . . . . . 97.90 60320. . . . . . 97.90 60322. . . . . 451.00 60323. . . . . 192.50 60327. . . . . 133.10 60328. . . . . . 85.80 60329. . . . . . 85.80 60331. . . . . 106.70 60332. . . . . . 62.70 60335. . . . . 451.00 60336. . . . . 189.20 63100. . . . . 179.30 63101. . . . . 172.70 63102. . . . . 132.00 63103. . . . . 132.00 63104. . . . . 225.50 63105. . . . . 209.00 63106. . . . . 243.10 63107. . . . . 205.70 63108. . . . . 271.70 63109. . . . . 135.30 63110. . . . . 141.90 63111. . . . . 127.60 63112. . . . . 134.20 63113. . . . . 126.50 63114. . . . . 135.30 63115. . . . . 213.40 Part Number Price ($US) 63116. . . . . 266.20 63117. . . . . 207.90 63118. . . . . 132.00 63119. . . . . 138.60 63120. . . . . 167.20 63121. . . . . 262.90 63122. . . . . 275.00 63123. . . . . 168.30 63124. . . . . 107.80 63125. . . . . 223.30 63126. . . . . 210.10 63127. . . . . 194.70 63128. . . . . 220.00 63129. . . . . 312.40 63130. . . . . 311.30 63131. . . . . . 69.30 63132. . . . . 205.70 63133. . . . . 316.80 63134. . . . . 147.40 63135. . . . . 190.30 63136. . . . . 119.90 63137. . . . . 144.10 63138. . . . . 166.10 63139. . . . . 149.60 63140. . . . . 121.00 63141. . . . . 119.90 63142. . . . . 122.10 63143. . . . . 228.80 63144. . . . . 137.50 63145. . . . . . 82.50 63146. . . . . 183.70 63147. . . . . 192.50 63148. . . . . 113.30 63149. . . . . 145.20 63150. . . . . 130.90 63151. . . . . 152.90 63152. . . . . 146.30 63153. . . . . 199.10 63154. . . . . 245.30 63155. . . . . 245.30 63156. . . . . 382.80 63157. . . . . 390.50 63158. . . . . 203.50 63160. . . . . 217.80 63161. . . . . 341.00 63162. . . . . 265.10 63163. . . . . 199.10 63164. . . . . 272.80 63165. . . . . 325.60 63166. . . . . 277.20 63167. . . . . 266.20 63168. . . . . 446.60 63169. . . . . 299.20 63170. . . . . 300.30 63171. . . . . 128.70 63172. . . . . 689.70 37 Part Number Price ($US) 63173. . . . . 320.10 63174. . . . . 311.30 63175. . . . . 314.60 63176. . . . . 628.10 63177. . . . . 150.70 63178. . . . . 282.70 63179. . . . . 308.00 63180. . . . . 283.80 63181. . . . . 286.00 63182. . . . . 333.30 63183. . . . . 280.50 63184. . . . . 215.60 63185. . . . . 251.90 63186. . . . . 150.70 63187. . . . . 139.70 63188. . . . . 144.10 63189. . . . . 149.60 63191. . . . . 306.90 63193. . . . . 149.60 63194. . . . . 205.70 63195. . . . . 157.30 63196. . . . . 136.40 63197. . . . . 151.80 63198. . . . . 157.30 63199. . . . . 393.80 63200. . . . . 136.40 63201. . . . . 150.70 63202. . . . . 269.50 63203. . . . . 201.30 63204. . . . . 119.90 63205. . . . . 149.60 63206. . . . . 134.20 63207. . . . . 134.20 63208. . . . . 104.50 63209. . . . . 297.00 63210. . . . . . 94.60 63211. . . . . 231.00 63212. . . . . 205.70 63214. . . . . 146.30 63215. . . . . 122.10 63216. . . . . 158.40 63217. . . . . 114.40 63218. . . . . . 85.80 63219. . . . . 262.90 63220. . . . . 125.40 63221. . . . . . 94.60 63222. . . . . 154.00 63224. . . . . 176.00 63225. . . . . 224.40 63226. . . . . 168.30 63227. . . . . 236.50 63228. . . . . 227.70 63230. . . . . 114.40 63231. . . . . 177.10 63233. . . . . 218.90 63234. . . . . 231.00 Part Number Price ($US) 63236. . . . . 320.10 63237. . . . . 107.80 63238. . . . . 261.80 63239. . . . . 272.80 63240. . . . . 267.30 63241. . . . . 312.40 63242. . . . . 137.50 63247. . . . . 191.40 63248. . . . . 176.00 63249. . . . . 288.20 63250. . . . . 139.70 63251. . . . . . 93.50 63252. . . . . 157.30 63253. . . . . 154.00 63254. . . . . 177.10 63255. . . . . 250.80 63256. . . . . 162.80 63257. . . . . 156.20 63258. . . . . 165.00 63259. . . . . 359.70 63264. . . . . 155.10 63265. . . . . 133.10 63266. . . . . 135.30 63270. . . . . 205.70 63271. . . . . 300.30 63272. . . . . 359.70 63273. . . . . 137.50 63275. . . . . 701.80 63276. . . . . 133.10 63282. . . . . 198.00 63284. . . . . 166.10 63285. . . . . 129.80 63286. . . . . 128.70 63292. . . . . 237.60 63294. . . . . 151.80 63295. . . . . 155.10 63296. . . . . 159.50 63297. . . . . 162.80 63298. . . . . 160.60 63299. . . . . 166.10 63300. . . . . 227.70 63301. . . . . 287.10 63305. . . . . 261.80 63307. . . . . 159.50 63308. . . . . 159.50 63309. . . . . 159.50 63313. . . . . 177.10 63315. . . . . 150.70 63318. . . . . 126.50 63319. . . . . 165.00 63320. . . . . 165.00 63322. . . . . 649.00 63323. . . . . 218.90 63327. . . . . 163.90 63328. . . . . 158.40 63329. . . . . 158.40 Part Number Price ($US) 63331. . . . . 130.90 63332. . . . . 105.60 63335. . . . . 649.00 63336. . . . . 257.40 65100. . . . . 170.50 65101. . . . . 163.90 65102. . . . . 126.50 65103. . . . . 125.40 65104. . . . . 214.50 65105. . . . . 199.10 65106. . . . . 232.10 65107. . . . . 195.80 65108. . . . . 258.50 65109. . . . . 129.80 65110. . . . . 135.30 65111. . . . . 121.00 65112. . . . . 127.60 65113. . . . . 119.90 65114. . . . . 128.70 65115. . . . . 203.50 65116. . . . . 254.10 65117. . . . . 198.00 65118. . . . . 125.40 65119. . . . . 132.00 65120. . . . . 159.50 65121. . . . . 249.70 65122. . . . . 261.80 65123. . . . . 160.60 65124. . . . . 102.30 65125. . . . . 212.30 65126. . . . . 200.20 65127. . . . . 185.90 65128. . . . . 228.80 65129. . . . . 297.00 65130. . . . . 295.90 65131. . . . . . 66.00 65132. . . . . 195.80 65133. . . . . 301.40 65134. . . . . 140.80 65135. . . . . 180.40 65136. . . . . 113.30 65137. . . . . 136.40 65138. . . . . 158.40 65139. . . . . 143.00 65140. . . . . 115.50 65141. . . . . 114.40 65142. . . . . 116.60 65143. . . . . 217.80 65144. . . . . 130.90 65145. . . . . . 79.20 65146. . . . . 174.90 65147. . . . . 183.70 65148. . . . . 107.80 65149. . . . . 138.60 65150. . . . . 124.30 65151. . . . . 145.20 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 65152. . . . . 138.60 65153. . . . . 189.20 65154. . . . . 233.20 65155. . . . . 233.20 65156. . . . . 365.20 65157. . . . . 371.80 65158. . . . . 193.60 65160. . . . . 207.90 65161. . . . . 324.50 65162. . . . . 253.00 65163. . . . . 190.30 65164. . . . . 259.60 65165. . . . . 310.20 65166. . . . . 264.00 65167. . . . . 254.10 65168. . . . . 425.70 65169. . . . . 284.90 65170. . . . . 286.00 65171. . . . . 122.10 65172. . . . . 656.70 65173. . . . . 304.70 65174. . . . . 297.00 65175. . . . . 299.20 65176. . . . . 598.40 65177. . . . . 144.10 65178. . . . . 269.50 65179. . . . . 293.70 65180. . . . . 270.60 65181. . . . . 272.80 65182. . . . . 317.90 65183. . . . . 267.30 65184. . . . . 204.60 65185. . . . . 239.80 65186. . . . . 144.10 65187. . . . . 133.10 65188. . . . . 137.50 65189. . . . . 149.60 65191. . . . . 291.50 65193. . . . . 141.90 65194. . . . . 195.80 65195. . . . . 150.70 65196. . . . . 129.80 65197. . . . . 144.10 65198. . . . . 149.60 65199. . . . . 375.10 65200. . . . . 129.80 65201. . . . . 144.10 65202. . . . . 257.40 65203. . . . . 191.40 65204. . . . . 114.40 65205. . . . . 141.90 65206. . . . . 128.70 65207. . . . . 128.70 65208. . . . . . 99.00 65209. . . . . 282.70 65210. . . . . . 90.20 Part Number Price ($US) 65211. . . . . 220.00 65212. . . . . 195.80 65214. . . . . 138.60 65215. . . . . 115.50 65216. . . . . 150.70 65217. . . . . 108.90 65218. . . . . . 81.40 65219. . . . . 249.70 65220. . . . . 118.80 65221. . . . . . 90.20 65222. . . . . 146.30 65223. . . . . 403.70 65224. . . . . 168.30 65225. . . . . 214.50 65226. . . . . 160.60 65227. . . . . 224.40 65228. . . . . 216.70 65229. . . . . 258.50 65230. . . . . 107.80 65231. . . . . 168.30 65233. . . . . 209.00 65234. . . . . 224.40 65236. . . . . 304.70 65237. . . . . 102.30 65238. . . . . 248.60 65239. . . . . 259.60 65240. . . . . 255.20 65241. . . . . 297.00 65242. . . . . 130.90 65245. . . . . 213.40 65246. . . . . 168.30 65247. . . . . 182.60 65248. . . . . 168.30 65249. . . . . 273.90 65250. . . . . 133.10 65251. . . . . . 89.10 65252. . . . . 150.70 65253. . . . . 146.30 65254. . . . . 168.30 65255. . . . . 236.50 65256. . . . . 155.10 65257. . . . . 148.50 65258. . . . . 156.20 65259. . . . . 342.10 65262. . . . . 261.80 65264. . . . . 147.40 65265. . . . . 127.60 65266. . . . . 135.30 65268. . . . . 254.10 65270. . . . . 195.80 65271. . . . . 286.00 65272. . . . . 342.10 65273. . . . . 130.90 65274. . . . . . 92.40 65275. . . . . 668.80 65276. . . . . 127.60 Part Number Price ($US) 65279. . . . . 243.10 65280. . . . . 124.30 65282. . . . . 188.10 65284. . . . . 157.30 65285. . . . . 122.10 65286. . . . . 122.10 65287. . . . . 196.90 65291. . . . . . 58.03 65292. . . . . 225.50 65294. . . . . 144.10 65295. . . . . 147.40 65296. . . . . 151.80 65297. . . . . 155.10 65298. . . . . 150.70 65299. . . . . 157.30 65300. . . . . 216.70 65301. . . . . 271.70 65302. . . . . . 82.50 65303. . . . . . 81.40 65304. . . . . . 59.40 65305. . . . . 248.60 65306. . . . . 137.50 65307. . . . . 151.80 65308. . . . . 151.80 65309. . . . . 151.80 65310. . . . . . 67.10 65312. . . . . 159.74 65313. . . . . 168.30 65314. . . . . . 66.28 65315. . . . . 140.80 65316. . . . . 299.20 65317. . . . . 224.40 65318. . . . . 119.90 65319. . . . . 156.20 65320. . . . . 156.20 65321. . . . . 138.60 65322. . . . . 617.10 65323. . . . . 209.00 65327. . . . . 155.10 65328. . . . . 150.70 65329. . . . . 150.70 65331. . . . . 119.90 65332. . . . . 100.10 65335. . . . . 617.10 65336. . . . . 245.30 65338. . . . . 152.04 65339. . . . . 152.04 66100. . . . . 226.60 66108. . . . . 314.60 66121. . . . . 313.50 66128. . . . . 265.10 66138. . . . . 223.30 66164. . . . . 367.40 66165. . . . . 304.70 66176. . . . . 755.70 66187. . . . . 171.60 Part Number Price ($US) 66203. . . . . 243.10 66204. . . . . 157.30 66216. . . . . 201.30 66217. . . . . 147.40 66218. . . . . 125.40 66220. . . . . 174.90 66233. . . . . 303.60 66238. . . . . 328.90 66240. . . . . 311.30 66284. . . . . 206.80 66301. . . . . 343.20 66305. . . . . 328.90 66315. . . . . 189.20 66322. . . . . 787.60 67101. . . . . . 83.60 67102. . . . . . 88.00 67103. . . . . . 70.40 67104. . . . . 199.10 67105. . . . . 147.40 67106. . . . . 149.60 67108. . . . . 218.90 67109. . . . . . 67.10 67110. . . . . . 74.80 67111. . . . . . 95.70 67112. . . . . . 69.30 67113. . . . . . 68.20 67114. . . . . . 72.60 67115. . . . . 148.50 67116. . . . . 183.70 67117. . . . . 147.40 67118. . . . . . 69.30 67119. . . . . . 77.00 67121. . . . . 192.50 67122. . . . . 202.40 67123. . . . . 121.00 67124. . . . . . 68.20 67125. . . . . 167.20 67126. . . . . 160.60 67127. . . . . 148.50 67128. . . . . 177.10 67129. . . . . 243.10 67130. . . . . 243.10 67131. . . . . . 47.30 67132. . . . . 119.90 67133. . . . . 190.30 67134. . . . . . 84.70 67135. . . . . 132.00 67136. . . . . . 89.10 67140. . . . . . 82.50 67142. . . . . . 69.30 67143. . . . . 163.90 67144. . . . . 106.70 67145. . . . . . 57.20 67146. . . . . 130.90 67147. . . . . 