ŻNEW Ż - TechRentals

Comments

Transcription

ŻNEW Ż - TechRentals
ST%$)4)/.
6OLUME)SSUE
2%.4!,
3%26)#%3
#!4!,/'5%
4%34-%!352%-%.4
4 % # ( 2 % . 4! , 3
4%34-%!352%-%.4
0/7%2-%!352%-%.4
! . $ ! . ! ,9 3 ) 3
% . 6 ) 2 / . - % . 4 ( % ! ,4 ( 3 ! & % 4 9
) 4 4 2 ! ) . ) . ' ! . $
0 2 % 3 % . 4!4 ) / . 3 / , 5 4 ) / . 3
2 % 4! ) , 3 4 / # + # / . 4 2 / ,
"%!2#/- / 4 / 2 / , ! 4 7 / 7 !9 2 ! $ ) / 3 ! , % 3
3 !4 % , , ) 4 % 0 ( / . % 3
" 2 / ! $ " ! . $ # / - - 5 . ) # !4 ) / . 3 3/,54)/.3
%.').%%2).'3%26)#%3
! 5 $ ) / 6 ) 3 5 ! , ) 4 0 2 % 3 % . 4!4 ) / .
# / - - 5 . ) # !4 ) / . 3
Whenever you have need for…
Test & Measurement Instruments
Computers, Business Equipment and Point of Sale
Voice and Data Communications
TR Services
...just ask TECHRENTALS for the solution
Rent or Buy?
Rental, short and long term, for a number of reasons can be more attractive than purchasing equipment. Rental conserves capital and stretches budgets by
not investing cash in equipment that may be used occasionally.
5HQWDOLVVLPSOHDQGÀH[LEOH<RXJHWZKDW\RXQHHGZKHQ\RXQHHGLWDQGZKHQ\RXDUH¿QLVKHG\RXVLPSO\UHWXUQWKHHTXLSPHQW5HQWDOFDQSURYLGHH[WUD
equipment for peak demands or can enable equipment to be evaluated before purchase.
Great Service and Support
7(&+5(17$/6KDVH[WHQVLYHUHQWDOVDOHVVHUYLFHDQGPDLQWHQDQFHFDSDELOLWLHVLQDOOWKHPDMRUFHQWUHVLQ$XVWUDOLD1HZ=HDODQGDQG6($VLD
The Latest Models
7(&+5(17$/6DVWKHOHDGHULQWKHUHQWDOLQGXVWU\LVDGGLQJPLOOLRQVRIGROODUVZRUWKRIQHZHTXLSPHQWWRRXULQYHQWRU\HYHU\\HDUWRHQVXUHZHKDYHWKH
HTXLSPHQWWKDW\RXQHHG7KHWHFKQRORJ\\RXQHHGWRGD\LVSUREDEO\DOUHDG\DSDUWRIRXULQWHUQDWLRQDOUHQWDOÀHHWDQGUHDGLO\DYDLODEOHIRU\RXULPPHGLDWH
XVH,IWKHHTXLSPHQW\RXUHTXLUHLVQRW\HWOLVWHGWKHQZHZLOOHQGHDYRXUWRVRXUFHLWIRU\RX
TR Services
7(&+5(17$/6RIIHUVRXUFXVWRPHUVPRUHWKDQMXVWUHQWDO75Services refers to our range of value added programs designed to assist you in your rental
needs.
Whether you need:
x
x
x
x
x
x
x
x
'DWD'RZQORDG6HUYLFHV
On-site Setup
(TXLSPHQW&RQ¿JXUDWLRQ
Electrical Safety Testing
Customised Programming
Trained Operators
Calibration
Total Asset Management
TR ServicesFDQWDLORUDSDFNDJHVSHFL¿FDOO\GHVLJQHGIRU\RXUUHTXLUHPHQWV$IWHU\HDUVLQWKHEXVLQHVV7HFK5HQWDOVLVZHOOSODFHGWRKDQGOH\RXUPRVW
FRPSOH[UHTXLUHPHQWV1H[WWLPH\RXFRQWDFWXVEHVXUHWRDVNDERXW75Services.
Purchase Options
‘Rental Purchase Option’ SODQVPD\EHFRQVLGHUHGZKHQIXWXUHUHTXLUHPHQWVIRUHTXLSPHQWFDQQRWEHFOHDUO\GH¿QHG$VNRXUIULHQGO\DQGH[SHULHQFHGVWDII
IRU\RXUEHVWVROXWLRQZKHQ\RXFDOOµRental Purchase Option’ plans must be arranged at the inception of the rental and a minimum rental period may apply.
6WDQGDUGUHQWDOVPD\EHFRQYHUWHGWRDµRental Purchase Option’SODQE\PXWXDODJUHHPHQWDWDQ\WLPHDIWHUWKH¿UVWPRQWKRIUHQWDOEXWPD\UHTXLUHDUHYLVLRQ
LQWKHPRQWKO\UDWHµRental Purchase Option’ plans are available for business purposes only.
Damage Waiver
)RU\RXUSHDFHRIPLQGDGDPDJHZDLYHULVDYDLODEOHWRFRYHULQDGYHUWHQWGDPDJHZKHQ\RXRU\RXUVWDIIDUHKDQGOLQJVWDWHRIWKHDUWHTXLSPHQW)RU
DVPDOOIHH\RXFDQJUHDWO\UHGXFH\RXU¿QDQFLDOOLDELOLW\IRUDFFLGHQWDOGDPDJHWRUHQWHGHTXLSPHQW)XOOGHWDLOVRQWKLVVHUYLFHZLOOEHH[SODLQHGDWWKH
time of ordering.
Tax Deductions
5HQWDOSD\PHQWVPD\EHIXOO\WD[GHGXFWLEOHLQWKH\HDURIH[SHQVHZKHUHDVSXUFKDVHGHTXLSPHQWLVW\SLFDOO\GHSUHFLDWHGRYHUDORQJHUWLPHIUDPH5HPHPEHU
WRFKHFNZLWK\RXUDFFRXQWDQWDVWKHUHDUHJHQHUDOO\WD[DWLRQDGYDQWDJHVDSSOLHGWRRIIEDODQFHVKHHWH[SHQVHVVXFKDVUHQWDO
TR Corporation Headquarters
Blackburn North
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
1
Quick Find Solution Guide
Test & Measurement
Equipment
8
General Electronic & Test
8
RF & Microwave
17
Low Frequency
29
TV Test Equipment
30
Data, Network &
Telecommunications
31
Cable/Pipe Testers & Locators 39
Power Analysis
41
Data Acquistion & Recording 65
Physical Measurement
73
Non-Destructive Testing
83
General Industrial Equipment 90
Temp & Humidity Measuremt 97
Security Equipment
100
Flow Meter
102
Air Conditioning & Air Quality 106
OH&S
111
Gas Analysis & Monitoring
115
General Environment
118
Laboratory
120
Business Equipment
121
Audio Visual
Scanners
Cameras & Accessories
Notebook Computers
Desktop Computers
PDA, Servers & Monitors
Network Products & Fax
Point of Sale
Printers
122
125
126
127
129
130
133
134
137
Bearcom
140
Radio Solutions
Service & maintenance
Engineering & System Design
Rental Solutions
Glossary of Radio Rentals
General Index
164
Advertising & Art Production
cameras digital still & video
125, 126
colour laser printers
137
computers desktop & notebook
127, 129
data and video projectors
122
¿OPVFDQQHUV
graphics monitors
130, 132
large format printers
138
studio lighting kits
122
2
Contents
Agriculture Maintenance &
Management
cameras & video
125, 126
chemical analysis
120
computers
127, 129
data logging
65
environmental testing
115
humidity measurement
106
light & UV measurement
111
OLTXLGJDVÀRZPHDVXUHPHQW microscopes
79
pressure measurement
74
temperature measurement
97
weather recording
110
Air Conditioning & Refrigeration
- Maintenance
air conditioning system balance 109
DLUÀRZPHDVXUHPHQW
air quality testing
106
data logging
65
dust detection
106
gas analysis & monitoring
115
gas leakage detectors
110
humidity measurement
74
OLTXLGJDVÀRZPHDVXUHPHQW noise analysis
112
pressure measurement
73
temperature measurement
97
temperature/humidity/barometric
recording
97
vibration measurement
83
Architecture
cameras digital still & video
computers desktop & notebook
¿OPVFDQQHUV
large format printers
studio lighting kits
125, 126
127, 129
138
122
Archiving - Electronic
CD authoring
122
DVD authoring
122
high speed document scanning 122
Audio Visual & Presentation
audio systems
cameras - digital still & video
data projection systems
electronic whiteboards
large format printers
overhead projection
screens
122
126
122
122
138
122
122
Automotive Engineering &
Design
DLUÀRZPHDVXUHPHQW
air quality testing
106
data logging
65
dc power supplies
13
electrical insulation testing
42
endoscopes
77
force gauges
79
gas analysis & monitoring
115
high speed video recording
73
humidity measure & recording 97
LQVWUXPHQWDWLRQDPSOL¿HUV
light & UV measurement
111
OLTXLGJDVÀRZPHDVXUHPHQWV
microscopes
79
noise analysis
112
non-destructive testing (NDT)
83
pressure & vacuum measure
73
tachometers & stroboscopes
76
temp measure & recording
97
thermal imaging camera
99
vibration measurement
83
Building & Construction
ac power sources/inverters/
generators
64
DLUÀRZPHDVXUHPHQW
air quality testing
106
cable & pipe location
39
cable integrity testing
39
concrete testing
85, 86, 87, 88
distance measurement
76
electrical insulation testing
42
endoscopes
77
gas analysis & monitoring
115
hardness testing
88
humidity & moisture measure
99
light & UV measurement
111
OLTXLGJDVÀRZPHDVXUHPHQW load measurement
79
noise measurement
112
non-destructive testing (NDT)
83
pressure measurement
73
security equipment
100
temperature/humidity/barometric
recorders
97
thermal imaging cameras
99
vibration measurement
83
weather recording
110
%XVLQHVV2I¿FH(TXLSPHQW
ac generators & UPS
61
audio visual equipment
122
cameras
125
data & video projection
122
desktop computers
129
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Quick Find Solution Guide
digital & VHS video cameras
digital photography
electronic whiteboards
fax machinces
inkjet printers - photo quality
large format inkjet printers
large graphics monitors
laser printers –
monochrome or colour
network servers
network test equipment
notebook computers
personal digital assistants (PDA)
photocopiers - desktop
plasma & LCD screens
point of sale systems (POS)
scanners –
$ÀDWEHGPP¿OP
security equipment
touchscreen monitors
training, seminar & exhibition
equipment
video players
wireless network equipment
125
125
122
133
137
138
132
137
130
32
127
130
122
122
134
100
130
122
123
133
Cad Design & Production
digital cameras
high performance computers
high resolution monitors
large format printers
scanners
126
127
132
138
125
Chemical Analysis
air quality measurement
ground water logging
salinity testing
spectrophotometers
water quality testing
106
118
118
120
118
Data Communications
ac generators & UPS
dc power supplies
¿EUHRSWLFVFDEOH
testing & splicing
LAN analysis and management
LAN cable testing
WAN analysis & management
Defence, Police, Fire &
Emergency
ac generators & UPS
ac power sources/inverters/
generators
DLUÀRZPHDVXUHPHQW
air quality
cable, pipe testing & location
data logging
61
13
36
32
34
34
61
64
106
39
65
Contents
endoscopes
environmental - testing
gas analysis & monitoring
high speed video capture
light & UV measurement
microscopes
noise & vibraton analysis
non-destructive testing (NDT)
notebook computers
sound signal analysis
spectroscopy
temperature measurement
thermal imaging cameras
TV test equipment
weather recording
77
115
115
73
111
79
112
83
127
111
120
97
99
30
110
Desktop Publishing
colour laser printing
137
digital cameras
126
high performance
computers
127, 129
LCD hi-res monitors
132
portrait monitors
132
VFDQQHUV¿OP$ÀDWEHG
wireless network equipment
133
Education
audio systems
122
cameras - still & video
125, 126
colour printers - ink & laser
137
desktop computers
129
electronic whiteboards
122
LCD hi-res monitors
132
network equipment
133
notebook computers
127
projection equipment data & video
122
security & surveillance
equipment
100
Electrical – Industrial & Domestic
ac generators & UPS
61
ac power analysis & recording 41
ac power sources/inverters/
generators
64
cable, pipe testing & location
39
current injection
60
data logging
65
dc power supplies
13
digital storage oscilloscope
8
electrical calibrators
15
electrical transducers
58
¿HOGVWUHQJWKPHDVXUHPHQW
general electrical testing
60
high voltage testing
10, 57
LQVWUXPHQWDWLRQDPSOL¿HUV
insulation testing
41
PDJQHWLF¿HOGPHDVXUHPHQW
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
multimeters & electrometers
phase meters
power transformers
temperature measurement
thermal imaging cameras
voltage current recording
Emergency Services
ac generators & UPS
ac power sources/inverters/
generators
DLUÀRZPHDVXUHPHQW
air quality
cable, pipe testing & location
data logging
endoscopes
environmental - testing
gas analysis & monitoring
high speed video capture
light & UV measurement
microscopes
noise & vibraton analysis
non-destructive testing (NDT)
notebook computers
RF & microwave testing
equipment
sound signal analysis
spectroscopy
temperature measurement
thermal imaging cameras
TV test equipment
weather recording
12
29
63
97
99
71
61
64
106
39
65
77
115
115
73
111
79
112
83
127
17
111
120
97
99
30
110
Entertainment
audio systems
122
cameras - video & still
125, 126
computers
127, 129
portable projection screens
122
projection equipment
122
video recorders
125
Environmental Testing
DLUÀRZPHDVXUHPHQW
air quality measurement
106
data logging
65
electrochemistry
118
gas analysis & monitoring
115
humidity & moisture
measurement
99
light & UV measurement
111
OLTXLGJDVÀRZPHDVXUHPHQW noise & sound
112
spectroscopy
120
temperature measurement
97
temperature/humidity/barometric
recorders
97
thermal imaging cameras
99
vibration analysis
83
TECHRENTALS
3
Quick Find Solution Guide
water quality testing
weather recording stations
118
110
Event Management
ID card printers
metal detectors
security & surveillance
wireless network equipment
137
101
100
133
Food Manufacturing
air quality monitoring
endoscopes
high speed video capture
humidity measurement
& logging
metal detectors
moisture meters
process control test
equipment
scales & balances
temperature measurement
& logging
water quality testing
106
77
73
97
100
99
90, 91
81
97
118
Gas Industry
cable, pipe testing & location
39
data logging
65
gas analysis & monitoring
115
high speed video capture
73
humidity & moisture
measurement
99
OLTXLGJDVÀRZPHDVXUHPHQW non-destructive testing (NDT)
83
OH&S & environmental testing
- general
114
pressure vacuum gauges
& recorders
73
spectroscopy
120
thermal imaging cameras
99
voltage current recording
71
General Electronics
Test Equipment
data logging
dc power supplies
digital storage oscilloscopes
distortion analysers
electrical calibrators
EMC test equipment
¿HOGVWUHQJWKPHWHUV
& antennas
frequency counters
frequency response analysers
function generators
LQVWUXPHQWDWLRQDPSOL¿HUV
LCR meters
LF signal generators
logic/analysers/testers
4
65
13
8
29
15
24
23
16
15
14
14
29
15
Contents
memory recorders
multimeters & electrometers
non-storage oscilloscopes
phase meters
probes & accessories
PROM programmers
pulse generators
strip chart recorders
tape recorders
TV test equipment
ultrasonic baths
voltage current recorders
68
12
9
29
10
15
14
71
72
30
95
71
Graphics Arts
see desktop publishing section
Health & Safety
DLUÀRZPHDVXUHPHQW
air quality measurement
106
data logging
65
electrical insulation testing
42
electrochemistry
118
gas analysis & monitoring
115
light & UV measurement
111
PDJQHWLF¿HOGPHDVXUHPHQW
– Gauss, Tesla
41
noise & sound analysis
112
OH&S & environmental compliance
testing
114
vibration analysis
83
water quality measurement
118
IT Departments
ac generators & UPS
61
air conditioning testing
106
DLUÀRZPHDVXUHPHQW
cable location
39
computers & servers 127, 129, 130
data comms test
equipment – LAN/WAN
34
printers
137
security & surveillance
equipment
100
temperature measurement
& recording
97
wireless nteworking
133
Local Government
ac generators & UPS
DLUÀRZPHDVXUHPHQW
air quality testing
cable, pipe testing & location
concrete testing equipment
data logging
electrical insulation testing
electrical testers
electrochemistry
gas analysis
61
106
39
85
65
42
60
118
115
LAN analysis & monitoring
LAN/WAN analysers
light & UV measurement
PDJQHWLF¿HOGPHWHUV
noise & sound analysis
OH&S & environmental
equipment
temperature measurement
thermal imaging cameras
vibration analysis
WAN analysers
water quality testing
32
34
111
112
114
97
99
83
34
118
Manufacturing & Process
Industry
ac generators & UPS
61
cable, pipe testing & location
39
data logging
65
distance mesurement
76
endoscopes
77
gloss mesurement
85
hardness testing
88
high speed video capture
73
humidity & moisture
measurement
99
inclinometers
76
light & UV measurement
111
OLTXLGJDVÀRZPHVXUHPHQW materials testing
80, 120
memory recorders
68
microscopes
79
noise & sound analysis
112
non-storage oscilloscopes
9
OH&S & environmental general
114
position transducers
75
pressure & humidity
measurement
74
pressure vacuum measurement 73
PROM programmers
15
scales & balances
81
strip chart recorders
71
tachometers/stroboscopes
76
tape recorders
72
temperature measurement
97
temperature/humidity recorders 97
thermal imaging cameras
99
vibration analysis
83
Marine
dc & ac power testing
41
endoscopes
77
OLTXLGJDVÀRZPHDVXUHPHQW non-destructive testing (NDT)
83
see general electronics test
equipment
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Quick Find Solution Guide
Mining & Exploration
ac generators & UPS
61
DLUÀRZPHDVXUHPHQW
air quality measurement
106
cable,pipe testers & locators
39
data logging
65
dc power supplies
13
distance measurement
& surveying
76
electrochemistry
118
endoscopes
77
force measurement
79
gas analysis
115
high speed video capture
73
humidity & moisture
measurement
99
inclinometers
76
light & UV measurement
111
OLTXLGJDVÀRZPHDVXUHPHQW load measurement
79
Logic analysers & testers
15
memory recorders
68
microscopes
79
noise & sound analysis
112
non-destructive testing (NDT)
83
OH&S & environment compliance
testing
114
power analysis & recording
41
pressure & humidity
measurement
74
pressure vacuum
gauges/recorders
73
protection relay testing
56
5)DPSOL¿HUV
RF signal ge nerators
17
RF sweep generators
17
spectroscopy
120
strip chart recorders
71
telecommunications testing
24
temperature measurement
97
temperature/humidity/
barometric measurement
97
thermal imaging cameras
99
vibration & alignment analysis 83
weather monitoring &
recording
110
Non-Destructive Testing
acceleration measurement
83
cover meters, 87
gloss measurement, 85
hardness testing, 88
OLTXLGJDVÀRZPHDVXUHPHQW
shock testing, 83
thickness measurement, 85
vibration measurement, 83
Contents
Occupational Health & Safety
DLUÀRZPHDVXUHPHQW
air quality measurement
106
data logging
65
electrical insultation testing
42
electrochemistry
118
gas analysis & monitoring
115
light & UV measurement
111
PDJQHWLF¿HOGPHDVXUHPHQW
– Gauss, Tesla
41
noise & sound analysis
112
OH&S & environment
compliance testing
114
vibration analysis
83
water quality measurement
118
2I¿FH(TXLSPHQW
VHHEXVLQHVVRI¿FHHTXLSPHQW
section
Petrochemical
data logging
65
electrochemistry
118
force measurement
79
gas analysis & monitoring
115
high speed video capture
73
OLTXLGJDVÀRZPHDVXUHPHQW load measurement
79
memory recorders
68
microscopes
79
non-destructive testing (NDT)
83
pressure & humidity
measurement
74
pressure vacuum
gauges/recorders
73
strip chart recorders
71
tachometers/stroboscopes
76
temperature measurement
97
thermal imaging cameras
99
vibration & alignment analysis 83
water quality measurement
118
Photography & Video
colour printers – photo quality
digital editing kits
digital still cameras
digital video cameras
memory cards & readers
studio lighting
VHS cameras
137
122
126
125
133
122
125
3OXPELQJ*DV¿WWLQJ
see ‘water, waste water & plumbing
section
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Power Generation & Distribution
cable, pipe testers & locators39
combustion gas analysis
& monitoring
115
current injectors
60
data logging
65
distance measurement
& surveying
76
endoscopes
77
force measurement
79
hi pot testing
57
high speed video capture
73
humidity & moisture
measurement
99
inclinometers
76
insulating testing
42
LCR meters
14
OLTXLGJDVÀRZPHDVXUHPHQW load measurement
79
PDJQHWLF¿HOGPHDVXUHPHQW
– Gauss, Tesla
41
noise & sound analysis
112
non-destructive testing (NDT)
83
power analysis & recording
41
protection relay testing
56
strip chart recorders
71
tachometers/stroboscopes
76
temperature/humidity/
barometric measurement
97
thermal imaging cameras
99
vibration & alignment analysis 83
voltage current recorders
71
weather monitoring
& recording
110
Presentation
audio systems
cameras digital still & video
data projection systems
electronic whiteboards
large format printers
overhead projection
screens
122
125, 126
122
122
138
122
122
Quality Control
see ‘manufacturing & process
industry’ section
Refrigeration
see ‘air conditioning & refrigeration’
section
Retail
barcode scanners
cash drawers
cash registers
134
134
134
TECHRENTALS
5
Quick Find Solution Guide
computers desktop & notebook
127, 129
ID card printers
137
point of sale equipment (POS) 134
security & surveillance
equipment
100
RF & Microwave
communications test sets
EMC test equipment
¿HOGVWUHQJWKPHWHUV
& antennas
¿OWHUV
frequency counters
logic analysers & testers
modulation meters
power meters
5)DPSOL¿HUV
RF signal generators
RF sweep generators
spectrum analysers high frequency
telecommunications testing
TV test equipment
24
24
23
16
15
24
25
17
17
18
24
30
Road, Rail & Civil Construction
ac power sources/
inverters/generators
64
DLUÀRZPHDVXUHPHQW
air quality measurement
106
cable, pipe testing & location
39
concrete testing
equipment
85, 86, 87
dc power supplies
13
distance measurement
& surveying
76
electrochemistry
118
force measurement
79
gas analysis & monitoring
115
hardness testers
88
inclinometers
76
load measurement
79
PDJQHWLF¿HOGPHDVXUHPHQW
– Gauss, Tesla
41
noise & sound analysis
112
non-destructive testing (NDT)
83
power analysis & recording
41
vibration & alignment analysis 83
water quality testing
118
weather monitoring
& recording
110
Secretarial
VHHµEXVLQHVVRI¿FHHTXLSPHQW¶
section
6
Contents
Security & Crowd Crontrol
bug detectors
100
cameras digital still & video
125, 126
CCTV
100
metal detectors –
personal & walk thru
100
photo ID card printers
& encoders
137
surveillance equipment
100
thermal sensing cameras
99
Travel & Leisure
cameras - video & still
dvd players
metal detectors
security equipment
video projections
Signwriting
large format printers
vinyl cutters
Water, Wastewater & Plumbing
data logging
65
distance measurement
& surveying
76
electrochemistry
118
endoscopes
77
gas analysis & monitoring
115
inclinometers
76
OLTXLGJDVÀRZPHDVXUHPHQW pipe locators
39
water quality testing
118
138
122
Telecommunications
distortion analysers
¿EUHRSWLFVWHVWLQJVSOLFLQJ
frequency counters
LAN/WAN analysis
logic analysers & testers
pulse generators
RF & microwave
5)DPSOL¿HUV
RF signal generators
RF sweep generators
WAN analysers
Training
audio systems
cameras video & still
colour printers
electronic whiteboards
LCD monitors
networking equipment
notebook computers
projection equipment data & video
security & surveillance
29
16
34
15
14
17
17
17
34
122
Video Production
digital editing kits
digital video cameras
studio lighting kits
Workplace Environment
DLUÀRZPHDVXUHPHQW
air quality measurement
data logging
electrical insulating testing
electrochemistry,
gas analysis & monitoring
125, 126
137
122
132
133
127
122
100
Transport
automotive general testing
85
data logging
65
dc power supplies
13
distance measurement, 76
endoscopes
77
load measurement
79
noise & sound analysis
112
non-destructive testing (NDT)
83
scales & balances
81
thermal imaging cameras
99
vibration & alignment analysis 83
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
125, 126
122
100, 101
100
122
122
125
122
106
65
42
118
115
Your Choices
Rental Periods to Suit You...
Short Term
)RU\RXUÀH[LELOLW\DQGHDV\SODQQLQJZHRIIHUUHQWDOSHULRGVIURPRQHGD\WRH[WHQGHGGXUDWLRQVDWDWWUDFWLYHUDWHV
7KHUDWHLVDGMXVWHGWRUHÀHFWWKHOHQJWKRIWKHKLUHWKDW\RXQRPLQDWH
Longer Term
For rental bookings of three months or more it is possible to negotiate an attractive hire rate providing that it is agreed
at the beginning.
Minimum rental charges apply to most assets.
5HQWDOFKDUJHVH[FOXGH
*RYHUQPHQW6WDPS'XW\
*67
Consumable items
Delivery
Damage Waiver Fees
TECHRENTALS can arrange :- Delivery
Installation
µ(QGRI5HQW¶&ROOHFWLRQ
You can Rent with an Option to Purchase
:KHQ\RXHQWHULQWRDUHQWDODJUHHPHQWZLWKDSXUFKDVHRSWLRQ\RXPD\H[HUFLVH\RXURSWLRQDQGSXUFKDVHWKHUHQWHGHTXLSPHQWDIWHUWKH
DJUHHGPLQLPXPUHQWDOWHUP7KHW\SLFDOSHULRGLVPRQWKVEXWVFKHPHVFDQEHWDLORUHGWRVXLW\RXU¿QDQFLDOSUHIHUHQFH
5HQWDO3XUFKDVH2SWLRQLVDQLGHDODUUDQJHPHQWIRUFRPSDQLHVZKRQHHGWRFRQVHUYHFDSLWDODOORFDWHH[SHQGLWXUHSUHVHUYHFUHGLWDQGRSWLPLVH
the requirements of asset management over the longer term.
'XULQJWKHUHQWDOSHULRGWKHHTXLSPHQWLVVXEMHFWWRDOOWKHEHQH¿WVDQGVXSSRUWWKDWJRZLWKDQ\7(&+5(17$/6UHQW
6KRXOG\RXGHFLGHQRWWRH[HUFLVH\RXUSXUFKDVHRSWLRQZHVLPSO\H[WHQGWKHUHQWXQWLO\RXFKRRVHWRUHWXUQWKHDVVHW
2QFH\RXURSWLRQWRSXUFKDVHKDVEHHQH[HUFLVHGWKHHTXLSPHQWLV\RXUV
)RUWKHHDVLHVWPRVWFRVWHIIHFWLYHDQGZRUU\IUHHZD\WRJHWWKHMREGRQHDQGPDQDJH\RXUFDSLWDOH[SHQGLWXUHDQGFDVKÀRZWDONWRD
TECHRENTALS consultant today.
Rental Purchase Option is only available to business users.
TR Services
6HOHFWIURPDUDQJHRIWDLORUHGSDFNDJHVFRPELQLQJUHQWDOSURGXFWDQGH[SHUWVHUYLFHVWRVROYH\RXUVSHFL¿F
requirements.
,QFOXGLQJ
SUHGHOLYHU\FRQ¿JXUDWLRQ
on-site setup & operation
GDWDGRZQORDG
operator training
DZLGHUDQJHRIRWKHUVHUYLFHVWRVDYH\RXWLPH
*LYHXVDFDOOWRH[SORUHKRZZHFDQKHOS\RXVDYH
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
7
General Electronic Test Equipment
Test & Measurement
Digital Storage Oscilloscopes
Model
Channels
TEK,TDS2014
TDS,TPS2014
YEW,DL1540L
4
TEK,TDS2024
TEK,TDS3052/B
TEK,TDS3054
TEK,TDS3054B
Bandwidth
(MHz)
Sampling
100
1GS/s
150
200MS/s
Inbuilt printer and FDD. FFT. 1.2Mb memory (2, 4 ch).
FFT and GO/NOGO waveform functions.
GPIB
200
2GS/s
Colour, automatic measurements, FFT
TDS2CMA,
GPIB, RS232
Extensive automatic measurements. Inbuilt FDD.
Centronics,
RS232, GPIB
Extensive automatic measurements. Inbuilt FDD.
Some assets include FFT, advanced trigger modules.
Centronics,
RS232, GPIB
5GS/s
100
500MS/s
4
TEK,THS720A
Colour, automatic measurements.
TDS2CMA,
GPIB, RS232
AC/DC battery portable. Multimeter functions.
TEK,THS720P
TEK,THS730A
Interfaces
Colour, battery operated, automatic & power measurements
2
500
Features
AC/DC battery portable. Multimeter functions.
Mains harmonic and power measurement.
2
AC/DC battery portable. Multimeter functions.
200
FLU,199CSCOPEMETER
2.5GS/s
Colour, DMM, auto screen capture, electrical power measurements, PC software.
FLU,196
2
100
1GS/s
Colour, DMM, auto screen capture
HP,6104A
4
1,000
4GS/s
16 channel logic analyser, serial trigger, usb, i2C, SPI, LIN, CAN, HDTV with LAN,
USB, GPIB, VGA interfaces
Software for Tektronix oscilloscopes.
Acquires and exports to common applications.
TEK,WAVESTAR
Tektronix TDS2014 100MHz 4 Channel Colour DSO
TEK,TDS2014
Tektronix TDS2024 4 Channel 200MHz Colour DSO
AU
TEK,TDS2024
Sampling rate 2GS/s. Sensitivity 2mV~5V/div. Bandwidth limited to 20MHz when
set to <5 mV/div. Automatic waveform measurements include period, frequency,
+width, -width, rise time, fall time, max, min, peak to peak, mean and RMS. Includes
FFT Analysis as standard, TDS2CMA GPIB & RS232 interfaces.
Tektronix TPS2014 100MHz 4 Channel Powerscope
Tektronix TDS3052 2 Channel 500MHz DSO
TEK,TPS2014
AU
6DPSOLQJUDWH*6V$OOFKDQQHOVLVRODWHGIRUÀRDWLQJPHDVXUHPHQWV6HQVLWLYLW\
2mV~5V/div. Bandwidth limited to 20MHz when set to <5mV/div. Measurements for
current and voltage distortion and their spectral content, harmonics, instantaneous
power, power factor and switching loss. Automatic waveform measurements
include period, frequency, +width, -width, rise time, fall time, max, min, peak to
peak, mean & RMS. Includes FFT Analysis as standard. Power analysis package,
low & high voltage power probes (P5120 probes: dc to 200MHz, 1,000Vrms etc).
Battery operation.
TEK,TDS3052
Tektronix TDS3052B 2 Channel 500MHz DSO
TEK,TDS3052B
YEW,DL1540L
AU/MY
,QEXLOWSULQWHU)''$PSOL¿HUEDQGZLGWK0+]6DPSOLQJUDWH06V
Sample memory of 2Mword for 2 channels & 1Mword for 4 channels. BMP, TIF
HPGL, postscript & comma separated waveform formats. GO/NOGO testing
of waveforms. External sample rate input - useful for rotating machinery work.
Waveform computations including FFT. Averaging function to reduce the S/N ratio,
accumulate function. GPIB interface.
AU
Sampling rate 5GS/s. Memory length 10k. Sensitivity 1mV~10v/div. Time base
1ns~10s/div. Trigger functions include video. Automatic waveform measurements.
FFT Analysis. Wave alert & e-scope web based control. Colour LCD with digital
phosphor function. Centronics, GPIB (IEEE-488), Ethernet, and RS232 interfaces.
In-built FDD.
TEK,TDS3054
Yokogawa DL1540L 150MHz 4 Channel DSO
AU
Sampling rate 5GS/s. Memory length 10k. Sensitivity 1mV~10v/div. Time base
1ns~10s/div. Trigger functions include video. Automatic waveform measurements.
Colour LCD with digital phosphor function. Centronics, GPIB (IEEE-488) & RS232
interfaces. In-built FDD.
Tektronix TDS3054 500MHz 4 Channel DSO
8
AU
Sampling rate 1GS/s. Sensitivity 2mV~5V/div. Bandwidth limited to 20MHz when
set to <5 mV/div. Automatic waveform measurements include period, frequency, +
width, - width, rise time, fall time, max, min, peak to peak, mean and RMS. Includes
FFT Analysis as standard, TDS2CMA GPIB & RS232 interfaces.