136.40 67148. . . . . . 68.20 Part Number Price ($US) 67149. . . . . 129.80 67150. . . . . . 73.70 67151. . . . . 100.10 67152. . . . . . 96.80 67153. . . . . 148.50 67154. . . . . 191.40 67155. . . . . 191.40 67156. . . . . 286.00 67157. . . . . 291.50 67158. . . . . 113.30 67160. . . . . 163.90 67161. . . . . 173.80 67162. . . . . 209.00 67163. . . . . 141.90 67164. . . . . 233.20 67165. . . . . 242.00 67166. . . . . 160.60 67167. . . . . 156.20 67168. . . . . 251.90 67169. . . . . 207.90 67171. . . . . 105.60 67172. . . . . 559.90 67173. . . . . 207.90 67174. . . . . 212.30 67175. . . . . 213.40 67176. . . . . 429.00 67177. . . . . . 82.50 67178. . . . . 177.10 67179. . . . . 207.90 67180. . . . . 216.70 67181. . . . . 216.70 67182. . . . . 168.30 67183. . . . . 211.20 67184. . . . . 150.70 67185. . . . . 169.40 67186. . . . . 104.50 67187. . . . . . 70.40 67188. . . . . . 72.60 67189. . . . . 113.30 67191. . . . . 248.60 67199. . . . . 290.40 67202. . . . . 170.50 67203. . . . . 149.60 67205. . . . . . 88.00 67206. . . . . . 77.00 67207. . . . . . 77.00 67209. . . . . 203.50 67210. . . . . . 57.20 67211. . . . . 163.90 67212. . . . . 124.30 67213. . . . . . 89.10 67214. . . . . . 96.80 67215. . . . . . 66.00 67216. . . . . 108.90 67218. . . . . . 58.30 67219. . . . . 173.80 38 Part Number Price ($US) 67220. . . . . . 99.00 67221. . . . . . 58.30 67225. . . . . 167.20 67226. . . . . . 99.00 67227. . . . . 203.50 67228. . . . . 194.70 67230. . . . . . 75.90 67233. . . . . 185.90 67234. . . . . 184.80 67236. . . . . 218.90 67237. . . . . . 96.80 67238. . . . . 209.00 67239. . . . . 188.10 67240. . . . . 216.70 67241. . . . . 243.10 67242. . . . . . 79.20 67249. . . . . 214.50 67250. . . . . . 78.10 67251. . . . . . 62.70 67259. . . . . 254.10 67260. . . . . 269.50 67261. . . . . 147.40 67264. . . . . 119.90 67265. . . . . . 74.80 67266. . . . . . 74.80 67268. . . . . . 83.60 67272. . . . . 254.10 67273. . . . . . 72.60 67274. . . . . . 73.70 67275. . . . . 569.80 67276. . . . . . 74.80 67277. . . . . . 81.40 67278. . . . . . 85.80 67280. . . . . 106.70 67281. . . . . 100.10 67282. . . . . 170.50 67284. . . . . 130.90 67285. . . . . . 95.70 67286. . . . . . 85.80 67290. . . . . 111.10 67292. . . . . 177.10 67294. . . . . 121.00 67295. . . . . 123.20 67296. . . . . 128.70 67298. . . . . 108.90 67299. . . . . 133.10 67300. . . . . 194.70 67301. . . . . 226.60 67305. . . . . 209.00 67307. . . . . 130.90 67308. . . . . 130.90 67309. . . . . 130.90 67313. . . . . 150.70 67315. . . . . 111.10 67317. . . . . 184.80 67318. . . . . . 89.10 Part Number Price ($US) 67319. . . . . . 92.40 67320. . . . . . 92.40 67322. . . . . 438.90 67323. . . . . 185.90 67327. . . . . 129.80 67328. . . . . . 82.50 67329. . . . . . 82.50 67331. . . . . 103.40 67332. . . . . . 61.60 67333. . . . . 169.40 67334. . . . . . 81.40 67335. . . . . 438.90 67336. . . . . 184.80 67337. . . . . . 63.64 69100. . . . . 215.60 69102. . . . . 173.80 69108. . . . . 300.30 69120. . . . . 213.40 69121. . . . . 298.10 69123. . . . . 211.20 69128. . . . . 253.00 69131. . . . . . 91.30 69138. . . . . 212.30 69149. . . . . 188.10 69152. . . . . 177.10 69153. . . . . 253.00 69164. . . . . 328.90 69165. . . . . 349.80 69176. . . . . 720.50 69178. . . . . 314.60 69187. . . . . 163.90 69189. . . . . 181.50 69194. . . . . 228.80 69195. . . . . 233.20 69196. . . . . 188.10 69197. . . . . 199.10 69203. . . . . 232.10 69204. . . . . 149.60 69207. . . . . 177.10 69211. . . . . 304.70 69214. . . . . 173.80 69216. . . . . 191.40 69217. . . . . 140.80 69218. . . . . 119.90 69220. . . . . 166.10 69222. . . . . 202.40 69224. . . . . 218.90 69231. . . . . 215.60 69233. . . . . 288.20 69238. . . . . 313.50 69239. . . . . 331.10 69240. . . . . 297.00 69242. . . . . 181.50 69245. . . . . 259.60 69247. . . . . 245.30 69248. . . . . 218.90 Part Number Price ($US) 69252. . . . . 233.20 69253. . . . . 202.40 69256. . . . . 213.40 69257. . . . . 204.60 69258. . . . . 216.70 69265. . . . . 185.90 69270. . . . . 228.80 69273. . . . . 185.90 69284. . . . . 194.70 69291. . . . . . 93.50 69294. . . . . 190.30 69297. . . . . 213.40 69298. . . . . 210.10 69299. . . . . 183.70 69301. . . . . 326.70 69302. . . . . 123.20 69303. . . . . 126.50 69304. . . . . 100.10 69305. . . . . 313.50 69310. . . . . 107.80 69315. . . . . 178.20 69322. . . . . 749.10 69331. . . . . 151.80 69335. . . . . 749.10 69336. . . . . 297.00 80100. . . . . . 96.80 80101. . . . . 220.00 80102. . . . . 103.40 80103. . . . . . 97.90 80104. . . . . 101.20 80105. . . . . . 94.60 80106. . . . . 108.90 80107. . . . . . 88.00 80108. . . . . 110.00 80109. . . . . 103.40 80110. . . . . 110.00 80111. . . . . . 84.70 80112. . . . . . 99.00 80113. . . . . 105.60 80114. . . . . 104.50 80115. . . . . 111.10 80116. . . . . 102.30 80117. . . . . 104.50 80118. . . . . . 84.70 80119. . . . . . 99.00 80120. . . . . . 89.10 80121. . . . . 101.20 80123. . . . . . 85.80 80124. . . . . . 78.10 80125. . . . . 105.60 80126. . . . . 102.30 80127. . . . . 106.70 80128. . . . . 118.80 80129. . . . . 101.20 80130. . . . . . 92.40 80131. . . . . . 88.00 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 80132. . . . . . 92.40 80133. . . . . . 92.40 80134. . . . . . 94.60 80135. . . . . 111.10 80136. . . . . . 86.90 80137. . . . . . 92.40 80138. . . . . . 88.00 80139. . . . . . 90.20 80140. . . . . . 80.30 80141. . . . . . 90.20 80142. . . . . 141.90 80143. . . . . 100.10 80144. . . . . 103.40 80145. . . . . . 96.80 80146. . . . . 119.90 80147. . . . . 118.80 80148. . . . . 104.50 80149. . . . . 169.40 80150. . . . . 105.60 80151. . . . . 110.00 80152. . . . . . 73.70 80153. . . . . . 95.70 80154. . . . . 133.10 80155. . . . . 119.90 80156. . . . . 133.10 80157. . . . . 132.00 80158. . . . . 125.40 80159. . . . . 106.70 80160. . . . . 171.60 80161. . . . . 194.70 80162. . . . . 181.50 80163. . . . . 100.10 80164. . . . . 187.00 80165. . . . . 100.10 80166. . . . . . 92.40 80167. . . . . . 97.90 80168. . . . . . 91.30 80169. . . . . 112.20 80170. . . . . 113.30 80171. . . . . 106.70 80172. . . . . 200.20 80173. . . . . 145.20 80174. . . . . 235.40 80175. . . . . 232.10 80176. . . . . 113.30 80177. . . . . 143.00 80181. . . . . 114.40 80182. . . . . . 62.70 80186. . . . . 108.90 80187. . . . . 198.00 80188. . . . . 198.00 80189. . . . . 200.20 80190. . . . . 128.70 80191. . . . . 128.70 80192. . . . . 128.70 80193. . . . . 128.70 Part Number Price ($US) 80194. . . . . 176.00 80195. . . . . . 84.70 80196. . . . . 128.70 80197. . . . . 196.90 80198. . . . . 234.30 80199. . . . . 236.50 80200. . . . . . 88.00 80201. . . . . . 90.20 80202. . . . . 232.10 80203. . . . . 101.20 80204. . . . . 150.70 80205. . . . . 158.40 80206. . . . . 245.30 80207. . . . . 408.10 80209. . . . . 259.60 80210. . . . . 258.50 80211. . . . . 284.90 80212. . . . . 305.80 80213. . . . . 103.40 80214. . . . . 204.60 80215. . . . . 202.40 80216. . . . . 212.30 80217. . . . . 310.20 80218. . . . . 310.20 80219. . . . . 124.30 80220. . . . . 187.00 80221. . . . . 402.60 80222. . . . . 389.40 80223. . . . . 113.30 80224. . . . . 122.10 80225. . . . . 389.40 80226. . . . . 112.20 80227. . . . . 167.20 80228. . . . . 112.20 80229. . . . . 132.00 80230. . . . . 158.40 80231. . . . . 162.80 80232. . . . . 167.20 80236. . . . . 166.10 80237. . . . . 258.50 80238. . . . . 273.90 80240. . . . . 209.00 80241. . . . . 139.70 80242. . . . . 145.20 80243. . . . . . 97.90 80244. . . . . 198.00 80250. . . . . 181.50 80259. . . . . 138.60 80260. . . . . 103.40 80261. . . . . 204.60 80262. . . . . 159.50 80265. . . . . 130.90 80269. . . . . 224.40 80270. . . . . 158.40 80272. . . . . 239.80 80275. . . . . 205.70 Part Number Price ($US) 80276. . . . . 147.40 80277. . . . . . 82.50 80281. . . . . . 97.90 80282. . . . . 149.60 80283. . . . . 101.20 80285. . . . . 128.70 80286. . . . . 224.40 80290. . . . . 239.80 80291. . . . . 148.50 80295. . . . . 129.80 80296. . . . . . 91.30 80298. . . . . 171.60 80302. . . . . 209.00 80306. . . . . 107.80 80307. . . . . 124.30 80308. . . . . 328.90 80309. . . . . . 99.00 80311. . . . . 138.60 80374. . . . . 205.70 83100. . . . . 173.80 83101. . . . . 314.60 83102. . . . . 178.20 83103. . . . . 162.80 83104. . . . . 173.80 83105. . . . . 159.50 83106. . . . . 196.90 83107. . . . . 152.90 83108. . . . . 200.20 83109. . . . . 198.00 83110. . . . . 180.40 83111. . . . . 158.40 83112. . . . . 192.50 83113. . . . . 203.50 83114. . . . . 206.80 83115. . . . . 217.80 83116. . . . . 205.70 83117. . . . . 192.50 83118. . . . . 157.30 83119. . . . . 178.20 83121. . . . . 192.50 83123. . . . . 158.40 83125. . . . . 196.90 83126. . . . . 190.30 83127. . . . . 196.90 83128. . . . . 173.80 83129. . . . . 190.30 83130. . . . . 172.70 83131. . . . . 150.70 83132. . . . . 163.90 83133. . . . . 166.10 83134. . . . . 170.50 83135. . . . . 203.50 83136. . . . . 150.70 83137. . . . . 163.90 83138. . . . . 155.10 83139. . . . . 159.50 Part Number Price ($US) 83140. . . . . 150.70 83141. . . . . 188.10 83142. . . . . 174.90 83143. . . . . 184.80 83144. . . . . 185.90 83145. . . . . 191.40 83146. . . . . 200.20 83147. . . . . 209.00 83148. . . . . 200.20 83149. . . . . 193.60 83150. . . . . 193.60 83151. . . . . 205.70 83152. . . . . 118.80 83153. . . . . 161.70 83154. . . . . 193.60 83155. . . . . 193.60 83156. . . . . 262.90 83157. . . . . 262.90 83158. . . . . 256.30 83159. . . . . 188.10 83160. . . . . 198.00 83161. . . . . 265.10 83162. . . . . 233.20 83163. . . . . 171.60 83164. . . . . 262.90 83165. . . . . 177.10 83166. . . . . 156.20 83167. . . . . 166.10 83168. . . . . 148.50 83169. . . . . 176.00 83170. . . . . 176.00 83171. . . . . 173.80 83172. . . . . 260.70 83173. . . . . 243.10 83174. . . . . 311.30 83175. . . . . 305.80 83176. . . . . 187.00 83177. . . . . 195.80 83181. . . . . 206.80 83182. . . . . . 90.20 83186. . . . . 172.70 83187. . . . . 267.30 83188. . . . . 265.10 83189. . . . . 269.50 83190. . . . . 176.00 83191. . . . . 176.00 83192. . . . . 176.00 83193. . . . . 176.00 83194. . . . . 258.50 83195. . . . . 147.40 83196. . . . . 176.00 83197. . . . . 268.40 83198. . . . . 316.80 83199. . . . . 331.10 83200. . . . . 145.20 83201. . . . . 149.60 Part Number Price ($US) 83202. . . . . 283.80 83203. . . . . 158.40 83204. . . . . 217.80 83205. . . . . 218.90 83206. . . . . 304.70 83207. . . . . 535.70 83209. . . . . 386.10 83210. . . . . 382.80 83211. . . . . 413.60 83212. . . . . 437.80 83213. . . . . 191.40 83214. . . . . 261.80 83215. . . . . 258.50 83216. . . . . 279.40 83217. . . . . 378.40 83218. . . . . 378.40 83219. . . . . 183.70 83220. . . . . 260.70 83221. . . . . 489.50 83222. . . . . 465.30 83223. . . . . 194.70 83224. . . . . 