AU/NZ
Sampling rate 5GS/s. Memory length 10k. Sensitivity 1mV~10V/div. Time base
1ns~10s/div. Trigger functions include logic, advanced video, pulse width & glitch,
plus slew rate. Automatic waveform measurements. Colour LCD with digital
phosphor function. FFT, integration and differential functions. Centronics, GPIB
(IEEE-488) & RS232 interfaces. TDS3FFT (FFT analysis module) & TDS3TRG
(advanced trigger module) included. In-built FDD.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Electronic Test Equipment
Test & Measurement
Digital Storage Oscilloscopes (cont’d)
Fluke 196 100 MHz Scopemeter
Ż1(:Ż
Tektronix TDS3054B 500MHz 4 Channel DSO
TEK,TDS3054B
FLU,196
AU/NZ
500 MHz 4 channel digital storage oscilloscope. 5 GS/s sampling rate. Memory
length 10 k. Sensitivity 1 mV - 10 v/div. Time base 1 ns - 10 s/div. Trigger
functions include video. Extensive automatic waveform measurements. Including
FFT, TV trigger, advanced analysis (TDS3AAM), and limit testing (TDS3LIM).
Colour LCD with digital phosphor function. Comes with TDS3BATB for battery
operation. VGA, GPIB (IEEE-488), and RS232 interfaces included (TDS3GV).
,QEXLOWÀRSS\GLVFGULYH
NZ
100MHz two channel portable oscilloscope. 1GS/S real-time sampling per input.
Connect & view automatic triggering, a full range of manual trigger modes plus
external triggering. 27,500 points per input record length using Scoperecord™
mode. Automatic capture and replay of 100 screens. Automatic waveform
PHDVXUHPHQWV&XUVRUV]RRPDQGUHDOWLPHFORFNN9LQGHSHQGHQWO\ÀRDWLQJ
isolated inputs. Includes a 5000 count true-rms multimeter and a Trendplot™
paperless recorder.
Fluke 199C Scopemeter 200MHz Hand-held
FLU,199C-SCOPEMETER
FLU,199
AU
NZ
200MHz bandwidth 2 channel colour digital oscilloscope with DMM feature. Colour
display 14.4cm with persistence feature. Real time sampling 2.5GS/s. Input
sensitivity 5mV/div~100V/div. Glitch capture 3ns using pulse width triggering.
Timebase range in scope mode 5ns/div~2min/div. Trigger types auto, free run,
single shot, edge, delay, video, video line, selectable pulse width & external.
Automatic capture and replay of last 100 screens. Measures electrical power
properties such as VA, VAR, etc. Inputs are isolated (1kV CAT II/600V CAT III).
PC software. Battery operation 4h.
Tektronix THS720A 100MHz ac/dc DSO
TEK,THS720A
AU
Dual channel battery portable digital storage oscilloscope with digital multimeter
facilities. Max sampling rate 500MS/s. Suited to high voltage applications
GHSHQGLQJRQSUREHVHOHFWLRQ0D[LQSXW9UPVPD[ÀRDW9UPV:DYHIRUP
processing including watts calculation. Video trigger. RS232 interface. Wavestar
PC software optional.
Tektronix THS720P Portable Power DSO
TEK,THS720P
Ż1(:Ż
HP/Agilent MSO6104A 1GHz Digital Oscilloscope with Logic
HP,6104A
AU
Agilent 6104A 1 GHz 4 + 16 channel mixed signal oscilloscope (MSO). 4Gsa/s.
XGA Colour display updates 100,000 waveforms/sec with 256 levels intensity. 4
analogue channels and 16 logic channels. Deep memory. 8 digit frequency counter
function. Triggering includes video, HDTV, I2C, SPI, LIN, CAN, and USB. FFT
analysis included. LAN, USB, GPIB, & XGA interfaces standard.
AU
Dual channel battery portable digital storage oscilloscope with digital multimeter
facilities. Suited to power applications. Measures harmonics to 31st of 50Hz.
Power measurement functions - W, VA, VAR, V & I rms and peak, THD, PF, DPF,
and phase difference between voltage and current. Max instrument input 640V rms,
PD[ÀRDW90D[SUREHLQSXW9UPV3:0PRWRUGULYHWULJJHU56
interface. Use TEK,WAVESTAR software for PC interface. Current clamp is not
included. Suggested type LEM,LEMFLEX II range 30, 300, 3000A.
Tektronix THS730A 200 MHz Battery DSO
TEK,THS730A
AU
Dual channel battery portable digital storage oscilloscope with digital multimetre
facilities. Max sampling rate 1GS/s. Suited to high voltage applications depending
RQSUREHVHOHFWLRQ0D[LQSXW9UPVPD[ÀRDW9UPV:DYHIRUPSURFHVVLQJ
including watts calculations. Video trigger. RS232 interface. Use TEK,WAVESTAR
software for PC interface.
7HNWURQL[:DYHVWDU6RIWZDUHIRU7'6'62
TEK,WAVESTAR
AU
Acquires, prints, and exports waveforms and screen images as graphics images
or data values. Exports to common packages, eg. MS Word, Excel. Obtains data
via RS232, GPIB and FDD.
Non - Storage Oscilloscopes
Tektronix 300MHz Portable Oscilloscope 4 Channel
Tektronix 2205GM 40MHz Dual Trace Oscilloscope
TEK,2205GM
AU
Vertical sensitivity 5mV/div~5V/div. Timebase 0.1µsaVHFGLY[PDJQL¿HU
79OLQHDQG¿HOGWULJJHU
TEK,2465
AU
P9a9GLY'XDOWLPHEDVHZLWKGHOD\HGVZHHSSVaVGLYŸPŸ
input impedance.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
9
General Electronic Test Equipment
Test & Measurement
Probes and Accessories
Model
Type
Bandwidth
Attenuation
Voltage Max
FLU,80K-40
DC~100MHz
1:1,000
40kV dc, 28kV ac
MET,HT212-30KDC
DC
1:100
30kV dc
75MHz
1:1,000
40kV
dc to 300Hz
1,000:1
1:20, 1:200
Voltage high
TEK,P6015
COL,HV40B
ACR,SI9000
Voltage isolation
15MHz
BEL,CG-100A
Current clamp-on AC DC
dc~1kHz
TEK,P6302-CT5
Current clamp-on
20 MHz
TEK,P6158
Passive probe
30GHz
TEK,5200
Differential probe
dc to 25MHz
Current Max (A)
700V
660 rms
100
50K
1:20
1300V
See also Electrical Transducers
$JLOHQW$*3,%+3,%,(((WR86%LQWHUIDFH
HP,82357A
AU
Allows all GPIB/HPIB/IEEE488 equipment to controlled from any USB equipped
PC (not MACs). Drivers for PC. Separate software may be required for equipment
being controlled.
Fluke 80K-40 High Voltage Probe
FLU,80K-40
aN9GFRUSHDNDFN9DFUPV,QSXWUHVLVWDQFH*ŸGLYLVLRQUDWLR
1RWHLQSXWLPSHGDQFHRI'90PXVWEH0ŸRUUHDGLQJZLOOEHZURQJ
Ż1(:Ż
1DWLRQDO,QVWUXPHQWV*3,%86%,QWHUIDFHZLWK3ORWWHU6RIWZDUH
NAT,GPIB-USB-HS
AU
High speed GPIB to USB interface. Provides control of GPIB/HPIB/IEEE488
devices from a USB equipped PC (requires Win 2000 or later operating system).
Includes software to allow PC to emulate a GPIB plotter. Plotter software outputs
plots as HPGL, HPGL/2, JPEG, TIFF, BMP & WMF. Plotter software can emulate
HP 7440, HP 7470, HP 7475, HP 7550 & HP 7570 pen-plotters.
Tektronix P5200 Isolated Differential Probe
TEK,P5200
NZ
High voltage differential probe to provide a safe means of measuring circuits with
ÀRDWLQJSRWHQWLDOVXSWRN9IURPHDUWKWRJURXQGDQGXSWR9GLIIHUHQWLDO
Range settings are 1/50 & 1/500. Bandwidth: dc to 25MHz accuracy is ±3%, input
LPSHGDQFHLV0ȍS)EHWZHHQLQSXWV5LVHWLPHLVQV
7HNWURQL[33DVVLYH5)3UREHGF*+];
TEK,P6158
AU
$WWHQXDWLRQGFa*+];,QSXWUHVLVWDQFHNŸ
Metrix HT212 30kV dc High Voltage Probe
MET,HT212-30KDC
Tektronix P6015 40kV High Voltage Probe
TEK,P6015
AU
DC probe to extend the upper limits of voltmeters. Designed to be used with a
0ŸLQSXWLPSHGHQFHYROWPHWHURQWKHGFUDQJH5DWLR,IQRWD0Ÿ
input the result shown will be incorrect. Potentially LETHAL voltages: these probes
should be used by skilled operators only.
Acree SI9000 Differential Probe
Ż1(:Ż
Tektronix P6302/CT-5 High Current Oscilloscope Probe System
TEK,P6302-CT5
AU
Input probe for converting oscilloscopes, etc, to floating input for power
PHDVXUHPHQWV HWF ,QSXW DWWHQXDWLRQ ZLWK 0Ÿ LPSHGDQFH WR
earth. Bandwidth dc~15MHz. Max input 700Vac. Input range up to 700Vdc in
1/200 mode. Battery operated.
Current Probe capable of measuring currents up to 20Adc (or dc plus peak
DFZLWKEDQGZLGWKRI0+]6XSSOLHGZLWK$0DPSOL¿HUDQG70
power supply. Includes CT-5 clip on current transformer which expands
measurement range to; bandwidth 0.5Hz~20MHz. Current range 20mA/div~1
kA/div. Maximum current 700Arms 50kA peak.
Bell CG-100 A Clip-on Current Gun
86%WR56&RQYHUWHU
ACR,SI9000
BEL,CG-100A
AU
AU
Current range dc, ac 10A~100A. DC~1kHz, accuracy 2%, 100% overrange
capacity, clamp ¾“Ø, 30h battery operation, IV output for oscilloscope.
10
AU
Bandwidth 75MHz. Input rating: 40kV pulse, 20kVdc plus peak ac. Derating with
IUHTXHQF\DSSOLHV,QSXWLPSHGDQFH0Ÿ$WWHQXDWLRQ[
USB,232CONVERTER
AU
Stackable expansion module that connects to a PC or server via the USB port.
Provides 1 high speed RS-232 serial port. System Requirements; pentium class,
USB type A, Win 98, ME, 2000, XP, MAC 8.6 & later.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Electronic Test Equipment
Test & Measurement
Multimeters and Electrometers
Model
Type
Application
Scale (digit)
HIO,3256-50
Digital HiTester multimeter
General
6
Interface
7UXH506
No
Max (V)
1,000
MET,MX44
MET,MX53
MET,MX54
General
Multimeter
MET,MX51EX
4½
1,000
Intrinsically safe
Yes
FLU,87
HP,3400A
RMS voltmeter
Audio/RF
Analogue
FLU,8010A
Analogue output
300
3½
LEM,UNIGOR355
LEM,UNIGOR380
4¾
General
Multimeter
6
HP,34401A
HP,3455A-NATA
6½
Precision
GOS,METRAHIT-29S
Powermeter - TRMS
Multimeter
SIM,SS2X
MMM,709
Precision
±310,000 count
Charge measurement
Electrostatic
Analogue
Electrostatic meter
Static voltage
4
GOS,METRAHIT-29S
High Precision Digital Multimeter
Yes
1,000
RS232/HPIB
HPIB
Yes
IR interface
Yes
CAT III 600
200 kV/m
No
8,000
0HWUL[0;+DQG+HOG'LJLWDO0XOWLPHWHU
Ż1(:Ż
*RVVHQ0HWUD+LW63RZHUPHWHU75060XOWLPHWHU
IR interface
MET,MX53
AU
AU
50,000 count display with 34 segment bar graph. DC volts ranges: 500mV~1kV.
AC volts ranges: 500mV~750V. Current ranges 500µA~10A. Resistance ranges
Ÿa0Ÿ&DSDFLWDQFHUDQJHVQ)P))UHTXHQF\UDQJH+]aN+]
Min and max value mode. Continuity and diode checking functions.
HP 3400A ac True rms 10MHz Analogue Voltmeter
HP,3400A
10Hz~10MHz, 1mV~300V full scale analogue display. Recorder output.
)OXNH$7UXH506:LGHEDQG9ROWPHWHU
FLU,8920A
AU
AU
10Hz~20MHz, 2mV~700V full scale. Common mode rejection, 60dB @ 50~60 Hz.
Digital display plus analogue peaking/dipping meter, dB ranges, dB references.
BNC input connector. Recorder output.
Fluke 8010A Bench Type Digital Multimeter
FLU,8010A
Ż1(:Ż
Fluke 87 Digital Multimeter
Hioki 3256-50 Digital Multimeter CAT II 1kV & CAT III 600V
FLU,87
HIO,3256-50
Hioki 3256-50 Digital HiTester Multimeter, CAT II 1000V and CATIII 600V AC/DC,
Current 10A AC/DC.
0HWUL[0;'LJLWDO0XOWLPHWHU
MET,MX54
AU
NZ
Handheld digital multimeter. Measures ac/dc voltage, current and resistance.
Peak hold feature.
/(08QLJRU+DQGKHOG'LJLWDO0XOWLPHWHU6LJQDO*HQHUDWRU
LEM,UNIGOR355
AU
Measures ac/dc voltage and current, resistance, frequency, and capacitance. 4½
digit display giving a sensitivity of 10µV & 10nA. Ranges: voltage 500mV~1,000V
9DFFXUUHQW—$a$UHVLVWDQFHŸa0ŸZLWKDPD[UHVROXWLRQ
RIPŸIUHTXHQF\+]aN+]G%PHDVXUHPHQWRYHULPSHGDQFHUDQJH
aŸ
Measures: dc, ac trms voltage and current, resistance, frequency, capacitance,
temperature and time. 4¾GLJLWGLVSOD\5HVROXWLRQ—9Q$PŸS)
& 0.01Hz. Ranges: voltage 300mV~1kV, current 300µA~10A, resistance
Ÿa0ŸIUHTXHQF\+]aN+]G%aWHPSHUDWXUHoC/oF, Pt 100
-200~100oC, Pt 1000 100~850oC. Features automatic socket shutters, IR interface,
split second chronograph, automatic measurement value storage, etc.
0HWUL[0;75060XOWLPHWHU
/(08QLJRU'LJLWDO0XOWLPHWHU
MET,MX55
MY
True rms digital multimeter measuring ac/dc voltage & current, resistance,
frequency. 4.5 digit display.
0HWUL[0;(;,QWULQVLFDOO\6DIH'LJLWDO0XOWLPHWHU
MET,MX51EX
AU
Resolution 5,000 count with 0.1% basic accuracy. Measures ac/dc voltage and
current, and resistance. Voltage sensitivity 100µV. Max voltage 1kV dc, 750Vac.
Max current 10A. Intrinsic safety limits of 60V & 500mA.
12
AU
LCD 3½ digit. Standard measurement functions the 5 basic DMM functions
(Vac/dc, Aac/dc, & resistance) and also conductance. High current measurement
function up to 10A.
LEM,UNIGOR380
AU
Precision, 6 digit multimeter. Measures: dc, ac trms voltage and current,
resistance, frequency, capacitance, temperature and time. Resolution: 1µV,
Q$PŸS)+]5DQJHVYROWDJHP9aN9FXUUHQW—$a$
UHVLVWDQFHŸa0ŸIUHTXHQF\+]aN+]G%aWHPSHUDWXUH
o o
C/ F K -200~1,372oC, J -210~1200oC. Features automatic socket shutters, IR
interface, split second chronograph, automatic measurement value storage, etc.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Electronic Test Equipment
Test & Measurement
Multimeters and Electrometers (cont’d)
HP 34401A Digital Multimeter
6LPFR66;(OHFWURVWDWLF&KDUJH0HWHU$QDORJXH
6½ digit multimeter. 100nV sensitivity on dc 120mV range. Max dc input 1kV.
0HDVXUHVDFYROWDJHGFDFFXUUHQWWR$RUZLUHUHVLVWDQFHWR0Ÿ
period and frequency. Max reading rate 1,000/s. Maths functions including limits
test. 512 point storage. RS232 and HPIB interfaces.
Battery operated. Remote sensing head on 1m cable. Ranges 0~200kV &
0~4MV/metre.
Keithley 2503 Static Detector Probe
Digital electrostatic meter. Reads 20 kV at 25mm distance, accuracy ±10%. 2
volt recorder output.
SIM,SS2X
HP,34401A
KEI,2503
0(OHFWURVWDWLF0HWHU
MMM,709
NZ
Detects voltage due to charge on small surface areas. Used at a distance of 6mm
from a surface having a charged plane of at least 13mmØ.
DC Power Supplies
Model
Current Max (A)
Voltage (Vdc)
HP,E3640A
3, 1.5
8, 20
LAB,622
2
RED-30V-30A
30
BWD,246A
5
36
20
35
SOR,DCR10-120B
120
10
SOR,DCR600-3B
3
600
SOR,DCS60-50
No
No
Yes
Yes
60
50
48
TRI,PD35-10D
10
35
XAN,XKW60-50
50
60
INV,MPS48DC2400W
Variable
Yes
30
TRI,PD35-20
AUS,AD2K5
Dual
%:'$'XDO3RZHU6XSSO\
BWD,246A
AU
Dual output 0~36V, 0~5A per section. Use in series, parallel or tracking modes.
Trio PD35-20 DC Power Supply
TRI,PD35-20
AU
Output 0~35V, 0~20A. Constant current, constant voltage. Multiple parallel or
series operation. Remote programming of voltage or current by external voltage
or resistance.
$XVPRGH$'.9$5HFWLÀHU
AUS,AD2K5
AU
No
Yes
6RUHQVHQ'&5%'&3RZHU6XSSO\
SOR,DCR10-120B
0~10V, 0~120A.
AU/MY
6RUHQVHQ'&5%GF3RZHU6XSSO\
SOR,DCR600-3B
0~600V, 0~3A.
Sorensen DCS60-50, 60V 50A dc Power Supply
SOR,DCS60-50
AU
AU
0~60V, 0~50A. Max power on a 240V 3ph supply 3kW, 2.5kW on a 1ph 240V
supply. On 1ph 50V @ 50A or 60V @ 42A. Remote programming.
'&UHFWL¿HUSRZHUVXSSO\$#99ROWDJHQRWDGMXVWDEOH8VHWRSRZHU
telecoms and other battery supported equipment.
Trio Kenwood PD35-10D 35V 10A Power Supply
$JLOHQW($3URJUDPPDEOH'&3RZHU6XSSO\
Output 0~35V, 0~10A. Constant current, constant voltage. Multiple parallel or
series operation. Remote programming of voltage or current by external voltage
or resistance.
HP,E3640A
AU
30W single-output programmable power supply with built-in GPIB and RS232
connectivity and SCPI language compatibility. 0~8V/3A or 0~20V/1.5A. Overvoltage protection and remote sensing. Low noise and excellent regulation. Front
and rear output terminals.
Lab 622 Dual 0~30Vdc DC Power Supply
LAB,622
Adjustable current limit of 0~2A dc.
5HGIHUQ9$3RZHU6XSSO\
RED,30V-30A
Adjustable current trip from 0~30V. Voltage and current meters.
NZ
NZ
TRI,PD35-10D
,QYHQV\V,QWHUJ\0LQL3RZHU6\VWHP9GFN:6XSSO\
INV,MPS48DC2400W
AU
AU
Sub-rack Mini System 19” rack mount range for low power telecommunications
applications (Premises Data Networks and IP Routers, Local Loop Transmission
Systems and Wireless) requiring compact, efficient and flexible dc power
supplies. Includes an integral dc distribution panel and an SM30 Series Intergy
Supervisory Module. All system settings are fully adjustable in software. Input:
R1248: 220/240Vac, 50/60Hz (nominal). Power factor: >0.98 @ 30~100% max
V\VWHP FXUUHQW (I¿FLHQF\ !2XWSXW YROWDJH 9a9GF FXUUHQW #
48Vdc 50A (2400W). Dimensions: 133H x 275W mm overall. Weight: 12kg
W\SLFDOFRQ¿JXUDWLRQ
;DQWUHN;.:9$GF3RZHU6XSSO\
XAN,XKW60-50
AU
0~60V, 0~50A. Constant current and constant voltage. Analogue programming.
Operation of multiple units in series or parallel.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
13
General Electronic Test Equipment
Test & Measurement
Function Generators
Model
Special features
Frequency Max (MHz)
Frequency Min (µHz)
HP,3325B
High stability & accuracy
21 MHz
1
HP,33120A
15 MHz
100
HP,33220A
20MHz
HP,33250A
80 MHz
10Vp-p
Yes
1
HP,3325B
Agilent 33220A 20MHz Function/Arbitrary Generator
HP,33220A
AU
Function/arbitrary waveform generator. Frequency range 20MHz sine & square
waveforms, 200kHz pulse, triangle, ramp, noise, and DC waveforms. Gaussian
QRLVH WR 0+] 2XWSXW LQWR Ÿ P9a9 33 $0 )0 )6. DQG EXUVW
modulation. Includes option 001 external timebase reference. With optional
Benchlink software waveforms can be captured and played back. HPIB, USB,
& LAN interfaces.
HP,33120A
Arbitary
HP 3325B Synthesized Function Generator
Ż1(:Ż
HP 33120A Function/Arbitrary Generator
Voltage Max
AU
Sine frequency range 1µHz~21MHz, square wave/triangle/ramps to 11MHz.
Sweep generator function. In-built modulation generator which includes arbitrary
waveforms with arbitrary, sine, and square wave outputs. Output phase can varied
with 0.1O resolution and multiple units can be locked together for variable phase
output signals. Very high amplitude resolution and setting accuracy.
+3$JLOHQW$0+])XQFWLRQ$UELWUDU\:DYHIRUP*HQHUDWRU
HP,33250A
AU
Frequency range 80MHz sine & square waveforms. 50MHz pulse waveforms
with variable rise/fall times. 25MHz arbitrary waveforms, 1MHz triangle & ramp
ZDYHIRUPV:KLWHQRLVHWR0+]2XWSXWLQWRŸP9SSa9SS$0)0
FSK, and burst modulation. Intuilink software for programming arbitrary waveforms.
HPIB & RS232C interfaces.
AU/MY
Frequency range 15MHz sine & square waveforms, and 100kHz triangle & ramp
waveforms. Gaussian noise to 10MHz. Output into 50, 50mV~10V pp. AM, FM,
FSK, and burst modulation. Optional Benchlink software allows waveforms to
be captured and played back. HPIB & RS232C interfaces. Some assets include
option 001 phase lock and high stability TCXO timebase - input & output 10MHz
with phase offset.
Pulse Generators
HP 8012B Pulse Generator
HP,8012B
AU
1Hz~50MHz pulse generator. Variable transition times down to 5ns. Amplitude + 10V with selectable source impedance. Pulse width 10ns~1s. External trigger and
gate.
LCR Meters
6WDQIRUG5HVHDUFK65/&5%ULGJH
SR,SR720
AU
AutomaticLCRbridgewith0.05%accuracy. Ranges:inductance0.0001µH~99,999H;
FDSDFLWDQFHS)a—)UHVLVWDQFHŸ~0Ÿ$OVRPHDVXUHV
Q & D. Test frequencies 100/120Hz, 1/10/100kHz. Indicates value, deviation, %
deviation, or bin number. DC bias internal 0~2V, external 0~40V. Complete with
optional Kelvin leads.
7HJDP+]0+]3URJUDPPDEOH/&50HWHU
TEG,3550
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional, fee you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected accidents - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
14
AU
Programmable Impedance/LCR Meter. User selectable test frequency from
42.0Hz~5.00MHz. 18mS measurement speed. 0.10% basic accuracy. Fully
programmable with18 measurable parameters and absolute or percentage
comparator. Binning function supports 10 output bins. Output to 3 highly visible
LED displays. Standard RS232C & I/O interfaces
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Electronic Test Equipment
Test & Measurement
Electrical Calibrators
Model
Type
DAN,DR60
Description
Resistance box
GR,1433B-NATA
Resistance box 1~11.1MŸ
Decade resistance box. 6 decades x 1Ÿ
GR,1433F-NATA
Resistance box 0.01Ÿ~11kŸ
Decade resistance box. 7 decades x 0.01Ÿ
YEW,2553
YEW,2554
Accuracy %
Decade resistance box
DC voltage & current standard
0.02
Portable DC voltage & current standard
*HQUDG%P'HFDGH5HVLVWDQFH%R[
GR,1433B-NATA
AU
*HQUDG).'HFDGH5HVLVWDQFH%R[
GR,1433F-NATA
AU
GHFDGHV E\ Ÿa.Ÿ DFFXUDF\ Ÿ 8VHIXO IRU SODWLQXP
resistance thermometer calibration. NATA calibrated.
'DQEULGJH'5'HFDGH5HVLVWRU5HVLVWDQFH
DAN,DR60
Decade Resistor. Maximum 10,000 ohms. Smallest resolution 0.01 ohm.
0.05
Yokogawa 2553 dc Voltage/Current Standard
YEW,2553
1µV~12V, 0.1µA~120mA, accuracy ±0.02%, power 240V/50Hz.
GHFDGHVE\Ÿ~0ŸDFFXUDF\1$7$FDOLEUDWHG
0.01
AU/MY
Yokogawa 2554 Portable dc Voltage/Current Standard
YEW,2554
AU
10mV, 100mV, 1V, 10V, 100V, 1mA, 10mA, 100mA, ±0.05% accuracy. Internal
battery or mains operation.
MY
Logic/Analysers/Testers
HP 1662A 68 Channel Logic Analyser
HP,1662A
Agilent 16500C Logic Analyser
AU/MY
Timing analysis 250MHz all channels, 500MHz half channels. Transitional: 125MHz
all channels, 250MHz half channels. Glitch: 125MHz half channels. State analysis
to 100MHz on all channels. Memory 4k/channel, 8k/channel in half-channel modes.
4 clock channels available. HPIB & RS232C ports. In-built DOS format FDD
used to load inverse assemblers and transfer measurement data to a computer.
Compatible with most HP preprocessors and inverse assemblers.
HP 1661A 102 Channel Logic Analyser
HP,1661A
HP,16500C
AU
Mainframe with 16555D acquisition card and 16522A pattern generator module.
110MHz 68 channels. Memory depth 2M (4M in half channel timing mode).
Minimum detectable glitch 3.5ns. Advanced trigger macros for capturing
elusive problems.
AU
7LPLQJDQDO\VLVWR0+]&RQ¿JXUHGZLWK)''KDUGGLVN+3,%56
interfaces. Centronics port also included. Memory depth 4K/channel, 8K/channel
in half-channel mode.
PROM Programmers
IceTech LV48 Programmer
ICE,LV48
AU
Eprom programmer for single device with laptop and preloaded software. Programs
devices up to 48 pins.
Data IO Chipwriter Standard
DAT,CHIPWRITER
AU
Eprom programmer for single device with laptop and preloaded software. Programs
devices up to 40 pins.
Data IO Chipwriter Gang 8 Chip
DAT,CHIP-GANG
Hi-Lo All 11 Programmer
ALL,11
AU
3URJUDPPHU IRU E\WH ZLGH (3520 ((3520 DQG ÀDVK 3520 ZLWK a
pins. Enables programming or copying of up to 8 devices at a time. Adaptors
provided to convert standard dip arrangement to PLCC for programming/copying
of single (one only) PLCC packages. Unit will handle devices up to 8Mb. i.e.
27C010~27C080.
6SHFWURQLFV8OWUD9LROHW3520(UDVHU
SPE,ERASER2
AU
AU
Holds up to 8 devices. 0~60min timer, 240V/50Hz operation.
Eprom programmer for 8 devices. Eight copy sockets and one master socket.
Can be used with a PC or in stand alone mode (two button operation). Programs
devices up to 32 pin DIP.
Frequency Response Analysers
HP35660A 100kHz Dual Channel Spectrum Analyser
HP,35660A
AU/MY
Dual channel 100kHz spectrum analyser. 401 line resolution. Displays frequency response, power spectrum, linear spectrum, coherence, cross spectrum, power
VSHFWUDOGHQVLW\DQGWLPH6LJQDOVRXUFHV¿[HGVLQHUDQGRPQRLVHFKLUS%XLOWLQGLVNGULYH+3,%LQWHUIDFH%DQGZLGWKLVN+]IRUVLQJOHFKDQQHOPHDVXUHPHQWV
and 51.2kHz for dual channel measurements.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
15
General Electronic Test Equipment
Test & Measurement
Frequency Counters
Model
Type
Frequency (GHz)
RAC,9906
Universal frequency counter
dc~0.200
SIC,WL260-PC230
Optical timing sensor
PHI,PM6666
dc~1
Universal frequency counter
HP,5350A
HP,53181A
dc~3
HP,5352B
Automatic microwave counter
10Hz~20GHz
HP,5385A
Universal frequency counter, DC operation
dc~1GHz
ADV,TR5212
Universal frequency counter
10MHz~18GHz
5DFDO)UHTXHQF\&RXQWHU7LPHU
RAC,9906
HP 5350A 20GHz Frequency Counter
AU
200MHz counter/timer. Eight digit display. Measures frequency, period, totalise,
WLPHLQWHUYDODQGUDWLR,QSXWLPSHGDQFH0Ÿ,QSXWVHQVLWLYLW\P9
6LFN:/35HÁH[3KRWRHOHFWULF6ZLWFK
SIC,WL260-P230
AU
/LJKWDQGVHQVRULQWKHVDPHXQLW'HWHFWVUHÀHFWLRQIURPUHÀHFWRUPRXQWHGRQRU
behind the object to be detected. Range 0.01~5m. Output compatible with Racal
FRXQWHU0DLQVRSHUDWHG6XSSOLHG[PPUHÀHFWRU'RHVQRWZRUNZLWK
normal mirror, white card etc, detects interruptions using supplied mirror.
3KLOLSV30*+]8QLYHUVDO&RXQWHU
PHI,PM6666
AU
Frequency, period, time interval, totalise, and ratio measurements. GPIB interface.
+LJKVWDELOLW\07&;2WLPHEDVHRSWLRQ¿WWHG
HP 53181A 3GHz Frequency Counter
HP,53181A
AU/MY
Option 010 high stability timebase included. HPIB interface. PC based Benchlink
meter software available.
HP,5350A
HP 5352B 40GHz Frequency Counter
HP,5352B
AU
Automatic microwave counter. Input 1 500MHz~40GHz. Input 2 10Hz~525MHz.
Sensitivity at 40GHz to 20dBm. TCXO timebase with aging rate 1 part in 10
million per month. HPIB interface. Input connector APC-3.5 (male) with collar;
type N adaptor included.
HP 5385A 1GHz Frequency Counter
HP,5385A
AU
11 digits display. Also measures period up to 0.1s. TCXO timebase. Operates
from ac or 9~15Vdc. HPIB interface.
$GYDQWHVW75*+])UHTXHQF\&RXQWHU
ADV,TR5212
AU
Range 10MHz~18GHz counter. 12 digit display with 1Hz resolution. Possible to
measure pulses as short as 0.5µs. Time base stability 2 x 10-8.
Did you know?
Portable Appliance Testing (PAT) is required by law.
To protect yourself, your employees and customers you
should test your portable appliances regularly.
Make the job easier and rent the Seward Supernova PAT
system with printer and scanner, which is fully compliant
with AS/NZS3760:2001/2003.
Talk to our friendly staff about this and other solutions for
making a safer workplace.
Call now!
16
MY
$XWRPDWLF0LFURZDYH&RXQWHU,QSXW0+]a*+]ŸLQSXWLPSHGDQFH
,QSXW+]a0+]DWŸ+]a0+]DW0Ÿ+3,%LQWHUIDFHVWDQGDUG
Option 006 input damage protection included.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
RF Signal Generators
Model
Type (All programmable)
Frequency
HP,ESG-3000A
AM/FM microwave signal generator
250kHz~3GHz
HP,ESG-D4000A
AM/FM high stability microwave signal generator
250kHz~4GHz
HP,8648B
High stability signal generator
9kHz~2GHz
HP,8648C
HP,8648D
FLU,6060B
9kHz~3.2GHz
AM/FM high stability signal generator
9kHz~4GHz
AM/FM high stability signal generator
HP/Agilent 8648D-1E5 4GHz Signal Generator
HP E4432B ESG-D3000A 3GHz RF Digital Signal Generator
HP,ESG-D3000A
AU
RF signal generator with digital modulation facilities. Frequency range
250kHz~3GHz, resolution 0.01Hz. AM, FM, phase, & pulse modulation. Wideband
AM modulation. DC to 10MHz. Internal modulation and pulse generator to 50kHz.