214.50 83225. . . . . 467.50 83226. . . . . 212.30 83227. . . . . 211.20 83228. . . . . 196.90 83229. . . . . 162.80 83230. . . . . 226.60 83231. . . . . 232.10 83232. . . . . 236.50 83236. . . . . 207.90 83237. . . . . 369.60 83238. . . . . 388.30 83239. . . . . 188.10 83240. . . . . 290.40 83241. . . . . 173.80 83242. . . . . 192.50 83243. . . . . 178.20 83244. . . . . 264.00 83246. . . . . 209.00 83248. . . . . 298.10 83249. . . . . . 15.40 83250. . . . . 325.60 83257. . . . . 242.00 83259. . . . . 179.30 83260. . . . . 190.30 83261. . . . . 261.80 83262. . . . . 240.90 83265. . . . . 222.20 83269. . . . . 282.70 83270. . . . . 226.60 83272. . . . . 262.90 83275. . . . . 357.50 83276. . . . . 185.90 83277. . . . . 138.60 83281. . . . . 165.00 39 Part Number Price ($US) 83282. . . . . 194.70 83283. . . . . 159.50 83285. . . . . 176.00 83286. . . . . 282.70 83290. . . . . 262.90 83291. . . . . 187.00 83295. . . . . 182.60 83296. . . . . 168.30 83298. . . . . 198.00 83302. . . . . 290.40 83307. . . . . 188.10 83308. . . . . 396.00 83309. . . . . 178.20 83311. . . . . 171.60 83374. . . . . 357.50 85100. . . . . 166.10 85101. . . . . 299.20 85102. . . . . 169.40 85103. . . . . 155.10 85104. . . . . 165.00 85105. . . . . 151.80 85106. . . . . 187.00 85107. . . . . 145.20 85108. . . . . 191.40 85109. . . . . 188.10 85110. . . . . 171.60 85111. . . . . 150.70 85112. . . . . 183.70 85113. . . . . 193.60 85114. . . . . 196.90 85115. . . . . 206.80 85116. . . . . 195.80 85117. . . . . 183.70 85118. . . . . 149.60 85119. . . . . 169.40 85121. . . . . 182.60 85123. . . . . 150.70 85125. . . . . 187.00 85126. . . . . 181.50 85127. . . . . 188.10 85128. . . . . 165.00 85129. . . . . 180.40 85130. . . . . 163.90 85131. . . . . 143.00 85132. . . . . 155.10 85133. . . . . 158.40 85134. . . . . 161.70 85135. . . . . 194.70 85136. . . . . 143.00 85137. . . . . 156.20 85138. . . . . 147.40 85139. . . . . 151.80 85140. . . . . 143.00 85141. . . . . 178.20 85142. . . . . 167.20 85143. . . . . 176.00 Part Number Price ($US) 85144. . . . . 177.10 85145. . . . . 182.60 85146. . . . . 191.40 85147. . . . . 199.10 85148. . . . . 190.30 85149. . . . . 184.80 85150. . . . . 184.80 85151. . . . . 195.80 85152. . . . . 113.30 85153. . . . . 154.00 85154. . . . . 184.80 85155. . . . . 184.80 85156. . . . . 250.80 85157. . . . . 250.80 85158. . . . . 244.20 85159. . . . . 179.30 85160. . . . . 189.20 85161. . . . . 253.00 85162. . . . . 222.20 85163. . . . . 163.90 85164. . . . . 249.70 85165. . . . . 169.40 85166. . . . . 148.50 85167. . . . . 157.30 85168. . . . . 140.80 85169. . . . . 167.20 85170. . . . . 168.30 85171. . . . . 166.10 85172. . . . . 246.40 85173. . . . . 231.00 85174. . . . . 295.90 85175. . . . . 290.40 85176. . . . . 178.20 85177. . . . . 187.00 85181. . . . . 196.90 85182. . . . . . 85.80 85186. . . . . 165.00 85187. . . . . 255.20 85188. . . . . 251.90 85189. . . . . 256.30 85190. . . . . 168.30 85191. . . . . 168.30 85192. . . . . 168.30 85193. . . . . 168.30 85194. . . . . 246.40 85195. . . . . 140.80 85196. . . . . 168.30 85197. . . . . 255.20 85198. . . . . 301.40 85199. . . . . 314.60 85200. . . . . 138.60 85201. . . . . 141.90 85202. . . . . 269.50 85203. . . . . 150.70 85204. . . . . 206.80 85205. . . . . 209.00 Part Number Price ($US) 85206. . . . . 289.30 85207. . . . . 510.40 85209. . . . . 367.40 85210. . . . . 364.10 85211. . . . . 393.80 85212. . . . . 416.90 85213. . . . . 182.60 85214. . . . . 249.70 85215. . . . . 246.40 85216. . . . . 266.20 85217. . . . . 360.80 85218. . . . . 360.80 85219. . . . . 174.90 85220. . . . . 248.60 85221. . . . . 466.40 85222. . . . . 443.30 85223. . . . . 185.90 85224. . . . . 204.60 85225. . . . . 444.40 85226. . . . . 202.40 85227. . . . . 200.20 85228. . . . . 188.10 85229. . . . . 155.10 85230. . . . . 215.60 85231. . . . . 221.10 85232. . . . . 224.40 85236. . . . . 198.00 85237. . . . . 352.00 85238. . . . . 369.60 85239. . . . . 178.20 85240. . . . . 276.10 85241. . . . . 159.50 85242. . . . . 181.50 85243. . . . . 169.40 85244. . . . . 251.90 85245. . . . . 110.00 85246. . . . . 199.10 85247. . . . . 202.40 85250. . . . . 310.20 85251. . . . . 179.30 85256. . . . . 132.00 85259. . . . . 170.50 85260. . . . . 181.50 85261. . . . . 249.70 85262. . . . . 228.80 85263. . . . . 190.30 85264. . . . . 173.80 85265. . . . . 212.30 85266. . . . . 173.80 85267. . . . . 171.60 85269. . . . . 268.40 85270. . . . . 215.60 85271. . . . . 177.10 85272. . . . . 249.70 85273. . . . . 137.50 85275. . . . . 339.90 Retail prices for ignition cable sets, dated November 1, 2014 For ordering instructions, please contact us. We do not have on-line ordering at this time. Address Magnecor 24581 Crestview Farmington Hills, MI 48335, USA Telephone (USA): Fax (USA): E-mail: WWW: 248-471-9505 248-471-9506 [email protected] www.magnecor.com - Prices are only valid for sales from the factory (USA), resale prices from dealers may be discounted; - Prices are in US dollars and are subject to change without notice; - This price list only lists prices for complete sets and some individual leads, if you do not see the price you need, please inquire; - Part numbers for sets sold by our dealers may be different. Magnecor factory part numbers in Australia and UK are different to USA; - Some sets have special fitting instructions or other important information that are not noted in the catalog; - If you need a custom specification wire set (even if you have moved or changed an ignition coil) please contact us, - For information about dealers, please contact us; Part umber Price ($US) 85276. . . . . 176.00 85277. . . . . 132.00 85278. . . . . 177.10 85279. . . . . 134.20 85281. . . . . 157.30 85282. . . . . 184.80 85283. . . . . 151.80 85285. . . . . 168.30 85286. . . . . 268.40 85290. . . . . 249.70 85291. . . . . 177.10 85295. . . . . 173.80 85296. . . . . 159.50 85297. . . . . 191.40 85298. . . . . 189.20 85302. . . . . 276.10 85304. . . . . 183.70 85306. . . . . 173.80 85307. . . . . 178.20 85308. . . . . 376.20 85309. . . . . 169.40 85311. . . . . 157.30 85312. . . . . 387.20 85315. . . . . 191.40 85374. . . . . 339.90 86128. . . . . 236.50 86129. . . . . 235.40 86131. . . . . 196.90 86132. . . . . 212.30 86133. . . . . 223.30 86134. . . . . 243.10 86136. . . . . 200.20 86137. . . . . 234.30 86138. . . . . 221.10 86139. . . . . 239.80 86149. . . . . 249.70 86154. . . . . 242.00 86156. . . . . 347.60 86157. . . . . 346.50 86161. . . . . 349.80 86177. . . . . 246.40 86188. . . . . 343.20 86219. . . . . 236.50 86224. . . . . 250.80 86239. . . . . 245.30 87101. . . . . 212.30 87104. . . . . . 93.50 87105. . . . . . 89.10 87107. . . . . . 81.40 87108. . . . . 102.30 87110. . . . . . 85.80 87111. . . . . . 78.10 87113. . . . . . 97.90 87115. . . . . 103.40 87116. . . . . . 94.60 87117. . . . . . 95.70 Part Number Price ($US) 87118. . . . . . 78.10 87119. . . . . . 90.20 87120. . . . . 137.50 87121. . . . . . 90.20 87122. . . . . 108.90 87123. . . . . . 79.20 87124. . . . . . 69.30 87127. . . . . . 97.90 87128. . . . . 114.40 87129. . . . . . 85.80 87130. . . . . . 77.00 87131. . . . . . 81.40 87132. . . . . . 85.80 87135. . . . . 102.30 87138. . . . . . 81.40 87140. . . . . . 72.60 87141. . . . . . 83.60 87142. . . . . 135.30 87143. . . . . . 91.30 87144. . . . . . 92.40 87145. . . . . . 86.90 87146. . . . . 112.20 87147. . . . . 111.10 87152. . . . . . 69.30 87153. . . . . . 89.10 87154. . . . . 130.90 87155. . . . . 112.20 87156. . . . . 121.00 87157. . . . . 121.00 87158. . . . . 114.40 87159. . . . . . 97.90 87160. . . . . 167.20 87161. . . . . 190.30 87162. . . . . 176.00 87163. . . . . . 92.40 87164. . . . . 179.30 87165. . . . . . 94.60 87166. . . . . . 88.00 87167. . . . . . 93.50 87168. . . . . . 88.00 87169. . . . . 107.80 87170. . . . . 107.80 87171. . . . . 102.30 87172. . . . . 196.90 87173. . . . . 137.50 87174. . . . . 231.00 87175. . . . . 228.80 87176. . . . . 106.70 87177. . . . . 100.10 87178. . . . . 182.60 87179. . . . . 364.10 87180. . . . . 345.40 87181. . . . . 110.00 87182. . . . . . 61.60 87183. . . . . 185.90 87184. . . . . 160.60 Part Number Price ($US) 87185. . . . . 431.20 87186. . . . . 102.30 87187. . . . . 193.60 87188. . . . . 193.60 87189. . . . . 195.80 87190. . . . . 123.20 87191. . . . . 123.20 87192. . . . . 123.20 87193. . . . . 123.20 87194. . . . . 170.50 87195. . . . . . 81.40 87196. . . . . 123.20 87197. . . . . 192.50 87198. . . . . 224.40 87199. . . . . 229.90 87200. . . . . . 85.80 87201. . . . . . 86.90 87202. . . . . 215.60 87203. . . . . . 96.80 87205. . . . . 155.10 87206. . . . . 242.00 87207. . . . . 402.60 87209. . . . . 248.60 87210. . . . . 247.50 87211. . . . . 273.90 87212. . . . . 294.80 87213. . . . . . 94.60 87214. . . . . 196.90 87215. . . . . 196.90 87216. . . . . 204.60 87217. . . . . 290.40 87218. . . . . 290.40 87219. . . . . 121.00 87223. . . . . 108.90 87224. . . . . 116.60 87227. . . . . 162.80 87229. . . . . 129.80 87233. . . . . 246.40 87234. . . . . 363.00 87235. . . . . 247.50 87236. . . . . 159.50 87237. . . . . 254.10 87238. . . . . 355.30 87240. . . . . 200.20 87241. . . . . 137.50 87242. . . . . 143.00 87243. . . . . . 94.60 87244. . . . . 191.40 87250. . . . . 172.70 87254. . . . . 557.70 87255. . . . . 477.40 87257. . . . . 193.60 87258. . . . . 246.40 87259. . . . . 136.40 87260. . . . . . 95.70 87261. . . . . 196.90 Part Number Price ($US) 87262. . . . . 151.80 87265. . . . . 122.10 87269. . . . . 216.70 87272. . . . . 235.40 87274. . . . . . 42.90 87275. . . . . 198.00 87276. . . . . 143.00 87277. . . . . . 74.80 87281. . . . . . 90.20 87282. . . . . 148.50 87283. . . . . . 96.80 87285. . . . . 123.20 87286. . . . . 216.70 87287. . . . . 177.10 87288. . . . . 226.05 87290. . . . . 235.40 87291. . . . . 145.20 87292. . . . . 232.10 87293. . . . . 162.80 87295. . . . . 127.60 87296. . . . . . 84.70 87298. . . . . 167.20 87302. . . . . 200.20 87305. . . . . 170.50 87307. . . . . 121.00 87308. . . . . 320.10 87309. . . . . . 92.40 87311. . . . . 135.30 87374. . . . . 198.00 89101. . . . . 371.80 89112. . . . . 236.50 89114. . . . . 234.30 89115. . . . . 261.80 89128. . . . . 224.40 89129. . . . . 223.30 89131. . . . . 188.10 89132. . . . . 202.40 89133. . . . . 213.40 89134. . . . . 231.00 89136. . . . . 190.30 89137. . . . . 223.30 89138. . . . . 210.10 89139. . . . . 227.70 89142. . . . . 229.90 89148. . . . . 244.20 89149. . . . . 237.60 89154. . . . . 231.00 89156. . . . . 331.10 89157. . . . . 330.00 89161. . . . . 333.30 89162. . . . . 315.70 89164. . . . . 324.50 89169. . . . . 236.50 89177. . . . . 234.30 89182. . . . . 118.80 89188. . . . . 326.70 Part Number Price ($US) 89189. . . . . 