Step sweep of frequency and power. Included option UN3 provides DECT, GSM,
NADC, PDC, PHS, & TETRA standards. External analogue I & Q modulation
inputs. Option 1E5 high stability reference 0.1ppm/yr included.
HP E4433B ESG-D4000A 4GHz RF Digital Signal Generator
HP,ESG-D4000A
HP,8648B
AU/MY
Frequency range 9kHz~2GMHz. Output range 13dBm~-136dBm, 1dB accuracy
over entire frequency range, resolution 0.001Hz. Full remote control via GPIB
(IEEE488) interface.
HP 8648C-1E5 3GHz Signal Generator
HP,8648C
HP,8648D
13dBm~-136dBm
10dBm~-136dBm
-127dBm~13dBm
AU/NZ/MY
9kHz~4GHz signal generator with AM/FM/Phase modulation output range from
10~-136dBm with ±1dB accuracy up to 2.5GHz. 0.001Hz resolution. Complete
with option 1E5 high stability timebase (<±0.1ppm/yr).
AU
Signal generator with digital modulation facilities. Frequency range 250kHz~4GHz,
resolution 0.01Hz. AM, FM, phase, & pulse modulation. Wideband AM modulation.
DC to 10MHz. Internal modulation and pulse generator to 50kHz. Step sweep of
frequency and power. Option 1E5 high stability reference 0.1ppm/yr included.
HP 8648B 2GHz Signal Generator (Analogue)
10kHz~1,050MHz
Output
Fluke 6060B 1GHz Signal Generator
FLU,6060B
AU
Programmable high stability AM/FM signal generator. 0.01~1.05GHz, 10Hz
resolution, 13~-127dBm output. Digital display of frequency, modulation and
amplitude. 50 complete front-panel settings can be stored in non-volatile memory
for frequently repeated tests. Reverse power protection. Optional low rate ac FM
DQG,(((LQWHUIDFH¿WWHG
AU/MY
9kHz~3.2GHz signal generator with AM/FM/Phase modulation output range from
+10~-136 dBm with ±1 accuracy up to 2.5GHz. 0.001Hz resolution. Complete
with option 1E5 high stability timebase (<±0.1ppm/yr).
RF Sweep Generators
HP 8350B Sweeper Mainframe
HP,8350B
HP 83592A Sweeper Plug-in 10Mhz~20GHz
AU/MY
HP,83592A
AU
Operates directly with HP,8757A scalar network analyser and HP,7475A plotter
or HP,2225A printer.
Broadband plug-in for HP,8350B mainframe. Frequency range 10MHz~20GHz.
Max levelled output power 10dBm. External AM and FM modulation.
HP 83525B 10MHz~8.4GHz Sweep Module
HP 83592C High Power 13dB Sweeper Plug-in
HP,83525B
Sweep generator module for HP,8350B. Frequency range 10MHz~8.4GHz.
HP 83594A Module for 8350B 2 to 26.5GHz
HP,83594A
AU
HP,83592C
AU
Broadband plug-in for HP,8350B mainframe. Frequency range 10MHz~20GHz.
Max levelled output power 13dBm. External AM and FM modulation.
AU
Broadband sweeper plug-in for HP,8350B mainframe. Frequency range
2~26.5GHz. Max levelled output 10mW up to 20GHz, 2.5mW up to 26.5GHz.
RF Amplifiers
(1,/*+]5)3RZHU$PSOLÀHU
ENI,603L
/LQHDU ZLGHEDQG 5) SRZHU DPSOL¿HU : RXWSXW &: DQG 3(3 8S WR :
saturated. Frequency range 0.8~1,000MHz. Gain 40dB. Input and output
LPSHGDQFHŸ
(1,/::LGHEDQG*+]5)$PSOLÀHU
ENI,604L
/LQHDUZLGHEDQG5)SRZHUDPSOL¿HU:RXWSXWDWDQLQSXWRIP:IURP
0.5~1GHz. Saturated output 7W 0dBm input. Extended performance gives
saturated output to a max of 16W at 10MHz and 12W at 100MHz typically.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
17
RF & Microwave
Test & Measurement
Spectrum Analysers - High Frequency
Model
Type
HP,8591E
Frequency
Spectrum analyser
HP,8594E
HP,8594E-G
Spectrum analyser with tracking generator
ADV,R3365A
Spectrum analyser with tracking generator
9kHz~2.9GHz
100kHz~8GHz
HP,E4407B
Spectrum analyser
HP,8591
HP,8593E
1kHz
10
9kHz~26.5GHz
30
9kHz~1.8GHz
1kHz
9kHz~22GHz
30
HP,8563E
Spectrum analyser, high resolution
ANR,MS2711A
Portable spectrum analyser
ANR,MS2711D
Spectrum analyser, colour, portable
ANR,MS2711D-6-29
Spectrum analyser with power meter
9kHz~6GHz
ANR,S331D-3
Antenna & cable test set with colour display
25MHz~4GHz
9kHz~26.5GHz
Network analyser with spectrum analyser
9kHz~3GHz
9kHz~3GHz
ANR,S332B
ANR,S332B-05
Resolution (Hz)
9MHz~1.8GHz
ANR,S332D
1
10kHz
100
100
10
100
ANR,S332D-29
Network analyser with spectrum analyser with colour screen
10
RS,FSH3-TG
Spectrum analyser with tracking generator and return loss bridge
100kHz~3GHz
RS,FSH6-TG
Portable spectrum analyser
100kHz~6GHz
1kHz
XXXSPIEFTDIXBS[DPNBV
TBMFT!STBVTSPIEFTDIXBS[DPN
1I'BY
5SVMZNPCJMF3'UFTUFRVJQNFOU
34¥'4)oUIFTQFDUSVNBOBMZ[FSBOENPSF
UIBUHPFTBOZXIFSF
*UTUIFJEFBMUPPMGPSVTFJOJOTUBMMJOHBOENBJOUBJOJOHUSBOTNJUUFSTZTUFNTDIFDLJOH
U 7FDUPSBOETDBMBSOFUXPSLBOBMZTJT
DBCMFTBOEBOUFOOBTQMVTBUIPVTBOEBOEPOFPUIFSPOTJUFBOEMBCBQQMJDBUJPOT
U )JHIQSFDJTJPOQPXFSNFBTVSFNFOUTVQUP()[
U 4QFDUSVNBOBMZTJTVQUP()[PS()[
U 'JFMETUSFOHUINFBTVSFNFOUT
U "EKVTUBCMFQSFBNQMJGJFS
U 6QUPGPVSIPVSTCBUUFSZPQFSBUJPO
U %JTQMBZFEBWFSBHFOPJTFMFWFMPGUZQoE#N)[
U 3FTPMVUJPOCBOEXJEUIPG)[UP.)[
18
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
Spectrum Analysers - High Frequency
Rohde & Schwarz FSH3 Spectrum Analyser/Tracking Generator
RS,FSH3-TG
AU/NZ
Handheld portable battery operated spectrum analyzer 100kHz~3GHz. Resolution
bandwidth 1kHz~1MHz. Less than -105dBm noise level (-116dBm typical). Colour
liquid crystal display. Suitable for RF surveying applications. Includes tracking
generator, VSWR bridge and distance to fault (DTF) options making it suitable for
antenna and cable testing. Four hours of continuous operation on battery power.
Cable for data transfer to PC.
HP 8582A 22GHz Spectrum Analyser
HP,8562A
MY
RF Spectrum Analyser, 9kHz to 22GHz. resolution 100Hz to 2MHz. HPIB plotter
interface.
HP 8563E Spectrum Analyser
HP,8563E
AU/MY
9kHz~26.5GHz. Resolution 1Hz~2MHz. Sensitivity up to -139dBm. HPIB plotter
and printer interface.
HP 8594E Spectrum Analyser
Rohde & Schwarz FSH6 Spectrum Analyser/Tracking Generator
RS,FSH6-TG
HP,8594E
AU/NZ
6SHFL¿FDWLRQDVDERYHEXWFDSDFLW\LV*+]
MY
Range 9kHz~2.9GHz. Average Noise Level 400kHz~5MHz equal to or less than
122dBm & 5MHz~2.9GHz equal to or less than 127dBm for 30Hz RBW.
HP 8594E-G Spectrum Analyser with Tracking Generator
HP,8594E-G
MY
Range 9kHz~2.9GHz. Average Noise Level 400kHz~5MHz equal to or less than
122dBm & 5MHz~2.9GHz equal to or less than 127dBm for 30Hz RBW. With
tracking generator option installed.
Anritsu MS2711A Portable Spectrum Analyser
ANR,MS2711A
AU/MY
Portable spectrum analyser, 9kHz~3GHz. Light weight battery powered spectrum
analyser with LCD. Resolution bandwidth down to 10kHz. Suitable for cellular
telephone walk or drive tests to determine coverage and base station positioning.
Can also be used for VHF/UHF signal surveying. N type connector.
Anritsu MS2711D 6GHz Spectrum Analyser with Power Meter
ANR,MS2711D-6-29
HP 8591E 1.8GHz Spectrum Analyser
HP,8591E
AU
9kHz~1.8GHz. Resolution 1kHz~3MHz. Card reader allows data storage and
also downloading of a range of measurement options (not included). Most assets
include option 010 tracking generator and option 021 HPIB interface. One analyser
includes; option 130 gives 30~300Hz resolution, option 041 HPIB interface and
quasi peak detector and option 103 AM/FM demodulation.
Advantest R3365A 8GHz Spectrum Analyser with Tracking Generator
ADV,R3365A
AU
Frequency range 100kHz~8GHz. Sensitivity -145dBm. Resolution 10Hz. Adjacent
channel leakage power measurement and digital radio measurement functions.
Gated sweep function for TDMA and video signal analysis. In-built tracking
generator 100kHz~3.6GHz. GPIB & RS232 interfaces. Memory card reader.
HP/Agilent E4407B 26.5GHz Spectrum Analyser
HP,E4407B
AU
Portable spectrum analyser, 9kHz~6GHz with power meter. Light weight battery
powered spectrum analyser with LCD. Resolution bandwidth from 100Hz~1MHz.
Has feature which can identify the type of interfering signal. Can be used in
applications such as cellular telephone walk or drive tests to determine coverage
and base station positioning and also VHF/UHF signal surveying. Has N type
connector.
Anritsu MS2711D Colour Portable Spectrum Analyser
ANR,MS2711D
AU
Colour portable spectrum analyser, 9kHz~3GHz. Light weight battery powered
spectrum analyser with colour LCD. Resolution bandwidth from 100Hz~1MHz. Has
feature which can identify the type of interfering signal. Can be used in applications
such as cellular telephone walk or drive tests to determine coverage and base
station positioning and also VHF/UHF signal surveying. Has N type connector.
AU
Frequency range 9kHz~26.5GHz. Resolution bandwidth down to 30Hz. Noise level
-105~-136dBm according to frequency. Centre frequency display with a resolution
of up to 10Hz. Stores up to 200 traces in internal memory and 200 traces on disk.
Some assets include GPIB/parallel interface with benchlink software (option A4H)
and narrow resolution black/white (option 1DR).
HP 8593E 22GHz Spectrum Analyser
HP,8593E
AU/MY
Frequency range 9kHz~22GHz. Max resolution 30Hz. Noise level -102~-127dBm
according to frequency. Centre frequency display with a resolution of up to 10Hz.
Some assets include GPIB/parallel and narrow resolution black/white options
(041 & 130).
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
19
RF & Microwave
Test & Measurement
Spectrum Analysers - High Frequency (cont’d)
Anritsu S332B Sitemaster incl 3GHz Spectrum Analyser
ANR,S332B
Anritsu S332D/29 Sitemaster including Spectrum Analyser & Power
Meter
AU
Antenna and cable test set with spectrum analyser. Frequency range 25~3300MHz
for cable and antenna test. 9kHz~3GHz for spectrum analysis. Measures return
loss, SWR, cable loss, and distance to fault. Integral synthesized signal generator.
Return loss range 0.00~54.00dB. SWR range 1.00~65.00. Distance to fault
rang e 1000m. Insertion loss range -120.00~+100 dB. Cable loss range (one
port) 0.00~20.00dB. Type n(f) port. RS232 interface for printer or PC. Spectrum
analyser resolution bandwidth down to 10KHz. Analysis software discs included
containing distance to fault and Smith chart tools. Complete with standard load
and short, ac/dc adaptor and 12Vdc car cigarette lighter adaptor.
ANR,S332D-29
AU
Antenna and cable test set with spectrum analyser and power meter. Standard
signal table allows automated setup. Frequency range 25~4000MHz for cable &
antenna test. 9kHz~3 GHz for spectrum analysis. Measures return loss, SWR,
cable loss, and distance to fault. Integral synthesized signal generator. Return
loss range 0~60dB. SWR range 1~65. Distance to fault range 1197m. Cable loss
range 0~30dB. Spectrum analyser resolution bandwidth 100Hz~1MHz. Interfering
VLJQDOIHDWXUHDOORZVLGHQWL¿FDWLRQRIW\SHRILQWHUIHUHQFH3RZHUPHWHUIUHTXHQF\
range 3MHz~3GHz, power range -80dBm~20dBm (0.1W). Battery operated
with LCD dis[play. Type N(f) port. RS-232 interface for printer or PC. Analysis
software included containing distance to fault and Smith chart tools. Complete with
calibration components,ac/dc adaptor and 12Vdc cigarette lighter adaptor.
Network Analysers/Antenna & Cable Test
Model
Type
Frequency
ANR,S331B
Antenna & cable test set
25MHz ~ 3,300MHz
ANR,S331B-05
Antenna & cable test set plus power meter
25MHz ~ 3,300MHz
Antenna & cable test set
25MHz ~ 4GHz
ANR,S331C
ANR,S331D-3
ANR,S332B
Antenna & cable test set plus spectrum analyser
ANR,S332B-05
Antenna & cable test set plus power meter
ANR,S332D
Antenna & cable test set plus spectrum analyser
25MHz ~ 4,000MHz
ANR,S820A
Antenna & cable test set
3GHz ~ 20GHz
ANR,C752-05
Antenna & cable test set (75ohm) plus power meter
5MHz ~ 1,200MHz
HP,8752A
9HFWRUQHWZRUNDQDO\VHUWUDQVPLVVLRQUHÀHFWLRQWHVWVHW
300kHz ~ 3GHz
HP,8753D
HP,8753ES
HP,8757A
HP,8757C
Vector network analyser S parameter test set
Scalar network analyser include detectors
RS232
dc Supply
Yes
Yes
Yes
Yes
Yes
Yes
25MHz ~ 3,300MHz
30kHz ~ 6GHz
30kHz ~ 3GHz
Anritsu S331B-05 Sitemaster/Power Meter Test
MY
Freq range 25~3300MHz. Freq resolution 100KHz SWR range 1~65. Return loss
range 0~54dB. Distance to fault range 0 to (Resolution x dp) Wattmeter power
monitor range -80~80dBm/10.0pW -100kW Max input(Damage level) +22dBm.
&DEOH LQVHUWLRQ ORVV UDQJH aG% 7\SH 1I SRUW Ÿ 56 LQWHUIDFH IRU
printer/PC Analysis software tools disc, std load & short.
20
SWR
60GHz
Anritsu S331B Sitemaster Antenna Tester
ANR,S331B
Return
Loss
ANR,S331B-05
AU/MY
Antenna and cable test set. Frequency range 25~3,300MHz. Measures return
loss, SWR, cable loss, and distance to fault. Integral synthesized signal generator.
Return loss range 0~54dB. SWR range 1~65. Distance to fault range 1,000m.
Insertion loss range -120~100dB. Cable loss range (one port) 0~20dB. Type N(f)
port. RS232 interface for printer or PC. Analysis software included containing
distance to fault and Smith chart tools. Power meter option with 3GHz detector.
Complete with standard load and short, ac/dc adaptor & 12Vdc car cigarette
lighter adaptor.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
Network Analysers/Antenna & Cable Test (cont’d)
Anritsu S331C Sitemaster Antenna Tester
ANR,S331C
AU/MY
Anritsu S820A Microwave Sitemaster 3~20GHz
ANR,S820A
AU
Antenna and cable test set. Frequency range 25~4GHz. Measures return loss,
SWR, cable loss, and distance to fault. Integral synthesized signal generator.
Return loss range 0~54dB. SWR range 1~65. Distance to fault range 1,000m.
Insertion loss range -120~100dB. Cable loss range (one port) 0~20dB. Type N(f)
port. RS232 interface for printer or PC. Analysis software included containing
distance to fault and Smith chart tools. Complete with calibration standard, ac/dc
adaptor & 12Vdc car cigarette lighter adaptor.
Microwave antenna and cable test set. Portable (1.14kg) single post analyser,
providing return loss (SWR) insertion loss and distance to fault measurements
in the frequency range of 3.3GHz~20GHz. RS232 interface. Smith chart and
software management tools, ac/dc and automotive adaptor. A comprehensive
range of precision waveguide components and adaptors are available.
Anritsu S331D-3 Colour Sitemaster Antenna Tester
Calibration components and wave guide to co-ax adaptors for Anritsu S820A
Sitemaster antenna. Set includes 1/8 and 3/8 shorts, termination, and waveguide
to co-ax adaptor.
ANR,S331D-3
AU
Antenna and cable test set. Battery operated with colour display. Frequency
range 25~4,000MHz. Measures return loss, SWR, cable loss, and distance to
fault. Integral synthesized signal generator. Return loss range 0~60dB. SWR
range 1~65. Distance to fault range 1,197m. Insertion loss range -120~100dB.
Cable loss range (one port) 0~30dB. Type N(f) port. RS232 interface for printer
or PC. Analysis software included containing distance to fault and Smith chart
tools. Complete with Instacal calibration standard, ac/dc adaptor & 12Vdc car
cigarette lighter adaptor.
Anritsu S332D Colour Sitemaster incl 3GHz Spectrum Analyser
ANR,S332D
AU/NZ
Antenna and cable test set with spectrum analyser. Battery operated with colour
display. Standard signal table allows automated setup. Frequency range 25~4GHz
for cable and antenna test. 9kHz~3GHz for spectrum analysis. Measures return
loss, SWR, cable loss, and distance to fault. Integral synthesized signal generator.
Return loss range 0~60dB. SWR range 1~65. Distance to fault range 1,197m.
Cable loss range 0~30dB. Spectrum analyser resolution bandwidth 100Hz~1MHz.
,QWHUIHULQJVLJQDOIHDWXUHDOORZVLGHQWL¿FDWLRQRIW\SHRILQWHUIHUHQFH7\SH1ISRUW
RS232 interface for printer or PC. Analysis software discs included containing
distance to fault and Smith chart tools. Complete with calibration components,
ac/dcadaptor and 12Vdc car cigarette lighter adaptor.
Anritsu S332B Sitemaster incl 3GHz Spectrum Analyser
ANR,S332B
AU
Antenna and cable test set with spectrum analyser. Frequency range 25~3.3GHz
for cable and antenna test. 9kHz~3GHz for spectrum analysis. Measures return
loss, SWR, cable loss, and distance to fault. Integral synthesized signal generator.
Return loss range 0~54dB. SWR range 1~65. Distance to fault range 1km.
Insertion loss range -120~100dB. Cable loss range (one port) 0~20dB. Type N(f)
port. RS232 interface for printer or PC. Spectrum analyser resolution bandwidth
down to 10kHz. Analysis software discs included containing distance to fault
and Smith chart tools. Complete with standard load and short, ac/dcadaptor and
12Vdc automotive adaptor.
Anritsu S332B/05 Sitemaster incl 3GHz Power Meter & Spectrum
Analyser
ANR,S332B-05
ANR,S332B-5
AU
MY
Antenna and cable test set with spectrum analyser and power meter. Frequency
range 25~3.3GHz for cable and antenna test. 9kHz~3GHz for spectrum analysis
and power meter. Measures return loss, SWR, cable loss, and distance to fault.
Integral synthesized signal generator. Return loss range 0~54dB. SWR range
1~65. Distance to fault range 1km. Insertion loss range -120~100dB. Cable
loss range (one port) 0~20dB. Type n(f) port. RS232 interface for printer or PC.
Spectrum analyser resolution bandwidth down to 10kHz. Analysis software discs
included containing distance to fault and Smith chart tools. Comes with power meter
option with 3GHz detector. Complete with standard load and short, ac/dcadaptor,
and 12Vdc automotive adaptor.
Anritsu Sitemaster Waveguide Components
ANR,WAVEGUIDE-ADAP
AU
$QULWVX&&DEOHPDWH$QWHQQD7HVW6HWŸ
ANR,C752-05
AU
$QWHQQDDQGFDEOHWHVWVHWIRUŸLQVWDOODWLRQV)UHTXHQF\5DQJHa*+]
Measures return loss, SWR, cable loss and distance to fault. Integral synthesized
signal generator. Return loss range 0~54dB resolution 0.01. SWR range 1~65
resolution 0.01. Distance to fault range 512m. Insertion loss range 0~20dB.
Type N(f) test port. RS232 interface for printer or PC. Cablemate software tools.
Includes -05 power meter option with 1.2GHz detector. Power meter sensor range
-50~20dBm (10nW~100mW). Comes with standard load, short, ac/dc adaptor &
12Vdc automotive adaptor.
HP 8753D 6GHz Vector Network Analyser
HP,8753D
AU
Vector network analyser with integral S-parameter test set. Frequency range
30kHz~6GHz with included option 006. In-built 1Hz resolution synthesized signal
source. Calibration kit included.
HP 8753ES 3GHz Vector Network Analyser
HP,8753ES
AU/MY
Vector network analyser with integral S-parameter test set. Frequency range
30kHz~3GHz.
HP 8757C Scalar Network Analyser
HP,8757C
AU
Scalar network analyser similar to HP,8757A. Colour screen. Complete with 3
x HP,11664A detectors.
HP 8757A Scalar Network Analyser
HP,8757A
AU
Scalar network analyser (Scalar denotes gain measurement only - no phase).
76dB dynamic range. Frequency range to 60GHz depending on detector used.
3 x HP11664A’s included. Analyser will act as system controller with HP8350B
sweeper. Output to HPIB plotter or HP2225 printer.
HP 11679A Detector Extension Cable
HP,11679A
MY
Extension cable for use with HP,11664A detectors and HP,8757 network analysers.
Length 7 metres. Extends the power and detected signal cable length.
HP 85032B Calibration Kit
HP,85032B
AU
&DOLEUDWLRQNLWIRUQHWZRUNDQDO\VHUV6LPSOL¿HGYHUVLRQZLWKRXWDGDSWRUV
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional, fee you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected accidents - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
22
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
Field Strength Meters & Antennas
Model
Type
Frequency
ANR,WIFI-ANTENNA
WIFI antenna
2.4GHZ ~ 5.8GHz
ANR,ANTENNA
Dipole antenna
25MHz ~ 1.7 GHz
ADV,TR1720
Loop vertical antenna system
100kHz ~ 30 MHz
AH,SAS-200/574
AH,SAS-200/571
18GHz ~ 40 GHz
Double ridge guide horn antenna
700MHz ~ 18 GHz
RS,HL013
Log periodic antenna
80MHz ~ 1300 MHz
AN,SAS-200/550
Monopole rod antenna
100kHz ~ 60 MHz
HOL,HI-3002
Isotropic RF radiation monitor
500kHz ~ 6 GHz
NAR,8616
Radio frequency radiator monitor
300MHz ~ 26 GHz
SE,MONITOR 4
Alpha, Beta, Gamma and X-Ray radiation monitor
SE,MCIK
Gamma X-Ray radiation monitor
HOL,HI-3004
,VRWURSLF5)ORZOHYHO¿HOGVWUHQJWKPHWHU
0.5MHz ~ 6 GHz
WG,ESM-20
3HUVRQDO5)¿HOGPRQLWRU
1MHz ~ 18 GHz
NAR,8217
Field strength meter for microwave ovens
2.4GHz
ROB,TX90
Microwave oven leakage detector
2.4GHz
PRO,3201
RF signal analyser & meter
100kHz ~ 2.06GHz
AH,ANTENNA
Log periodic antenna
300MHz ~ 12GHz
See also TV Test Equipment
Advantest TR1720 100kHz ~30MHz Antenna
ADV,TR1720
AU
Loop and vertical antenna system. Frequency range 100kHz~30MHz. Suitable
IRUXVHZLWK$'95'IRU¿HOGVWUHQJWKDQG(0,PHDVXUHPHQWV$QWHQQD
WXQHULQFOXGHGZKLFKFDQEHXVHGDVDQLQSXWRXWSXW¿OWHUWRUHMHFWQRLVHEHORZ
the measuring frequency.
AH Systems SAS-200/571 Antenna
AH,SAS-200/571
AH,SAS-571
AU
MY
Double ridge guide horn antenna. Frequency range 700MHz~18GHz. Continuous
SRZHU:,PSHGDQFHŸ9PPD[UDGLDWHG¿HOG7\SH1IFRQQHFWRU
AH Systems SAS-200/574 18~40GHz Antenna
AH,SAS-200/574
AU
Double ridge guide horn antenna 18~40GHz. Gain in excess of 15dB. Type
K(f) connector compatible with 3.5mm connectors including SMA. Complete
with tripod.
AH SAS-200/550-2B 100Hz~60Mhz Rod Antenna
Rohde & Schwarz HL013 80MHz~1.3GHz Log-Periodic Antenna
RS,HL013
AU
Complete with tripod.
Holaday HI-3002 Field Strength Meter
HOL,HI-3002
AU
,VRWURSLF5)UDGLDWLRQPRQLWRU(¿HOG+¿HOGSUREHVVSDQQLQJN+]a*+]
(¿HOGa0+]+¿HOG2SHUDWHVIURPEDWWHULHV
Narda 8616 Radiation Hazard Monitor
NAR,8616
AU
Radio frequency radiation monitor complete with probes. Battery operated
with analogue meter and recorder output (3Vdc full scale). Probe type 8623B
has a frequency range of 300MHz~26GHz over a range of 0.05~100mW/cm2.
(Frequency range up to 8GHz is calibrated to NATA standard, above 8GHz
FDOLEUDWLRQLVWRPDQXIDFWXUHU¶VVSHFL¿FDWLRQV3UREHW\SHKDVDIUHTXHQF\
range of 10~300MHz over a range of 0.05~100mW/cm2.
SE International Monitor 4 Nuclear/X-Ray Monitor
SE,MONITOR 4
AU/MY
Monopole rod antenna. Frequency range 100Hz~60MHz. Active unit with battery
power. Rod height 220mm~1.09m. Ground plane 450 x 450mm. Antenna factor
0~24.
Alpha, Beta, Gamma & X-ray radiation monitor. Meter, LED & audible indication.
Range; 0~0.5, 5, 50mR/hr, 0~500, 5,000, 50,000CPM, 0~5, 50, 500µSv.
Energy sensitivity Alpha 2.5MeV, Beta 50KeV, Gamma & X-ray 10KeV. Battery
operated.
AH Systems 300MHz ~12GHz Antenna System
SE International Monitor MC1K Radiation Survey Meter
AH,SAS-200/550
AH,ANTENNA
AU
AU
SE,MCIK
AU
Log periodic antenna system. Comprises two antennas: A: 300MHz~1.8GHz,
power handling 1kW, antenna factor 15~32dB, B: 1~12GHz, power handling
10W, antenna factor 25~44dB. Complete with tripod.
Gamma & x-ray radiation monitor. Meter, LED, and audible indication. Ranges
0.1~1,000mR/h & 0.01~10mSv/h full scale. Battery operated.
Anritsu Dipole Antenna Kit
HOL,HI-3004
ANR,ANTENNA
AU
Comprises types MP534Aand MP651Aantenna covering 25~520 & 470~1,700MHz.
Complete with tripod type MB9A and coaxial cable.
Anritsu 2.4/5.8GHz WIFI 802.11A/B/G Antenna
ANR,WIFI-ANTENNA
Holaday HI-3004 Field Strength Meter
AU
,VRWURSLFEURDGEDQG¿HOGVWUHQJWKPHWHUGHVLJQHGSULPDULO\WRPHDVXUHORZOHYHO
¿HOGVIRU(0,(0&VWXGLHV0HWHUVFDOHFDOLEUDWHGLQYPZLWKSRLQWHUGHÀHFWLRQ
proportional to v2/m26XSSOLHGZLWK+6(KLJKVHQVLWLYLW\(¿HOGSUREH67((
Field probe. HSE probe has 4 ranges, 1v/m ~30v/mFS, 0.5~1,500Mhz. STE probe
has 4 ranges 100v/m~3,000v/mFS, 0.5Mhz~6Ghz. Recorder output (0~1Vdc).
High precision antenna set for wireless network test applications (802.11A/B/G,
11Mbps &54 Mbps). Includes 2.4GHz and 5.8GHz antennas with reverse SMA
FRQQHFWRUV$OVRLQFOXGHVSUHFLVLRQUHYHUVH60$WR1W\SHDGDSWHUWR¿WVWDQGDUG
test equipment.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
23
RF & Microwave
Test & Measurement
Field Strength Meters & Antennas (cont’d)
WG ESM-20 Radiation Meter
WG,ESM-20
AU
3HUVRQDOPRQLWRUIRUKLJKIUHTXHQF\HOHFWURPDJQHWLF¿HOGV6LPXOWDQHRXV(DQG
+¿HOGPHDVXUHPHQWV%DWWHU\OLIHK)UHTXHQF\UDQJH+¿HOG0+]a*+]
(¿HOG0+]a*+]&RPSHQVDWHVIRUKXPDQERG\DEVRUSWLRQVRFDQEHZRUQ
System includes alarm.
Narda 8217 Microwave Oven Survey Meter
NAR,8217
AU
Complete with beaker and thermometer for oven power measurement. Calibration
frequency 2.45GHz. Measurement range 0.5~10mW/cm2. Battery operated.
Robin Electronics TX90 Microwave Leakage Detector
ROB,TX90
Protek 3201 RF Analyser/Signal Meter
PRO,3201
AU
RF signal analyser and level meter. Provides spectrum display up to 2.06GHz,
audio output, level measurement, and frequency measurement. In-built antenna.
Frequency range 100kHz~2.06GHz with frequency steps from 5kHz. Modulation
types narrow and wide band FM, AM, and SSB. Level measurement min frequency
- narrow band FM 1MHz, wide band FM, AM, SSB 10MHz. Bandwidth - narrow
band FM 12.5kHz, wide band FM 180kHz, AM & SSB 2.4kHz. Frequency
PHDVXUHPHQW0+]a*+],QSXWLPSHGDQFHŸ
AU
Eight dipole analogue meter reading. Ranges 1~10mW/sqcm & 0·1~1mW/sqcm.
Display analogue moving coil. Power density accuracy ±1dB. Probe area 2cm2.
6XSSOLHG ZLWK D PDQXIDFWXUHUV FHUWL¿FDWH RI FDOLEUDWLRQ WUDFHDEOH WR 1DWLRQDO
Standards. Powered by 9V alkaline battery.
Modulation Meters
Marconi TF2304 Auto AM/FM Modulation Meter
MAR,TF2304
Automatic operation. Frequency 9~12.5MHz & 18~1,000MHz, FM deviation 8 ranges, 1.5~150kHz FS AM depth 3 ranges, 10~30~100%.
AU
EMC Test Equipment
Laplace RF Absorbing Clamp
LAP,RF-CLAMP
AU
Schaffner CDN-125 Capacity Coupling Clamp
SFN,CDN-125
AU
For measurement of emissions from power and other lines to CISPR and VDE
VWDQGDUGV)UHTXHQF\UDQJH0+]a*+]2XWSXWŸ
For injection of interference pulses into signal and data lines. Used with SFN,
NSG-225A transient burst generator. Complete with 402-379 6dB attenuator.
Laplace SA1000 EMC Test System
Schaffner 438 30kV Static Discharge Generator
LAP,SA1000
AU
SFN,438
AU
&RPSULVHV3&FRQWUROOHGVSHFWUXPDQDO\VHUN+]a*+]6$SUHDPSOL¿HU
5)EURDGEDQGDQWHQQD0+]a+]77,/,61/,61DQG5)(¿HOG
+¿HOGSUREHV6XSSOLHGZLWKQRWHERRN3&DQG(0&VRIWZDUH
Generates an electrostatic charge in a range from 2~30kV. This instrument is in a
‘gun’ form. Removable discharge network which can be interchanged with other
(optional) impedance networks. Performs test to IEC1000-4-2 standards.
Seaward Near Field Probe 20 MHz~1Ghz
Schaffner NSG-420 RF Current Immunity Tester
SEA,PROBE
AU
0HDVXULQJ+¿HOG)UHTXHQF\UDQJH0+]a*+]1RPLQDOJDLQG%
Schaffner BestPlus B-1
SFN,BEST+
AU
EMC, ESD, PQT, Burst and Surge Immunity generator simulators. Includes
ESD generator/gun.
SFN,NSG-420
AU
Provides pre-compliance testing to IEC 801-3 and IEC 801-6. Clamp coupled to
power, data, and signal cables of a device under test. Injects noise signal from
100kHz~100MHz with a level response from 1MHz~10MHz. AM & FM modulation
of source from a 1kHz oscillator source or an external input. Indication of signal
current from source or existing signal. Also dc recorder output of this signal. Cable
size up to 10 x 22mm. Operates for 1h on 4AA alkaline batteries.
Communications Test Sets
Marconi 2945 Communications Test Set
MAR,2945
AU
Output frequency range 400kHz~1.05GHz. Input frequency range to modulation
monitor and spectrum analyser 100kHz~1.05GHz. Tracking generator with offset
tracking inbuilt. Power measurement to 150W. Full duplex operation. AMPS cellular option included. Spectrum analyser with 1kHz resolution. AC mains, external
11~32V and internal battery operation. RS232C remote control interface.
Marconi 2945A Communications Test Set
MAR,2945A
AU
Output frequency range 400kHz~1.05GHZ. Input frequency range to modulation
monitor and spectrum analyser 100kHz~1.05GHz. Tracking generator with offset
tracking in-built. Power measurement to 150W. Full duplex operation. Spectrum
analyser with 1kHz resolution. AC mains, external 11~32V dc on some assets,
and external battery operation. RS232C remote control interface.
HP 8920A Communications Test Set
HP,8920A
AU
RF Communications Analyser test set. Frequency range of 250KHz~1GHz.
Includes an AM/FM signal generator, AM/FM modulation analyser, duplex offset
generator, SSB demodulator, RF power meter, frequency counter, ac/dc voltmeter,
SINAD meter, Distortion meter, oscilloscope and two variable audio sources.
Includes Spectrum analyser with tracking generator. Antenna & microphone are
included.
24
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
Communications Test Sets (cont’d)
Anritsu MS8608A Digital Mobile Radio Transmission Tester
IFR Com120B Communications Analyser
IFR,COM120B
AU
Communications test set to 1GHz.
ANR,MS8608A
AU
Equipped with internal spectrum analyzer, modulation analyzer and power meter.
Spectrum analyzer has resolution bandwidths up to 20MHz, supports measurement
of a 2Mb/s (16Mcps) wide-band signal for IMT-2000. Modulation analyzer realizes
all Vector Signal Analysis (VSA) functions through high-speed DSP processing.
Power sensor performs highly accurate power measurements of ±0.4dB using an
amorphous power sensor. Up to three dedicated measurement software options
(such as -CDMA & GSM/EDGE) can be installed simultaneously. Input signals can
be selected from either RF or I/Q inputs. For I/Q signals, balanced or unbalanced
input can also be selected. Equipped with GPIB, RS232C & 10 Base-T (optional)
interfaces for remote measurement. Monitor uses 6.5” TFT color LCD screen.
Power Meters - RF
Model
HP,E4418B
Type
Digital Power Meter
Frequency
Power
9kHz~8GHz
100µW~25mW
Dual Channel Power Meter
.HP,436A & HP,8481A
HP,436A & HP,8484A
HP,436A & HP,8485A
10MHz~18GHz
Digital power meter & sensor
HP,436A & HP,8482B
1µW~100 mW
0.1nW~10µW
50MHz~26.5GHz
1µW~100mW
100kHz~4.2GHz
1W~25W
HP,E4418B
HP,E4419B
BIR,43
RF Thru-line power meter
BIR,4391
In-line digital RF power meter
BIR,4391A
RF Digital Thru-line power meter
0.45~27GHz
BIR,4421
In-line RF power meter
1.8MHz~26.5GHz
300mW~1kW
BIR,APM16
Average reading power meter for PCD GSM & CDMA
0.4MHz~2.2GHz
2.5W~25W
BIR,ELEMENT
Elements for Model 43
According to element
100mW~10kW
According to element
MAR,6970
Digital power meter
COL,DC1500A
In-line RF power meter
dc~0.5 GHz
According to sensor
100W
WAV,FIT
RF power & VSWR meter
70MHz~1GHz
20mW~50W
R&S,NRT-Z43-Z44
Directional power meter
R&S,NRT
3RZHUUHÀHFWLRQPHWHU
HP,E4418B
30W
30W
Ż1(:Ż
Ż1(:Ż
HP E4418B High Speed 1 Channel Averaging Power Meter
200MHz~4GHz
HP E4419B High Speed 2 Channel Averaging Power Meter
AU
High-performance, single-channel, programmable power meter. Fully compatible
with the 8480 series and the E-series power sensors (except the E9320A family).
Depending upon sensor used, the E4418B can measure from -70dBm~44dBm at
frequencies from 9kHz~110GHz. Designed for bench and automatic test equipment
(ATE) use, the E4418B makes fast (up to 200 readings/s with E-series sensors),
accurate and repeatable power measurements.
HP,E4419B
AU
High-performance, dual channel, programmable power meter. Fully compatible
with the 8480 series and the E-series power sensors (except the E9320A family).
Depending upon sensor used, the E4418B can measure from -70dBm~44dBm
at frequencies from 9kHz~110GHz. Designed for bench and automatic test
equipment (ATE) use, the E4418B makes fast (up to 200 readings/s with E-series
sensors), accurate and repeatable power measurements.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
25
RF & Microwave
Test & Measurement
Power Meters - RF (cont’d)
HP 436A Digital Power Meter
HP,436A
AU
100µW~25W, 100kHz~18GHz (depending on power sensor), 4 digit display~W,
dBm, dB (rel). Power sensor required, select and specify when ordering.
HP 8481A 100MHz~18GHz Power Sensor for HP43X Series Meters
HP,8481A
For HP436A, HPE4418B & HPE4419B. 100MHz~18GHz, 1µW~100mW.
HP 8484A 0.01 ~18GHz Power Sensor
HP,8484A
AU
AU
For HP436A, HPE4418B & HPE4419B. 10MHz~18GHz, 0.1nW~10µW. Complete
with HP,11708A 30dB reference attenuator.
HP 8485A 50Mhz~26.5GHz 100mW Sensor
HP,8485A
AU
For HP436A , HPE4418B & HPE4419B. Frequency range 50MHz~26.5GHz
power range 1µW~100mW.
HP 8482B Power Sensor for HP 436A, 435B
HP,8482B
For HP436A, HPE4418B & HPE4419B. 10kHz~4.2GHz, 1mW~25W.
HP E9300A Power Sensor for HP E4416, E4418
HP,E9300A
AU
HIO,3134
AU/MY
MY
AC line power meter, 3 phase W/V/A 1000kw uses two-wattmeter method for 3
wire systems. Can do 4 wire systems. Digital display plus analogue O/P for all
display values V/A/W/VAR. Watts/VAR can both be O/P together to derive power
factor. Supplied with 2x CT’s 3x volts I/P leads in case.
Hioki 3136 Clamp-on Power Meter
HIO,3136
MY
Power meter 3-phase, 4-wire. FSD 200/1000kw 1kA 600/3V 200/1000 kVAR
UHFRUGHU239Ÿa+]FRPSOHWHZLWK[&7¶VXQLWZLOOPHDVXUH
phase V, A & W. VA & VAR will need to be calculated. On 3-phase it will measure
VAR, VA will need to be calculated.
Fluke 36 True RMS ac/dc Clamp Meter
FLU,36
MY
Jaws accept 1 x 750 MCM (1.2 (3mm)) cable or 2 x 500 MCM, (0.98 (2.46cm))
cables up to 38mmØ. True-rms responding. 3.5 digit, 2000 count display. Rugged
design. AC current(45~400Hz), range 600A/200A, resolution 1A/.1A, accuracy
10~600A ±(2%+3) or 0.5~200A ±(2%+5), crest factor 2</-CF</-3, add 2% Rdg,
overload protection, 600A continuous (CF</-3). DC current range 1kA/1kA/200A,
resolution 1A/1A/1A, accuracy 0~600A ±(1.9%+4), 600~1000A ±(3%+3), 0~200A
±(1.9%+7), overload protection 1kA. AC volts(45~400Hz), range 600V/200V,
resolution 1V/1V, accuracy ±(1.5%+3), crest factor <3 (pk voltage ±933V),
overload protection 1200V rms. DC volts range 600V/200V, resolution 1V/1V,
accuracy ±(1.0%+3), overload protection 1200V rms continuous. Manual ranging.
3URWHFWLYHFDVH7/KDUGSRLQWWHVWOHDGV&RQWLQXLW\EHHSHUXQGHUŸ
Bird 43 Power Meter
BIR,43
MY
5)WKUXOLQHSRZHUPHWHU5HTXLUHVELUGHOHPHQWRIVSHFL¿HGIUHTXHQF\DQGSRZHU
0HDVXUHVIRUZDUGDQGUHÀHFWHGSRZHUE\UHYHUVLQJWKHHOHPHQW
Bird RF Element for Model 43 Power Meter
BIR,ELEMENT
BIR,ELEMENT-LF
BIR,ELEMENT-HF
Bird watt meters. Available in various power and frequency ranges.
26
BIR,4391
AU
MY
MY
AU
RF power meter/analyser with pulse power capability covering 0.45~2,300MHz
at a power of 100mW~10kW according to the elements selected (elements
rented separately). Measures peak pulse, peak envelope, & CW power. Pulse
parameters: minimum pulse width 0.8µs, 100~2,300MHz, 1.5µs, 26~99MHz,
15µs, 2~25MHz; minimum repetition rate 25pp/s & minimum duty factor 1 part in
10,000. Measures VSWR and percentage modulation. Operates from ac mains
and rechargeable batteries.
Bird 4391A RF Digital Thru-Line Power Meter
BIR,4391A
MY
3RZHUPHWHUZLWKGLJLWDOGLVSOD\PLFURSURFHVVRUEDVHGRSHUDWLRQDQGVLPSOL¿HG
push-button control. Wattmeter is suited to telemetry, two-way communications,
avionics, radar, and standard radio and TV applications. Freq. 0.45~2700MHz.
Power 100mW~10kW with 20% over-range. Reads forward and reflected
CW or FM power in watts or DBM. Calculate SWR, return loss in dB and %
modulation.
Bird 4421 Wide Range Power Meter
BIR,4421
For HPE4416/HP,E4418 power meters. 10MHz~18GHz frequency range.
1nW~100mW (-60~+20dBm) power range. 320mW max average power handling
(+25dBm), 2W (+33dBm) peak power (<10usec). N-Type connectors.
Hioki 3134 Digital Power Meter
Bird 4391 In-line Digital RF Power Meter
AU
Supplied complete with 4021 sensor 300mW~1kW, 1.8~32MHz and 4022 sensor
300mW~1kW, 25MHz~1GHz. Max input 1.2kW. VSWR range 1~2. Measures
forward and reverse power in W or dBm, VSWR, and return loss in dB. Digital
display. Operates from ac mains or internal rechargeable batteries.
Bird APM16 Power Meter
BIR,APM16
AU
Average reading power meter intended for PCS, cellular (including CDMA, GSM)
and general purpose applications. Includes in-line elements for 2.5 & 25W,
frequency ranges 0.4~1GHz, 1.7~2.2GHz. Battery operated.
Marconi 6910 Power Sensor
MAR,6910
MY
)UHTXHQF\UDQJH0+]a*+]3RZHUUDQJHG%PaG%Pȝ:aP:
0D[5)LSG%PP:&:G%P:SHDNIRUȝV6HQVLQJHOHPHQW
semiconductor thermocouple. VSWR 1.25 10MHz~30 MHz, 1.1 30MHz~2GHz,
1.18 2~16GHz, 1.28 16~18 GHz, 1.4 typical 18~20GHz. Linearity factor provided
with sensor. Accuracy ±0.5% at 25C between 10 & 20dBm. Improves by a factor
of 10 for each lower rang. Calibration factor provided with sensor. Accuracy
uncertainty provided with sensor. Resolution 0.01%. RF connector precision
1W\SH0Ÿ
Marconi 6912 Power Sensor
MAR,6912
MY
)UHTXHQF\ UDQJH N+]a*+] ,S SRZHU UDQJH G%P ȝ: WR G%P
(100mW).
Marconi 6913 Power Sensor
MAR,6913
MY
)UHTXHQF\UDQJH0+]a*+],SSRZHUUDQJHG%Pȝ:WRG%P
P:0D[G%PP:&:G%P:SHDNIRUȝV6HQVLQJ
element semiconductor thermocouple. VSWR 1.40 10MHz~50MHz, 1.15
50MHz~100MHz, 1.10 100MHz~2GHz,
1.15 2~12.4GHz, 1.20 12.4~18GHz,
1.25 18~26.5GHz. Calibration factor provided at 1GHz intervals (500MHz intervals
above 20GHz) with each sensor. Accuracy uncertainty provided with each sensor.
Resolution 0.01%. Linearity factor accuracy ±0.5% at 100mW, decreasing by
0.005% per 1mW.
Marconi 6920 Power Sensor
MAR,6920
MY
High sensitivity diode sensor. Frequency range 10MHz~20GHz. I/p power range
G%PQ:WRG%Pȝ:PD[G%PP:&:G%P:SHDN
IRUȝV6HQVLQJHOHPHQW6KRWWN\EDUULHUGLRGH96:5aa0+]
1.20 40MHz~10GHz,
1.35 10~18GHz, 1.40 typical 18~20GHz. Calibration
factor provided at 1GHz intervals with
each sensor. Accuracy uncertainty
provided with each sensor.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
RF & Microwave
Test & Measurement
Power Meters - RF (cont’d)
Marconi 6923 RF Power Sensor
MAR,6923
MY
High sensitivity diode sensor. Frequency range 10MHz~26.5GHz. I/p power range
G%PQ:WRG%Pȝ:PD[G%PP:&:G%P:
SHDNIRUȝV6HQVLQJHOHPHQW6KRWWN\EDUULHUGLRGH96:5a0+]
1.15 40~100MHz, 1.12
0.1MHz, 1.17 2~8GHz, 1.30 8~18GHz, 1.50 typical
18~26.5GHz. Calibration factor provided at 1GHz intervals with each sensor.
Accuracy uncertainty provided with each sensor. Resolution 0.01%. Linearity
factor provided with each sensor. Accuracy ±1% between -30 & -20dBm. RF
FRQQHFWRUW\SH10SUHFLVLRQŸ
Wavetek FIT RF Power and VSWR Meter
WAV,FIT
NZ
Portable RF power meter with VSWR, volts and resistance measurements.
Frequency range is 70MHz~1GHz. Power range is 20mW~50W, resolution is
10mW. Accuracy is ±0.5dB at 1W. VSWR range is 1.2~10. Voltage measurement
LVa9UHVROXWLRQLVP95HVLVWDQFHPHDVXUHPHQWLVaNŸUHVROXWLRQ
is 0.1.
Rohde & Schwarz NRT-Z43-Z44 Directional Power Meter
R&S,NRT-Z43-Z44
MY
NiCd battery operated with digital display. Complete with ac adaptor. Requires
sensor. Sensors available for 10MHz~26.5GHz frequency range.
0HDVXUHVSRZHUDQGUHÀHFWLRQXQGHURSHUDWLRQDOFRQGLWLRQV:LGHIUHTXHQF\
range from 200(400)MHz~4GHz covers all relevant frequency bands. Measurement
method is compatible with all common analog and in particular digital modulation
standards: GSM/EDGE, 3GPP (W-/TD-CDMA), CDMA (IS-95), CDMA2000, PHS,
NADC, PDC, TETRA, DECT, DAB, DVB-T and many more.
Coline DC1500A VSWR/Power Meter
5RKGH6FKZDU]1573RZHU5HÁHFWLRQ0HWHU
Marconi 6970 Digital Power Meter
MAR,6970
AU/MY
COL,DC1500A
AU
Frequency range: dc~1.5GHz. Accuracy ±5% of reading. Max continuous power
100W, intermittent 200W. Resolution 0.1W. VSWR measurement 30MHz~1.5GHz.
Usable to 10MHz. Power range for VSWR varies with frequency. Min 5W @
30MHz, 30mW at 1.5GHz. Max 200W @ 30MHz, 50W @ 1.5GHz. Range
1.00~19.99. 50W RF load included.
RS,NRT
MY
0HDVXUHVSRZHUDQGUHÀHFWLRQXQGHURSHUDWLRQDOFRQGLWLRQV:LGHIUHTXHQF\UDQJH
from 200(400) MHz ~4GHz covers all relevant frequency bands. Measurement
method is compatible with all common analog and in particular digital modulation
standards. GSM/EDGE, 3GPP (W-/TD-CDMA), CDMA (IS-95), CDMA2000, PHS,
NADC, PDC, TETRA, DECT, DAB, DVB-T and many more.
RF Attenuators
Model
Type
HP,8494B-8496B
HP,8494B
HP,8495B
Frequency (GHz)
Power Max (W)
121
Coaxial step attenuator
HP,8494/5B
HP,8495D
Attenuation (dB)
11
dc~18
70
1
81
70
dc~26.5
WEI,33-10-34
Step attenuator
10
dc~8
25
WEI,34-30-34
30
dc~4
24
WEI,46-03-34
3
Fixed
WEI,46-06-34
50
6
WEI,46-10-34
10
WEI,46-20-43
20
WEI,AS6
Calibrated attenuator
3
dc~18
25
WEI,AS20
Variable attenuator
30
dc~26.5
WEI,M2020
Attenuator
20
dc~18
BIR,25A-10
Fixed
10
dc~4
25
NAR,705-69
Attenuator
30
dc~18
25
HP 8494B/8496B Attenuator Set 121dB x 1dB
HP,8494B-8496B
AU
Coaxial step attenuator set. DC-18GHz. 0.11dB in 1dB steps and 10-110 dB in
10dB steps. Type N(f) connectors. Comprises a connected set of types 8494B
and 8496B with 11716A rigid interconnect kit.
HP 8494B 11 x 1dB 18GHz Coaxial Step Attenuator
HP,8494B
HP,8495B
DC~18GHz. 0~70dB in 10dB steps.
HP 8494/5B Coaxial Step Attenuator Set 81dB x 1dB
HP,8494/5B
AU/MY
DC~18GHz. 0~11dB in 1dB steps. 11~81dB in 10dB steps. Type N(f) connectors.
Comprises a connected set of types 8494B & 8495B.
HP 8495D 70dB 26.5GHz Step Attenuator
HP,8495D
AU
DC~18GHz. 0~11dB in 1dB steps. 1W average power handling. Option 001.
N type connectors.
HP 8495B 70dB x 10dB Coaxial Step Attenuator
2
AU/MY
70dB step attenuator in 10dB steps. Frequency range dc~26.5GHz. Max
continuous power 1W. Note attenuator uses 3.5mm connectors.
Weinschell 33-10-34 25 W 10dB 8.5GHz RF Attenuator
WEI,33-10-34
AU
10dB, 25W, dc~8GHz. Type N connectors.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
AU
27
RF & Microwave
Test & Measurement
RF Attenuators (cont’d)
Weinschell 46-20-43 25W 20dB 18GHz RF Attenuator
WEI,46-20-43
DC~18GHz, 20dB, 25W. Type N connectors.
AU/MY
Weinschell 34-30-34 25W 30dB 4GHz RF Attenuator
WEI,34-30-34
AU
30dB, 25W, dc~4GHz. Type N connectors.
MY
Set of calibrated RF attenuator. Frequency range DC-18GHz, set consists of
4 different nominal value 3, 6, 10 & 20dB. Connector type N per mil-STD-348,
power rating 5W.
WEI,M2-20
WEI,46-03-34
MY
DC - 18GHz, 3 dB, average power 25W, 200W peak, type N connector
BIR,25A-10
WEI,46-06-34
MY
DC - 18GHz, 6 dB, average power 25W, 200W peak, type n connector.
DC~4GHz, 10dB, 25W, .
%LUG5)&RD[LDO5HVLVWRU:Ÿ
BIR,8080
Weinschell 46-10-34 50W 10dB 18GHz RF Attenuator
WEI,46-10-34
MY
NAR,705-69
Weinschell AS20 Precision Attenuator Set
AU
AU
MY
Ÿ:'&0+='XPP\/RDG
Narda 705-69 69 x 1dB GHz Attenuator
DC - 18GHz, 10 dB, average power 25W, 200W peak, type N connector.
MY
20 dB attenuator. DC to 18GHz, double male N type
Bird 25-A-MFN-10 10dB 25W 4GHz RF Attenuator
Weinschell 46-06-34 50W 6dB 18GHz RF Attenuator
DC~26.5GHz. Attenuator values 3,6,10,20,30dB. Average power 2W.
3.5mm connectors.
WEI,AS6
Weinschell M2-20 Attenuator
Weinschell 46-03-34 50W 3dB 18GHz RF Attenuator
WEI,AS20
Weinschell AS6 Calibrated Attenuator Set
MY
Step Attenuator. 0 - 69dB in 1dB steps. Frequency range DC - 18GHz
Filters
Krohn-Hite 3550 Bandpass Filter
KRO,3550
AU
%DQGSDVVEDQGUHMHFWORZSDVVKLJKSDVV¿OWHU)UHTXHQF\UDQJH+]aN+]%DQGZLGWK+]a0+]0D[DWWHQXDWLRQG%6ORSHG%SHURFWDYH
RF Accessories
HP 85021A RF Directional Bridge
HP,85021A
For HP,8757A scalar network analyser.
HP 11667A Power Splitter
HP,11667A
AU
HP,X281A
8.2~12.4GHz waveguide to type N (F) adaptor.
HP P281B-013 WR-62, 1-089 to Coax Adaptor
HP,P281B
12.4~18GHz waveguide to type N(f) adaptor.
HP S281A WR-284 to N(F) Adaptor
HP,S281A
2.6~3.95GHz waveguide to type N (F) adaptor.
RF Connector Kit N, BNC, TNC, SMA, APC7
TR,RF-CONN
AU
AU
AU
MAU,K200A1
Adaptor WR42 K band 18~26.5GHz waveguide to 3.5mm (F) adaptor.
HP 11692D Dual Directional Coupler
HP,11692D
Frequency range 2~18GHz.
28
AU
HP 908A Coaxial Termination
HP,908A
DC~4GHz. Max power 0.5W average.
HP 11852A Min Loss Pad 50 ~75Ÿ
HP,11852A
AU
AU
/RZ6:5PLQORVVSDGIRUXVHZLWKŸ network analysers or other instruments
WRDOORZFRQQHFWLRQWRŸ cables and devices.
Radiall R-404850 RF Termination
RAD,R-404850
AU
5)ORDG:ŸGFa*+]7\SH10
AU
Telonic TLP 700, 700MHz Low Pass Filter
TEL,TLP700
N type connectors.
AU
RF connection adaptors. Comprises 10 couplers with interchangeable connectors;
3 x N, BNC, SMA, & 1 x TNC, all (M) & (F). Includes APC~7 to N (F) adaptor.
Maury K200A1 K Wave Guide to Coax Adaptor
HP,778D
Frequency range 100MHz~2GHz.
For HP,8757A scalar network analysers, dc~18GHz, 0.5W max. N (F) connector
on all ports.
HP X281A WR-90, 1-079 to N(F) Adaptor
HP 778D Dual Directional Coupler
AU
Telonic RF Sampler N type through with BNC Sampling Port
TEL,1-EFB
AU
AU
Insertion loss = 0Db, coupling factor = 27Db at 1GHZ. N type connector through
line with side entry BNC to take sample of signal.
Flann 1713320 Waveguide Directional Coupler
FLA,1713320
20dB.
AU/MY
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
AU
Low Frequency
Test & Measurement
Phase Meters
Krohn-Hite 6400 Phase Meter
KRO,6400
AU
Digital phase meter. Frequency range 3Hz~5MHz. Input voltage range 0.01~120V rms. Resolution 0.1O. Analogue recorder output.
LF Signal Generators
Tektronix ASG100 Audio Generator
TEK,ASG100
MY
Dual CH for stereo applications. Balanced i/p & o/p. Connects in-line for easy test
VLJQDOLQVHUWLRQ4XLFNLGHQWL¿FDWLRQRILQVHUWLRQSWZLWKYRLFH,'6KRUWGXUDWLRQ
audio test sequence for rapid automatic checkout of audio lines. Single button
VHOHFWLRQ RI OLQHXS WRQH 0DQXDO PRGH DOORZV VHOHFWLRQ RI IUHT DPSOLWXGH
RS-232 for remote control.
AWA G232 Low Distortion Oscillator
AWA,G232
Genrad 1390B Random Noise Generator
GR,1390-B
AU/MY
Random noise generator. Frequency range 5Hz~5MHz, range selectable 20kHz,
500kHz & 5MHz. Output level 3V, 2V, 1V for each frequency range respectively.
*DXVVLDQ RXWSXW )UHTXHQF\ UHVSRQVH G% +]aN+] 3LQN QRLVH ¿OWHU
optional.
AU
8OWUDORZGLVWRUWLRQRVFLOODWRU+]aN+]2XWSXWOHYHOG%P9UPVLQWR
ŸGLVWRUWLRQ¿JXUHG%+]aN+]
Distortion Analysers
HP 8903B-010-051 Audio Analyser
HP,8903B
AU
Audio analyser for communications and other applications. Measures distortion,
VLQDGVLJQDOWRQRLVHDF9GF9IUHTXHQF\/RZGLVWRUWLRQSURJUDPPDEOHVLQH
ZDYH VRXUFH )UHTXHQF\ UDQJH +]aN+] 2SWLRQDO +] KLJK SDVV DQG
&&,77ZHLJKWLQJ¿OWHUV¿WWHG
Trend Type 3 Distortion Generator
TRE,TYPE 3
Distortion generator.
AU
Did you know?
When your presentation has to be spot-on,
TECHRENTALS has the solution.
Whether it’s a small Board Meeting or
International Conference, we have the largest
range of data projectors and we can help you
look your best, every time.
Discuss your presentation needs with our
knowledgeable staff today.
Call now!
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
29
TV Test Equipment
Test & Measurement
TV Test Equipment
Promax Prolink 4C Premium Analogue/Digital TV Test Set
PRO,PROLINK4C-PREM
AU
Measures terrestrial, satellite and cable TV systems including analogue and digital
VHF & UHF bands. Built in colour monitor provides measurement readout and
can be used to display video signal. Measurement functions include spectrum
analysis, direct signal level readout, carrier to noise, channel power, digital carrier
to noise, digital bit error ratio (BER) and digital QAM constellation. DVB digital
79FKDQQHOLGHQWL¿HU/RJVWR3&DQGLQFOXGHVVRIWZDUHIRUUHPRWHFRQWURODQG
channel plan management.
Philips PM5639/001 TV Colour Analyser
PHI,PM5639
TEK,1741
PAL waveform monitor and vectorscope for television and video use.
Promax MC577 Cable/Sat TV Level Meter with Spectrum Analyser
PRO,MC577
AU
Digital and analogue TV analyser with true BER for QPSK (digital satellite) and QAM
(digital cable). 45-2, 150MHz frequency range. Signal level, digital channel power,
carrier to noise and vision to audio ratio measurements. Instantaneous real-time
spectrum display. Spectrum measurement bandwidth selectable. Bit Error Rate
signal quality measurement system for Digital Satellite (QPSK) or Digital Cable
(QAM). Errors are shown with calibrated MER. Timer counts seconds, minutes
& hours since lock was last lost. Analogue and digital data logging of logging
MATV, SMATV and UBB TV distribution system signal levels across DTH, MDU
DQG05(LQVWDOODWLRQV3URWHFWLYHUXEEHUPRXOGLQJFDVHVXLWDEOHIRU¿HOGZRUN$&
and rechargeable battery operated. Teletext, DiSEqC 1.1, SCART and RS232.
Pre-programmed with Foxtel/Austar channels.
AU
For adjustment of the brightness and colour of CRT based television and computer
monitors. Simple test signals are required for operation. Analyser provides an
RGB balance and also measures luminance and colour error. Operation at any
79¿HOGUDWHEHWZHHQ+]
Tektronix 1741 Vectorscope/Waveform Monitor
Unaohm EP300 QPSK & QAM Cable & Satellite TV Tester
UNA,EP300-QQ
Unaohm S20 & Datum 10 Digital TV Meter Combo Meter
UNA,DATUM10-S20
AU
Comprises S20 Satellite digital and analogue television bit error rate meter and
Datum 10 terrestrial digital and analogue television instrument.
AU
AU
Portable analogue and digital TV test instrument which includes all current
measurement functions required during analog and digital TV installation. Single
input for both terrestrial and satellite up to 2,150MHz. Includes spectrum analyser,
signal level meter, and monitor modes for measuring line synchronism, analog
signal levels, digital channel power, and Carrier to Noise ratio (C/N) in analog
and digital channels.
Promax GV698 TV Pattern Generator
PRO,GV698
Promax MC360B Cable/Sat TV Level Meter
PRO,MC360B
AU
TV analyser integrates all functions for installing, surveying and servicing TV signal
distribution systems, whether individual or collective, in FM, TV & satellite bands.
$V6EDQGLVFRYHUHGWRRWKLVXQLWFDQEHXVHGLQFDEOHWHOHYLVLRQ&$79¿WWLQJVDV
well. Accurate level measurement in the 48~856MHz band. Signal demodulation
is available both in AM & FM enabling audio monitoring. SAT TV frequency range
(950~2,050MHz) includes detection function for searching the parabola positioning
and since it is not frequency selective any signal in a covered band is detected.
Frequency tuned is read digitally.
Barco Quasar Modulator
BAR,MODULATOR
AU
Digital television signal converter. Rack mounted. Supports a full range of variable
data rates, signal bandwidths and constellations. Complies with ITU-TJ.83
standards, annex A (DVB), B (open cable) & C Japan. ASI input interface (with
DFWLYHORRSWKURXJK9DULHW\RILQSXWLQWHUIDFHVDYDLODEOH%LWVWXI¿QJRQRIIDQG
3&5UHVWDPSLQJ6WDWLF3,'¿OWHULQJ7XQHDEOHRU¿[HGRXWSXW5)IUHTXHQF\,)
loop. Front panel RF testpoint (-20dB). 60dBmV (rms) output level. Front panel
LCD and buttons for easy set-up. Full remote control and diagnostics with ROSA
management. Back-up and automatic level control available with ROSA.
Call now
30
AU
Multi-standard TV test pattern generator. PAL, NTSC television/video standards;
1,&$0VRXQGRSWLRQVDYDLODEOHQRW¿WWHG2SHUDWLRQ6\QWKHVLVHG5)RXWSXW
37~865MHz with 50kHz tuning steps. Teletext VPS and Zweiton stereo sound
RSWLRQVLQFOXGHG2XWSXWV5)FRPSRVLWH9YLGHR<&69+65*%6\QFK
CRO trigger, Euroconnector (SCART), which includes audio outputs. SCART
connector also includes external audio and video modulation inputs. 32 Alternative
test patterns including mono-scope with text, multiburst, and a range of CRT
adjustment patterns. Includes Teletext option.