331.10 89190. . . . . 224.40 89196. . . . . 227.70 89205. . . . . 262.90 89214. . . . . 328.90 89215. . . . . 326.70 89216. . . . . 353.10 89217. . . . . 452.10 89218. . . . . 452.10 89219. . . . . 224.40 89220. . . . . 323.40 89223. . . . . 221.10 89224. . . . . 238.70 89228. . . . . 235.40 89229. . . . . 196.90 89230. . . . . 267.30 89231. . . . . 275.00 89239. . . . . 234.30 89240. . . . . 388.30 89241. . . . . 201.30 89242. . . . . 234.30 89244. . . . . 325.60 89246. . . . . 251.90 89251. . . . . 232.10 89252. . . . . 206.80 89259. . . . . 213.40 89261. . . . . 328.90 89270. . . . . 267.30 89276. . . . . 207.90 89279. . . . . 178.20 89283. . . . . 196.90 89285. . . . . 227.70 89295. . . . . 218.90 89302. . . . . 388.30 89306. . . . . 221.10 91040. . . . . . 20.90 91050. . . . . . 31.90 91051. . . . . . 31.90 91340. . . . . . 25.30 91350. . . . . . 38.50 91351. . . . . . 40.70 91540. . . . . . 23.10 91550. . . . . . 36.30 91551. . . . . . 37.40 91640. . . . . . 31.90 91650. . . . . . 44.00 91740. . . . . . 19.80 91750. . . . . . 30.80 91751. . . . . . 28.60 91940. . . . . . 29.70 91950. . . . . . 41.80 940515. . . 129.80 940522. . . 121.00 940523. . . 121.00 940527. . . 141.90 940532. . . 130.90 40 Part Number Price ($US) 940548. . . 115.50 943515. . . 151.80 943522. . . 151.80 943523. . . 151.80 943527. . . 156.20 943532. . . 151.80 943548. . . 143.00 945515. . . 144.10 945522. . . 144.10 945523. . . 144.10 945527. . . 148.50 945532. . . 144.10 945548. . . 135.30 947515. . . 127.60 947522. . . 117.70 947523. . . 117.70 947527. . . 139.70 947532. . . 128.70 947548. . . 111.10 960283. . . 196.90 960323. . . 192.50 960324. . . 155.10 960325. . . 104.50 960326. . . 105.60 960330. . . 105.60 963323. . . 218.90 963324. . . 205.70 963330. . . 143.00 965283. . . 237.60 965323. . . 209.00 965324. . . 195.80 965325. . . 132.00 965326. . . 118.80 965330. . . 135.30 966330. . . 167.20 967261. . . 147.40 967283. . . 194.70 967290. . . 111.10 967323. . . 185.90 967325. . . 104.50 967326. . . 102.30 967330. . . 102.30 967333. . . 169.40 967334. . . . . 81.40 969324. . . 228.80 969325. . . 155.10 969326. . . 150.70 969330. . . 158.40 980269. . . 224.40 980286. . . 224.40 980301. . . 473.00 980303. . . 473.00 980308. . . 328.90 980310. . . 160.60 980313. . . 229.90 983269. . . 282.70 Part Number Price ($US) 983286. . . 983301. . . 983303. . . 983308. . . 983310. . . 983313. . . 985269. . . 985284. . . 985286. . . 985301. . . 985303. . . 985308. . . 985310. . . 985313. . . 987268. . . 987269. . . 987286. . . 987299. . . 987301. . . 987303. . . 987308. . . 987310. . . 987313. . . 282.70 545.60 545.60 396.00 189.20 267.30 268.40 277.20 268.40 522.50 522.50 376.20 179.30 254.10 217.80 216.70 216.70 566.50 467.50 467.50 320.10 156.20 224.40 Part Number Price ($US) Magnecor 7mm ELECTROSPORTS 70 SS Ignition Wire Specifications OVERALL LEAD ASSEMBLY ® Outside Diameter of Cable.......... 7mm. Colour............................................... Black. Boot/Terminal Configuration....... Various - to suit different domestic and foreign applications as well as customer special requirements. Country of Manufacture............... Cable: USA. Assemblies: USA, UK and Australia. CABLE Construction Type......................... Insulator Material.......................... Outer Jacket Material.................. Heat Resistance........................... Dielectric Strength....................... Two section: Insulator bonded with tape to high tear strength, high heat resistant outer jacket. High dielectric silicone rubber. Extreme high tear strength, high temperature resistant silicone rubber. 205o C (400o F) service temperature. 45,000 volts. CONDUCTOR Conductor Size............................. Conductor Type............................. Core................................................. Windings........................................ Windings Material........................ Resistance..................................... Capacity.......................................... 1.90 mm in diameter. Magnecor Metallic Inductance RFI and EMI Suppressed. No conductive coatings applied. Ferrimagnetic base over Kevlar and fiberglass substrate. 77 turns per cm (200 turns per inch). Stainless steel. 98.4 ohm per cm, 3K ohm per ft. + 10%. 45,000 volts, 2kVA. TERMINALS Spark Plug..................................... Distributor and Coil...................... Stainless steel snap-lock 180o bendable and fixed 90o styles. Brass, stainless steel snap-lock 180o and 90o styles. PROTECTIVE BOOTS Spark Plug..................................... Distributor and Coil...................... Silicone 205o C (400o F) - selection of straight, 45o and 90o styles used where applicable - special connector assemblies for some applications. EPDM or Silicone - some sets will be fitted with OE style connectors. AVAILABILITY NO MINIMUM ORDER REQUIRED Available in sets to fit domestic and import car, truck, motorcycle and marine engines. Also, universal sets, individual wires, and tailored sets. Loose cable, boots and terminals can be purchased separately. ELECTROSPORTS 70 SS IGNITION CABLE EXTREME STRENGTH HIGH TEMPERATURE RESISTANT SILICONE RUBBER JACKET METALLIC INDUCTANCE SUPPRESSED CONDUCTOR ACHIEVES SUPERIOR EMI SUPPRESSION WITHOUT A CONDUCTIVE COATING HIGH DIELECTRIC STRENGTH INTERNAL SILICONE INSULATOR BONDED BY TAPE TO OUTER JACKET FOR SUPERIOR TERMINAL RETENTION ORIGINAL EQUIPMENT APPLICATIONS Magnecor’s (Original Equipment size) 7mm Wire Sets now use ELECTROSPORTS 70 SS IGNITION CABLE Vastly superior replacement for OE and aftermarket ignition wires using carbon conductors or resistor/connectors at cable ends, all of which reduce spark energy when deterioration develops with usage. ELECTROSPORTS 70 SS IGNITION CABLE, with its updated high-tech wire-wound conductor, will properly suppress both RFI and EMI on all engines without reducing spark current or deteriorating with use. The high tear strength silicone rubber insulating jacket provides better insulation than most 8mm aftermarket ignition wires, and new construction provides better terminal retention than ever before. Any wire set using ELECTROSPORTS 70 SS IGNITION CABLE can be used on both older and newer carburetted engines as well as the most modern fuel injected engines using any electronic engine management system. Suppression is also provided for 2-way radio and computer equipment. www.magnecor.com Technical Bulletin 110211 Commencing 2000 TECHNICAL INFORMATION AGNECOR ELECTROSPORTS 70 IGNITION CABLE For over 20 years, Magnecor manufactured ignition wires using its 7mm HIGH PERFORMANCE IGNITION CABLE. Wire sets using this cable were very popular as a superior replacement for 7mm size original equipment (OE) and aftermarket ignition wires using limited-life carbon conductors and resistor/connectors at cable ends. Over the years, the wire-wound conductor was updated to provide better RFI suppression, and later versions achieved moderate EMI suppression. A small 7mm insulating jacket makes providing a wirewound conductor to properly suppress EMI (needed by late model engines) both difficult and expensive. To suppress EMI, most manufacturers use wires with carbon conductors and resistor/connectors at cable ends. Although these wires deteriorate with use and spark current is reduced, manufacturers are not concerned, because they all treat ignition wires as service items to be replaced regularly. Others in the aftermarket use cheap wire-wound conductors that cannot properly suppress EMI (no mention is ever made of this fact). In the past, it has been a policy at Magnecor to recommend our 8.5mm KV85 COMPETITION CABLE sets (designed primarily for race engines) if we thought a possible EMI problem could arise on later model engines fitted with 7mm wires as original equipment. Of course, not all vehicle owners necessarily want to purchase more expensive larger diameter ignition wires designed for a race engine. All they want is good ignition wires with a conductor providing proper suppression that won’t deteriorate with usage – more so, with so many late model “multi-valve” engines using ignition wires (fitted with complicated extended spark plug connectors) that have become very expensive and time consuming to replace. The good news is, with the recent introduction of our ELECTROSPORTS 70 IGNITION CABLE, we can now offer a 7mm ignition cable with a wire-wound conductor to properly suppress both RFI and EMI. Wire sets using ELECTROSPORTS 70 IGNITION CABLE can be used on both older and newer carburetted engines and the most modern fuel injected engines using any electronic engine management system. Excellent suppression is also provided for 2-way radio equipment. In addition, a new insulating jacket provides better insulation than most 8mm original equipment and aftermarket wires, and new construction provides better terminal retention than ever before. Remaining Limitation When used with either the original ignition system or a better ignition system designed for street use, wire sets using our ELECTROSPORTS 70 IGNITION CABLE will prove to be vastly superior to all limited-life 7mm original equipment and aftermarket carbon conductor wires, resistor/connector wires and other brand wire-wound conductor wires. However, no 7mm or 8mm cable size wires can fully insulate the maximum output from a racing ignition system. If you intend to ever modify your vehicle for competition we recommend our wire sets using either our: KV85 COMPETITION CABLE (8.5mm) or R-100 RACING CABLE (10mm) For more information about Magnecor products, visit or web site: www.magnecor.com Magnecor 8mm ELECTROSPORTS 80 Ignition Lead Specifications OVERALL LEAD ASSEMBLY ® Outside Diameter of Cable.......... Colour............................................... Boot/Terminal Configuration....... Country of Manufacture............... 8mm. Blue. Various - to suit different domestic and foreign applications as well as customer special requirements. Cable: USA. Assemblies: USA, UK and Australia. CABLE Construction Type......................... Insulator Material.......................... Outer Jacket Material.................. Heat Resistance........................... Dielectric Strength....................... Silicone rubber insulator, re-inforcing braiding, high-tear strength silicone rubber outer jacket. High dielectric silicone rubber. Extreme high-tear strength silicone rubber. 260o C (500o F) service temperature. 55,000 volts. ELECTROSPORTS 80 IGNITION CABLE EXCEPTIONALLY TOUGH HIGHTEAR STRENGTH SILICONE RUBBER OUTER JACKET OVER RE-INFORCING BRAIDING PROVIDES EXCELLENT TERMINAL RETENTION METALLIC INDUCTANCE SUPPRESSED CONDUCTOR ACHIEVES SUPERIOR EMI AND RFI SUPPRESSION HIGH DIELECTRIC STRENGTH INTERNAL SILICONE RUBBER INSULATOR CONDUCTOR Conductor Size............................. Conductor Type............................. Core................................................. Windings........................................ Windings Material........................ Resistance..................................... Capacity.......................................... 2.00 mm in diameter (+/- .05) Magnecor Metallic Inductance SS25 RFI and EMI Suppressed. Ferrimagnetic base over Kevlar and fiberglass substrate. 77 turns per cm (200 turns per inch). Stainless steel. 98 ohm per cm, 3K ohm per ft. +/- 10%. 55,000 volts, 2kVA. TERMINALS Spark Plug..................................... Distributor and Coil...................... Stainless steel snap-lock 180o bendable and fixed 90o styles. Brass and stainless steel snap-lock 180o and 90o styles. PROTECTIVE BOOTS Spark Plug..................................... Distributor and Coil...................... Silicone 205o C (400o F) - selection of straight, 45o and 90o styles used where applicable - special connector assemblies for some applications. EPDM or Silicone - some sets will be fitted with OE style connectors. AVAILABILITY NO MINIMUM ORDER REQUIRED Available in sets to fit domestic and import car, truck, motorcycle and marine engines. Also, universal sets, individual leads, and tailored sets. Loose cable, boots and terminals can be purchased separately. Magnecor’s 8mm leads can be fitted into original 7mm wire holders ELECTROSPORTS 80 IGNITION LEADS Vastly superior replacement leads (wires in USA) for OE and aftermarket ignition leads using carbon conductors or resistor/ connectors at lead ends, all of which reduce spark energy when deterioration develops with usage. ELECTROSPORTS 80 IGNITION CABLE, with its updated high-tech wire-wound conductor, will properly suppress both RFI and EMI on all vehicles without reducing spark current or deteriorating with use. The new extremely flexible high-tear strength silicone insulating jacket allows leads to be fitted into original 7mm holders without damage, and provides better terminal retention than ever before. Leads using ELECTROSPORTS 80 IGNITION CABLE can be used on both older and newer carburetted engines as well as the most modern fuel injected engines using any electronic engine management system. Excellent suppression is also provided for 2-way radio and computer equipment. Ideal for engines using LPG or CNG and industrial applications where heat resistance and adequate suppression is important. www.magnecor.com Technical Bulletin 090062 TECHNICAL INFORMATION AGNECOR ELECTROSPORTS 80 IGNITION CABLE For over 20 years Magnecor manufactured ignition leads using its 8mm HIGH PERFORMANCE IGNITION CABLE. Lead sets (wire sets in USA) using this cable were very popular as a superior replacement for 8mm size original equipment and aftermarket ignition leads using limited-life carbon conductors and resistor/connectors at lead ends. Over the years, the wire-wound conductor was updated to provide better RFI suppression, and later versions achieved moderate EMI suppression. To suppress EMI, most manufacturers use leads with carbon conductors and resistor/connectors at lead ends. Although these leads deteriorate with use and spark current is reduced, manufacturers are never concerned, because all treat ignition leads as service items to be replaced regularly. Others in the aftermarket use cheap wire-wound conductors that cannot properly suppress EMI (no mention is ever made of this fact) which causes interference problems with later model vehicles using electronic engine management systems. In the past, it has been a policy at Magnecor to recommend our 8.5mm KV85 COMPETITION CABLE sets (designed primarily for race engines) if we thought a possible EMI problem could arise on later model engines fitted with 7mm or 8mm leads as original equipment. Of course, not all vehicle owners necessarily want to purchase more expensive larger diameter ignition leads designed for a race engine. All they want is good ignition leads with a conductor providing proper suppression that won’t deteriorate with usage – more so, with so many late model “multi-valve” engines using ignition leads (fitted with complicated extended spark plug connectors) that have become very expensive and time consuming to replace. The good news is, with the recent introduction of our ELECTROSPORTS 80 IGNITION CABLE, we can now offer a 8mm ignition cable with a wire-wound conductor to properly suppress both RFI and EMI. Lead sets using ELECTROSPORTS 80 IGNITION CABLE can be used on both older and newer carburetted engines and the most modern fuel injected engines using any electronic engine management system. Excellent suppression is also provided for 2-way radio equipment. FOR THOSE WANTING TO FIT A LARGER SIZE CABLE INTO ORIGINAL 7mm LEAD HOLDERS: The new extremely flexible high-tear strength all silicone construction of the cable allows leads to be fitted into original 7mm holders without damage to either the cable or the holders. IF YOU PREFER TO MAKE YOUR OWN LEADS: The construction of ELECTROSPORTS 80 IGNITION CABLE allows us to satisfy the ever-increasing demand for cable sold separately. This cable’s jacket is easy to strip (to expose the conductor) even without a stripping tool, yet the extremely tough jacket makes hand- terminating practical, as the strength and flexibility of the cable provides better terminal retention than ever before. The conductor is finished with a conductive bind coating to prevent the windings from unravelling during handtermination. Of course, Magnecor can also supply all terminals, boots, and extended connectors to use with the cable. No minimum order is required. For more information about Magnecor products, visit our web site: www.magnecor.com Magnecor KV85 V5 and R-100 V3 Ignition Cables Specifications OVERALL LEAD ASSEMBLY ® Outside Diameter of Cables.......... 8.5mm (KV85) and 10mm (R-100). Colour............................................... Red. Boot/Terminal Configuration....... Various - to suit different domestic and foreign applications as well as customer special requirements. Country of Manufacture............... Cable: USA. Assemblies: USA, UK and Australia. CABLE Construction Type......................... Insulator Jacket Material............ Heat Resistance........................... Dielectric Strength....................... Flexibility and Tear Strength....... One piece, no cost saving layers used. Extreme heat resistant TC-1500-HS high strength aerospace silicone rubber formulated to dissipate heat away from section exposed to high temperatures. KV85: 600oF (320oC) service temp. 1,000oF (540oC) short burst 3 minutes, R-100: 700oF (380oC) service temp. 1,200o F (650oC) short burst 3 minutes. o KV85: 60 kV, R-100: 80kV at 260 C. Core................................................. Windings........................................ Windings Material........................ Resistance..................................... Capacity.......................................... Distributor and Coil...................... Distributor and Coil...................... SUBSTRATE SERVES AS INDESTRUCTIBLE STRENGTH MEMBER FOR CABLE ASSEMBLY FINISHED IGNITION CABLES HAVE NON-LAYERED HIGH STRENGTH INSULATING JACKETS MADE ENTIRELY OF AEROSPACE GRADE SILICONE RUBBER TO PREVENT SWELLING AND SPLITTING AT EXTREME TEMPERATURES 2.50 mm in diameter. Magnecor Metallic Inductance. RFI and EMI Suppressed. Ferrimagnetic base. 79 turns per cm (200 turns per inch). Stainless steel. 72 ohm per cm, 2.2K ohm per ft. + 10%. R-100: 80 kV, 2kVA. KV85 limited by jacket thickness to 60kV unless spaced. Magnecor KV85 and R-100 Ignition Cables are primarily designed to eliminate both EMI and RFI suppression problems resulting from the use of solid and mag style conductor ignition wires on vehicles utilizing high-output ignition systems together with sensitive on board electronic devices, including fuel, ignition and engine management systems, as well as radio and TV equipment. When used with high-output ignitions, exceptional ignition performance can be expected from domestic and foreign built race and modified engines using fuel injection, turbo- charging, super-charging and / or exotic fuels. Stainless steel snap-lock 180o bendable and fixed 90o styles. Brass, stainless steel and beryllium snap-lock 180o and 90o styles. PROTECTIVE BOOTS Spark Plug..................................... MAGNECOR’S EXCLUSIVE 2.5MM METALLIC INDUCTANCE EMI SUPPRESSED CONDUCTOR: STAINLESS STEEL WINDINGS FULLY EXPOSED (FOR METAL TO METAL TERMINATION CONTACT) PRECISELY SPACED OVER FERRIMAGNETIC CORE RECOMMENDED USAGE: TERMINALS Spark Plug..................................... METALLIC INDUCTANCE EMI SUPPRESSED CONDUCTOR Extremely strong and flexible, KV85 can be fitted into OEM 7mm separators. R-100 may need holes in separators enlarged to at least 8.5mm if large hole separators are not available. CONDUCTOR Conductor Size............................. Conductor Type............................. RACE WIRES Silicone 320o C (600o F) - selection of straight, 45o and 90o styles used where applicable - special connector assemblies for some applications. EPDM or Silicone - some sets will be fitted with OE style connectors. AVAILABILITY Available in sets to fit race and modified street engines in popular demand, sets made to customer specifications (at no extra cost), universal sets, individual leads for both race and street, sets for racing made to OEM engine lengths, sets for foreign vehicle race and street engines, sets for marine and motor cycle race and street engines — as well as severe service commercial engines. Magnecor Ignition Cables can be purchased loose (wound on spools), together with OEM and specialty boots, connectors, terminals and assembly tools. A catalog is available. NO MINIMUM ORDER IS REQUIRED 45 Magnecor KV85 and R-100 Ignition Cables can also be used to advantage on engines fitted with exhaust emission controls, as well as marine engines, and severe load commercial vehicle engines particularly those using alternative fuels such as propane and natural gas with a history of persistent ignition lead failure. These engines will benefit from the ability of Magnecor Ignition Cables to conduct a high spark current at above and below normal operating temperatures. Unless deliberately severed, Magnecor’s Metallic Inductance Suppressed conductors will provide full conductance indefinitely ® Information About KV85 Version 5 (8.5mm) Competition Ignition