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data, Network & Telecommunications
Test & Measurement
Telecommunications
Radcom Prismlite E1,E3,OC-3/STM-1 ATM Protocol Analyser
RAD,PRISMLITE
AU
Supports both monitor and simulate mode on E1(2048kb/s), E3(34Mb/s) and OC3/
VWP0EVPXOWLPRGH¿EUH3URWRFROGHFRGHVDOOPDMRU/$1DQG:$1RYHU
$70XQLWSURYLGHVVWDWLVWLFDODQDO\VLV¿OWHULQJDQGÀH[LEOHWUDI¿FJHQHUDWLRQ
Anritsu ME447A Transmission Measuring Set
$150($
Anritsu ME520B PCM Digital Transmission Analyser
$8
0HDVXUHVHUURUUDWHRI3&0VLJQDOVIURPN+]a0+]MLWWHUPHDVXUHPHQWIURP
N+]a0+]%XLOWLQSULQWHU&RQIRUPVWR&&,77
Anritsu ME538MLA TX & RX Microwave Link Analyser
$150(0
$8
0HDVXUHVJURXSGHOD\PRGXODWRUGHPRGXODWRUOLQHDULW\VHQVLWLYLW\GLIIHUHQWLDO
JDLQSKDVH,)%%DPSOLWXGHUHVSRQVH,)%%UHWXUQORVVIUHTXHQF\VSHFWUXP
GHYLDWLRQ DP WR SP FRQYHUVLRQ FRHI¿FLHQW SRZHU JDLQ DWWHQXDWLRQ DQG GF
FKDUDFWHULVWLFV)HDWXUHV/('GLVSOD\DXWRUDQJH&57SXVKEXWWRQSDUDPHWHU
VHOHFWLRQDQGUHPRWHPRQLWRULQJ0+]EDQGVN+]
0+]
Anritsu ML522F Measuring Receiver
$150/)
0<
0K]a*K] DQDORJXH PHDVXULQJ UHFHLYHU$SSOLFDWLRQV LQYHVWLJDWLRQ WR
GHWHUPLQHVHUYLFHDUHDVUDGLRZDYHSURSDJDWLRQWHVWDQGPHDVXUHPHQWRIVSXULRXV
UDGLDWLRQIURPWUDQVPLWWHU,QFOXGHKLJKVHQVLWLYLW\VLJQDOGHPRGXODWLRQ/&'GLVSOD\
ZLWKGLJLWV8SWRIUHTXHQFLHVFDQEHVWRUHGDQGUHFDOOHG
Nettest EPE06/7 2,8,34,140 MPPS BERT
*1((3(
75($8525$621$7$
$8
%5,35,3276WHVWVHW3URYLGHVVLPXODWLRQDQGPRQLWRUFDSDELOLWLHVIRU3ULPDU\
5DWH%DVLF5DWHDQG3276VHUYLFHV3URYLGHVGHFRGLQJRI(76,,6'1SURWRFROV
+DV68(DQG5-3276LQWHUIDFHV%DWWHU\RSHUDWHGKDQGKHOGGHYLFH
W&G/Acterna IBT-10U Basic Rate ISDN Test Set
$80<
&RPSULVHGRIVHSDUDWHXQLWV0/$OHYHOPHWHUSVRSKRPHWHU+]a0+]
# Ÿ XQEDODQFHG a N+] # Ÿ EDODQFHG +]aN+] # Ÿ
EDODQFHG,QSXWUDQJHaG%P5HFRUGHUDQGDPSOL¿HURXWSXWV0/$
V\QWKHVL]HGOHYHOJHQHUDWRURXWSXWUDQJHaG%P01$OHYHOFRPSDUDWRU
$XWRPDWLFGLVSOD\RIJDLQDQGORVVZLWKGLJLWDOUHDGRXW
$150(%
Trend Aurora Sonata BRA/PRI ISDN Test Set
$8
3&0%(57WHVWHUIRU0E3&0V\VWHPV3HUIRUPDQFHDFFRUGLQJ
WR*ZLWK%1&W\SHFRQQHFWRUV)RUXQEDODQFHGLQSXWV
Nettest EPE07 140Mb/s BERT Tester
:*,%78
$8
3HUIRUPV%(57SURWRFRODQDO\VLVWROHYHOLQFOXGHVERWK68LQWHUIDFH)HDWXUHV
LQFOXGH17VLPXODWLRQWHOHSKRQHDQGWUDFHUIXQFWLRQ;RQ'FKDQQHODQG%
FKDQQHOPHDVXUHPHQWRIVXSSO\YROWDJHV
W&G PSM 139 Selective Level Measurement Set
:*360
$8
Nettest Lite 3000E Signal Analyser
*1(/(
$8
)RUWHOHFRPPXQLFDWLRQVV\VWHPV)XQFWLRQDOLW\IRU$%,666,6'1IRUXVH
LQERWKZLUHGDQGZLUHOHVVFHOOXODU*60DSSOLFDWLRQV'DWDLQWHUIDFHWRDOORZ
SURWRFROGHFRGLQJRQ56956FLUFXLWV
Ż1(:Ż
Digital Lightwave NIC 2.5G STM16 2.5Gbit SDH Test Set
'/:1,&*
$8
3RUWDEOHDQDO\VHUZLWKWRXFKVFUHHQ3&EXLOWLQ3URYLGHVWHVWLQJDW6'+UDWHV
RI 670 0EV *EV 7HVWV 3'+ DW (( ( '6
'60EV'XDOZDYHOHQJWKQP6&2SWLFDO
FRQQHFWRUV7HVWVLQFOXGH%(57OHYHOSURWRFROGHFRGLQJDQDO\VLVDQG$70
DQDO\VLV&RPSOHWHLQSRUWDEOHKDUGFDVH
Digital Lightwave NIC10G STM16/64 SDH Analyser
'/:1,&*
$8
1HWZRUN LQIRUPDWLRQ FRPSXWHU 9HULILHV DQG TXDOLILHV WKH SHUIRUPDQFH RI
2&F2&F 621(7 670670 *ESV 6'+ DQG ':'0
WHOHFRPPXQLFDWLRQV QHWZRUNV 2SWLFDO LQWHUIDFHV QP IRU 670 QPIRU670,QFOXGHVFRQFDWHQDWHGSD\ORDGVXSSRUWDQG2&670
DGGGURS´DFWLYHPDWUL[WRXFKVFUHHQ*8,RSHUDWLRQ0HDVXUHVRSWLFDOSRZHU
DQGIUHTXHQF\3&0&,$VORWVIRUPHPRU\FDUGVDQGSHULSKHUDOV
Ż1(:Ż
*1((3(
Digital Lightwave NICPlus 10G SDH tester with Gigabit Ethernet
3&0%(57WHVWHUIRU0E3&0V\VWHPV3HUIRUPDQFHDFFRUGLQJWR*
ZLWK%1&W\SHFRQQHFWRUV)RUXQEDODQFHGLQSXWV
'/:1,&3/86*
$8
0XOWLFKDQQHOWHOHFRPVSURWRFRODQDO\VHUIRUGHWDLOHGDQDO\VLVRIVLJQDOOLQJV\VWHPV
VXFKDV66$EOHWRDQDO\VHFKDQQHOVDWWKHVDPHWLPH$GGLWLRQDOSURWRFRO
GHFRGHVDYDLODEOH8QLWLVFXUUHQWO\VHWXSWRKDQGOHVLJQDOOLQJDQDO\VLVIRUFHOOXODU
WHOHSKRQHH[FKDQJHV
3RUWDEOH*LJDELW2&6701HWZRUN,QIRUPDWLRQ&RPSXWHU7KLVLQVWUXPHQW
LV XVHG IRU YHULI\LQJ DQG TXDOLI\LQJ WKH SHUIRUPDQFH RI 2&F2&F
621(7670670*ESV6'+DQG':'0DQG*LJDELW(WKHUQHW
WHOHFRPPXQLFDWLRQVQHWZRUNV(OHFWULFDODQGRSWLFDOLQWHUIDFHVQPIRU
670DQGQPIRU670,QFOXGHVFRQFDWHQDWHGSD\ORDGVXSSRUWDQG
2&670DGGGURSLQFKDFWLYHPDWUL[WRXFKVFUHHQ*8,RSHUDWLRQ
0HDVXUHV RSWLFDO SRZHU DQG IUHTXHQF\ 3&0&,$ VORWV DYDLODEOH IRU PHPRU\
FDUGVDQGSHULSKHUDOV
Nettest MPA7400 Multichannel Signalling Protocol Analyser
Fluke 990DSL CopperPro Telecom Line & DSL Test Set Analyser
Nettest MPA 7300 Signal Protocol Analyser
*1(03$
*1(03$
$8
$8
0XOWLFKDQQHOWHOHFRPSURWRFRODQDO\VHUIRUGHWDLOHGDQDO\VLVRIVLJQDOOLQJV\VWHPV
VXFKDV66$EOHWRDQDO\VHFKDQQHOVDWWKHVDPHWLPH6RPHHPXODWLRQ
FDSDELOLW\$GGLWLRQDOSURWRFROGHFRGHVDYDLODEOHRQUHTXHVW8QLWLVFXUUHQWO\VHW
XSWRKDQGOHVLJQDOOLQJDQDO\VLVIRUFHOOXODUWHOHSKRQHH[FKDQJHV
Dynatel 3M 965DSP Subscriber Loop Analyser
'<1'63
)/8'6/
$8
&RSSHU3UREURDGUDQJH3ODLQ2OG7HOHSKRQH6HUYLFHV3276WURXEOHVKRRWLQJIDXOW
ORFDWLRQDQGOLQHTXDOL¿FDWLRQFDSDELOLWLHV,QFOXGHV:LGHEDQG7'5RSWLRQZKLFK
DGGVKLJKIUHTXHQF\WUDQVPLVVLRQWHVWLQJDQGTXDOL¿FDWLRQIXQFWLRQVIRUVHUYLFHV
OLNH$'6/+'6/+'6/+'6/,6'17(DQG''67'5IHDWXUHDGGV
SUHFLVHIDXOWORFDWLRQDQGDQDO\VLV,QFOXGHV71UHPRWHWHUPLQDWRU
1=
3URYLGHV IXOOIHDWXUHG 3276 ZLGHEDQG '6/VSHFL¿F WHVWLQJ *HQHUDO WHVW
IXQFWLRQV LQFOXGH IDXOW ORFDWLRQ UHSDLU YHUL¿FDWLRQ RQ WZLVWHGSDLU DQG GURS
FDEOHV XWLOLVLQJ FDSDFLWDQFH EULGJH UHVLVWDQFH EULGJH DQG7'5 7LPH 'RPDLQ
5HÀHFWRPHWHU6SHFL¿FWHVWVLQFOXGHYROWDJHWRQHFXUUHQWUHVLVWDQFH7'5
ORDGFRLOFRXQWZLGHEDQGORVVQRLVH.WHVWULQJHUVOHYHOWHVWVRDNWHVWIDVW
NLFN2SHUDWRUIHDWXUHVLQFOXGH,5SRUWIRUXSORDGLQJWHVWUHVXOWVWRD3&VHOI
FDOLEUDWLRQ JUDSKLFDO XVHU LQWHUIDFH WHOHSKRQH EDFNOLW KLJK UHVROXWLRQ /&'
GLVSOD\+DQGKHOGEDWWHU\SRZHUHG
Emutel Ultra ISDN BRI/PRI Exchange Simulator
(088/75$,6'1
$8
SULPDU\UDWH35,SRUWVEDVLFUDWH%5,SRUWV
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
31
Data, Network & Telecommunications
Test & Measurement
Telecommunications (cont’d)
W&G/Acterna ANT 20 SDH/PDH Analyser
:*$17
W&G/Acterna PFA-30 Digital Comms Analyser
$8
,QWHUIDFHVIRU3'+GDWDVWUHDPVDW0EVHOHFWULFDODQGRSWLFDO
LQWHUIDFHVIRU6'+DW6700EV-LWWHUDQGZDQGHUJHQHUDWRUVDQGDQDO\VHU
RSWLRQVDUH¿WWHG,QWHUQDO3&ZLWK)''IRUWUDQVIHUULQJUHVXOWV6HULDOSDUDOOHO
NH\ERDUGDQGSHQLQWHUIDFHV
W&G/Acterna PA41 CAS/MFC-R2 Signalling Analyser
:*3$
$8
7ZRUHFHLYHUVDOORZLQJERWKGLUHFWLRQVRID0ESV*FLUFXLWWREHPRQLWRUHG
VLPXOWDQHRXVO\3HUIRUPV%(5%/(5DQG*DQDO\VLVRIWHVWSDWWHUQVLQQ
NESVWLPHVORWV,QWHUQDOJHQHUDWRUSURYLGHVIRUWKHJHQHUDWLRQRI3&03&0
&5&3&0DQG3&0&5&IUDPHVWUXFWXUHV'URSDQGLQVHUWFDSDELOLWLHVDUH
SURYLGHGE\9LQWHUIDFH3$RIIHUV&$6VLPXODWLRQDQGDQDO\VLV0)&5
RSWLRQDQGKDQGVHWLQFOXGHG
:*3)$
$8
)RUIUDPHGXQIUDPHGWHVWRI3&0GDWDFKDQQHOVIURPEVaNEV%(57
WHVWHUZLWKPXOWLLQWHUIDFHFDSDELOLW\956&9;9956
*FRGLU*NEV'7('&(FDSDELOLW\NEVIUDPHG
(JHQHUDWRUZLWKWKURXJKPRGHGURSLQVHUWNEVIUDPHG(PRQLWRU
1[NEVHUURUWHVWLQJ0X[GHPX[PHDVXUHPHQWVFKDQQHOVLJQDOOLQJVWDWXV
GLVSOD\%(5%/(5*DQGKLVWRJUDPUHVXOWDQDO\VLVZLWK[GVWRUHV
$XWRSULQWDQGDXWRFRQ¿JXUHIDFLOLW\56&UHPRWHFRQWURO
Aegis GPset Telecom Pair ID & Intercom
$(**36(7
$8
)RU WHOHFRPPXQLFDWLRQV FDEOH ZRUN 7\SLFDOO\ XVHG E\ 7HOVWUD FRQWUDFWRUV
,QWHUFRPIXQFWLRQDYDLODEOHRQOLYHRUXQSRZHUHGOLQHV
Harris (Aegis) TS22A Butt Set
+$576$
$8
&OLSRQWHOHSKRQHEXWWVHW&DQEHXVHGDVDVWDQGDUGWHOHSKRQHVSHDNHUSKRQH
RULQPRQLWRUPRGHIRUPRQLWRULQJWHOHSKRQHOLQHVZLWKRXWWDNLQJRIIKRRN
LAN Analysers/Management
Airmagnet Portable 802.11 a/b/g Survey System
$,5$,50$*1(76859(<
Fluke Networks Etherscope Gigabit LAN Analyser
$8
3RUWDEOHZLUHOHVVQHWZRUNVXUYH\WRROIRUDEDQGJZLUHOHVV
QHWZRUNV*+]3URYLGHVPDSSLQJRIZLUHOHVVQHWZRUNFRYHUDJHZLWK
RSWLRQDO *36 ORFDWLRQ IDFLOLW\ 3UHORDGHG RQ ODSWRS FRPSXWHU ZLWK DSSURYHG
ZLUHOHVVQHWZRUNFDUG
Airmagnet Portable 802.11 a/b/g Wireless Network Analyser
$,5$,50$*1(775,2
$8
)/8(7+(56&23((;
$8
(WKHUVFRSHH[WHQGHGNLWIXOOGXSOH[*E/$1DQDO\VHU+DQGKHOGDQDO\VHU
IRUGLVFRYHU\RIQHWZRUNHOHPHQWVDQGIDXOWORFDWLRQ'LVFRYHUVGHYLFHVE\,3
VXEQHWV1HW%,26GRPDLQVDQG,3;QHWZRUNV9/$1GLVFRYHU\VKRZVLQWHUIDFH
VWDWXV FRQQHFWHG KRVW GHWDLOV DQG WUHQGLQJ GDWD $OORZV PHDVXUHPHQW RI
GHYLFH GHWDLOV DQG VWDWLVWLFV &RPSOHWH ZLWK FDEOH ,' DFFHVVRU\ IRU WUDFNLQJ
FDEOHURXWHV
3RUWDEOHZLUHOHVVQHWZRUNDQDO\VHUIRUDEDQGJZLUHOHVV
QHWZRUNV*+]9DOLGDWHV:(3[/($37.,30,&931V3URYLGHV
VHFXULW\SROLF\YDOLGDWLRQDQGLQWUXVLRQGHWHFWLRQ'HWHFWVGHQLDORIVHUYLFHDWWDFNV
3URYLGHVDFWLYHSHUIRUPDQFHDQDO\VLVDQGLGHQWL¿HVDQGSLQSRLQWV:/$1)DXOWV
,QFOXGHV)LQG7RROIRUWUDFNLQJGRZQURJXHGHYLFHVDQGFRQ¿JXUDEOHDODUPV
ZLWKH[SHUWDGYLFH3UHORDGHGRQ3QRWHERRNFRPSXWHU
Fluke Optiview Pro Gigabit 10/100/Gigabit LAN Analyser
)/8237,9,(:*,*
)/8237,9,(:
$8
1=
3URYLGHVQHWZRUNDQDO\VLVRQ*LJDELW(WKHUQHWQHWZRUNVPXOWLPRGH¿EUH
FRSSHU$FWLYHGLVFRYHU\LQVZLWFKHGQHWZRUNVIXOOOD\HUDQDO\VLVIXOO\DXWRPDWLF
,3FRQ¿JXUDWLRQHYHQZLWKRXW'+&3DGGUHVVWRQDPHPDSSLQJSDFNHWFDSWXUH
DQG GHFRGH 6103 GHYLFH DQDO\VLV 5021 ,, WUDI¿F DQDO\VLV *LJDELW WHVWLQJ
FDSDELOLWLHVDQGEDVLFFDEOHWHVWLQJZLUHPDSUHWXUQORVVHWF
Airmagnet Portable Wireless Network Analyser
$,5$,50$*1(7352
$8
9DOLGDWHV:(3[/($37.,30,&931V3URYLGHVVHFXULW\SROLF\YDOLGDWLRQ
DQG LQWUXVLRQ GHWHFWLRQ 'HWHFWV GHQLDO RI VHUYLFH DWWDFNV 3URYLGHV DFWLYH
SHUIRUPDQFHDQDO\VLVDQGLGHQWL¿HVDQGSLQSRLQWV:/$1)DXOWV,QFOXGHV)LQG
7RROIRUWUDFNLQJGRZQURJXHGHYLFHVDQGFRQ¿JXUDEOHDODUPVZLWKH[SHUW
DGYLFH%XLOWLQVLWHVXUYH\XWLOLW\ZLWK*36VXSSRUW
HP J3446C 10/100 Ethernet Analyser
+3-&
$8
+DV5-DQG$8,SRUWV$8,SRUWVDOORZ¿EUHRUFRD[FRQQHFWLRQVWREHPDGH
ZLWKDSSURSULDWHDGDSWRUDGDSWRUQRWVXSSOLHG)RUXVHZLWK+3LQWHUQHWDGYLVRU
XQGHUFUDGOHVIRU)'',RUVLPLODUDQDO\VLV
HP J2524A FDDI Under Cradle
+3-$
$8
)RUWKH+3-$RU+3-$%,QFOXGHV7330'RQ673'%RU
8735-0EGDWD
HP J2523B Ethernet/Token LAN Analyser
+3-$
$8
+RXVHGLQDUXJJHGLVHGODSWRSVW\OHFRORXUFRPSXWHU,QFOXGHV+3¶VODWHVW'ULOO
'RZQ([SHUW6RIWZDUH
Call now
32
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data, Network & Telecommunications
Test & Measurement
Network problem solver? Meet your new assistant.
Introducing the EtherScope™ Network
Assistant – your eyes into the network to
help you spot problems and solve them
faster than ever. You don’t have time for trial
and error. Or methods that only provide part
of the picture. That’s why Fluke Networks’ new
EtherScope analyzer, with its immediate
discovery and fast diagnostics, helps you
quickly isolate urgent problems on your gigabit
network as well as those nagging issues that
may be keeping it from performing at optimum
level. Fast. Accurate. EtherScope.
Your network assistant is waiting
to show you what it can do to help
make your job easier. Just go to
www.flukenetworks.com/EtherScope
and take a tour of the virtual demo.
EtherScope™
Network Assistant
N E T W O R K S U P E R V I S I O N
TM
LAN Analysers/Management (cont’d)
Network General Sniffer - Ethernet /Token Ring
1*61,))&20%
W&G/Acterna Domino Gigabit
$8
+RXVHGLQDFRORXU7RVKLED7$QDO\VHUSURYLGHVDSSOLFDWLRQVIRUQHWZRUN
DQDO\VLVDQGPRQLWRULQJ3URWRFROLQWHUSUHWDWLRQIRURYHUSURWRFROVPRQLWRULQJ
IHDWXUHVDQGH[SHUWDQDO\VLVWRKHOSLGHQWLI\/$1SUREOHPV2UDFOHGDWDEDVH
GHFRGHVDOVRDYDLODEOH
Network General 10/100Mb/s Ethernet Protocol Analyser
1*61,))
$8
)RUEDVH7QHWZRUNV8QLWVXSSOLHGZLWK5-FRQQHFWLRQVRQO\,IDXQLWLV
UHTXLUHG IRU FRD[LDO RU PDX FRQQHFWLRQ XVH HLWKHU WKH +3-$ RU :*'RPLQR
DQDO\VHUV
$8
)RU PRQLWRULQJ WURXEOHVKRRWLQJ DQG VLPXODWLRQ RI *LJDELW (WKHUQHW QHWZRUNV
3URYLGHV IXOO OLQH UDWH IXOO GXSOH[ DQDO\VLV RI *LJDELW (WKHUQHW QHWZRUNV $OO
WUDQVPLW FDSWXUH ¿OWHULQJ DQG VWDWLVWLFV DUH SURYLGHG DW IXOO OLQH UDWH ([SHUW
DQDO\VLVVRIWZDUHSURYLGHVHDV\GLDJQRVLVRIQHWZRUNIDXOWVDQGGHFRGHVRYHU
SURWRFROV/LQNFRQ¿JXUDWLRQVWDWXVLVGHWHFWHGDXWRPDWLFDOO\DQGHTXLSPHQW
DXWRFRQ¿JXUHVLWVHOIWRVXLWWKHGHWHFWHGVWDWXV3URYLGHGZLWKKRWVZDSSDEOH
PRGXOHVIRUVLQJOHPRGHDQGPXOWLPRGH¿EUHLQWHUIDFHV/;6;LQWHUIDFHV
&RPSOHWHZLWKODSWRSFRPSXWHUFRQ¿JXUHGIRUWKHDQDO\VHU
W&G/Acterna Domino DA320 Ethernet/Token Ring Analyser
:*'20,12
Network General Sniffer WAN Interface
1*61,)):$132'
:**,*$%,7
$8
(QDEOHVWKH1HWZRUN*HQHUDO6QLII3URWRSHUIRUP:$1DVZHOODV/$1DQDO\VLV
:LWKLQWHUIDFHDQGFDEOHVIRU569956DQG;0XVWEH
XVHGZLWK1*61,))3523HUIRUPV(,6'1SULPDU\UDWHDQDO\VLV
$8
6XSSRUWVPRVWSURWRFROVKDV%1&$8,5*0$8LQWHUIDFHVVHOHFWDEOHYLD
:LQGRZVV\VWHPV2SHUDWHVIURP:LQGRZVDQGLVVXSSOLHGZLWKDQRWHERRN
3&6XSSRUWVGDWDUDWHVRIPESVWRNHQULQJPESVHWKHUQHW'RPLQR
ZL]DUGVRIWZDUHLQFOXGHGZLWKDVVHW
W&G/Acterna DA-30 Dual Protocol Analyser
:*'$
$8
(DV\WRXVH:LQGRZVEDVHGLQWHUIDFHZLWKLQEXLOWWUDFNEDOO3URYLGHVPHDVXUHPHQW
RISK\VLFDOFKDUDFWHULVWLFVRILQWHUIDFHVSURWRFRODQDO\VLVRI/$1DQG:$1VWHVWLQJ
RI/$1:$1LQWHUFRQQHFWLRQGHYLFHVVLPXOWDQHRXVDQDO\VLVRIDQ\FRPELQDWLRQRI
/$1VDQG:$1V(WKHUQHWDQG7RNHQ5LQJLQWHUIDFHFRPSOHWHZLWKDOOPDMRUOD\HU
SURWRFROVXLWHV:$1FRQ¿JXUDWLRQ9;ZLWK³KLJKVSHHG´:$1IHDWXUH
PRGXOHDOORZLQJVSHHGVXSWR0ESV,QFOXGHV0ESV7RNHQ5LQJLQWHUIDFH
(WKHUQHW+6:$199;LQWHUIDFHV3$0PRGXOHLQFOXGHG
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
33
Data, Network & Telecommunications
Test & Measurement
LAN/WAN Analysers
Spirent/Netcomm Smartbits SMB200 Router Tester
Nettest Winpharaoh LAN/WAN Analyser
*1(:,13+$5$2+
$8
&DSDEOHRI0ESVHWKHUQHWDQGXSWR0E:$1ZLWKWKHIROORZLQJLQWHUIDFHV
95656(,DQG935,DQG%5$,6'1DELOLW\5HSRUWZULWLQJ
VRIWZDUHLQVWDOOHGIRUTXLFNRYHUYLHZRIQHWZRUNVWDWXV
Nettest Winpharoah 2 LAN/WAN Analyser
*1(:,13+$5$2+
$8
&DSDEOHRI0ESV(WKHUQHWDQGXSWR0E:$1ZLWKWKHIROORZLQJLQWHUIDFHV
95656DQG9;+DV%(57WHVWLQJIRU:$15HSRUWZULWLQJ
VRIWZDUHLQVWDOOHGIRUTXLFNRYHUYLHZRIQHWZRUNVWDWXV
Nettest Winpharaoh ATM Interface
*1(:,13+$5$70
$8
$70VLQJOHPRGHRSWLFDOLQWHUIDFHIRUWKH*1(:,13+$5$2+SURWRFRODQDO\VHU
0XOWLPRGHDWWHQXDWRUDGDSWRUVVXSSOLHG6LQJOHPRGHRSHUDWLRQLVQPZLWK
6&FRQQHFWRUV,QWHUIDFHLQFOXGHV[7[[5[SRUWVIRUPRQLWRULQJ&DQRQO\
EHXVHGLQWKHVORWFDUGFDJHYHUVLRQRIWKH*1(:,13+$5$2+$OORZIRUXS
WRKIRULQVWDOODWLRQLQWRFDJH
63,60%
$8
SRUW HWKHUQHW670$70 V\VWHP IRU GHWHUPLQLQJ URXWHU SHUIRUPDQFH
LQFOXGLQJODWHQF\ODWHQF\YDULDWLRQDQGMLWWHU&DQEHXVHGWRORDGQHWZRUNZLWK
VSHFL¿FGH¿QDEOHWUDI¿FWRGHWHUPLQHURXWLQJSHUIRUPDQFHDQGGLVFRYHUWKURXJKSXW
ERWWOHQHFNV6\VWHPLQFOXGHV[0/LQWHUIDFHFDUGV
Spirent Netcomm Smartbits SMB600 Mainframe
63,60%
$8
0DLQIUDPHIRUURXWHUWHVWV\VWHPIRUGHWHUPLQLQJURXWHUDQGQHWZRUNSHUIRUPDQFH
LQFOXGLQJODWHQF\ODWHQF\YDULDWLRQDQGMLWWHU&DQEHXVHGWRORDGQHWZRUNZLWK
VSHFL¿FGH¿QDEOHWUDI¿FWRGHWHUPLQHURXWLQJSHUIRUPDQFHDQGGLVFRYHUWKURXJKSXW
ERWWOHQHFNV 6XSSOLHG ZLWK VWDQGDUG VRIWZDUH DQG YHUVLRQ RI 6PDUWÀRZ
DSSOLFDWLRQ5HTXLUHVDSSURSULDWHLQWHUIDFHFDUGV
Spirent Smartbits LAN-3101A interface for SMB600/6000 Chassis
63,60%$
$8
Spirent Smartbits LAN-3201B Gigabit card for SMB600/6000
63,60%%
$8
Spirent Smartbits LAN-3310A 2Port Gigabit Card for SMB600/6000
63,60%$
$8
WAN Analysers
HP 4951C 19.2Kbps Protocol Analyser
+3&
HP J2302A 2Mbps WAN Analyser
$8
6HULDO GDWD DQG SURWRFRO DQDO\VHU a EDXG GDWD WUDQVIHU UDWHV IRU
PRQLWRULQJ VLPXODWLQJ DQG WULJJHULQJ 'DWD FRGHV$6&,, (%&',& %$8'27
VL[ELWWUDQVFRGH6%7,3$56DQG(%',&3URWRFROV;%6&+'/&6'/&
,3$56DQGXVHUGH¿QDEOH(UURUFKHFNLQJ&5&&&,77&5&/5&SDULW\
DQGEORFNHUURUUDWHWHVWLQJ%(57RUELWSHUFKDUDFWHUSDULW\RU
VWRSELWV)XOO$6&,,NH\ERDUGXSWRWULJJHUVNEEXIIHUPHPRU\NE
LQWHJUDOPLFURÀRSS\GULYHYLGHRRXWSXWVHSDUDWHSULQWHURXWSXW&RPSOHWHZLWK
+3$56&9LQWHUIDFHZLWKIXOOEUHDNRXWER[
HP 4957A 64Kbps Protocol Analyser
+3$
$8
3URWRFRODQDO\VHU)RUXSWRNEVRSWLRQLQFOXGHGIRUDV\QFKURQRXVELWDQG
15=15=,ELWRULHQWHGSURWRFROVXSWRNESV3URWRFROVLQFOXGH,6'14
; 6'/& +'/& ,3$56 %6&$6<1& DQG PRVW FKDUDFWHU V\QFKURQRXV
SURWRFROVRSWLRQLQFOXGHGIRU;%(57IXQFWLRQ'DWDFRGHV$6&,,(%&',&
%$8'27 ELW WUDQVFRGH 6%7 ,3$56 (%&' DQG +(; N% QRQYRODWLOH
PHPRU\N%YRODWLOHPHPRU\NEPLFURÀRSS\NEQRQYRODWLOH5$0GLVN
&RPSOHWHZLWK56&56DQG9LQWHUIDFHVSULQWHUDQGYLGHRRXWSXWV
Nettest Fastnet Probe
*1()365
$8
)DVWQHWSUREHIRU)UDPH5HOD\3URYLGHVPRQLWRULQJDQGVWDWLVWLFDOLQIRUPDWLRQ
IRU )UDPH 5HOD\ 1HWZRUNV &RPSOHWH ZLWK LQWHUIDFH FDEOH DQG PDQDJHPHQW
VRIWZDUH
+3-$
HP J2302B 2 Mbps WAN Analyser
+3-%
)OXNH'7;&DWHJRU\&DEOH&HUWLÀFDWLRQ7HVWHU
$81=
&DEOHFHUWL¿FDWLRQWHVWHU7HVWVXSWR0+]&DW$XWRWHVWWLPHRIV&RPHV
FRPSOHWHZLWKODWHVWFDW30SHURQDOLW\PRGXOHV/LQNZDUH3&VRIWZDUHDQG
86% FDEOH ,QWHUQDO PHPRU\ VWRUHV WHVWV 2SWLRQDO PHPRU\ FDUG VWRUHV
WHVWV
)OXNH'7;&DWHJRU\&DEOH&HUWLÀFDWLRQ7HVWHU
)/8'7;
$81=
&DEOHFHUWL¿FDWLRQWHVWHUXSWR0+]&DW$XWRWHVWWLPHRIV&RPHVFRPSOHWH
ZLWKODWHVWFDW30SHUVRQDOLW\PRGXOHV/LQNZDUH3&VRIWZDUHDQG86%FDEOH
,QWHUQDOPHPRU\VWRUHVWHVWV7HVWVWR&DW(,QFOXGHG&DW
KHDGVZLOOWHVWXSWRFDWHJRU\2SWLRQDOPHPRU\FDUGVWRUHVWHVWV
Call now
34
$8
,QWHUQHWDGYLVRU:$1DQDO\VHUIURPEVa0EV&(37(DQG9VHULHV
:$1 SURWRFRO DQDO\VHU ,QFOXGHV 569 9 56 DQG &(37(
DQDO\VLVWR0EVZLWK%1&FRQQHFWRUV,6'1SULPDU\UDWHDQDO\VLVDYDLODEOHZLWK
+3$SRG)XOOPRQLWRUDQGGHFRGLQJRIPDMRUSURWRFROVRYHUDQ\FKDQQHO
)UDFWLRQDOFKDQQHORUIXOO&(37(&RPSOHWH(QJOLVKGHFRGHVZLWKFXVWRPL]DEOH
GLVSOD\V7LPHVWDPSIRUFDSWXUHGGDWDRUVWDWLVWLFVQVUHVROXWLRQ([WHQVLYH
GDWD¿OWHULQJFDSDELOLW\5HDOWLPHVWDWLVWLFDOLQFOXGLQJ/$1WUDI¿FDQDO\VLVRYHU
:$16FDSWXUHSHUIRUPDQFHGXULQJIXOOOLQHORDGLQJ6LPXOWDQHRXVGHFRGHV
VWDWLVWLFVWULJJHUVDQG¿OWHUV/RJWRKDUGGULYH)XOO%LW(UURU5DWHWHVWVWRPEV
%(57LQFOXGLQJ*2YHUSUHZULWWHQWHVWVLQFOXGHG
LAN Cable Testers
)/8'7;
$81=
:$1DQDO\VHUIURPEVa0EV,QWHUQHW$GYLVRU&(37(DQG9VHULHV
:$1 SURWRFRO DQDO\VHU ,QFOXGHV 569 9 56 DQG &(37(
DQDO\VLVWR0EVZLWK%1&FRQQHFWRUV,6'1SULPDU\UDWHDQDO\VLVDYDLODEOHZLWK
+3$SRG)XOOPRQLWRUDQGGHFRGLQJRIPDMRUSURWRFROVRYHUDQ\FKDQQHO
)UDFWLRQDOFKDQQHORUIXOO&(37(&RPSOHWH(QJOLVKGHFRGHVZLWKFXVWRPL]DEOH
GLVSOD\VUHDOWLPHVWDPSIRUFDSWXUHGGDWDRUVWDWLVWLFVQVUHVROXWLRQ([WHQVLYH
GDWD¿OWHULQJFDSDELOLW\5HDOWLPHVWDWLVWLFDODQDO\VLVLQFOXGLQJ/$1WUDI¿FDQDO\VLV
RYHU :$1V FDSWXUH SHUIRUPDQFH GXULQJ IXOO OLQH ORDGLQJ 6LPXOWDQHRXV
GHFRGHVVWDWLVWLFVWULJJHUVDQG¿OWHUV/RJWRKDUGGLVN)XOO%LW(UURU5DWHWHVWV
WR0ELQFOXGLQJ*2YHUSUHZULWWHQWHVWLQFOXGHG
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data, Network & Telecommunications
Test & Measurement
LAN Cable Testers (cont’d)
Fluke DSP4100 Category5/5E/6 Permanent Link CableTool
Fluke DTX-MFM Multimode Fibre Adaptor for DTX Cable Analyser
)/8'7;0)0
$8
)/8'63
0<
'7;PXOWLPRGH¿EUHLQWHUIDFH7HVWV¿EUHLQVWDOODWLRQVLQORFDODUHD
QHWZRUNV)LWVLQWKHVORWRQWKHEDFNRI'7;FDEOHDQDO\VHUVWDQGDUGFRSSHU
FDEOHDGDSWRUVFDQEHFRQQHFWHGEXWQRWXVHGVLPXOWDQHRXVO\3URYLGHV¿EUH
WHVWLQJDQGFHUWL¿FDWLRQ%LGLUHFWLRQDOWHVWLQJDWQPQPDWWKHVDPH
WLPH0HDVXUHVRSWLFDOSRZHUORVVOHQJWKDQGSURSDJDWLRQGHOD\IRUPXOWLPRGH
¿EUHV3DVVIDLOUHVXOWVEDVHGRQFRPPRQ¿EUHVWDQGDUGV6&RSWLFDOFRQQHFWRUV
,QFOXGHVLQEXLOWYLVXDOIDXOWORFDWHU9)/
&DW(FDEOHWHVWHUDQGFHUWL¿FDWLRQWRRO,QFOXGHV3&OLQNDQGDQDO\VLVVRIWZDUH
&DW(3HUPDQHQW/LQNKHDGVLQFOXGHGZLWK30VKLHOGHG5-PRGXOHV
,QFOXGHV5-&KDQQHOWHVWLQJKHDGVZKLFKDUHFDW(FRPSOLDQW)RURWKHU
FRQQHFWRUW\SHVVHH)/8'63308QLWVDOVRLQFOXGHDPHPRU\FDUGRSWLRQ
7HVWLQJWR76%VWDQGDUGVXSSRUWHGIRU&DW(
Fluke DTX-SFM Singlemode Fibre Adapter for DTX Cable Analyser
3HUVRQDOLW\ PRGXOH IRU )OXNH '63; FDW 3HUPDQHQW /LQN KHDGV 5-
FRQQHFWRUVHWV303030LQFOXGHPRGXOHV%ORFNFRQQHFWRUVHWV
LQFOXGHRQHPRGXOH30%30%0RGXOHVDYDLODEOHLQFOXGH30PRVW
V\VWHPV 30 PRVW XQVKLHOGHG V\VWHPV 30 OHJDF\ 30% 3DGXLW
*,*$381&+EORFN30%6LHPRQ6EORFN
)/8'7;6)0
$8
'7;VLQJOHPRGH¿EUHLQWHUIDFH8VHIRUWHVWLQJ¿EUHLQVWDOODWLRQVLQ
ORFDODUHDQHWZRUNV)LWVLQWKHVORWRQWKHEDFNRI'7;FDEOHDQDO\VHUVWDQGDUG
FRSSHUFDEOHDGDSWRUVFDQEHFRQQHFWHGEXWQRWXVHGVLPXOWDQHRXVO\3URYLGHV
¿EUHWHVWLQJDQGFHUWL¿FDWLRQ%LGLUHFWLRQDOWHVWLQJDWQPDQGQPDW
WKHVDPHWLPH0HDVXUHVRSWLFDOSRZHUORVVOHQJWKDQGSURSDJDWLRQGHOD\IRU
PXOWLPRGH¿EUHV3DVVIDLOUHVXOWVEDVHGRQFRPPRQ¿EUHVWDQGDUGV6&RSWLFDO
FRQQHFWRUV,QFOXGHVLQEXLOWYLVXDOIDXOWORFDWHU9)/
)OXNH'63&DWHJRU\(&DEOH&HUWLÀFDWLRQ7RRO
)/8'63
$81=
&DW( FDEOH WHVWHU DQG FHUWL¿FDWLRQ WRRO ,QFOXGHV 3& OLQN DQG DQDO\VLV
VRIWZDUH&DW(SHUPDQHQWOLQNKHDGVLQFOXGHG,QFOXGHVLQWHUQDOPHPRU\
DQGPHPRU\FDUGRSWLRQV7HVWLQJWR76%VWDQGDUGVXSSRUWHGIRU&DWHJRU\
(
Fluke DSP Personality Module for DSP4X00 series
)/8'6330
$8
Fluke DSP4X00 Series Fibre Heads
)/8'63),%
$8
'63¿EUHLQWHUIDFH)RUWHVWLQJ¿EUHLQVWDOODWLRQVLQORFDODUHDQHWZRUNV)LWV
WR'63VLPLODUWR&DWKHDGV3URYLGHV¿EUHWHVWLQJDQGFHUWL¿FDWLRQ
%LGLUHFWLRQDOWHVWLQJDWQPQPDWWKHVDPHWLPH0HDVXUHVRSWLFDOSRZHU
ORVVOHQJWKDQGSURSDJDWLRQGHOD\IRUPXOWLPRGH¿EUHV3DVVIDLOUHVXOWVEDVHG
RQFRPPRQ¿EUHVWDQGDUGV5HFHVVHG6&RSWLFDOFRQQHFWRUV
Fluke DSP4X00 Series Cat 6 Permanent Link Adaptors
)/8'633/+($'6
$8
$GDSWRUKHDGVVHWRIIRU)OXNH'63&RPHVZLWK303HUVRQDOLW\
0RGXOH+HDGVDUHVXLWDEOHIRUFHUWDLQPDQXIDFWXUHU¶VVWDQGDUGV7KHVHDUHVXEMHFW
WRRQJRLQJUHVHDUFKRQFRQQHFWLQJKDUGZDUHIRUWKHPRVWXSWRGDWHLQIRUPDWLRQJR
WRZHEVLWHKWWSZZZÀXNHQHWZRUNVFRPXVFDEOLQJFRSSHUFDEOLQJ'63SHUPD
QHQWOLQNIHDWXUHVSHUVRQDOLW\PRGXOHVKWP
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
35
Data, Network & Telecommunications
Test & Measurement
LAN Cable Testers (cont’d)
Ż1(:Ż
)OXNH1HWZRUNV&DEOH,4&DEOH1HWZRUN,GHQWLÀFDWLRQ7RRO
)/8&$%/(,4
&DEOH,4FDEOHDQGQHWZRUNWHVWHUIRUWZLVWHGSDLUFRD[DQGDXGLRFDEOLQJ$OORZV
WURXEOHVKRRWLQJFRQQHFWLYLW\SUREOHPVDQGTXDOLI\FDEOLQJEDQGZLGWKWRVHHZKHWKHU
DQH[LVWLQJFDEOLQJOLQNLVTXDOL¿HGWRVXSSRUW9R,3RU*LJDELW(WKHUQHW
'LVFRYHUVZKDWLVDWWKHIDUHQGRIDQ\QHWZRUNFDEOH'HWHFWVVSHHGDQGGXSOH[
VHWWLQJV RI DWWDFKHG VZLWFKHV DQG 3&V ,QWHOOLJHQW ZLUHPDS JUDSKLFDOO\ VKRZV
GLVWDQFHWRIDXOWVHJSLQEUHDNDWP&DQDOVRWHVWFDEOHVHWXSIRUDXGLR
DSSOLFDWLRQLQWHUFRP3$+DQGKHOGDQGOLJKWZHLJKWSRZHUHGE\[$$$ONDOLQH
EDWWHULHV&DQEHXVHGDVDVLJQDOVRXUFHIRURSWLRQDO,QWHOOLWRQHFDEOHWUDFHU
Fibre Optics
Nettest 6250/6025 Light Source/Power Meter 1310/1550
*1(
Fluke FT300 Fibre Inspector Video Inspection Microscope 250x
$8
6LQJOHPRGHOLJKWVRXUFHDQGSRZHUPHWHUFRPELQDWLRQ/LJKWVRXUFH
LVQPQPG%PPLQSRZHURXWSXWODVHURXWSXW3RZHUPHWHUDQGOLJKW
VRXUFHDXWRVZLWFKZDYHOHQJWKVWRV\QFKURQL]HZLWKHDFKRWKHU6WRUHVSDVW
UHVXOWVLQPHPRU\IRUUHIHUHQFH&RPHVLQKDUGFDVH%DWWHU\RSHUDWHG
)/8)7
$8
+DQGKHOG/&'GLVSOD\XQLWDQGVPDOOOLJKWZHLJKWSUREHWKDWFRQWDLQVDORQJOLIH
/(' OLJKW VRXUFH DQG &&' YLGHR FDPHUD 3UREH DGDSWRU WLS PDWHV ZLWK WKH
FRQQHFWRUDQGSURMHFWVFULVSFOHDULPDJHVRIPLFURVFRSLFGHEULVDQGHQGIDFH
GDPDJHRQWKHGLVSOD\
Fluke FTK200 Optical Fibre Power Meter/Light Source
)/8)7.
$8
&RPSULVHVOLJKWVRXUFHDQGSRZHUPHWHU/LJKWVRXUFHLVPXOWLPRGHQP
QPG%PLQWRµP¿EUH6WDELOLW\LV“G%SHUKDW0&3RZHU
PHWHUKDVFDOLEUDWHGPHDVXUHPHQWVDWQPPXOWLPRGHQP
VLQJOHPRGHG%PaG%PPHDVXUHPHQWSRZHUZLWKUHVROXWLRQDFFXUDF\
RI“DW0&G%P3RZHUPHWHUPHPRU\VWRUHVXSWRUHVXOWVDW
HDFKZDYHOHQJWKZKLFKFDQEHGRZQORDGHGWR3&ZLWKVXSSOLHGVRIWZDUHDOVR
FRPSDWLEOHZLWK)OXNH&DEOH0DQDJHUXVHGIRUWKH'63VHULHV67
FRQQHFWRURQSRZHUPHWHUDQGOLJKWVRXUFH
Acterna OMK-6 Fibre Optic Power Meter
:*20.
$81=
20.RSWLFDOSRZHUPHWHUZLWKPXOWLPRGHDQGVLQJOHPRGHOLJKWVRXUFHV/HYHO
PHDVXUHPHQWLVaG%P0HDVXUHPHQWHUURUVDUHHOLPLQDWHGEHFDXVHWKH
SRZHUPHWHUDXWRPDWLFDOO\GHWHFWVWKHZDYHOHQJWKEHLQJWUDQVPLWWHGE\WKHOLJKW
VRXUFH6LQJOHPRGHG\QDPLFUDQJHZLWKFRQWLQXRXVZDYHLVG%DSSUR[NP
#QPNP#QP0XOWLPRGHG\QDPLFUDQJHZLWKFRQWLQXRXVZDYH
LVG%DSSUR[NPDWQPNPDWQP
Acterna OMK-14 Optical Measurement Kit
:*20.
0<
.LW FRQVLVWV RI :*2/6 OLJKW VRXUFH DQG :*2/3 SRZHU PHWHU
:*2/6 QP QP RS G%P LQWR —P PRG IUHTXHQF\
+]N+]N+]:*2/3aQPVZLWFKDEOHDW
QP6HQVRUW\SH,Q*D$VVXLWDEOH¿EHUW\SHDa—P0RG
GHWHFWLRQ+]+].+].+]'LVSOD\UDQJHaG%P
)OXNH2SWLÀEUH0XOWLPRGH27'5
)/8237,),%(500
Call now
36
$8
6KRUWUDQJHPXOWLPRGH27'5GHVLJQHGIRUWHVWLQJWURXEOHVKRRWLQJDQGFHUWLI\LQJ
QHWZRUNFDEOLQJQPPPPODXQFKFDEOHLQFOXGHGPP
UHTXLUHVODXQFKFDEOH¿EUHVZLWK6&FRQQHFWRUV$WWHQXDWLRQGHDG]RQHQP
PW\SLFDOPPD[QPPW\SLFDOPPD[NPUDQJHIRUQP
NP UDQJH IRU QP 0HDVXUHV LQVHUWLRQ ORVV DQG ¿EUH OHQJWK DOORZV
DXWRPDWLF DQG PDQXDO 27'5 DQDO\VLV LQFOXGLQJ FKDQQHO PDS RI FRQQHFWRUV
,QFOXGHG/LQN:DUH3&VRIWZDUHGRFXPHQWVUHSRUWVDQGPDQDJHVDOOWHVWGDWD
%DWWHU\RSHUDWHGZLWKFRORXUGLVSOD\
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data, Network & Telecommunications
Test & Measurement
Fibre Optics (cont’d)
.LQJÀVKHU2SWLFDO$WWHQXDWRU
.,1.,
$80<
QPVLQJOHPRGHLQFOXGLQJLQWHUFKDQJHDEOH3&FRQQHFWRULQWHUIDFHV
DQGDGDSWRUV$WWHQXDWLRQUDQJHG%UHVROXWLRQSRZHUFDSDELOLW\G%P
DQG OLQHDULW\ G% 2SHUDWLRQDO PRGHV LQFOXGH PDQXDO UHODWLYH VWHS DQG
SURJUDPPHFRQWURO
Nettest CMA4000 Single Mode OTDR
*1(&0$60
$8
,QFOXGHVPDLQIUDPHDQGQPG%VLQJOHPRGHPRGXOHPRGXOH
SDUWQXPEHU7'00RGHO,QVWUXPHQWKDVEXLOWLQ)''DQGVXSSOLHG
ZLWK6&3&)&3&DQG673&FRQQHFWRUV
.LQJÀVKHU.,9LVLEOH/LJKW6RXUFH
.,1.,
$8
)LWWHGZLWKQPYLVLEOHODVHUPRGXOH)RU¿EUHLGHQWL¿FDWLRQDQGIDXOWORFDWLRQRQ
VLQJOHPRGHPXOWLPRGH¿EUHRSWLFV\VWHPV8VHZLWKDQ27'5WRSLQSRLQWWKH
ORFDWLRQRIDIDXOW)LWWHGZLWK67FRQQHFWRUDQGVXSSOLHGZLWKDYDULHW\RISDWFK
OHDGV1RWVXLWDEOHIRUSRZHUPHWHUOLJKWVRXUFHDSSOLFDWLRQV
Nettest CMA4000 1310/1550nm (40dB) Single Mode Module
*1(7'0
$8
)RUWKH*11HWWHVW&0$27'5PDLQIUDPH0RGXOHKDV6&3&)&3&
FRQQHFWRUV2SHUDWLQJZDYHOHQJWKVDUHQPG%QPG%
Anritsu MG921A 1300nm Stabilised Light Source
$150*$
0<
)RUXVHZLWKPXOWLPRGHVLQJOHPRGH¿EHUVRI—PZDYHOHQJWKV8QSUHFHGHQWHG
OLJKWRSOHYHOZDYHOHQJWKVWDELOLW\WKURXJKXVHRI$3&WHPSHUDWXUHFRQWURO
FFWV,QWHUQDOH[WHUQDOPRGXODWLRQIXQFWLRQVDUHSURYLGHGSHUPLWWLQJUHPRYDO
RIVWUD\OLJKW
.LQJÀVKHU.,2SWLFDO3RZHU0HWHUDQG6RXUFH
.,1.,
$8
/LJKWVRXUFH.,DQGSRZHUPHWHU.,RSWLFDO¿EUHWHVWVHWIRUPXOWLPRGH
DSSOLFDWLRQVQPQP8QLWVKDYH67FRQQHFWRUVDQGDYDULHW\RISDWFK
OHDGV/LJKWVRXUFHPRGXOHV¿WWHGWR.,.,SRZHUPHWHU
XVHVDJHUPDQLXPGHWHFWRUIRUEURDGEDQGRSHUDWLRQ3RZHUPHWHUFDQEHXVHG
IRU VLQJOHPRGH DSSOLFDWLRQV EXW UHTXLUHV D VHSHUDWH VLQJOHPRGH OLJKW VRXUFH
VXFKDVWKH.,1.,
.LQJÀVKHU.,1$7$&DOLEUDWHG
.,1.,1$7$
$8
6SHFL¿FDWLRQDVDERYHEXW1$7$FDOLEUDWHG
*1(1(7:25.6
$8
)RUXVHZLWK1HWWHVW&0$27'5$OORZVUHVXOWVIURP&0$27'5WR
EHWUDQVIHUUHGFDWDORJXHGDQGDQDO\VHGRQD3&
Nettest TD-4791-CL DWDM Optical Spectrum Analyser Module
*1(26$7'&/
$8
)RUGHQVHZDYHOHQJWKGLYLVLRQPXOWLSOH[LQJDSSOLFDWLRQV&DQEHXVHGRYHURSWLFDO
¿EUH&QPaQP/EDQGVQPaQP8VHZLWK&0$
PDLQIUDPH5HVROXWLRQWR*+],GHDOIRUDOO:'0DSSOLFDWLRQVLQFOXGLQJKLJK
GHQVLW\RIFKDQQHOVDQGDERYH
Nettest Nexus Polarisation Mode Dispersion Analyser
.LQJÀVKHU.,/DVHU6RXUFH
.,1.,
Nettest OTDR Software
$8
*1(30'
$8
QPVLQJOHSRUWODVHUOLJKWVRXUFH+DV¿[HG)&ÀDWFRQQHFWRU0XVW
EHXVHGZLWKDVHSDUDWHSDWFKFRUGLIDQJOHGFRQQHFWRUVDUHWREHXVHG,QFOXGHV
WHVWWRQHIXQFWLRQDQG¿EUHLGHQWL¿FDWLRQIXQFWLRQV
)RURSWLFDO&EDQGPHDVXUHPHQWVG%G\QDPLFUDQJH)RUPHDVXUHPHQWVRQ
RSWLFDO¿EUHIRUTXDOL¿FDWLRQIRU':'0RUDQDORJXHYLGHRDSSOLFDWLRQV
Nettest FI720 Active Fibre Detector
1272)6
*1(),
$8
1RQLQWUXVLYH¿EUHWRROIRULGHQWLI\LQJDFWLYH¿EUHV0HDVXUHVEDUH¿EUHVFRDWHG
¿EUHVDQGMDFNHWHGSDWFKFRUGV*LYHVUHDGRXWRIRSWLFDOSRZHUOHYHOLQ¿EUH
DQGFDQGHWHFWRSWLFDOWHVWWRQHVRI+]N+]0HDVXUHVZDYHOHQJWKV
aQPDQGSRZHUOHYHOVIURPaG%P“,QVHUWLRQORVVG%1RWH
DFFXUDF\ RI SRZHU PHDVXUHPHQW GHSHQGV RQ ¿EUH FRDWLQJ MDFNHWLQJ )RU
DFFXUDWHSRZHUPHDVXUHPHQWVDQRSWLFDOSRZHUPHWHUVKRXOGEHXVHG
Nettest CMA4000 Multi-Mode OTDR
*1(&0$00
Noyes OFS300 Fibre Optic Cable Microscope
Westover Fibre Inspection Microscope
:(6:6)0/
,QFOXGHVPDLQIUDPHDQGQPG%PXOWLPRGHPRGXOHPRGXOHSDUW
QXPEHU7'00RGHO,QVWUXPHQWKDVEXLOWLQ)''DQGVXSSOLHG
ZLWK6&3&)&3&DQG673&FRQQHFWRUV
$8
&RPHV ZLWK XQLYHUVDO DGDSWRU WR VXLW PRVW ¿EUH RSWLF FRQQHFWRU W\SHV [
PDJQL¿FDWLRQ DOORZV YLHZLQJ RI ¿EUH FRUH DQG FRQQHFWRU HQG IDFH %DWWHU\
SRZHUHG
Fitel S323B Fibre Cleaver
),76%
$8
$8
$81=
&OHDYHUIRUXVHZLWKSUHFLVLRQVSOLFHUVIRUVLQJOHDQGPXOWLPRGH¿EUHV)HDWXUHV
EXLOWLQVKDUSVFROOHFWLRQELQZKLFKDXWRPDWLFDOO\VWRUHV¿EUHRIIFXWVDVHDFK¿EUH
LVFOHDYHG
Nettest CMA4000 Single/Multi Mode OTDR
*1(&0$0060
$8
,QFOXGHV PDLQIUDPH DQG QP G% PXOWLPRGH DQG QP
G% VLQJOHPRGH PRGXOH PRGXOH 0RGHO ,QVWUXPHQW KDV EXLOW LQ
)''DQGVXSSOLHGZLWK6&3&)&3&DQG673&FRQQHFWRUV
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
37
Data, Network & Telecommunications
Test & Measurement
Fibre Optics (cont’d)
Fitel S176CF Core Alignment Single & Multi Mode Fusion Splicer
Fitel S121A V-Groove Fusion Splicer
),76$
$8
7\SLFDOVSOLFHORVVLVG%IRUVLQJOHPRGHDQGG%PXOWLPRGH7\SLFDOVSOLFH
WLPHLVV,QFOXGHVVSOLFHSURWHFWRUKHDWVKULQNKHDWHUDQGVSOLFHWHQVLRQWHVWHU
J2SHUDWHVIURPDFa9RUEDWWHU\XSWRVSOLFHVDQGKHDWLQJV
SHUFKDUJH&OHDYHULVQRWLQFOXGHG
),76
$8
)XOO\DXWRPDWLF3URYLGHVDW\SLFDOVSOLFHORVVRIG%RQVLQJOHPRGH¿EUH
G%RQPXOWLPRGH¿EUH6SOLFHWLPHLVW\SLFDOO\V7HPSHUDWXUHRSHUDWHV
IURP0&a0&KXPLGLW\RSHUDWHVXSWR5+DW0C), and altitude sensors
RSHUDWHVXSWRPDGMXVWDUFWLPHDQGLQWHQVLW\,QFOXGHVDEXLOWLQKHDWHU
IRUDSSO\LQJVSOLFHSURWHFWRUVDQGDVSOLFHWHQVLRQWHVWHUJ)URQWPRXQWHG
FRORXUGLVSOD\2SHUDWHGIURPDF99RUEDWWHU\XSWRVSOLFHV
DQGKHDWVKULQNVSHUFKDUJH&OHDYHULVQRWLQFOXGHG
Fitel S175 Core Alignment Single & Multi Mode Fusion Splicer
),76
$8
'HIDXOW PXOWLPRGH RSHUDWLRQ LV FODGGLQJ DOLJQ )XOO\ DXWRPDWLF 3URYLGHV D
W\SLFDOVSOLFHORVVRIG%RQVLQJOHPRGH¿EUHG%RQPXOWLPRGH¿EUH
7HPSHUDWXUHKXPLGLW\DQGDOWLWXGHVHQVRUVDGMXVWDUFWLPHDQGLQWHQVLW\,QFOXGHV
EXLOWLQKHDWHUIRUDSSO\LQJVSOLFHSURWHFWRUV&OHDYHULVQRWLQFOXGHG
Sumitomo 35SE Fibre Optic Fusion Splicer
6806(
Call now
38
1=
$XWRVSOLFHORVVHVWLPDWLRQ,QFOXGHVKLJKUHVROXWLRQ/&'GLVSOD\SURJUDPPDEOH
KHDWHUVSOLFHGDWDVWRUDJHDQGDXWRPDWLF¿EUHDOLJQPHQW)XVLRQF\FOHWLPHLV
V$YHUDJHVSOLFHORVVLVG%+DQGOHVFODGGLQJGLDPHWHUV—Pa—P
DQG¿EUHW\SHVVLOLFDJODVVDQGVLQJOHPXOWLPRGH¿EUH)LEUHDOLJQPHQWFDSDELOLW\
IRU60&25(6100FODGGLQJ
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Cable/Pipe Testers & Locators
Test & Measurement
Cable / Pipe Testers & Locators
Ż1(:Ż
7HPSR7(6&DEOH/RFDWRU
TEM,508S
5DGLRGHWHFWLRQ6WHWKRVFRSH$QWHQQDIRU5$'5'6HULHV
RAD,STETH-L
AU/NZ
Tempo 508S Cable Locator for locating buried or in-wall wiring. Compact design.
Provides results on buried cables to depths of 1 meter and lengths up to 300
meters. Can be used to determine approximate depth of a wire or cable before you
dig. Fully adjustable transmitter output and receiver gain Transmitter frequency is
447.5KHz. Transmitter can be connected directly to AC power outlet. Transmitter
runs approximately 35 hrs and receiver runs approximately 20 hrs from standard
9V batteries.
AU
&RQFDYHKHDG¿WWHGWRÀH[LEOHJRRVHQHFNZLWKKDQGOH/HQJWKPPKHDG
46mmØ. Frequency range 50Hz~65kHz. Connect to any Radiodetection receiver
¿WWHGZLWKDFFHVVRU\VRFNHW
5DGLRGHWHFWLRQ5'3ODVWLF3LSH/RFDWRU
RAD,RD500
AU
Operates with 3 alternative pressure wave signal transmitters. Range 150m.
/RFDWLRQDFFXUDF\WRRIGHSWKWRP7UDQVPLWWHUVLQFOXGHGWRPDWFKPHWHU
base, hydrant, and tap outlets.
0HJJHU7'5
MEG,TDR1000
AU
For cable consisting of 2 insulated metallic elements, one of which may be the
armouring or screen of the cable. Internal matching networks to allow testing of
FDEOHV&DQEHPDWFKHGWRWKHFDEOHXVLQJWKHEDODQFHFRQWURO
allowing long lengths of cable to be easily tested and faults close the instrument to
be seen. Propagation velocity value can be similarly adjusted to match the cable,
ensuring an accurate distance measurement can be directly read. Gain of the
LQVWUXPHQWLVDOVRYDULDEOHDOORZLQJPRUHPLQRUIDXOWVWREHLGHQWL¿HGRYHUOHQJWK
of the cable. Eliminates the transmission pulse ‘dead zone’. Range 10m~3km.
'LVSOD\/DUJHKLJKUHVROXWLRQEDFNOLW>/&'@%DWWHULHV[/5$$DONDOLQH
NiCd or NiMH cells. Consumption 100mA nominal 140mA with backlight (20/30h
continuous use depending on backlight use). Dust and shower proof to IP54.
$HJLV&=0.,,,'LUHFW5HDGLQJ%ULGJH
AEG,CZ3000MKIII
0HJJHU7'57'5&DEOH)DXOW/RFDWRU
AU
Cable fault location information by bridge measurement. Direct readout for
telecommunication and other cables for distance to fault (and cable length). Shows
details of cable faults including shorts, shorts to ground and cable open circuits.
3DWKÀQGHU3)&LUFXLW7UDFHU.LW
PAT,PF610
AU
For tracing concealed power cabling and other signal or data conductors.
Comprises a transmitter and a detector. Transmitter when connected to a cable
generates a 4.6kHz current pulse by drawing low current from the cable circuit. In
the case of data and signal circuits a 9V battery can be used to power the cable.
This may require disconnection of computer equipment, etc. Detector gives audible
DQGYLVXDOLQGLFDWLRQRIWKHVLJQDO¿HOG7UDFHSKDVHFDEOHVFRD[EXULHG
unpowered cable, locate fuses, etc.
+DJDQXN7HOHÁH[&DEOH)DXOW7HVWHU
HAG,2000
AU
7LPHGRPDLQUHÀHFWRPHWHUIRUSRZHUFDEOHV0HDVXULQJUDQJHV
IW3XOVHZLGWKV
QV$FFXUDF\“W\SLFDOZRUVWFDVH'LJLWDOGLVSOD\RIGLVWDQFH
Can only work with multi-core cable with respect to between the cores or with
UHVSHFWWRFRUHDQGVKLHOG1RWVXLWDEOHIRU¿QGLQJIDXOWZLWKGLIIHUHQWFDEOHV
+':7N96XUJH*HQHUDWRU
HDW,T19
AU
MEG,TDR2000
0HJJHU7'550'XDO&KDQQHO7'5
MEG,TDR2000/2RM
'\QDWHO%XULHG&DEOHDQG)DXOW/RFDWRU
DYN,2273
3DWKÀQGHU&DEOH/RFDWRU7UDFHU
7HNWURQL[&7'5&DEOH7HVWHU
For tracing live power cables within buildings. Connection is generally made at an
outlet. Transmitter has visual and audible indication. Range 3m.
)OXNH,QWHOOLWRQH&DEOH7UDFHU
FLU,INTELLITONE200
AU/NZ
,QWHOOL7RQHWRQHUSUREHXVHVDGYDQFHGGLJLWDOVLJQDOORFDWLQJWHFKQRORJ\WR
locate and isolate hidden or bundled voice, data and video cables. Decisively
rejects noise and false signals, isolates cables within a bundle, despite cable bleed.
Provides a visual end-to-end Cablemap for twisted-pair installations.
NZ
)HDWXUHVLQFOXGHDF9PHWHUŸPHWHUFDEOHGHSWKPHWHUQRQHQHUJLVHGFDEOHV
only) and multiple frequency transmitter (user selectable). Trace path of energised
and unenergised cables, indicate cable depth and locate the position of shorted
conductors to ground using the A frame accessory. Max depth is 2.5m.
06FRWFKWUDN&DEOH/RFDWRU
AU
AU
Range 20km at VF =0.90. Monochrome display with backlight, dual cursor
PHDVXUHPHQWRXWSXWSXOVHDPSOLWXGHDQGZLGWKFRQWURO1REORFNLQJ¿OWHU
required for direct connection to live systems up to 300Vac. 15 memory
trace storage, down loadable to PC via RS232C interface, software supplied.
5DQJHVPPPPNPNPNPNPNP5HVROXWLRQ
PXSWRPPXSWRPRIUDQJHDERYHP0HDVXUHPHQW
DFFXUDF\RIUDQJH,QSXWLPSHGDQFHŸ9HORFLW\IDFWRUYDULDEOHIURP
0.300~0.999 in steps of 0.001. Powered via rechargeable NiMH powerpack,
charger supplied.
&DEOHIDXOWORFDWLRQV\VWHP)RUXVHZLWK+$*WLPHGRPDLQUHÀHFWRPHWHU
can be used as a stand alone instrument as a “thumper” and insulation tester.
&RPSULVHVDKLJKYROWDJHJHQHUDWRUZLWKDQDUFUHÀHFWLRQ¿OWHU6XUJHRXWSXW
range to 15kV. High voltage insulation test output to 40kV dc. Leakage current
ranges 10µA~100mA. Use to burn faults up to 25mA continuous output. Thumper
function provides 800j of energy up to 15kV up to 5s.
PAT,LOCAT220
NZ
Minimum resolution of 0.1m and a maximum range of 20km at 0.9VF and 16km
at 0.65VF. Perform single or dual channel measurements on a wide range
of metallic cables. Active channels can be compared with each other or with
previously stored traces from memory. Differential channel measurements
DUHSRVVLEOHDQGFURVVWDONEHWZHHQFKDQQHOVFDQDOVREHLGHQWL¿HG
6&27.%
1=
6KRUWFLUFXLWFDEOHDQGFLUFXLWEUHDNHUWUDFHU7UDFHVZLUHVLQZDOOVÀRRUVDQG
ceilings back to the switchboard. Locates associated fuses and circuit breakers.
To be used on live circuits.
TEK,1503C
AU/NZ/MY
'LVWDQFHUDQJH¶UHVROXWLRQ¶ŸRXWSXWLPSHGDQFH
LCD display. Internal battery or mains operation. Supplied with ethernet testing
and isolation network options.
7HNWURQL[7LPH'RPDLQ5HÁHFWRPHWHU
TEK,1503
MY
7LPH'RPDLQ5HÀHFWRPHWHUIRUORQJFDEOHIDXOWORFDWLRQ'LVSOD\IURPa
to 0~50,000 feet. Internal battery or mains operation.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
39
Cable/Pipe Testers & Locators
Test & Measurement
Cable / Pipe Testers & Locators (cont’d)
7DVFR375&DEOH7UDFHU
TAS,PTR600
NZ
&ODPSRQHDUWKWHVWHUaȍ0HDVXUHVHDUWKUHVLVWDQFHE\XVLQJFODPS
CTs without disconnecting the earth conductor. Measures the dc loop resistance
ZLWKRXWDQ\LQÀXHQFHIURPRWKHUFRQGXFWRUV
$HJLV&=(DUWK/HDNDJH&DEOH)DXOW
AEG,CZ7000
Used by Telstra Contractors.