Cables R-100 Version 3 (10mm) Racing Ignition Cables MAGNECOR RACE WIRES Magnecor KV85 Version 5 (8.5mm) Competition and R-100 Version 3 (10mm) Ignition Cables are specifically designed and constructed to conduct the maximum output generated by conventional and racing ignition systems to the spark plugs, and to provide full suppression for both EMI (electro magnetic interference) and RFI (radio frequency interference). Magnecor KV85 and R-100 Ignition Cables will enable output maximization from both conventional and specific race ignition systems on engines using turbo-charging, super-charging, and exotic fuels, particularly if electronic equipment, including computer controlled ignition, fuel and engine management systems, are also fitted to the vehicle. Improved clarity for radio and television transmission and reception can also be expected because of RFI reduction. EMI suppression problems are caused by electrical energy picked up by sensors and wires connected to computerized equipment from ignition wires not designed or constructed (despite claims by manufacturers) to suppress EMI. As a result, computers and other electronic devices react to erroneous signals, often causing erratic engine running that may not immediately be associated with EMI emitted from ignition wires. All serious EMI problems associated with cheap (to manufacture) generic “mag, spiral, heli, monel, pro, chromel, super, energy, twin core” etc. spiral conductor ignition wires (usually mass-marketed with well publicized performance component providers’ name printed on them), and expensive so-called “capacitor” wires with partial grounded metal braiding over the jacket are eliminated by Magnecor KV85 and R-100 Ignition Cables. Most of these ignition wires are promoted as having little or no “resistance” if measured with an ohmmeter. However, in reality, none provide adequate, if any, EMI suppression. Independent tests have shown that contrary to the exaggerated claims made by most ignition wires promoters, no spiral conductor ignition wires with low measurable electrical resistance or grounded “capacitor” wires will either boost the ignition coil’s output or adequately suppress EMI on race or street engines. An ignition wire’s ability to conduct the full spark energy required to fire the spark plug gap and provide adequate EMI suppression is solely determined by the design and construction of conductors that are beyond the manufacturing capability of most ignition wire manufacturers. In reality, “low” electrical resistance indicates a design to cut manufacturing costs. Magnecor KV85 and R-100 Ignition Cables feature Magnecor’s exclusive 2.5mm Metallic Inductance Suppressed Conductor that consists of heavy duty stainless steel windings precisely spaced and wound at 200 turns per inch. The conductor is wound to provide an effective magnetic coupling for efficient EMI suppression and a capacitive reserve to help overcome the deficiency of high engine speed ignition coil energy regeneration. The use of a ferrimagnetic base core also provides efficient RFI suppression. The stainless steel conductor windings are exposed without a conductive bonding layer after insulating jacket is stripped away to provide a clean metal-to-metal terminal contact to prevent burnout when using high amperage racing ignition systems. Magnecor KV85 and R-100 conductor core substrates also serve as strength members to provide terminated wire assemblies with excellent pull strength. This enables the use of a specially formulated aerospace grade one piece pure silicone rubber insulating jacket with exceptional thermal conductivity and high temperature resistance capabilities. The 10mm diameter R-100 Racing cable is recommended for use with ultra high output ignitions and magnetos. Magnecor KV85’s insulating jacket can withstand up to 1,000oF (540oC) and R100 up to 1,200oF (650oC). Since both jackets are made entirely of a one compound silicone rubber - heat will dissipate away from any area subjected to the extreme heat that would normally destroy other brand multi-layer “silicone” ignition wires, as well as wires encased in tight fitting fiberglass mesh sleeves (with or without a “silicone” coating) that usually absorb and localize heat from the heat source to cook and destroy any multi-layer ignition wire inside the fiberglass sleeves. Magnecor KV85 and R-100 Ignition Cable assemblies are fitted with boots and terminals designed to work in high temperatures. Sets are available for most popular domestic and imported performance engine configurations, as well as individual leads in various styles and lengths tailored sets to meet customer specifications. Magnecor does not use ridiculously large spark plug boots that cannot be positioned away from headers. Unlike its competitors, Magnecor does not manufacture its products to suit prices and terms dictated by massmerchandisers. The designs, construction and materials used by Magnecor are what works best for the applications in which all Magnecor products are used, regardless of the cost, difficulty of manufacturing, and the amount of research and continuous upgrading necessary to stay with developments in the automobile and marine racing industries. Magnecor KV85 and R-100 Ignition Cables can also benefit street engines fitted with exhaust emission controls, as well as marine and severe service commercial engines. Ignition noise suppression for radio and sensitive stereo equipment is also provided. All versions of Magnecor KV85 and R-100 Ignition Cables have been used extensively throughout the world on road, track and marine racing engines since initial versions were added to Magnecor’s extensive domestic and import product line in 1987. NOTE: Version 5 KV85 and Version 3 R-100 Ignition Cables comply with the demand by race engine tuners for EMI suppressed ignition cable that can also be purchased loose on spools to enable them to prepare ignition leads at a moment’s notice. All Magnecor high temperature specialty boots, terminals and terminal crimping tools are available as separate items to be used with Magnecor Ignition Cables. REVISED 05102001 46 MAGNECOR LIMITED WARRANTY Magnecor Ignition Wires will be replaced or repaired free of charge if the product should fail for any reason other than abuse, accident, negligence, improper installation, alteration or failure attributed to original engine design, engine maintenance (or lack thereof) or engine modification. Warranty applies only to the original purchaser and is Iimited to replacement or repair of the suspected failed wire and does not include labor charges for removal or replacement. Wire should be returned together with proof of purchase to any authorized Magnecor distributor or dealer or Magnecor itself for authorization for replacement or repair. Distributed by: Made in USA by: Magnecor 24581 Crestview Court Farmington Hills, MI 48335 USA European factory: Magnecor Europe Unit 12, Jubilee Business Park Snarestone Road Appleby Magne Derbyshire DE12 7AJ United Kingdom Ph: +44 (0) 1530 274 975 E-mail: [email protected] www.magnecor.co.uk All prices and specifications in this catalog subject to change without notice. Printed in USA 7+(7587+$%287 ,*1,7,21:,5( &21'8&7256 &$5%2168335(66,21&21'8&7256 &DUERQFRQGXFWRUVDUHXVHGLQRULJLQDOHTXLSPHQWLJQLWLRQ ZLUHVE\PRVWYHKLFOHPDQXIDFWXUHUVDQGLQWKHPDMRULW\RI VWRFNUHSODFHPHQWZLUHV7KLVVW\OHRILJQLWLRQZLUHLVFKHDS WRPDQXIDFWXUHDQGJHQHUDOO\SURYLGHVJRRGVXSSUHVVLRQIRU ERWK5),UDGLRIUHTXHQF\LQWHUIHUHQFHDQG(0, HOHFWURPDJQHWLFLQWHUIHUHQFH&RQGXFWRUXVXDOO\FRQVLVWVRI DVXEVWUDWHRIILEHUJODVVDQGRU.HYODURYHUZKLFK KLJKUHVLVWDQFHFRQGXFWLYHODWH[RUVLOLFRQHLVFRDWHGDQG IXQFWLRQVE\UHGXFLQJVSDUNFXUUHQWE\UHVLVWDQFHWR SURYLGHVXSSUHVVLRQ¥DMRELWGRHVZHOOZKLOHWKH FRQGXFWRUODVWV9HKLFOHPDQXIDFWXUHUVWUHDWLJQLWLRQZLUHVDV VHUYLFHLWHPVWREHUHSODFHGUHJXODUO\DQGOLPLWHGOLIHLV QHYHUDQLVVXH7KLVW\SHRIFRQGXFWRUTXLFNO\IDLOVEXUQV RXWLIDKLJKSRZHUHGDIWHUPDUNHWLJQLWLRQV\VWHPLVXVHG (0,HOHFWURPDJQHWLFLQWHUIHUHQFH (0,IURPVSDUNSOXJZLUHVFDQFDXVHHUURQHRXVVLJQDOVWREH VHQWWRHQJLQHPDQDJHPHQWV\VWHPVDQGRWKHURQERDUG HOHFWURQLFGHYLFHVXVHGRQERWKUDFLQJDQGSURGXFWLRQ YHKLFOHVLQWKHVDPHPDQQHUDV5),UDGLRIUHTXHQF\ LQWHUIHUHQFHFDQFDXVHXQZDQWHGVLJQDOVWREHKHDUGRQD UDGLRUHFHLYHU(QJLQHUXQQLQJSUREOHPVUDQJLQJIURP LQWHUPLWWHQWPLVVHVWRDGUDPDWLFORVVRISRZHUFDQUHVXOW ZKHQHQJLQHPDQDJHPHQWFRPSXWHUVUHFHLYHVLJQDOVIURP VHQVRUVWKDWKDYHEHHQDOWHUHGE\(0,HPLWWHGIURPVSDUN SOXJZLUHV7KLVSUREOHPLVPRVWQRWLFHDEOHRQPRGHUQ SURGXFWLRQYHKLFOHVXVHGIRUFRPPXWLQJZKHUHYLUWXDOO\ HYHU\IXQFWLRQRIWKHYHKLFOH VGULYHWUDLQLVPDQDJHGE\D FRPSXWHU)RUPDQ\UHDVRQVWKHHIIHFWRI(0,RQHQJLQH PDQDJHPHQWFRPSXWHUVLVQHYHUSUHGLFDEOHDQGSUREOHPVGR EHFRPHZRUVHRQSURGXFWLRQYHKLFOHVDVVHQVRUVFRQQHFWRUV DQGZLULQJGHWHULRUDWHDQGFRUURVLRQRFFXUV7KHSUREOHPLV RIWHQH[DFHUEDWHGE\UHSODFLQJWKHRULJLQDOLJQLWLRQV\VWHP ZLWKDKLJKRXWSXWV\VWHP 62/,'&25(&21'8&725:,5(6 6ROLGPHWDOFRSSHUWLQSODWHGFRSSHUDQGRUVWDLQOHVVVWHHO FRQGXFWRUZLUHVDUHVWLOOXVHGLQUDFLQJRQFDUEXUHWHG HQJLQHVEXWFDQFDXVHDOOVRUWVRIUXQQLQJSUREOHPVLIXVHG RQYHKLFOHVZLWKHOHFWURQLFLJQLWLRQIXHOLQMHFWLRQDQG HQJLQHPDQDJHPHQWV\VWHPVSDUWLFXODUO\LIYHKLFOHLVGULYHQ RQWKHVWUHHW'DPDJHWRVRPHRULJLQDOHTXLSPHQWDQG PRGHUQDIWHUPDUNHWLJQLWLRQDQGHQJLQHPDQDJHPHQW V\VWHPVFDQRFFXULIVROLGFRUHFRQGXFWRULJQLWLRQZLUHVDUH XVHG /2:5(6,67$1&(63,5$/:,5(6 %\IDUWKHPRVWSRSXODUFRQGXFWRUXVHGLQLJQLWLRQZLUHV GHVWLQHGIRUUDFHDQGSHUIRUPDQFHVWUHHWHQJLQHVDUHVSLUDO FRQGXFWRUVDNDPDJSURVXSHUVSLUDOPRQHOKHOL HQHUJ\IHUURWZLQFRUHHWF6SLUDOFRQGXFWRUVDUH FRQVWUXFWHGE\ZLQGLQJILQHZLUHDURXQGDFRUH$OPRVWDOO PDQXIDFWXUHUVXVHFRQVWUXFWLRQVZKLFKUHGXFHSURGXFWLRQ FRVWVLQDQHQGHDYRUWRRIIHULJQLWLRQFRPSRQHQWPDUNHWHUV DQGPDVVPHUFKDQGLVHUVFKHDSHUSULFHVWKDQWKRVHRIWKHLU FRPSHWLWRUV ,QWKH86$LQSDUWLFXODUPRVWPDUNHWHUVRISHUIRUPDQFH SDUWVVHOOLQJWKHLUSURGXFWVWKURXJKPDVVPHUFKDQGLVHUVDQG VSHHGVKRSVLQFOXGHDYDULHW\RIYHU\HIIHFWLYHKLJKRXWSXW LJQLWLRQV\VWHPVWRJHWKHUZLWKDEUDQGHGQRWVRHIIHFWLYH LJQLWLRQZLUHOLQHXVLQJDVSLUDOFRQGXFWRU0RVWSHUSHWXDOO\ WU\WRRXWGRWKHLUFRPSHWLWRUVE\RIIHULQJVSLUDOFRQGXFWRU LJQLWLRQZLUHVZLWKWKHORZHVWHOHFWULFDOUHVLVWDQFH6RPH SXEOLVKUHVXOWVZKLFKVKRZWKHLUZLUHVDUHVXSHULRUWRD FRPSHWLWRU VZLUHVZKLFKXVHLGHQWLFDOFDEOHRQZKLFK DQRWKHUEUDQGQDPHLVSULQWHG7KHSXEOLVKHGORZ UHVLVWDQFHSHUIRRWLVPHDVXUHGZLWKDWHVWRKPPHWHU V YROWGLUHFWFXUUHQW'&SDVVLQJWKURXJKWKHHQWLUHOHQJWKRI WKHILQHZLUHXVHGIRUWKHVSLUDOFRQGXFWRU /RZUHVLVWDQFHFRQGXFWRUVDUHDQHDV\VHOODVPRVW SHRSOHDVVRFLDWHDOOLJQLWLRQZLUHFRQGXFWRUVZLWKRULJLQDO HTXLSPHQWDQGUHSODFHPHQWLJQLWLRQZLUHFDUERQFRQGXFWRUV ZKLFKSURJUHVVLYHO\IDLODVDUHVXOWRIPLFURVFRSLFFDUERQ JUDQXOHVEXUQLQJDZD\DQGWKXVUHGXFLQJWKHVSDUNHQHUJ\WR WKHVSDUNSOXJVDQGZLWKVROLGZLUH]HURUHVLVWDQFH FRQGXFWRUVWKDWZHUHXVHGE\UDFHUVZLWKQRQHHGIRU VXSSUHVVLRQ&RQVXPHUVDUHHDVLO\OHGLQWREHOLHYLQJWKDWLID