5DGLRGHWHFWLRQ5'7\SH&DEOH/RFDWLRQ.LW
RAD,RD4000TYPE7KIT
AU
Ż1(:Ż
&VFRSH&DEOH/RFDWRU7UDQVPLWWHU
CSC,CATXD-KIT
AU
Includes transmitter, locator and 75mm tong set. Transmitter can operate with
direct connection, tongs or induction. Instrument will determine cable depth.
Operates with Radiodetection 33kHz sondes.
AU
,QFOXGHVWUDQVPLWWHUDQGORFDWRU5HFHLYHUKDV+]N+]SRZHU
and radio modes. 3 locating modes. Modes, 2 peak, 1 null, location arrows,
simultaneous digital depth and current readout. Transmitter T10 version, FF,
+]N+]WUDQVPLVVLRQIUHT/&'GLVSOD\IRUIUHTSRZHUEDWWHU\
DQGFRQQHFWLRQUHDGRXWPXOWLPHWHUIXQFWLRQFDEOHIDXOW¿QGIXQFWLRQ:RXWSXW
KLJKHI¿FLHQF\LQGXFWLRQPRGH6LJQDOFODPSPP‘&RQQHFWLRQOHDGVDQG
carry bag.
,&&/'8OWUDVRXQG/HDNDQG(PLVVLRQ'HWHFWRU
ICC,LD400
AU
Used to detect water and gas leaks, from ultrasonic emission. Also used for
mechanical noise location. Supplied complete with an ultrasonic transmitter to
enable leaks within containers to be detected, e.g. vehicle bodies, fuel tanks.
$XUDODQGYLVXDOLQGLFDWLRQ%DWWHU\RSHUDWHG
,&&/'1RLVH/HDN'HWHFWRU
ICC,LD408
MY
A-Frame accessory for RAD,RD4000Type7KIT. For sheath to ground type fault
¿QGLQJ
8VHGWRGHWHFWZDWHUJDVOHDNVHWFIURPXOWUDVRQLFHPLVVLRQ$OVRPD\EHXVHG
for mechanical noise location. Supplied complete with an ultrasonic transmitter
to enable leaks within containers to be detected, e.g. vehicle bodies, fuel tanks.
$XUDOYLVXDOLQGLFDWLRQ%DWWHU\RSHUDWHG
5DGLRGHWHFWLRQ)OH[LVRQGH3LSH7UDFHU
8OWUD3UREH83.78OWUDVRQLF/HDNDJH'HWHFWRU
5DGLRGHWHFWLRQ$)UDPHIRU5$'5'7\SH.LW
RAD,AFRAME FORRD4000
RAD,FLEXISONDE
AU
AU
Sonde for use with RD400PXL. Flexible rod on reel 50m long complete with
2 sondes. Small sonde transmitter is suitable for insertion into plastic pipes of
PP‘PPPLQEHQGUDGLXV&DQEHGHWHFWHGDWGHSWKVXSWRP/DUJHU
sonde can be detected at 5m depth and is suitable for insertion into plastic pipes
RIPP‘PPPLQEHQGUDGLXV6RQGHVDUHEDWWHU\RSHUDWHG
5DGLRGHWHFWLRQ6XSHUVRQGH
RAD,SUPERSONDE
AU
ULT,UP100KT
AU/NZ
Hand held pistol type with stainless steel sensor enclosure. Frequency reponse
20~100kHz, (centred at 28 ~42kHz), 10 segment LED bargraph (red). Sensitivity
8 precision attenuation. Response time 300ms, operating temperature range
0~500C. Kit includes contact stethoscope module with different wave guide
extension rods for direct for use on pipes, bearing housings, steam traps, etc.
Rubber focusing probes, head set, warble tone generator for determining leaks
in seals of empty containers, etc.
Can be connected to the RAD,FLEXISONDE cable if required. Detectable to
15m depth.
5DGLRGHWHFWLRQPP&ODPS$QWHQQD
RAD,CLAMP-ANT
AU
For use with RAD,RD400PXL. Identify an individual cable out of a bunch. Good
for cable tracing. Transmitter is connected to one end and placed around individual
FDEOHVIRULGHQWL¿FDWLRQ&ODPSLVPP‘
5DGLRGHWHFWLRQ5'3;/3LSHDQG&DEOH/RFDWRU
RAD,RD400PXL
AU
Can measure current in buried lines. Includes transmitter and locator, peak and
null location by audio and meter, very useful in congested areas. Has power
/radio/8kHz/33kHz modes, can read depth to 3m. Includes direct connect lead
and signal clamp (tong) (10cm). Works with optional sondes to trace sewers and
plastic pipes.
40
3ULPD\HU2PLNURQ:DWHU/HDN'HWHFWRU
PRI,OMIKRON-AG
AU
Water leak locating listening probe and ground microphone system designed to
locate leaks in water pipe. Supplied with headphones and interconnection cables.
Probe detects leak noise directly at available valves hydrants, etc. High sensitivity
DQG ZLGH EDQG DPSOL¿FDWLRQ RI OHDN QRLVH SDUWLFXODUO\ DW ORZHU IUHTXHQFLHV
Microphone will detect noise reaching the ground surface.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Magnetic Field Meters - Gauss Tesla
Model
Type
Frequency (Hz)
Range (G)
ARL,GM
$&PDJQHWLF¿HOGPHWHU
a
aP*
+2/+,
9HFWRU$&PDJQHWLF¿HOGPHWHU
a
a
+2/+,
$&¿HOGVWUHQJWKPHWHU
a
aP*
7(6
$&PDJQHWLF¿HOGPHWHU
+0,*0
%(/
'LJLWDOJDXVVPHWHU
%(/
%(/
%(/
'LJLWDO(/)JDXVVPHWHU
a
aP*
GFaN+]
*a*
dc~12
a*
a
P*aP*
GFaN+]
a
a
aP*
Arlyuna LF Milligauss Magnetic Field Strength Meter
ARL,GM
NZ
+DQGKHOGDFPDJQHWLF¿HOGVWUHQJWKPHWHU5DQJHVP*P*0HDVXUHPHQW
EDQGZLGWK+]a.+]+]+]¿OWHUDQGDQDORJXHDFRXWSXWIRUFRQQHFWLRQ
WRRVFLOORVFRSHVUHFRUGHUVRUORJJHUV
Bell 4048 ac/dc Gauss Meter
%(/
1=
+DQGKHOGGLJLWDODFGF*DXVV7HVODPHWHU5DQJHVDUHaN*DXVVZLWKD
UHVROXWLRQRI*DXVVRUa7HVODZLWKDUHVROXWLRQRI(7HVOD$FFXUDF\
LVGLJLWV3HDNKROGIHDWXUH6XSSOLHGZLWKWUDQVYHUVHSUREHDQG]HUR
JDXVVFKDPEHU
Bell 4080 ELF Gaussmeter
%(/
$8
5HVROXWLRQP*$XWRUDQJLQJaP*3UREHD[LVWHFKQRORJ\PDLQWDLQV
DFFXUDF\UHJDUGOHVVRIRULHQWDWLRQ7UXHUPVPHDVXUHPHQW7\SLFDODFFXUDF\
HUURU“GLJLW)UHTXHQF\UHVSRQVH“a+]G%+]
$SSOLFDWLRQVLQFOXGHGHWHFWLQJPDJQHWLF¿HOGHPLVVLRQVIURPRYHUKHDGDFSRZHU
OLQHVYLGHRGLVSOD\WHUPLQDOVRI¿FHHTXLSPHQWDQGKRXVHKROGDSSOLDQFHV
Bell 5080 Gauss/Tesla Meter
%(/
$8
3RUWDEOH JDXVVPHWHU FRPSOHWH ZLWK +DOO HIIHFW WUDQVYHUVH SUREH )UHTXHQF\
EDQGZLGWKGFN+]UDQJHV*aN*0D[UHVROXWLRQ*—70D[
DQGPLQKROG$QDORJXHRXWSXWDQG56LQWHUIDFH%DWWHU\RSHUDWHG
Holaday HI-3627 Magnetic Field Meter
+2/+,
$8
7KUHHRUWKRJRQDO¿HOGVHQVRUV'\QDPLFUDQJHP*a*7UXHUPVGHWHFWLRQ
)UHTXHQF\ UDQJH +]aN+] ZLWK DQ LQEXLOW +] KLJK SDVV ILOWHU 0HHWV
UHTXLUHPHQWVRIWKH6ZHGLVKSURWRFRODQGWKH,(((3SURWRFRO
Holaday HI-3604 LF E & H Field Monitor
+2/+,
Electric Field
Output
CRO
a9PHWHU
$QDORJ56
Hirst GM04 Microprocessor Controlled Gaussmeter
+0,*0
$8
)DFLOLWLHVVWRUHDQGUHFDOORQaVDPSOHVKROG$QDORJXHSHDNZLWKGLJLWDO
VWRUDJH$XWRDQGPDQXDOUDQJHV$XWRPDWLFUHDGLQJFRQYHUVLRQEHWZHHQGLIIHUHQW
XQLWV1RWHP7 *
5DQJHaWRPRUHWKDQ7UHVROXWLRQP7
5DQJHaP7UHVROXWLRQ—7
5DQJHaP7UHVROXWLRQ—7
5DQJHaP7UHVROXWLRQ—7
$FFXUDF\DW&“)UHTXHQF\UDQJHGFDQG+]aN+])XQFWLRQV
GFGFSHDNDFUPVDFUPVPD[DFSHDN$SSOLFDWLRQVLQFOXGHPHDVXUHPHQW
RIPDJQHWLFÀX[GHQVLW\RIPDJQHWVDQGDVVHPEOLHVHOHFWULFPRWRUDLUJDSVDQG
GULYHDFWXDWRUV
Hirst Magnetic Instruments GM04 Axial Probe
+0,*02$;,$/352%(
$8
$[LDOSUREHIRUXVHZLWK+0,*0
Teslatronics 70 milliGauss Meter
7(6
1=
7ULD[LDODFPDJQHWLF¿HOGPHWHU5DQJHLVaP*DXVVDFFXUDF\LV“
DW+])UHTXHQF\UHVSRQVHLVa+]“a+]“a+]
GE
Tri-axial Milligauss Magnetic Field Meter
%(/1=
+DQGKHOGGLJLWDO(/)JDXVVPHWHU5HVROXWLRQP*$XWRUDQJLQJaP*
5HVROXWLRQ P* LQ KLJKVHQVLWLYLW\ PRGH P* UHVROXWLRQ LQ ORZVHQVLWLYLW\
PRGH3UREHD[LVWHFKQRORJ\PDLQWDLQVDFFXUDF\UHJDUGOHVVRIRULHQWDWLRQ7UXH
UPVPHDVXUHPHQW7\SLFDODFFXUDF\HUURU“GLJLW)UHTXHQF\UHVSRQVH
“a+]G%+]$SSOLFDWLRQVLQFOXGHGHWHFWLQJPDJQHWLF¿HOG
HPLVVLRQVIURPRYHUKHDGDFSRZHUOLQHVYLGHRGLVSOD\WHUPLQDOVRI¿FHHTXLSPHQW
DQGKRXVHKROGDSSOLDQFHV
$80<
/RZ IUHTXHQF\ ¿HOG PHWHU 'HVLJQHG WR HYDOXDWH HOHFWULF DQG PDJQHWLF ¿HOGV
DVVRFLDWHG ZLWK +] SRZHU OLQHV )UHTXHQF\ UDQJH +]aN+] 0HDVXUHV
PDJQHWLF¿HOGVIURPP*a*0HDVXUHVHOHFWULF¿HOGVIURP9PWRN9P
/&'GLVSOD\UHDGLQJGDWDPHPRU\0HHWVWKHLQWHULPUHTXLUHPHQWVRIWKH
$XVWUDOLDQ5DGLDWLRQ/DERUDWRU\IRUQRUPDOOHYHOVRIDFSRZHUH[SRVXUH
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional fee, you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected accidents - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Call now!
TECHRENTALS
41
Power Analysis
Test & Measurement
Insulation/Condition/Resistance Testers
Model
Type
Voltage
V
Resistance
Ȏ
Current
A
Frequency
Hz
$6&RPSOLDQWIXOO
NH\ERDUGEDUFRGHVFDQQHU
56$XWRPDWLFODEHOWDJ
SULQWHU
6(:;3.,7
3RUWDEOH$SSOLDQFH7HVWHU
$6&RPSOLDQWEDUFRGH
VFDQQHU56
6(:(8523$3$7
0(*&%7
5&'7HVWHU
0(*/7
(DUWK/RRS,PSHGDQFH
aP$
aNȍ
/(06$7851*(2
($6<
/(06$7851*(2;
Features
6RLO5HVLVWLYLW\7HVWHU
aNȍ
P$
%DWWHU\56
PȍaNȍ
P$
a
%DWWHU\6WDNHOHVVPHDVXUHPHQW
HDUWKORRSLPSHGDQFH56
DF
0(*'(75
a
MEG,BM21
a
7ȍ
0(*%0'
N9N9
N9
Nȍa*ȍ
0(*.9
N9
7ȍ
a
*ȍ
+,2+9,7.9
N9
N9N9GF
7ȍ
1mA
%DWWHU\GDWDVWRUDJH86%
LQWHUIDFH
+,2
*ȍ
P$
,QVXODWLRQZLWKP$FRQWLQXLW\
WHVWHU
N9—)
KP
P$
—ȍaȍ
%DWWHU\
FZ3UREH/HDG6HW
/(06$7851,62
+'9+9$'&9/)
,QVXODWLRQ7HVWHU
+LJK9ROWDJH,QVXODWLRQ
'LHOHFWULFV7HVW6HW
&+./0
P$N9
dc
&52'
—ȍaȍ
—ȍaPȍ
75'60
—ȍaȍ
—ȍaNȍ
P$a
PȍaNȍ
0LFUR2KP0HWHU
0(*'/52
0(*'/52;
0(*'/52
—ȍaPȍ
0(*'/52
0(*&0
0(*0)7
0XOWLIXQFWLRQ,QVWDOODWLRQ
7HVWHU
/(06$7851
%$8'3$
$922763%
aN9
a
2LO,QVXODWLRQ7HVWHU
a0ȍ
aNȍ
2SHUDWHVIURPPDLQVXSSO\RU
UHFKDUJHDEOHEDWWHU\
—$
75'60
9$/%
%DWWHU\
GF9/)
%DWWHU\
)RXULQRQH+9WHVWVHW
9/)'&-DFNHW6KHDWK)DXOW
&RQGLWLRQLQJ
56
dc
+HDY\GXW\.HOYLQOHDGV
$OSKDQXPHULFNH\SDGIRU
HQWHULQJWHVWQRWHVDXWRUDQJLQJ
ZLWKPDQXDORSWLRQUHDOWLPHRU
IURPVWRUDJHYLD56ODUJH
EDFNOLW/&'
566RIWZDUH
aP$
a
aP$
a
566RIWZDUH5&'WHVWHU
/RRSLPSHGDQFH3URVSHFWLYH
VKRUWFLUFXLW
a
a
%DWWHU\
a
a
aN9UPV
56
N9UPV
%DWWHU\56
%-0$//7(67
0RWRU&RLO7HVWHU
N9
a0ȍ
0
0HJRKP0HWHU
a
a*ȍ
a
3RZHU)DFWRU&DSDFLWDQFH
(6'6XUIDFH7HVWLQJ
6HH$OVR+L3RW7HVWHUV
42
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Insulation/Condition/Resistance Testers (cont’d)
Ż1(:Ż
Ż1(:Ż
Megger 10-01 10kV Insulation Tester, Test Voltage 500~10,000V
0(*.9
+LRNL'LJLWDO0Ÿ+L7HVWHU,QVXODWLRQ7HVWHU
$8
7KH 0HJJHU 0(*N9 ,QVXODWLRQ7HVWHU LV D FRPSDFW 0LFURSURFHVVRU
FRQWUROOHGKLJKYROWDJHGF,QVXODWLRQWHVWHU
+,2
$8
&RQWLQXLW\ IXQFWLRQ ZLWK P$ DQG UDQJH YROWDJH VHOHFWDEOH 9 9
N9 (DV\ WR UHDG GLJLWDO GLVSOD\ DXWRGLVFKDUJH OLYHZLUH ZDUQLQJ VDIHW\
V\VWHPIRUKLJKYROWDJHPHDVXUHPHQWVOLGLQJFRYHU%DFNOLJKWLQJOLTXLGFU\VWDO
GLVSOD\IRUHDV\UHDGLQJLQGDUNDUHDVFKHFNVJURXQGZLUHFRQWLQXLW\ZLWKDVKRUW
FLUFXLWFXUUHQWRIP$&DSDEOHRIWHVWLQJWKHFRQWLQXLW\RIHOHFWULFDOIDFLOLW\
JURXQGVLQDFFRUGDQFHZLWK,(&0HDVXUHPHQWUDQJHLQVXODWLRQUHVLVWDQFH
PD[LPXP0Ÿ#N92WKHUIXQFWLRQVLQVXODWLRQDQGORZUHVLVWDQFHPRGH
FRPSDUDWRUPHDVXUHPHQWYDOXHKRGLQVXODWLRQUHVLVWDQFHPRGHDXWRGLVFKDUJH
LQVXODWLRQDQGDFYROWDJHPRGHOLYHZLUHZDUQLQJZKHQYROWDJHRI9RU9
H[LVWVDFURVVPHDVXUHPHQWWHUPLQDOV/RZUHVLVWDQFHPRGH]HURDGMXVW$OO
PHDVXUHPHQWPRGHVEDWWHU\LQGLFDWRUVDXWRSRZHURII0D[LPXPUDWHGZRUNLQJ
YROWDJH9DF
Ż1(:Ż
Hioki 3455 High Voltage Insulation Tester
+,2+9,7.9
$8
3,DQG'$5IXQFWLRQWRFKHFNLQVXODWLRQTXDOLW\DQGVWHSYROWDJHWHVWWRGHWHFWIRU
VLJQVRIGHWHULRUDWLRQ*HQHUDWHVDZLGHUDQJHRIWHVWYROWDJHVIURP9WRN9
7KHYROWDJHPD\EHFKRVHQIURPWKHFRPPRQO\XVHGSUHVHWVRI99N9
N9N9RUVHWWRGHVLUHGOHYHOE\LQFUHPHQWVRUGHFUHPHQWVRI9RU9
,QVXODWLRQGLDJQRVHVIRUDXWRPDWLFFDOFXODWLRQDQGLQGLFDWLRQRI3,3RODULVDWLRQ
LQGH[DQG'$5'LHOHFWULFDEVRUSWLRQUDWLRVWHSYROWDJHWHVWLQJDQGWHPSHUDWXUH
FRUUHFWLRQ/DUJHPHPRU\VWRUHVXSWRPDQXDOUHFRUGVDQGDORJJLQJIXQFWLRQ
IRUGDWDWLPHV6WRUHGGDWDPD\EHGLVSOD\HGRQWKH/&'RUGRZQORDGHG
WRD3&7KHGDWHDQGWLPHRIPHDVXUHPHQWDOVRUHFRUGHG
Ż1(:Ż
RCD Isolation Test Transformer for Testing Portable RCD Unit
352,7;9$5&'
5&',VRODWLRQ7HVW7UDQVIRUPHUIRU7HVWLQJ3RUWDEOH5&'XQLWV,QSXW9+]
DQGRXWSXW99$WKHUPDOO\SURWHFWHGLVRODWLRQWUDQVIRUPHU7KLVLVRQO\
VXLWDEOHIRUWHVWLQJSRUWDEOH5&'VDQGE\XVLQJWKLVLVRODWLRQWUDQVIRUPHUZLOODYRLG
WULSSLQJRIWKHZKROHFLUFXLW,WFRPHVZLWK$PSV$XVWUDOLDQ1HZ=HDODQG
6RFNHW,VRODWLRQWHVWWUDQVIRUPHUFDQEHXVHGWRWHVWXSWRP$WULSFXUUHQW
Cropico DO7 Micro-Ohm Meter complete with Probe/lead Set
&52'2
CHK LM05 Micro-Ohm Meter 10A
&+./0
$80<
2SHUDWHVIURPLQWHUQDOEDWWHULHVRUH[WHUQDOSRZHUVXSSO\0D[WHVWFXUUHQW$
5HVLVWDQFHUDQJHXSWRŸZLWKDPD[VHQVLWLYLW\RI—Ÿ,QFOXGHVSRZHUVXSSO\
FKDUJHUGXSOH[KHOLFDOWHVWOHDGVOHQJWKP
Megger DLRO10 Micro-Ohm Meter
0(*'/52
$8
/RZUHVLVWDQFHPHDVXUHPHQWIRUXVHLQZRUNVKRS¿HOGRUWHVWIDFLOLWLHV5XJJHG
FRQVWUXFWLRQLQDVHDOHGSODVWLFFDVHZLWKOLGDQGFDUU\KDQGOH$GYDQFHGIHDWXUHV
LQFOXGLQJSURWHFWLRQXSWR9UPVDWWKHPHDVXULQJWHUPLQDOVGLJLWDOFDOLEUDWLRQ
DQGORQJVFDOHOHQJWKFRXQW5HFKDUJHDEOHEDWWHULHV!KRIFRQWLQXRXV
RSHUDWLRQRQORZHVWUDQJHVKRQDOORWKHUV%DWWHU\FKDUJHLQGLFDWRUVDUH
SURYLGHG ,QWHUQDO FKDUJHU ZLOO ERRVW FKDUJH WR RI IXOO FKDUJH VZLWFKLQJ
DXWRPDWLFDOO\WRDPDLQWHQDQFHFKDUJH:DUQLQJ/('VLOOXPLQDWHZKHQDQRSHQ
FLUFXLWOHDGFRQGLWLRQLVGHWHFWHG56RXWSXWIRUFRQQHFWLRQWRDQH[WHUQDO
SULQWHURU3&3OXJLVSURYLGHGIRUWKHFRQQHFWLRQRIH[WHUQDOVWDUWVZLWFKHJIRRW
VZLWFK6XSSOLHGZLWKEDWWHULHVPDLQVFRUGDQGWHVWOHDGV)RUVSHFLDOOHDGVHWV
ZHRIIHUDYDULHW\RIGLIIHUHQWVW\OHVWRJHWKHUZLWKFDOLEUDWLRQVWDQGDUGV
$8
6HOIFRQWDLQHGDXWRPDWLFPLFURRKPPHWHUVHOHFWLQJWKHPRVWVXLWDEOHWHVWFXUUHQW
XSWR$GFWRPHDVXUHUHVLVWDQFHIURPPŸaNŸRQRQHRIVHYHQUDQJHV
,QVWUXPHQWLVEXLOWLQWRDVWURQJOLJKWZHLJKWFDVHWKDWLVHTXDOO\DWKRPHLQWKH
¿HOGRULQWKHODERUDWRU\/LJKWHQRXJKWREHZRUQDURXQGWKHQHFNVPDOOHQRXJK
WREHWDNHQLQWRDUHDVZKLFKZHUHSUHYLRXVO\WRRVPDOOWRDFFHVV'/52XVHV
DODUJHEULJKW½GLJLW/('GLVSOD\5HVROXWLRQ—Ÿ%DWWHU\UHFKDUJHDEOH
1L0+W\SLFDOOLIHWHVWDWIXOOORDG
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
43
Power Analysis
Test & Measurement
Insulation/Condition/Resistance Testers (cont’d)
Valhalla 4300B Digital Micro-Ohm Meter
Megger DLRO-10X Digital Low Resistance Ohmmeter
0(*'/52;
$81=
$XWRPDWLFDOO\VHOHFWVWKHPRVWVXLWDEOHWHVWFXUUHQWXSWR$GFWRPHDVXUH
UHVLVWDQFHIURP—ȍaNȍRQRIUDQJHV5HDOWLPHGRZQORDGRIUHVXOWVDQG
RQERDUGVWRUDJHIRUODWHUGRZQORDGWRD3&$XWRPDWLFDOO\GHWHFWVFRQWLQXLW\LQ
SRWHQWLDODQGFXUUHQWFRQQHFWLRQV9LVLEOHZDUQLQJRIKLJKYROWDJHVSUHVHQWDWWKH
WHUPLQDOV9LVLEOHZDUQLQJRIFXUUHQWÀRZLQJLQWKHWHVWVDPSOH0XOWLSOHRSHUDWLQJ
PRGHVLQFOXGLQJIXOO\DXWRPDWLF$OSKDQXPHULFNH\SDGIRUHQWHULQJWHVWQRWHV
8VHUVHOHFWDEOHKLJKDQGORZOLPLWV$XWRUDQJLQJZLWKPDQXDORSWLRQ
9$/%
$8
6HOHFWDEOHFXUUHQWUDQJHV—$a$6XLWDEOHIRUODUJHHOHFWULFDOPDFKLQHU\
5HVLVWDQFHUDQJHVPŸa.ŸZLWKDPD[UHVROXWLRQRI—Ÿ%DVLFDFFXUDF\
ZLWKD½GLJLWGLVSOD\6XSSOLHGZLWKKHDY\GXW\.HOYLQOHDGV
Megger BM21 500V/1/2/5kV Insulation Test Set
0(*%0
$8
7HVWYROWDJHVa9LQ9VWHSV,QVXODWLRQUDQJHWR7ŸDW97Ÿ
DWN9$&GFYROWDJHPHDVXUHPHQW9aN9/HDNDJHFXUUHQWPHDVXUHPHQW
&DSDFLWDQFHPHDVXUHPHQWDWHQGRIWHVW$XWRPDWLFGLVFKDUJHRIFDSDFLWDQFH
,QEXLOWWHVWWLPHU,QVXODWLRQEXUQPRGHVKRUWFLUFXLWFXUUHQWP$QRPLQDO%DWWHU\
OLIHKLQEXLOWFKDUJHUIRUFKDUJLQJIURPPDLQVRU9GF
AVO/Megger BM11D Analogue/Digital 5kV Insulation Tester
0(*%0'
$80<
7HVWYROWDJHV9N9N9DQGN9,QVXODWLRQUDQJHNŸa*ŸGLJLWDO
$&GFYROWDJHPHDVXUHPHQW9aN97LPHUaPLQ$XWRPDWLFGLVFKDUJHRI
FDSDFLWDQFH%DWWHU\OLIHKLQEXLOWFKDUJHUIRUFKDUJLQJIURPPDLQVRU9GF
Megger BM25 Insulation Tester
0(*%0
Megger DLRO600 Digital Micro-Ohm Meter- High current
0(*'/52
$8
0HDVXUHVUHVLVWDQFHEHWZHHQ—ŸŸDWKLJKFXUUHQWV3URYLGHVWHVWFXUUHQWV
IURP$a$VXEMHFWWRWKHORDGUHVLVWDQFHDQGVXSSO\YROWDJH%DFNOLWOLTXLG
FU\VWDOGLVSOD\VKRZVLQIRUPDWLRQQHHGHGWRSHUIRUPDWHVWDOOWHVWSDUDPHWHUV
DQGPHDVXUHPHQWUHVXOWVDUHGLVSOD\HG5DQJH—ŸaP:>VXEMHFWWR
VXSSO\[email protected]$FFXUDF\YROWDJH““P9FXUUHQW
““$5HVLVWDQFHEHWWHUWKDQ—ŸaP:3RZHUVXSSO\IRUIXOORXWSXW
a9+]ZLWKDORDGOHVVWKDQPŸLQFOXGLQJFXUUHQWOHDGV>LHVWDQGDUG
PPPðFXUUHQWOHDGVRQO\PŸ[email protected]+]
7HVWFXUUHQWUDQJH$a$XQVPRRWKHGGFLQ$VWHSVDFFXUDF\““$7HVW
0RGHVPDQXDODXWRFRQWLQXRXV7HVW7LPHV1250$/$872PRGH5HIUHVKHG
HYHU\VLQ&217,18286PRGH9ROWPHWHULQSXWLPSHGDQFH!N:'DWD
7UDQVIHUUHDOWLPHRUEDWFKGRZQORDGYLD56XVLQJ$92'RZQORDG0DQDJHU
6WRUDJH&DSDFLW\UHVXOWVHWVDQGPHPREDWWHU\EDFNHGIRU\
$81=
)LYH N9 LQVXODWLRQ WHVWHU ZKLFK LV EDWWHU\SRZHUHG KRXVHG LQ D UXJJHG FDVH
DQGKDVDODUJHDQDORJXHGLJLWDO/&'$EXLOWLQWLPHUPDNHVERWKVSRWWHVWV
DQG 3RODULVDWLRQ ,QGH[ 3, WHVWLQJ HDVLHU WR FDUU\ RXW 3UHVHW VWDQGDUG WHVW
YROWDJHVDW9N9ZLWKYDULDEOHWHVWYROWDJHLQ9VWHSV'LVSOD\V
FDSDFLWDQFHDWWKHHQGRIDWHVWWR—)3HUIRUPVDXWRPDWLF3,6WHS9ROWDJH
DQG'LHOHFWULF'LVFKDUJHWHVWVDVZHOODVSURYLGLQJDQRSWLFDOO\LVRODWHG56
SRUWIRUGRZQORDGLQJUHVXOWVGXULQJDWHVW6KRUWFLUFXLWFXUUHQWQRPLQDOP$
PD[P$%DWWHU\OLIHW\SLFDOO\K
Megger 200A Micro-Ohm DLRO200
0(*'/52
$8
'LJLWDOORZUHVLVWDQFHPLFURRKPPHWHU$
Megger CM500 Multifunction Installation Tester
0(*&0
$81=
&RPELQHVWKHIXQFWLRQRIVHYHUDOLQVWUXPHQWV1RQWULSSLQJORRSWHVWIRUWHVWV
RQ 5&' SURWHFWHG FLUFXLWV 5&' UDPS WHVW IHDWXUHV DFWXDO WULSSLQJ FXUUHQW
)XQFWLRQVDUHLQVXODWLRQFRQWLQXLW\ORRSWHVWLQJ5&'WHVWVYROWDJHIUHTXHQF\
PHDVXUHPHQW3KDVHLQGLFDWLRQRXWOHWSRODULW\LQGLFDWLRQ6WRUHVDSSUR[LPDWHO\
WHVWUHVXOWVLQPHPRU\IRUXSORDGLQJWR3&
LEM Saturn Insulation Tester
/(06$7851,62
$8
7HVWYROWDJHVa9LQVWHSVRI90D[UDQJH*Ÿ0HDVXUHVDFGF
YROWDJH WR 9 UHVLVWDQFH WR NŸ 'LJLWDO DQG DQDORJXH GLVSOD\ %DWWHU\
RSHUDWHG
Megger CBT2 Earth Leakage Breaker Tester
T&R DSM200 200A Micro-Ohm Meter
75'60
$8
MD[$0D[UHVROXWLRQ—Ÿ'LJLWDOGLVSOD\ZLWK56RXWSXW$&PDLQV
RSHUDWLRQ&RPSOHWHZLWKPOHDGV