VSLUDOFRQGXFWRU VUHVLVWDQFHLVDOPRVW]HURLWVSHUIRUPDQFH PXVWEHVLPLODUWRWKDWRIDVROLGPHWDOFRQGXFWRUDOOUDFH FDUVRQFHXVHG+2:(9(5127+,1*,6)857+(5 )5207+(7587+ :KDWLVQRWJHQHUDOO\XQGHUVWRRGRULVLJQRUHGLVWKDWDVD UHVXOWRIWKHODZVRIHOHFWULFLW\WKHSRWHQWLDOSOXV YROWVZLWKDOWHUQDWLQJFXUUHQWFKDUDFWHULVWLFVIURPWKH LJQLWLRQFRLODSXOVHW\SHWUDQVIRUPHUGRHVQRWIORZ WKURXJKWKHHQWLUHWKHOHQJWKRIILQHZLUHXVHGIRUDVSLUDO FRQGXFWRUOLNHWKHYROW'&YROWDJHIURPDWHVWRKPPHWHU EXWIORZVLQDPDJQHWLFILHOGVXUURXQGLQJWKHRXWHUPRVW VXUIDFHRIWKHVSLUDOZLQGLQJVVNLQHIIHFW7KHVDPHVNLQ HIIHFWDSSOLHVHTXDOO\WRWKHVDPHSXOVDWLQJIORZRIFXUUHQW SDVVLQJWKURXJKFDUERQDQGVROLGPHWDOFRQGXFWRUV $VSLUDOFRQGXFWRUZLWKDORZHOHFWULFDOUHVLVWDQFHPHDVXUHG E\DQRKPPHWHULQGLFDWHVLQUHDOLW\QRWKLQJRWKHUWKDQOHVV RIWKHH[SHQVLYHILQHZLUHLVXVHGIRUWKHFRQGXFWRUZLQGLQJV ¥DFRQVWUXFWLRQZKLFKFDQQRWDFKLHYHDFOHDQDQGHIILFLHQW FXUUHQWIORZWKURXJKWKHPDJQHWLFILHOGVXUURXQGLQJWKH ZLQGLQJVUHVXOWLQJLQSRRUVXSSUHVVLRQIRU5),DQG(0, 3DJHRISDJHV 2IFRXUVHLJQLWLRQZLUHPDQXIDFWXUHUVVDYHDFRQVLGHUDEOH DPRXQWLQPDQXIDFWXULQJFRVWVE\XVLQJOHVVILQHZLUHOHVV H[RWLFZLQGLQJPDFKLQHU\DQGOHVVH[SHUWLVHWRPDNH ORZUHVLVWDQFHVSLUDOFRQGXFWRUV$VDQLQFHQWLYHWKH\ILQGD OXFUDWLYHPDUNHWDPRQJVWSHUIRUPDQFHSDUWVPDUNHWHUVZKR DGYHUWLVHWKHLUEUDQGHGLJQLWLRQZLUHVDVKDYLQJ ORZUHVLVWDQFHFRQGXFWRUVGHVSLWHWKHIDFWWKDWVXFK ORZUHVLVWDQFHFRQWULEXWHVQRWKLQJWRPDNHVSLUDOLJQLWLRQ ZLUHVSHUIRUPEHWWHUDQG5),DQG(0,VXSSUHVVLRQLV FRPSURPLVHG ,QUHFHQW\HDUVPRVWLJQLWLRQZLUHPDQXIDFWXUHUVWR WHPSRUDULO\LPSURYHWKHLUVSLUDOFRQGXFWRU VVXSSUHVVLRQ KDYHUHVRUWHGWRFRDWLQJH[FHVVLYHO\VSDFHGVSLUDOZLQGLQJV PRVWRIZKLFKDUHFUXGHO\ZRXQGDURXQGVWUDQGVRI ILEHUJODVVRU.HYODUZLWKDKHDY\OD\HURIKLJKUHVLVWDQFH FDUERQLPSUHJQDWHGFRQGXFWLYHODWH[RUVLOLFRQHFRPSRXQG 7KLVW\SHRIFRQVWUXFWLRQKLGHVWKHFRQGXFWLYHFRDWLQJ VKLJK UHVLVWDQFHZKHQWKHRYHUDOOFRQGXFWRULVPHDVXUHGZLWKDWHVW RKPPHWHUZKLFKRQO\PHDVXUHVWKHORZHUUHVLVWDQFHRIWKH VSDUVHVSLUDOO\ZRXQGZLUHWKHSDWKRIOHDVWUHVLVWDQFH XQGHUWKHFRQGXFWLYHFRDWLQJDQGLJQRUHVWKHKLJKUHVLVWDQFH RIWKHRXWHUPRVWFRQGXFWLYHFRDWLQJLQZKLFKWKHVSDUN HQHUJ\DFWXDOO\WUDYHOV7KHFRQGXFWLYHFRDWLQJLVUDUHO\ VKRZQRUPHQWLRQHGLQDGYHUWLVHPHQWLOOXVWUDWLRQV 7KHVXSSUHVVLRQDFKLHYHGE\WKLVSUDFWLFHRIFRDWLQJWKH ZLQGLQJVLVRQO\WHPSRUDU\DVWKHVSDUNFXUUHQWLVIRUFHGWR WUDYHOWKURXJKWKHRXWHUPRVWKLJKUHVLVWDQFHFRQGXFWLYH FRDWLQJLQWKHVDPHPDQQHUWKHVSDUNFXUUHQWWUDYHOVWKURXJK WKHRXWHUPRVWKLJKUHVLVWDQFHFRQGXFWLYHFRDWLQJRIDFDUERQ FRQGXFWRUXVHGLQPRVWRULJLQDOHTXLSPHQWDQGVWRFN UHSODFHPHQWZLUHV ,QHIIHFWZKHQQHZDFRDWHGORZUHVLVWDQFH VSLUDOFRQGXFWRU VWUXHSHUIRUPDQFHLVLGHQWLFDOWR WKDWRIDKLJKUHVLVWDQFHFDUERQFRQGXFWRU 8QIRUWXQDWHO\DQGSDUWLFXODUO\ZLWKWKHXVHRIKLJKRXWSXW LJQLWLRQVWKHRXWHUPRVWKLJKUHVLVWDQFHFRQGXFWLYHFRDWLQJ RYHUVSLUDOZLQGLQJVDFWLQJDVWKHFRQGXFWRUZLOOIDLOIURP EXUQRXWLQWKHVDPHPDQQHUDVFDUERQFRQGXFWRUVDQG DOWKRXJKLQPRVWFDVHVWKHVSLUDOFRQGXFWRUZLOOQRWFHDVHWR FRQGXFWOLNHDKLJKUHVLVWDQFHFDUERQFRQGXFWRUDQ\5),RU (0,VXSSUHVVLRQZLOOEHORVWDVDFRQVHTXHQFHRIWKHFRDWLQJ EXUQLQJRXW7KHZRUVWLQWHUIHUHQFHZLOOFRPHIURPWKH VRFDOOHGVXSHUFRQGXFWRUVWKDWDUHZRXQGZLWKFRSSHU DOOR\ZLUH +RZHYHUGHVSLWHWKHVKRUWFRPLQJVRIORZUHVLVWDQFH VSLUDOFRQGXFWRULJQLWLRQZLUHVWKHVHZLUHVZRUN VDWLVIDFWRULO\RQROGHUSURGXFWLRQYHKLFOHVDQGUDFHYHKLFOHV WKDWGRQRWUHO\RQHOHFWURQLFHQJLQHPDQDJHPHQWV\VWHPV RUXVHRQERDUGHOHFWURQLFVHIIHFWHGE\(0,¥DOWKRXJK ZLWKWKHORZHVWUHVLVWDQFHFRQGXFWRUZLUHVGRQ WH[SHFW PXFK5),VXSSUHVVLRQRQWKH$0EDQGLQSRRUUHFHSWLRQ DUHDV 6RPH(XURSHDQDQG-DSDQHVHRULJLQDOHTXLSPHQWDQG UHSODFHPHQWLJQLWLRQZLUHVLQFOXGLQJ%RXJLFRUGDQG1*. GRKDYHVSLUDOFRQGXFWRUVWKDWSURYLGHJRRGVXSSUHVVLRQ¥ XVXDOO\QRQHRIWKHVHZLUHVDUHSURPRWHGDVKDYLQJ ORZUHVLVWDQFHFRQGXFWRUV¥KRZHYHUQRQHDUHLGHDOIRU FRPSHWLWLRQXVHDVWKHLUFRQGXFWRUVDQGSLQW\SH WHUPLQDWLRQVDUHIUDJLOHDQGDUHNQRZQWRUDUHO\ODVWDVORQJ DVJRRGFDUERQFRQGXFWRULJQLWLRQZLUHV 7REHHIIHFWLYHLQFDUU\LQJWKHIXOORXWSXWIURPWKHLJQLWLRQ V\VWHPDQGVXSSUHVVLQJ5),DQG(0,LQSDUWLFXODUVSLUDO FRQGXFWRUVQHHGZLQGLQJVWKDWDUHPLFURVFRSLFDOO\FORVHWR RQHDQRWKHUDQGSUHFLVHO\VSDFHGDQGIUHHIURPFRQGXFWLYH FRDWLQJV7REHPRUHHIIHFWLYHWKHZLQGLQJVQHHGWREH ZRXQGRYHUDFRUHRIPDJQHWLFPDWHULDO¥DPHWKRGWRR FRVWO\IRUZLUHVVROGWKURXJKPDVVPHUFKDQGLVHUVDQGPRVW VSHHGVKRSVZKRSXUFKDVHRQO\WKHFKHDSHVWWRWKHPDQG PRVWKHDYLO\SURPRWHGSURGXFWV &ODLPVRI+RUVHSRZHU*DLQ (YHU\EUDQGRIVSLUDOFRQGXFWRULJQLWLRQZLUHVZLOOSHUIRUP WKHIXQFWLRQRIFRQGXFWLQJFRLORXWSXWWRWKHVSDUNSOXJVEXW 121(GHVSLWHWKHFODLPVPDGHLQDGYHUWLVHPHQWVDQGRWKHU SURPRWLRQDOOLWHUDWXUHZLOOLQFUHDVHKRUVHSRZHU ,QGHSHQGHQWWHVWVLQFOXGLQJDWHVWSHUIRUPHGE\&LUFOH 7UDFN0DJD]LQHVHH0D\LVVXHLQWKH86$VKRZ WKDW12ORZUHVLVWDQFHLJQLWLRQZLUHVIRUZKLFKD KRUVHSRZHULQFUHDVHLVFODLPHGGRLQIDFWLQFUHDVH KRUVHSRZHU¥WKHWHVWDOVRLQFOXGHGFRPSDULVRQVZLWKVROLG PHWDODQGFDUERQFRQGXFWRULJQLWLRQZLUHV &$3$&,725())(&7:,5(6 ZLWKJURXQGHGPHWDOEUDLGLQJRYHUMDFNHW 7KHPRVWQRWDEOHRIH[DJJHUDWHGFODLPVIRULJQLWLRQZLUHV DUHPDGHE\1RORJ\DUHFHQWPDQXIDFWXUHURILJQLWLRQZLUHV SURPRWHGDVWKHRQO\VSDUNSOXJZLUHVZLWKEXLOWLQ FDSDFLWRU1RORJ\ V+RW:LUHVFDOOHG3ODVPD/HDGVLQ WKH8.FRQVLVWRIXQVXSSUHVVHGVROLGPHWDORUVSLUDO FRQGXFWRULJQLWLRQZLUHVRYHUZKLFKEUDLGHGPHWDOVOHHYHV DUHSDUWLDOO\ILWWHG7KHEUDLGHGPHWDOVOHHYHVDUHJURXQGHG YLDVWUDSVIRUPHGIURPSDUWRIWKHEUDLGLQJ,QVXODWLQJFRYHUV DUHILWWHGRYHUWKHEUDLGHGPHWDOVOHHYHV7KHVHZLUHDUHZHOO FRQVWUXFWHG)RUZKDWHYHUUHDVRQ1RORJ\VSHFLILHVWKDW QRQUHVLVWRUVSDUNSOXJVQHHGWREHXVHGZLWKWKHLU +RW:LUHV ,JQLWLRQZLUHVZLWKJURXQGHGEUDLGHGPHWDOVOHHYHVRYHUWKH FDEOHKDYHFRPHDQGJRQHDOORYHUWKHZRUOGIRUDWOHDVWWKH ODVW\HDUVDQGVLPLODUZLUHVZHUHXVHGRYHU\HDUVDJR E\DIHZFDUPDNHUVWRVROYHFURVVILULQJSUREOHPVRQHDUO\ IXHOLQMHFWHGHQJLQHVDQG5),SUREOHPVRQILEHUJODVVERGLHG FDUV¥RQO\WRILQGRWKHUSUREOHPVZHUHFUHDWHG7KHUHFHQW &LUFOH7UDFN0DJD]LQH86$0D\LVVXHWHVW VKRZHG1RORJ\+RW:LUHVSURGXFHGQRDGGLWLRQDO KRUVHSRZHUWKHWHVWDFWXDOO\VKRZHGDKRUVHSRZHU GHFUHDVHZKHQFRPSDUHGWRVWRFNFDUERQFRQGXFWRUZLUHV 3DJHRISDJHV 7KHSHUFHLYHGHIIHFWDEULJKWHUVSDUNFRQGXFWHGE\DQ LJQLWLRQZLUHHQFDVHGRUSDUWLDOO\HQFDVHGLQDEUDLGHGPHWDO VOHHYHVKLHOGJURXQGHGWRWKHHQJLQHMXPSLQJDFURVVD KXJHIUHHDLUJDSZKLFKEHDUVQRUHODWLRQVKLSWRWKHVSDUN QHHGHGWRILUHWKHYDULDEOHDLUIXHOPL[WXUHXQGHUSUHVVXUHLQ DFRPEXVWLRQFKDPEHULVFRQWLQXDOO\EHLQJUHGLVFRYHUHG DQGFOHYHUO\GHPRQVWUDWHGE\PDUNHWHUVZKRFRQYLQFH WKHPVHOYHVWKHUH VPRQHWDU\YDOXHLQVXFKDEULJKWVSDUNDQG DOOVRUWVRIZLOGFRPSOHWHO\XQSURYDEOHFODLPVDUHPDGHIRU WKLVSKHQRPHQD 8QOHVV\RXDUHSUHSDUHGWRDFFHSWXQVXSSUHVVHGLJQLWLRQ ZLUHVWKDWIDLOVRRQHUWKDQDQ\RWKHUW\SHRILJQLWLRQZLUHV DQGVWUHWFK\RXULJQLWLRQV\VWHPWRWKHOLPLWDQGKDYHDQ HQJLQHZLWKQRHOHFWURQLFPDQDJHPHQWV\VWHPDQGRU H[KDXVWHPLVVLRQFRQWUROVLW VEHVWQRWWREHLQIOXHQFHGE\ WKHH[DJJHUDWHGFODLPVDQGVRPHYHVWHGLQWHUHVWMRXUQDOLVWV UHVHOOHUV DQGLQVWDOOHUV SHUFHSWLRQDQHQJLQHKDVPRUHSRZHU DIWHU1RORJ\ZLUHVDUHILWWHG2IWHQDIWHUUHSODFLQJ GHWHULRUDWHGZLUHVDQ\QHZLJQLWLRQZLUHVPDNHDQHQJLQH UXQEHWWHU /LNHPDQ\LQWKHSDVW1RORJ\FOHYHUO\GHPRQVWUDWHVD EULJKWHUIUHHDLUVSDUNFRQWDLQLQJXVHOHVVIODVKRYHUFUHDWHG E\WKHFUXGHFDSDFLWRUHIIHFWRIWKLVVW\OHRIZLUH,Q UHDOLW\WKHEULJKWVSDUNKDVQRPRUHXVHIXOHQHUJ\WRILUHD YDULDEOHFRPSUHVVHGDLUIXHOPL[WXUHWKDQWKHFOHDQVSDUN \RXZRXOGVHHLQDVLPLODUGHPRQVWUDWLRQXVLQJDQ\JRRG FDUERQFRQGXFWRUZLUH:KDWLVKDSSHQLQJLQVXFKD GHPRQVWUDWLRQLVWKHFRLORXWSXWLVEHLQJXQQHFHVVDULO\ ERRVWHGWRDGGLWLRQDOO\VXSSO\VSDUNHQHUJ\WKDWLVLQGXFHG DQGZDVWHGLQWRWKHJURXQGHGEUDLGHGPHWDOVOHHYHDURXQG WKHLJQLWLRQZLUH VMDFNHW7RWHVWWKHYDOLGLW\RIWKLV VWDWHPHQWDVNWKHGHPRQVWUDWRUWRGLVFRQQHFWWKHJURXQG VWUDSDQGREVHUYHMXVWKRZPXFKHQHUJ\LVVSDUNLQJWR JURXQG 27+(5'(9,&(6&/$,0,1*72 ,1&5($6(63$5.6 &ODLPVE\1RORJ\RIWKHLU+RW:LUHVFUHDWLQJVSDUNVWKDW DUHWLPHVPRUHSRZHUIXOUHDFKLQJWHPSHUDWXUHVRI WRGHJUHHV)PRUHWKDQHQRXJKWRPHOW VSDUNSOXJHOHFWURGHVVSDUNGXUDWLRQVRIELOOLRQWKVRID VHFRQGVSDUNGXUDWLRQLVFRQWUROOHGE\WKHLJQLWLRQV\VWHP LWVHOIDQGFXUUHQWVRIDPSHUHVPDJLFDOO\HYROYLQJ LQFDSDFLWRUVDOOHJHGO\EXLOWLQWRWKHLJQLWLRQZLUHVDUH DVULGLFXORXVDVWKHGDWDDQGWKHGHSLFWLRQRIVSDUNVLQ SKRWRJUDSKVXVHGLQDGYHUWLVLQJPDWHULDODQGWKHSULFHDVNHG IRUWKHVHZLUHV0RVWVWRFNLJQLWLRQSULPDULHVDUHUHJXODWHG WRDPSHUHVDQGWKHPRVWSRZHUIXOUDFHLJQLWLRQWRQRPRUH WKDQDPSHUHVDW530 ,WLVFRPPRQNQRZOHGJHDPRQJVWDXWRPRWLYHHOHFWULFDO HQJLQHHUVWKDWLWLVXQZLVHWRXVHLJQLWLRQZLUHVILWWHGZLWK JURXQGHGEUDLGHGPHWDOVOHHYHVILWWHGRYHULJQLWLRQFDEOH MDFNHWVRQDQDXWRPRELOHHQJLQH7KLVW\SHRILJQLWLRQZLUHV IRUFHVLWVFDEOHMDFNHWVWREHFRPHDQXQVXLWDEOHGLHOHFWULFIRU DFUXGHFDSDFLWRUHIIHFWEHWZHHQWKHFRQGXFWRUDQGWKH EUDLGHGPHWDOVOHHYHV:KLOHWKHZLUHVIXQFWLRQQRUPDOO\ ZKHQILUVWILWWHGWKHFDEOHMDFNHWVVRRQEUHDNGRZQDVD GLHOHFWULFDQGSURJUHVVLYHO\PRUHVSDUNHQHUJ\LVLQGXFHG IURPWKHFRQGXFWRUVWKRXJKWKHFDEOHMDFNHWVLQWRWKH JURXQGHGPHWDOVOHHYHVFDXVLQJWKHLJQLWLRQFRLOWR XQQHFHVVDULO\RXWSXWPRUHHQHUJ\WRILUHERWKWKHVSDUNSOXJ JDSVDQGWKHDGGLWLRQDOHQHUJ\ORVWYLDWKHEUDLGHGPHWDO VOHHYHV2IWHQWKLVVLWXDWLRQOHDGVWRLJQLWLRQFRLODQGFRQWURO XQLWRYHUORDGIDLOXUHV,WVKRXOGEHQRWHGWKDWLWLVGDQJHURXV WRXVHWKHVHZLUHVLIQRWJURXQGHGWRWKHHQJLQHDVWKH JURXQGLQJVWUDSVZLOOEHDOLYHZLWKWKRXVDQGVRIYROWV ZDQWLQJWRJURXQGRXWWRDQ\WKLQJRUERG\QHDUE\ 1HYHUEHIRROHGE\DQ\GHYLFHWKDWLVILWWHGEHWZHHQWKH LJQLWLRQFRLODQGWKHGLVWULEXWRUDQGRUGLVWULEXWRUDQGWKH VSDUNSOXJVLQFOXGLQJLQSODFHRILJQLWLRQZLUHVIRUZKLFK FODLPVRILQFUHDVHGSRZHUPXOWLSOHVSDUNVDQGEHWWHUIXHO HFRQRP\DUHPDGH7KHVHGHYLFHVKDYHFRPHDQGJRQHRYHU WKHODVW\HDUVDQGXVXDOO\FRQVLVWVRIDVHDOHGFRQWDLQHULQ ZKLFKWKHVSDUNLVIRUFHGWRMXPSDQDGGLWLRQDOJDSRULV SDUWLDOO\LQGXFHGWRJURXQGRXWRQLWVZD\WRWKHVSDUNSOXJ JDS7KHVHGHYLFHVFDQDOVREHFOHYHUO\GHPRQVWUDWHGWR SURGXFHVSDUNVWKHKXPDQH\HSHUFHLYHVDVEHLQJPRUH SRZHUIXO7KHRQO\LQFUHDVHDJXOOLEOHFRQVXPHUFDQ H[SHFWIURPWKHVHGHYLFHVLVDQXQGHVLUDEOHLQFUHDVHLQORDG RQWKHLUYHKLFOH VLJQLWLRQV\VWHP 6800,1*83 $OOLQWHUQDOFRPEXVWLRQHQJLQHVUHO\RQDQLJQLWLRQV\VWHP ¥DQGDQHQJLQHWKDWLVUHTXLUHGWRSURGXFHPRUH KRUVHSRZHUDQGQHHGVWRRSHUDWHDWKLJKHUWKDQSURGXFWLRQ HQJLQH530QHHGVDPRUHSRZHUIXOLJQLWLRQV\VWHPWR DFKLHYHWKHH[WUDKRUVHSRZHUDQGKLJKHU530 2ULJLQDOVWRFNHTXLSPHQWLQGXFWLYHLJQLWLRQV\VWHPV ZLWKGLVWULEXWRUVDQGGLUHFWLJQLWLRQV\VWHPVWKDWHOLPLQDWH WKHGLVWULEXWRUE\FRQWUROOLQJWKHLJQLWLRQV\VWHPZLWKD FRPSXWHUDUHGHVLJQHGWRRXWSXWVSDUNHQHUJ\PRGHUDWHO\LQ H[FHVVRIZKDWLVQHHGHGWRILUHVSDUNSOXJJDSVXQGHU QRUPDORSHUDWLQJFRQGLWLRQVDQGWRFRQWUROWLPLQJDQGVSDUN GXUDWLRQWRLPSURYHWKHHQJLQH VDELOLW\WRFRQWUROH[KDXVW HPLVVLRQVDVZHOODVHQVXULQJWKHHQJLQHLVQRWRYHUVWUHVVHG GXULQJWKHYHKLFOH VZDUUDQW\SHULRG &DSDFLWRUGLVFKDUJHLJQLWLRQV&',VXFKDVWKRVHIURP $FFHO&UDQH+ROOH\-DFREV0DOORU\06'DQGRWKHUV FUHDWHVSDUNVWKDWDUHFRPSUHVVHGDQGLQWHQVLILHGLQWR VKRUWHUGXUDWLRQDQGDUHGHVLJQHGWRDGGLWLRQDOO\SURGXFHWKH H[WUDVSDUNHQHUJ\QHHGHGE\UDFHDQGPRGLILHGVWUHHW HQJLQHVWKDWZLOOUHDFKKLJKHU530WKDQVWRFNHQJLQHVDQG XVHIXHOVPRUHGLIILFXOWWRILUHWKDQSXPSJDVROLQHSHWURO 0RVW&',LJQLWLRQVLQFRUSRUDWHPXOWLVSDUNFLUFXLWVWRHQDEOH WKHHQJLQHWRUXQVPRRWKHUXQGHU530 $+LJKRXWSXWLQGXFWLYHLJQLWLRQV\VWHPLVSUREDEO\PRUH DSSURSULDWHWKDQD&',LJQLWLRQV\VWHPIRUPRVWODWHPRGHO 3DJHRISDJHV SURGXFWLRQHQJLQHVPRGLILHGRUQRWEHFDXVHWKLVW\SHRI LJQLWLRQSURYLGHVWKHORQJHUGXUDWLRQVSDUNQHHGHGE\WKHVH HQJLQHV%DVLFKLJKRXWSXWLQGXFWLYHLJQLWLRQV\VWHPVDUH FXUUHQWO\DYDLODEOHLQWKHDIWHUPDUNHWIURPDWOHDVW$FFHO &UDQH+ROOH\06'DQGDPHQXGULYHQGLUHFWLJQLWLRQ V\VWHPLVDDYDLODEOHIURP(OHFWURPRWLYH 2IWHQRQSURGXFWLRQYHKLFOHVXVHGRQWKHVWUHHWUHSODFLQJD WLUHGLJQLWLRQFRLOZLWKDKLJKHURXWSXWLJQLWLRQFRLOIURP $FFHO&UDQH-DFREV0DOORU\0RURVR06'1RORJ\ 7RUTXH0DVWHUHWFFDQLPSURYHLJQLWLRQSHUIRUPDQFH SDUWLFXODUO\XQGHUORDGDQGDWKLJKHU530 (OHFWULFDOGHYLFHVLQFOXGLQJ63$5.3/8*6XVHRQO\WKH HOHFWULFDOHQHUJ\QHFHVVDU\WRSHUIRUPWKHIXQFWLRQIRUZKLFK VXFKGHYLFHVDUHGHVLJQHG,*1,7,21:,5(6DUHQRWKLQJ RWKHUWKDQFRQGXFWRUVDQGZKHUHDVDQLJQLWLRQZLUH V LQHIILFLHQWRUIDLOLQJFRQGXFWRURULQVXODWLQJMDFNHW SDUWLFXODUO\DMDFNHWLQVLGHJURXQGHGPHWDOVKHLOGLQJFDQ UHGXFHWKHIORZRIHOHFWULFLW\WRWKHVSDUNSOXJDQLJQLWLRQ ZLUHWKDWDOOHJHGO\JHQHUDWHVDQLQFUHDVHLQVSDUNHQHUJ\ ZLOOKDYHQRHIIHFWRQWKHVSDUNMXPSLQJDFURVVWKHVSDUN SOXJJDSDVWKHHQHUJ\FRQVXPHGDWWKHVSDUNSOXJJDS ZRQ WEHDQ\PRUHWKDQZKDWLVQHHGHGWRMXPSWKHJDSHJ DZDWWOLJKWEXOEZRQ WXVHDQ\PRUHHQHUJ\RUSURGXFH DQ\PRUHOLJKWLILW VVFUHZHGLQWRDVRFNHWZLUHGWRVXSSO\ FXUUHQWWRDZDWWOLJKWEXOE $OWKRXJKPRVWQHZLJQLWLRQZLUHVZLOOSHUIRUPWKHIXQFWLRQ RIFRQGXFWLQJFRLORXWSXWWRWKHVSDUNSOXJZKDWLV LPSRUWDQWWRVRSKLVWLFDWHGUDFHHQJLQHSUHSDUHUVDQGRZQHUV RISURGXFWLRQYHKLFOHVZLWKH[KDXVWHPLVVLRQFRQWUROVLV (0,VXSSUHVVLRQ$OOHOHFWURQLFGHYLFHVFDQEHHIIHFWHGE\ (0,HPLWWHGIURPLJQLWLRQZLUHVDQGWKHSUREOHPLVRIWHQ H[DFHUEDWHGE\LQVWDOOLQJDKLJKRXWSXWLJQLWLRQV\VWHP$V ODWHPRGHOSURGXFWLRQYHKLFOHVDJHHQJLQHPDQDJHPHQW VHQVRUVDQGZLULQJGHWHULRUDWHDQGEHFRPHPRUHVXVFHSWLEOH WR(0,UDGLDWLQJIURPLPSURSHUO\VXSSUHVVHGLJQLWLRQZLUHV 7REHWUXO\HIIHFWLYHLJQLWLRQZLUHVQHHGWREH(0, VXSSUHVVHGIRUDUHDVRQDEOHWLPHZKLOHKDYLQJWKHDELOLW\WR PDLQWDLQJRRGFRQGXFWDQFHZLWKRXWRYHUORDGLQJRWKHU LJQLWLRQV\VWHPFRPSRQHQWV (QJLQHWXQHUVVKRXOGDOVRWDNHLQWRDFFRXQWWKDWPRVWVWRFN HQJLQHVDQGVRPHKLWHFKDIWHUPDUNHWHQJLQHPDQDJHPHQW V\VWHPVXVHUHVLVWDQFHLQLJQLWLRQZLUHVWRVHQVHDGGLWLRQDO LQIRUPDWLRQQHHGHGE\WKHFRPSXWHU 0$*1(&255$&(:,5(63529,'(())(&7,9( $1'3(50$1(17(0,68335(66,21 6LQFH0DJQHFRUKDVUHFRJQL]HGWKDWLJQLWLRQZLUHV FDSDEOHRIFRQGXFWLQJWKHH[WUHPHHQHUJ\RXWSXWIURP LJQLWLRQVDYDLODEOHIURP$FFHO&UDQH(OHFWURPRWLYH -DFREV0DOORU\06'DQGRWKHUVDOORIZKLFKDUHXVHGRQ HQJLQHVFRQWUROOHGE\HOHFWURQLFHQJLQHPDQDJHPHQW V\VWHPVQHHGHIIHFWLYHDQGSHUPDQHQW(0,VXSSUHVVLRQWR DYRLGLQWHUIHUHQFHWRYHKLFOHHOHFWURQLFV 0DJQHFRU5DFH:LUHVFRPSOHWHO\HOLPLQDWHWKHQHHGWR UHVRUWWRVKRUWOLYHGFDUERQFRQGXFWRULJQLWLRQZLUHVWR RYHUFRPHWKHSUREOHPVFDXVHGE\(0,RQUDFHDQG SHUIRUPDQFHYHKLFOHHOHFWURQLFVIURPLPSURSHUO\VXSSUHVVHG ORZUHVLVWDQFHVSLUDOFRQGXFWRULJQLWLRQZLUHVZLWKRU ZLWKRXWFRQGXFWLYHFRDWLQJVRYHUFRQGXFWRUZLQGLQJV 0DJQHFRU5DFH:LUHVDUHDOVRH[WHQVLYHO\XVHGRQERWK VWRFNDQGPRGLILHGSURGXFWLRQYHKLFOHVZKLFKQHHGWR PDLQWDLQH[KDXVWHPLVVLRQVZLWKLQWKHOHJDOOLPLW 8QOLNHLWVFRPSHWLWRUVVRPHRIZKRPKDYHFKRVHQWR PDUNHWFKHDSHUWRPDQXIDFWXUHORZUHVLVWDQFHLPLWDWLRQV RI0DJQHFRU5DFH:LUHV0DJQHFRUGRHVQRWPDNHDQ\ FODLPWKDWWKHLUFXUUHQW.9&RPSHWLWLRQPPDQG 55DFLQJPP5DFH:LUHVKDYHORZUHVLVWDQFH FRQGXFWRUVQRUGRWKHFRQGXFWRUVQHHGORZUHVLVWDQFHIRU DQ\SUDFWLFDOUHDVRQ0DJQHFRUGRHVQRWFODLPLWV5DFH :LUHVLQFUHDVHKRUVHSRZHUDQGDQ\KRUVHSRZHUJDLQHGE\ WKHXVHRI0DJQHFRU5DFH:LUHVUHVXOWVHQWLUHO\IURPWKH DELOLW\RIWKHZLUHVWRPDLQWDLQIXOOFRQGXFWDQFHDQG VXSSUHVV(0,WKDWSUHYLRXVO\VWROHHQJLQHKRUVHSRZHU 0DJQHFRU5DFH:LUHV PP0HWDOOLF,QGXFWLYH 6XSSUHVVHG&RQGXFWRUVDUHGHVLJQHGWRFDUU\WKHIXOO RXWSXWIURPDOOUDFHLJQLWLRQVDQGDUHH[FOXVLYHO\ PDQXIDFWXUHGLQ0DJQHFRU VVSHFLDOL]HGIDFLOLWLHVZLWK SUHFLVLRQPDFKLQHU\DQGHTXLSPHQWDQGLQFOXGH PLFURVFRSLFDOO\FORVHVSLUDOZLQGLQJVZRXQGRYHU IHUULPDJQHWLFFRUHV1RFRQGXFWLYHFRDWLQJVDUHXVHGRYHU WKHVSLUDOZLQGLQJV0DJQHFRU5DFH:LUHV FRQGXFWRUVDUH MDFNHWHGHQWLUHO\ZLWKWKHKLJKHVWWHPSHUDWXUHDHURVSDFH JUDGHVLOLFRQHUXEEHUWRUHVLVWWKHH[WUHPHWHPSHUDWXUHV JHQHUDWHGE\UDFHHQJLQHV 6LQFHILUVWLQWURGXFHGSURJUHVVLYHYHUVLRQVRI0DJQHFRU 5DFH:LUHVKDYHEHHQFRQVLVWHQWO\XVHGE\OHDGLQJ FRQWHQGHUVDOORYHUWKHZRUOGLQFOXGLQJWKRVHFRPSHWLQJLQ 6&&$1$6&$5,06$1+5$DQGFOXEHYHQWVLQWKH 86$7RGDWH0DJQHFRU86$KDVQRWVSRQVRUHGDQ\ SDUWLFXODUUDFHUWRSURPRWHWKHXVHRILWVLJQLWLRQZLUHVLQ FRPSHWLWLRQHYHQWV$OOUDFHUVXVLQJ0DJQHFRU5DFH:LUHV GRVRWRHQVXUHWKHLUHQJLQHVSHUIRUPHIILFLHQWO\DQGZLWKRXW WKHULVNRI(0,IURPLJQLWLRQZLUHVUXLQLQJWKHKXJHHIIRUW DQGH[SHQVHWRSUHSDUHDQGWXQHHQJLQHVIRUFRPSHWLWLRQ )RU\HDUV0DJQHFRUKDVDOVRRIIHUHGSURJUHVVLYH YHUVLRQVRILWVPPDQGPP+,*+3(5)250$1&( ,*1,7,21&$%/(6IRUFDUEXUHWRUPHFKDQLFDODQGHDUO\ HOHFWURQLFIXHOLQMHFWHGHQJLQHV7KHVHZLUHVSURYLGH5), VXSSUHVVLRQVLPLODUWRWKHYHU\EHVWRIIHUHGE\0DJQHFRU V FRPSHWLWRUVLQWKHSHUIRUPDQFHDIWHUPDUNHWIHDWXUHDIDU VXSHULRUKHDWUHVLVWDQWMDFNHWDQGSULFHVFRPSDUDEOHWR SURGXFWVVROGWKURXJKVSHHGVKRSVDQGPDVVPHUFKDQGLVHUV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 0DJQHFRU 2DNOH\ 3DUN 5RDG :DOOHG /DNH 0, 86$ 7HOHSKRQH )DFVLPLOH :HE 6LWH ZZZPDJQHFRUFRP 3DJHRISDJHV Magnecor Spark Plug Wire Sets for AUSTRALIAN FORD vehicles. Replace the "_" with "7" for 7mm, "0" for 8mm, "5" for KV85 and "9" for R-100. NOTE: Not all sizes available for all sets - please inquire. Model Engine Year Part No CAPRI,SA,SB CAPRI,SA,SB,SC CAPRI,SB,SC CLEVELAND V8 AROUND CLEVELAND V8 AROUND CLEVELAND V8 OVER 1.6 SOHC EFI 1.6 DOHC TURBO EFI 12 VALVE 302,351,4.9,5.8 302,351,4.9,5.8 HEI CAP 302,351,4.9,5.8 1989-92 AU4_018 ALL AU4_099 1990 ON AU4_103 ALL EXCEPT EFI AU8_008 ALL EXCEPT EFI AU8_078 ALL EXCEPT EFI AU8_001 CORSAIR CORSAIR CORTINA CORTINA , TC,TD CORTINA , TD,TE,TF COURIER COURIER ECONOVAN ESCORT ESCORT ESCORT FAIRLANE,NA,NB,NC FAIRLANE,ZJ,ZK 2.0 EFI CA20E 2.4 EFI KA24 2.0 LITRE 6 CYL PRE X-FLOW 6 CYL X-FLOW 2.0 4 CYL 2.6 12 VALVE EFI 2.0 litre FE 1600 2.0 LITRE TWIN CAM 6 CYL OHC 3.2,3.9,4.0 4.1 X-FLOW CARBY 1989-92 1989-92 1971-81 1972-75 1976-82 1979-85 1991-98 1990-98 1975-81 1975-81 1969-72 1988-94 1979-84 AU4_143 AU4_142 AU4_015 AU6_016 AU6_012 AU4_045 AU4_289 AU4_166 AU4_024 AU4_014 AU4_016 AU6_006 AU6_012 FAIRLANE,ZK FAIRLANE,ZL FAIRLANE,ZL FALCON,AU FALCON,AU 4.1 EFI 4.1 CARBY 4.1 EFI 4.0 6 CYL 5.0 LITRE V8 1983-84 1984-86 1984-88 1998 ON 1998 AU6_013 AU6_014 AU6_015 AU6_113 AU8_083 FALCON,AU 2 FALCON,EA,EB,ED,XG FALCON,EB,ED,EF,XH FALCON,EF,EL FALCON,EL , XH UTE FALCON,XC TO XE FALCON,XE 4.0 LITRE 6 CYL 6 CYL OHC 3.2,3.9,4.0 V8 5.0 4.0 LITRE 4.0 LITRE 3.3,4.1 X-FLOW CARBY 4.1 EFI 2000 1988-94 1991 ON 1994 - 9/96 9/96 on 1976-84 1982-84 AU6_139 AU6_006 AU8_044 AU6_046 AU6_092 AU6_012 AU6_013 Notes 1 4 3 5 Model Engine Year Part No FALCON,XF FALCON,XF FALCON,XK TO XB FESTIVA 4.1 CARBY 4.1 EFI 250 ETC 6 CYL 1.3 (EXCEPT 16 VALVE) 1984-88 1984-88 1960-76 1991 ON AU6_014 AU6_015 AU6_016 AU4_118 FESTIVA KA LASER,KA,KB LASER,KC LASER,KE LASER,KE LASER,KE LASER,KF 1.5 SOHC EFI 1.3 OHV 1.3, 1.5 1.6 1.6 EFI EXCEPT DOHC 1.6 CARBY 1.6 DOHC 1.8 EFI DOHC 1999 1998 1981-85 1985-87 1987-89 1987-90 1987-89 1990-91 AU4_313 AU4_334 AU4_020 AU4_021 AU4_018 AU4_021 AU4_099 AU4_128 LASER,KF LASER,KJ111 LASER,KJ111 LASER.KJ MAVERICK MONDEO RAIDER SPECTRON TELSTAR TELSTAR TELSTAR TELSTAR 1.8 EFI EXCEPT DOHC 1.6 1.8 DOHC 1.6 1.8 DOHC 1.6 &1.8 DOHC 4.2 2.0 DOHC 2.6 12 VALVE EFI 1.8 2.0 LITRE 2.0 LITRE DOHC 2.2 12 VALVE 2.2 12 VALVE TURBO 1990-91 10/94 ON 1998 10/94 ON 1988-94 1995 on 1991-96 1984 ON 1983-89 1992 ON 1987-92 1987-92 AU4_019 AU4_297-1 AU4_322 3 AU4_297 10 AU6_018 AU4_242 AU4_289 AU4_167 AU4_025 AU4_201 AU4_119 AU4_223 TELSTAR WINDSOR V8 AROUND WINDSOR V8 OVER 2.5 V6 DOHC 1992 ON AU6_041 289-351 ALL EXCEPT EFI AU8_015 289,302,351 EXTRACTORS ALL EXCEPT EFI AU8_003 NOTES: 1. Bosch Ignition 3. Distributorless ignition 4. Distributorless Ignition.Different design than O.E 5. With Distributor 6. Right-angle plug boots 7. 115 degree plug boots 8. 1 Piece Silicone Plug Boots 10. No Coil lead Copyright© 2001 Thundercords Notes Magnecor Spark Plug Wire sets for HOLDEN vehicles. Replace the "_" with "7" for 7mm, "0" for 8mm, "5" for KV85 and "9" for R-100. NOTE: Not all sizes available for all sets - please inquireif you do not see what you want. Model Engine Year Part No Notes 6 CYL 6 CYL HEI 6 CYL RED MOTOR 6 CYL RED MOTOR APOLLO,JK,JL APOLLO. JM,JP GREY MOTOR VC-VK,WB EH-VB R/ANGLE BOTH ENDS 3SF CARBY 3VZFE 3.0 LITRE V6 ALL 1980-85 1964-80 ALL 1989-93 1993-97 AU6_074 AU6_004 AU6_005 AU6_089 AU4_200 AU6_112 2 APOLLO. JM,JP ASTRA ASTRA BARINA BARINA GSI BARINA GSI BARINA MF, MH, ML. CALIBRA CALIBRA CALIBRA,YE CAMIRA,JB, JD LEADED CAMIRA,JD UNLEADED CAMIRA,JE 5SFE 1.6,1.8 EFI HEI E SERIES 1.5,1.6 1.2 1.4 SOHC 1.6 DOHC C16XE 1.6 DOHC X16XE 1.3 G13a,b 2.0 DOHC C20XE 2.0 DOHC X20XEV 2.0 SOHC 1.6, 1.8 1.8 EFI 2.0 1993-97 1987-89 1984-87 1994-98 1994-95 1995-98 1986-93 1991-97 1991-97 1992 ON 1982-85 1986-87 1987-89 AU4_286 2 AU4_032 AU4_122 AU4_131 AU4_270 AU4_343 AU4_217 AU4_337 3 AU4_265 4 AU4_235 AU4_034 AU4_033 AU4_032 COMMODORE,VC - VL COMMODORE,VC - VL COMMODORE,VC,VH COMMODORE,VL COMMODORE,VN 4.2,4.9,5.0 CARBY 4.2,4.9,5.0 CARBY 1.9 STARFIRE 3.0 6 CYL 3.8 V6 SINGLE COIL PACK 1980-88 SUIT BRACKETS 1980-83 1986-88 1988-90 AU8_016 AU8_060 AU4_029 AU6_003 AU6_001 COMMODORE,VN,VP,VR COMMODORE,VN,VP,VR COMMODORE,VN,VP,VR COMMODORE,VS,VT COMMODORE,VS,VT COMMODORE,VT COMMODORE,VT SER II 3.8 V6 TRIPLE COIL PACK 5.0 V8 EXCEPT GROUP A 5.0 V8 EXCEPT GROUP A 3.8 V6 except Supercharged 3.8 V6 SUPERCHARGED 5.0 V8 (HOLDEN ENGINE) GEN III 5.7 (CHEVROLET) 1990 ON 1989 ON SUIT BRACKETS 1995 1996 ON 1997 ON 1999 AU6_002 AU8_017 AU8_051 AU6_086 AU6_119 AU8_073 AU8_079 Model Engine Year Part No FRONTERA GEMINI GEMINI GROUP A,VL 2.2 16 VALVE UE S30 FWD RWD 5.0 V8 2000 1985-87 1975-85 1988 AU4_340 5 AU4_027 AU4_028 AU8_018 GROUP A,VN HT TO VB HT TO VB HT TO VB JACKEROO JACKEROO JACKEROO NOVA, LE,LF 5.0 V8 V8 253,308 V8 253,308 V8 253,308 2.4 2.6 EFI 3.2 V6 6VD1 1.6 CARBY 4AF 1990 1969-80 R/A AT DISY SUIT BRACKETS 1983 1988-92 1992-97 1989-94 AU8_019 AU8_014 AU8_077 AU8_081 AU4_302 AU4_198 AU6_078 5 AU4_175 NOVA, LF,LG PIAZZA RODEO RODEO SHUTTLE STATESMAN STATESMAN STATESMAN STATESMAN,HQ SUNBIRD WB 1.8 7AFE TURBO 2.2 EFI 2.6 EFI 1.8 3.8 V6 (NON SUPERCHARGED) 3.8 V6 SUPERCHARGED 5.7 LITRE GEN 3 350 V8 FACT. P/STEER 1.9 STARFIRE 4.2,4.9,5.0 CARBY 1991-96 ALL 6/98 ON 1988-98 1982-87 VS 3/95 ON VS 2, - WH WH 6/99 ON 1971-74 1978-80 1980-85 AU4_329 2 AU4_231 AU4_330 AU4_198 AU4_026 AU6_086 AU6_119 AU8_079 AU8_020 AU4_029 AU8_016 NOTES: 2. original. leads are 5mm 3. distributor cap faces guard 4. distributor cap faces bonnet 5. with distributorlessignition Copyright© 2001 Thundercords. Notes
Similar documents
Magnecor catalog and price list
Renault. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 Rolls-Royce and Bentley. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ...
More informationMT. VERNON PELLET STOVE ADVANCED ENERGY (AE) Models:
URXWHFRUGXQGHURULQIURQWRIDSSOLDQFH '$1*(5 5LVN RI HOHFWULFDO VKRFN 'LVFRQQHFW SRZHU VXSSO\ EHIRUH VHUYLFLQJ 5HSODFH JODVV RQO\ ZLWK PP FHUDPLF DYDLODEOH IURP \RXU...
More informationMT VERNON PELLET INSERT ADVANCED ENERGY (AE) Owner`s
2ZQHU¶V0DQXDO ,QVWDOODWLRQDQG2SHUDWLRQ
More information