0(*&%7
$8
5HVLGXDOFXUUHQWGHYLFH5&'VDIHW\VZLWFKFLUFXLWEUHDNHUWHVWHU7ZHOYHUDQJHV
IURPaP$'LVSOD\VWULSSLQJWLPHLQPV
T&R DSM200 600A Micro-Ohm Meter
75'60
$8
MD[RXWSXW$PD[UHVROXWLRQ—Ÿ'LJLWDOGLVSOD\ZLWK56RXWSXW$&
PDLQVRSHUDWLRQ&RPSOHWHZLWKPOHDGV
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
45
Power Analysis
Test & Measurement
Insulation/Condition/Resistance Testers (cont’d)
Metrel MI 2121 AUS Advanced RCD Tester
0(70,$86
$8
([FHHGVDOOUHTXLUHPHQWVRI$61=66WRUHVXSWRWHVWV,QWHUIDFH
566RIWZDUH
Kikisui TOS-5051 5kV ac/dc Hi-Pot Tester
.,.726
$8
+LJKYROWDJHDFGFLQVXODWLRQWHVWVHW5DQJHVaN9aN90D[RXWSXWDF
P$GFP$3DVVIDLOFRPSDUDWRULQFOXGHG
Megger Det5/3R Ground Resistance Tester
0(*'(75
0(*'(7
$8
1=
&KHFNV UHVLVWDQFH RI HOHFWULFDO V\VWHPV LQFOXGLQJ VRLO UHVLVWLYLW\ 0HDVXUHV
UHVLVWDQFHIURPaŸLQUDQJHV/&'òGLJLWGLVSOD\2SHUDWLQJ
IUHTXHQF\+]&RPSOHWHZLWKHDUWKWHVWLQJNLWLQFOXGLQJVSLNHVDQGZLUH
3M Model 701 Micro-ohm ESD Surface Tester
0
$8
7HVWHUIRUVWDWLFFRQWUROVXUIDFHVWDEOHPDWV¿HOGVHUYLFHNLWVÀRRUFRYHULQJVHWF
7HVWYROWDJHV95HVLVWDQFHUDQJHa*Ÿ
Baur DAP75 Insulating Oil Tester
%$8'3$
Megger BT51 Low Resistance Ohmmeter
0(*%7
$8
2XWSXWYROWDJHaN9UPV6HOHFWDEOHSURJUDPPHVWRLQWHUQDWLRQDOVWDQGDUGV
,QWHJUDOSULQWHU56LQWHUIDFH
$8
8VHVWHUPLQDOPHWKRGZLWKKHOLFDOGXSOH[GXDOSURQJHGSUREHV7HVWFXUUHQW$
QRPLQDODWŸ5DQJHVUHVROXWLRQPŸPŸUHVROXWLRQ—Ÿ$FFXUDF\
DWa&“RIUHDGLQJ“GLJLWV'LVSOD\/('òGLJLW3RZHUVXSSO\LQWHUQDO
1L&GUHFKDUJHDEOHEDWWHULHVW\SLFDOO\DURXQGWHVWVDWVGXUDWLRQ5HFKDUJH
WLPHDURXQGKZLWK9DFPDLQVSRZHU1HWWZHLJKWNJV
AVO OTS60PB Transformer Oil Tester
$922763%
%-0$OO7HVW,,,0RWRU&RLODQG:LQGLQJ7HVWHU
%-0$//7(67
Megger LT6 Digital Loop Tester
$8
7HVW YROWDJH N9 PD[ DW +] )XOO\ DXWRPDWLF RSHUDWLRQ 5HFKDUJHDEOH
EDWWHU\RSHUDWLRQ56&LQWHUIDFH
$8
(DUWKIDXOWORRSLPSHGDQFHWHVWHUŸUDQJHŸUHVROXWLRQNŸUDQJHŸ
UHVROXWLRQ6LQJOHSKV\VWHPVFDQEHWHVWHG8VHGZLWK0(*&%7WRWHVW
FRPSOLDQFHWR$6HOHFWULFDOZLULQJIRUKD]DUGRXVDUHDV7HVWVDXWRPDWLFDOO\
ZKHQFRQQHFWLRQWRFLUFXLWLVPDGH1HRQVLQGLFDWHIDXOWFRQGLWLRQV
7HVWHUIRUVLQJOHRUSRO\SKDVHDFPRWRUVJHQHUDWRUVWUDQVIRUPHUVRUGFPRWRUV
8VHWRWHVWDQ\PRWRUFRLORUZLQGLQJWRGHWHUPLQHLQVXODWLRQFRQGLWLRQEHWZHHQ
ZLQGLQJVZLQGLQJVDQGIUDPHRSHQFLUFXLWV$OVRPHDVXUHSKDVHEDODQFHDQG
DQJOH,PSHGDQFH]aŸ,QGXFWDQFH/P+a+&DSDFLWDQFH&
P)aQ)3RZHUIDFWRU)LaO,QVXODWLRQa0Ÿ#N9)UHTXHQF\
UDQJH+]N+]WLPHV
Megger MFT1502 Combined Insulation, Loop & RCD Tester
BJM All-Test IV PRO 2000
0(*/7
0(*0)7
$8
$8
7HVWV¿[HGZLULQJLQDFFRUGDQFHZLWK,QWHUQDWLRQDODQG1DWLRQDO:LULQJ6WDQGDUGV
'LVSOD\GLJLWDODQDORJXHDUF/&'9ROWDJHPHDVXUHPHQWDXWRPDWLFVHOHFWLRQDFRU
GFXSWR9&RQWLQXLW\WHVWLQJP$IURPaŸDXWRPDWLFFRQWLQXLW\
WHVWLQJFRPPHQFHVWKHPRPHQWWKHWHVWSUREHVWRXFKWKHFLUFXLWWREHWHVWHG
$XGLEOHWRQHWRFRQ¿UPWHVW6DIHW\FKHFNIRUSUHVHQFHRIDYROWDJH9DULDEOH
EX]]HU WKUHVKROG VHOHFWDEOH IURP aŸ LQ VWHSV ,QVXODWLRQ WHVWLQJ 9N96DIHW\ORFNRXWDWYROWDJHVJUHDWHUWKDQ9$XWRGLVFKDUJHIDFLOLW\
VDIHO\GLVFKDUJHVDOOFLUFXLWVDIWHULQVXODWLRQWHVW/RZFXUUHQWORRSWHVWDZLUH
QRQWULSSLQJ Ÿ ORRS WHVW GHVLJQHG WR SUHYHQW 5&' WULSSLQJ +LJK FXUUHQW
ORRSWHVWDW$SURYLGHVDIDVWORRSWHVWZKHUHQR5&'LV¿WWHG6XSSO\YROWDJH
DQGSRODULW\LQGLFDWLRQDW9a9+]a+]SKDVHWRSKDVH3KDVHaSKDVH
SKDVHaQHXWUDODQGSKDVHaHDUWKORRSWHVWVDUHSRVVLEOH/RRSPHDVXUHPHQWV
IURP 9a9 3URVSHFWLYH VKRUWaFLUFXLW FXUUHQW 36& D KLJK FXUUHQW ORRS
WHVWLVSURYLGHGIRUUDSLGPHDVXUHPHQWRIORRSFXUUHQWVERWKDWWKHVRFNHWRXWOHW
DQGGLVWULEXWLRQERDUG5DQJHVIURP$aN$ZLWKDUHVROXWLRQRI$
GHSHQGLQJRQUDQJHDXWRUDQJLQJ5&'WHVWLQJP$aP$ZLWKERWKO
SKDVHDQJOH5&'UDPSWHVWPHDVXUHVWKH5&'WULSFXUUHQW'LVSOD\VDFWXDOWULS
FXUUHQWRQDOO5&'UDQJHVLQVWHDGRIWULSWLPH/('WRUFKLQLOOXPLQDWHGSUREHIRU
ORZOLJKWOHYHODUHDV,3
%-0$//7(67
$8
7HVWVVLQJOHRUSRO\SKDVHDFPRWRUVJHQHUDWRUVWUDQVIRUPHUVRUGFPRWRUV8VHWR
WHVWDQ\PRWRUFRLORUZLQGLQJWRGHWHUPLQHLQVXODWLRQFRQGLWLRQEHWZHHQZLQGLQJV
ZLQGLQJVDQGIUDPHRSHQFLUFXLWV0HDVXUHSKDVHEDODQFHDQGDQJOH,PSHGDQFH
] ŸaNŸ ,QGXFWDQFH / P+a+ &DSDFLWDQFH & P)aQ)
3RZHUIDFWRU)LO,QVXODWLRQa0Ÿ#N9)UHTXHQF\UDQJH
+]N+]WLPHV
LEM Saturn GEO Easy Earth Tester
/(06$7851*(2($6<
$8
:DWHUSURRILQVWUXPHQWUXEEHUSURWHFWLYHFRYHU,30HDVXUHVHDUWKUHVLVWDQFH
RUSROH6RLOUHVLVWLYLW\0HDVXUHVUHVLVWDQFHIURPaNŸ'LVSOD\GLJLW
EDFNOLJKWPP/&'2SHUDWLQJIUHTXHQF\+]6LQJOHEXWWRQXVHULQWHUIDFH
&RPSOHWH ZLWK HDUWK WHVWLQJ NLW LQFOXGLQJ VWDNHV UHHOHG FDEOHV FOLSV DQG
FDUU\FDVH
46
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Insulation/Condition/Resistance Testers (cont’d)
LEM Saturn GEO X Earth/Soil Resistance Tester
/(06$7851*(2;
Seaward PAC 3760 Appliance Checker
$8
$XWRPDWLFDOO\WHVWVHDUWKVRLOUHVLVWDQFHSROHDQGVWDNHOHVVZLWK&72SWLPLVH
RXWSXWIUHTXHQF\PDQXDORUDXWRPDWLFaNŸDW9DFIUHTXHQF\
+]'LVSOD\VDOOPHDVXULQJUHVXOWVIRUDVORQJDVGHVLUHG
3URJUDPPDEOH OLPLWV 2SWLFDO DQG DXGLEOH RYHUOLPLW ZDUQLQJ 6SODVKSURRI
FDVH,3RXWGRRUDSSOLFDWLRQ0HDVXUHPHQWVZLWKFXUUHQWFODPSVVHOHFWLYH
VWDNHOHVV5HVLVWDQFHPHDVXUHPHQWVZLWKP$VKRUWFLUFXLWFXUUHQW2XWSXW
RIPHDVXUHGYDOXHVYLDLQWHUIDFHRQSULQWHURU3&
LEM Saturn 100plus Safety Tester
/(06$7851
6(:3$&
$8
3HUIRUPVWKHIROORZLQJWHVWVLQFRQIRUPDQFHWR$61=6HDUWKERQG
LQVXODWLRQSRODULW\WHVWVDOVROHDNDJHFXUUHQWWHVWVIRU&ODVV,&ODVV,,DSSOLDQFHV
DQGOHDGVOHDNDJHFXUUHQWWHVWLQJRIDSSOLDQFHVZKLFKUHTXLUHVSRZHUWR³VZLWFK´
WKHPRQLVWKHPHWKRGUHTXLUHGE\$61=6)HDWXUHVVLPSOHSDVV
IDLOLQGLFDWLRQ8QLTXHEXWWRQRSHUDWLRQ&ODVV,FODVV,,DQGOHDNDJHFXUUHQW
$XWRPDWLFWHVWVHTXHQFHVHQVHVDQ,(&RUH[WHQVLRQOHDGWKHQSHUIRUPVDSRODULW\
WHVW'HWHFWVWKDWWKHDSSOLDQFHXQGHUWHVWLVVZLWFKHG³2Q´(DUWKERQGWHVWLV
VHWDW$DQGLVFDSDEOHRIIXVLQJDSRRUHDUWK/DUJH/&'
$8
&RQ¿UPVFRUUHFWRSHUDWLRQRI5&'SURWHFWLRQUHVLVWDQFHRIDOODVSHFWVRISURWHFWLYH
HDUWKLQJ V\VWHPV ORRS LPSHGDQFH OLQHQHXWUDO SRODULW\ SUHGLFWLYH VKRUW FLUFXLW
FXUUHQWSKDVHVHTXHQFHDQGYROWDJH5&'FXUUHQWP$a$7ULSSLQJWLPH
aPV 7ULSSLQJ FXUUHQW PHDVXUHPHQW ZLWK LQWHOOLJHQW UDPS )DXOW YROWDJH
a9/RRSDQGHDUWKLQJUHVLVWDQFH:aN:(DUWKHOHFWURGHYROWDJH
6(9 XS WR 9 6KRUWFLUFXLW FXUUHQW $aN$ /RRSOLQH LQWHUQDO
UHVLVWDQFH5/223a:1RPLQDOOLQHYROWDJHVa9%DWWHU\VDYLQJ
DXWRPDWLFVZLWFKRIIW\SLFDOEDWWHU\VHUYLFHOLIHLQVXODWLRQPHDVXUHPHQWV
Multi-amp MET-2 Clamp-On Earth Tester
08/0(7
1=
&ODPSRQHDUWKWHVWHUaŸ0HDVXUHVHDUWKUHVLVWDQFHE\XVLQJFODPS
&7V ZLWKRXW GLVFRQQHFWLQJ WKH HDUWK FRQGXFWRU 0HDVXUHV GF ORRS UHVLVWDQFH
ZLWKRXWDQ\LQÀXHQFHIURPRWKHUFRQGXFWRUV
6HDZDUG6XSHUQRYD;(3$76\VWHPZLWK3ULQWHUDQG6FDQQHU
Seaward Europa Advanced Portable Appliance Tester
6(:(8523$3$7
$8
5HFRUGVUHVXOWVFRPSOLDQWZLWK$61=6FDQEHSULQWHGDVD
FHUWL¿FDWH XVLQJ WKH VHULDOSDUDOOHO DGDSWRU %DUFRGH UHDGHU LQFOXGHG (DUWK
FRQWLQXLW\RXWSXWFXUUHQWP$a$DF5DQJHaŸ$FFXUDF\“RI
UHDGLQJ“GLJLW,QVXODWLRQWHVWUDQJHNŸa0Ÿ7HVWYROWDJH9GF
5HVROXWLRQ0Ÿ,QFOXGHVSOXJDGDSWRUWRWHVW(32'VDQGH[WHQVLRQOHDGV
,(&,(&DQG$XVWUDOLDQ
Ż1(:Ż
6HDZDUG3$70DQDJHPHQW6RIWZDUH:,1
6(:3$7*8$5'6::,1
$8
6HDZDUG¶V3$7*XDUG3OXVWDNHVDVLJQL¿FDQWOHDSLQHOHFWULFDOVDIHW\PDQDJHPHQW
VRIWZDUH,WVXQLTXH³'UDJDQG'URS´SUHVHQWDWLRQPDNHVWKHVRIWZDUHLQWXLWLYHDQG
YHU\HDV\WRXVH3$7*XDUGERWKXSORDGVDQGGRZQORDGVDSSOLDQFHLQIRUPDWLRQ
DQGWHVWUHVXOWVIURPWKH(XURSD;((XURSD3OXVDQG6XSHUQRYD;(8VHUV
KDYHDFRPSOHWHYLVXDORYHUYLHZRIDOODSSOLDQFHVLQWHUPVRIORFDWLRQVDQGWHVW
VWDWXV$SSOLDQFHVDUHVLPSO\GUDJJHGDQGGURSSHGIURPRQHORFDWLRQWRDQRWKHU
5HSHDWWHVWLQJUHTXLUHPHQWVDUHHDVLO\GLVSOD\HGDOORZLQJVFKHGXOLQJRIWHVWVWR
EHFRQYHQLHQWO\PDQDJHGDQGXSORDGHGLQWRWKHDSSOLDQFHWHVWHU
6(:;(3.,7
6(:;(3.,7
$8
1=
IQFOXGHVUHVXOWVODEHOWDJSULQWHUDQGEDUFRGHVFDQQHU3HUIRUPVDOO$61=6
FRPSOLDQWWHVWVLQFOXGLQJFODVVFODVVOHDNDJHFXUUHQWP$P$
DQHDUWKFRQGXFWRUERQGWHVWXSWR$DW9DSSUR[:DQG9GF029
LQVXODWLRQUHVLVWDQFHWHVWV6WRUHVWHVWVLQLQWHUQDOPHPRU\E\DSSOLDQFH
,'LQFOXGLQJWHVWW\SHGHWDLOHGUHVXOWVWHVWWLPHGDWHQH[WWHVWGXHGDWHVLWH
ORFDWLRQ&DOLEUDWHGUHVROXWLRQEHWWHUWKDQWKHUHTXLUHGRIIXOOVFDOHDFURVVDOO
UDQJHVDVVSHFL¿HGE\WKH6WDQGDUG)XOO4:(57<NH\ERDUGDQGEDUFRGHUHDGHU
IRULQSXW'XUDEOHSODVWLFDGKHVLYHWHVWODEHOWDJVSULQWHGWRDWWDFKWRDSSOLDQFHV
DQGOHDGVLQFOXGHVXVHU,'ORJRRSWLRQDORQUHTXHVWDQGWHVWEDUFRGH,'VDYHV
WUDQVFULSWLRQ&RPSDWLEOHZLWK6HDZDUG3$7*XDUGSOXVVRIWZDUHSDFNDJH
Ż1(:Ż
752//(<68,7$%/()256(:;(3.,7683(5129$3$7
TESTER
6(:752//(<3.,7
7KLVWUROOH\LVVSHFLDOO\GHVLJQHGIRU6(:;(3.,7DQGYHU\XVHIXOIRU
3RUWDEOH$SSOLDQFH7HVWHU6HDZDUG;(3.,77KLVWUROOH\FRPHVZLWK
WKHIROORZLQJDFFHVVRU\DQGFRQWDLQVIRXUOD\HUVKHOYLQJH[WHQVLRQERDUGZLWK
¿YHVRFNHW9$PSVH[WHQVLRQFDEOHDSSUR[LPDWHO\PHWHUV1RVRI
HODVWLFWLHURSHDQGDSODVWLFELQ%\XVLQJWKLVWUROOH\RQHFDQ¿WDOOWKHUHTXLUHG
LQVWUXPHQWVIRU3RUWDEOH$SSOLDQFH7HVWLQJDQGWKLVZLOOLPSURYHSHUIRUPDQFH
DQGKLJKHUSURGXFWLYLW\
Ż1(:Ż
PRO-TAG Thermal Transfer Printer
3527$*35,17(5
$8
3ULQW GXUDEOH DQG SHUPDQHQW V\QWKHWLF WHVW WDJV RQVLWH GLUHFWO\ IURP \RXU
(XURSD;((XURSD3OXVRU6XSHUQRYD;(DSSOLDQFHVDIHW\WHVWHUV(DV\
WHVWWKHDSSOLDQFHSULQWWKHWDJSHHOLWRIIDQGVWLFNLWRQ$FFRXQWDEOHWKH
3UR7DJV\VWHPVDUHIRROSURRIDQGWDPSHUHYLGHQW7HVWWDJVDUHJHQHUDWHG
GLUHFWIURPWKHWHVWHU¶VWHVWUHVXOWV)DVW&KHDSQRPRUHKDQGZULWLQJ
WHVW WDJV DQG 3UR7DJ WHVW WDJV DUH OHVV WKDQ KDOI WKH SULFH RI YLQ\O WDJV
$FFXUDWHWDJVDUHSULQWHGZLWKDSSOLDQFHQXPEHUDSSOLDQFHEDUFRGHWHVW
GDWHXVHUQDPHDQGWHVWVWDWXVIURPWKHWHVWHU¶VPHPRU\&XVWRPLVH\RX
FDQSHUVRQDOLVHWKHWHVWWDJZLWK\RXURZQFRPSDQ\ORJR
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
47
Power Analysis
Test & Measurement
Power Analysers & Recorders
Model
Type
92/30$
3RZHUTXDOLW\
demand
92/93$6
/(0723$6
/(00(02%2;
6RIWZDUH
3RZHUTXDOLW\
demand
1HWZRUN
SHUIRUPDQFH
DQDO\VHU
'5$%0,3;
8QLYHUVDOSRZHU
TXDOLW\GHPDQG
'5$%0,3;
8QLYHUVDOSRZHU
TXDOLW\GHPDQG
'5$%0,3*
8QLYHUVDOSRZHU
TXDOLW\GHPDQG
5(/
Volt
Inputs
Current
Inputs
Voltage (V)
(Max,rms)
Current (A)
(Max,rms)
Features
Output
N9
$GLUHFW
N$N$&7
+]+DUPRQLFVWK
9HU\KLJKDFFXUDF\
1$7$FHUWL¿HGXQLWDYDLODEOH
'LVSOD\56
PRUH
4
4
N9
6DPSOLQJ0+]
+DUPRQLFVWK
56(WKHUQHW
VRIWZDUH
4
,QWHUKDUPRQLFVa+]
LQVWHSVRI+]
56VHULDOFDEOH
&2'$0SOXVVRIWZDUH
N$
4
4
+,234$
&+.30
3RZHUTXDOLW\
demand
N$N$
9DFGF
N$N$
9DFGF
N$N$
N$
N$
6DPSOLQJ0+]
+DUPRQLFVWK
N$N$
6DPSOLQJN+]7+'
N$N$
6DPSOLQJN+]
+DUPRQLFVWK,3
N$
7+'DQGLQGLYLGXDOWRWKKDUPRQLFV
)OH[LEOH&WV&ODPS&WV
4
&+.30
&+.303OXV
'5$%0,35
'5$%0,35
'5$%0,35$
&7
)OH[LEOH&7
$
8QLYHUVDOFXUUHQWFODPSDFGF
$
8QLYHUVDOFXUUHQWFODPSDFGF
$DF
)OH[LEOH&7´OHQJWK
'5$%0,75
$
,QVWUXPHQW&7+]±N+]
'5$75
$DF
,QVWUXPHQW&7$
&+.&5
&+.&5
&7
.D
&+.&7/
1
&+.&.
0(*3$3/86
3RUWDEOHSRZHU
DQDO\VHU
4
9DF
9GF
N$
8SWRUGKDUPRQLFV7+'
6DPSOHUDWHF\FOH
&XUUHQWYROWDJHVLPXOWDQHRXVO\
aÀH[LEOH&7V
$/*830
3RZHUGHPDQG
DX[
$N$
+DUPRQLFVWK
)RUWKFXUUHQWFKDQQHORI830
$/*830
$/*5(7
$/*&
+,25306
+,25306
0EFRPSDFW
ÀDVKFDUG
3DUDOOHOVRIWZDUH
'LVSOD\HWKHUQHW
56
&RPSDFWÀDVKFDUG
'LVSOD\56
VRIWZDUH
'LVSOD\56
6RIWZDUH
5632:(5YLHZ
VRIWZDUH
0EPHPRU\
4
4
3UHFLVLRQ&7IRU
HDUWKOHDNDJH
3RZHUGHPDQG
0EFRPSDFW
ÀDVKFDUG
1
SKFXUUHQW
FRQYHUWHU
3RZHUTXDOLW\
demand
)OH[LEOH&7
0EFRPSDFW
ÀDVKFDUG
&+.&57/
&+.&.
48
6DPSOLQJ0K]WUDQVLHQW
+DUPRQLFVUG
)OLFNHU3VW3OW
6DPSOLQJ0K]WUDQVLHQW
+DUPRQLFVUG
)OLFNHU3VW3OW
6DPSOHUDWHF\FOHV
+DUPRQLFVUG
)OLFNHU3VW3OW
6DPSOLQJ0+]
+DUPRQLFVUG
9DFGF
$GLUHFW
N$
N$
0ELQWHUQDOPHPRU\
0EFRPSDFWÀDVK
FDUG
+DUPRQLFVWKa+]
'LVSOD\SULQWHU
56VRIWZDUH
P$aN$
4
4
a$
5HPRWHSRZHUPHDVXUHPHQW
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
(WKHUQHW
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
Model
Type
<(:&:
3RZHUGHPDQG
Volt
Inputs
Current
Inputs
Voltage (V)
(Max,rms)
Current (A)
(Max,rms)
Features
Output
$a
$
+]+DUPRQLFVWK
'LVSOD\)''56
RSWLRQDOSULQWHU
GLUHFW
N$&7
DFGFYROWDJHSKDVHDQJOH
'LVSOD\56
3DUDOOHOSULQWHU
+]+DUPRQLFVWK
6DPSOLQJ0+]
&KDUW)''56
9LHZLQJVRIWZDUH
$923(17$3/86'00
%0,
%0,$
SK'00GHPDQG
3RZHU4XDOLW\
4
&7V
9ROWDJHSOXJLQ
BMI,A112
%0,$
&7
%0,$
'5$
'5$75
'5$75
'5$*
3RZHUGHPDQG
&7V
N$
&KDUW
N$
&7
N$
7HUPLQDWLRQ
'5$
'5$
$
3RZHUTXDOLW\
4
SKSOXJLQ
&KDUW
'5$
'5$3$
'5$3$$
'5$3$&
GFSOXJLQ
'5$3$
5)SOXJLQ
'5$3$
1JURXQGSOXJLQ
'5$3$
&XUUHQWSOXJLQ
'5$3$
*UDSKLFVSULQWRXW
1
1
&7
&KDUW
'5$3$$
0(73))
0(70;
0(70;
/(0$1$/<67
+,2
'5$&$)56
'5$&$)(7+(51(7
+DUPRQLFVWK
&XUUHQWORJJHU
SKSRZHU
demand
&ODPSRQ
$PPHWHU
SK3RZHU
'HPDQG
9ROWDJH&XUUHQW
5HFRUGHU
&RPPXQLFDWLRQ
DGDSWRU
&RPPXQLFDWLRQ
DGDSWRU
N9
N$
N9
56VRIWZDUH
N$
'LVSOD\DQDORJXHRXW
$
'LVSOD\
&7
1
1
N$
+DUPRQLFVWK
'LVSOD\56,5
VRIWZDUH
FKDQQHOUHFRUGHUYROWDJHRUFXUUHQW
&KDUW
)LEUHWR56ZLWK1RGHOLQN
VRIWZDUH
)LEUHWR(WKHUQHWZLWK1RGHOLQN
VRIWZDUH
'5$0%)0&
)ODVKFDUG
8OWUDKLJKVSHHG
'5$'90'6
0DWK'ULYHU
6RIWZDUH
3520$*186.9
6WHS8S
7UDQVIRUPHU
1
5HVFXHNLWIRUDQ\FRUUHFWLRQV
±ORJJHGGDWD
3UHSDUHH[FLWDWLRQFXUYHVIRU
LQVWUXPHQWWUDQVIRUPHUGHPDJQHWL]H
&7DQGFRQGXFWWUXQUDWLRWHVWRQ97
$&532:(5:$7&+
'LVWXUEDQFH
/RJJHU
1
+$:
3RZHUGHPDQG
1
9ROWDJHGLVWXUEDQFHUHFRUGHU
56
9
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
(QHUJ\PRQLWRULQJ
TECHRENTALS
49
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
Ż1(:Ż
Ż1(:Ż
Dranetz-BMI Power Xplorer PX5
'5$3;
$81=
0HDVXUHPHQWFDSDELOLWLHVRIWKH'5$%0,3;IHDWXUHVDSSOLFDWLRQVSURYLGHV
WKHIXOOUDQJHRIPHDVXUHPHQWVLQFOXGH9,:9$9$573)'3)'HPDQG
(QHUJ\+DUPRQLFV,QWHUKDUPRQLFV7+'+DUPRQLFVVSHFWUXP9,:WRWKH
UG)OLFNHU3VW3OW&UHVWIDFWRU.IDFWRUWUDQVIRUPHUGHUDWLQJHWF0LQ0D[
$YJYDOXHVDUHGHWHUPLQHGLQòF\FOH506VWHSV$VVHWFRPHVZLWKDFÀH[LEOH
FXUUHQWFODPS'5$%0,55$FXUUHQWUDQJH$DFRQO\&DQ
EHH[WHQGHGWRWKHEHOORZPHQWLRQHGGLIIHUHQWUDQJHVRIPHDVXUHPHQWERWKDF
GFE\VHOHFWLQJDSSURSULDWHFXUUHQWFODPSV7KHIROORZLQJRSWLRQDYDLODEOHZLWK
DGGLWLRQDOUHQWDOFKDUJH
$&ÀH[LEOHFXUUHQWFODPS'5$%0,55$UDQJH$
$&FXUUHQWFODPS'5$%0,75UDQJHa$
$&FXUUHQWFODPS'5$%0,75FXUUHQWUDQJHa$+]aN+]
$&GFFXUUHQWFODPS'5$%0,35UDQJHa$
$&GFFXUUHQWFODPS'5$%0,35UDQJHa$
+LJKVSHHGWUDQVLHQWFDSWXUH0+]VDPSOLQJUDWHDQGWKHIXOOUDQJHRIDULWKPHWLF
YHFWRUDQGVHTXHQFHSDUDPHWHUVWRHYDOXDWHGLVWRUWHGDQGXQEDODQFHGORDGV
DVGH¿QHGLQ,(((([FHHGLQJKLJKORZOLPLWVRIDQ\DFWLYHSDUDPHWHUFDQ
WULJJHUORJJLQJ9ROWDJHDQGFXUUHQWGLVWXUEDQFHVFDQEHWULJJHUHGE\SHDNYDOXH
ZDYHVKDSHFKDQJHDQGF\FOHE\F\FOH506YDOXHFKDQJH3UHHYHQWDQGSRVW
HYHQWZDYHIRUPFDSWXUHF\FOHVDUHXVHUDGMXVWDEOH9ROWDJHDQGFXUUHQWFKDQQHOV
FDQ EH FURVVWULJJHUHG 6XLWDEOH IRU ERWK DFGF SRZHU TXDOLW\ PHDVXUHPHQWV
8QLYHUVDO3RZHU4XDOLW\$QDO\VHUV'5$%0,3;DQDO\VHUVFDQEHXVHGIRU
SRZHUTXDOLW\PHDVXUHPHQWVFXUUHQWLQUXVKF\FOHE\F\FOHFXUUHQWORJJLQJIDXOW
UHFRUGLQJF\FOHE\F\FOHYROWDJHORJJLQJORQJWHUPPRQLWRULQJDQGFRQWLQXRXV
ORJJLQJDWVHFRQGLQWHUYDOV)RXUGLIIHUHQWLDOYROWDJHVDQGFXUUHQWFKDQQHOVFDQ
DOVREHXVHGLQGHSHQGHQWO\'5$%0,3;LV&ODVV$FRPSOLDQWZLWK,(&6WDQGDUG
µ3RZHU4XDOLW\0HDVXUHPHQW0HWKRGV¶DOVR$6'5$6
µ+DUPRQLF,QWHUKDUPRQLF0HDVXUHPHQWV¶DQG$6µ)OLFNHUPHWHU¶
$OOGDWDLVFROOHFWHGDWVDPSOHVF\FOHFKDQQHO
Ż1(:Ż
Dranetz-BMI Power Xplorer PX5-400Hz
'5$3;
$8
6SHFL¿FDLRQDVDERYHEXWZLWK+]FDSDELOLW\VXLWDEOHIRUDYLDWLRQDQGPLOLWDU\
XVH
Dranetz-BMI Power Guide 4400
'5$3*
Ż1(:Ż
'5$1(7=DFGF&XUUHQW&ODPS$
'5$35
$80<
)RUaSK+]+]0RQLWRUVDQGSULQWVOLQHYROWDJHYDULDWLRQVF\FOHE\
F\FOHVDJVDQGVXUJHVDQGLPSXOVHVRIGXUDWLRQa—V$FFXPXODWHVGDWD
LQPHPRU\ZKLOHSURFHVVLQJDQGSULQWLQJGDWD2SWLRQVXQGHURYHUIUHTXHQF\
PRQLWRULQJ
50
$8
$&GFFXUUHQWFODPSSUREH$506PD[FRQGXFWRUVL]HLVPP‘
&XUUHQWFODPSSUREHLVVXLWDEOHIRUDQ\RIQHZ'UDQHW]%0,PRGHOV'5$
%0,3*'5$%0,3;'5$%0,3;&XUUHQWFODPSSUREHLVYHU\
XVHIXOIRUFXUUHQWPHDVXUHPHQWWKURXJK&7FXUUHQWWUDQVIRUPHU&75DWLRFDQ
EHVHOHFWHGRQWKHQHZ'UDQHW]%0,DERYHPHQWLRQHGPRGHOV
Dranetz 606-3 Mains Disturbance Monitor
'5$
$81=
0HDVXUHPHQW FDSDELOLWLHV RI WKH '5$%0,3* IHDWXUHV DSSOLFDWLRQV
SURYLGHV WKH IXOO UDQJH RI PHDVXUHPHQWV LQFOXGH 9 , : 9$ 9$573) '3)
GHPDQGHQHUJ\KDUPRQLFVLQWHUKDUPRQLFV7+'KDUPRQLFVVSHFWUXP9,
:WRWKHUGÀLFNHU3VW3OWFUHVWIDFWRU.IDFWRUWUDQVIRUPHUGHUDWLQJHWF
0LQPD[DYJYDOXHVDUHGHWHUPLQHGLQòF\FOH506VWHSV$VVHWFRPHVZLWKDF
ÀH[LEOHFXUUHQWFODPS'5$%0,55$FXUUHQWUDQJH$DF
RQO\&DQEHH[WHQGHGWRWKHEHORZPHQWLRQHGGLIIHUHQWUDQJHVRIPHDVXUHPHQW
DFGFE\VHOHFWLQJDSSURSULDWHFXUUHQWFODPSV7KHIROORZLQJRSWLRQDYDLODEOHZLWK
DGGLWLRQDOUHQWDOFKDUJH
$& ÀH[LEOH FXUUHQW FODPS '5$%0,55$ UDQJH $ $&
RQO\
$&FXUUHQWFODPS'5$%0,75UDQJHa$
$&FXUUHQWFODPS'5$%0,75UDQJHa$+]aN+]
$&GFFXUUHQWFODPS'5$%0,35UDQJHa$
$&GFFXUUHQWFODPS'5$%0,35UDQJHa$
+DV WKH IXOO UDQJH RI DULWKPHWLF YHFWRU DQG VHTXHQFH SDUDPHWHUV WR HYDOXDWH
GLVWRUWHGDQGXQEDODQFHGORDGVDVGH¿QHGLQ,(((([FHHGLQJKLJKORZ
OLPLWVRIDQ\DFWLYHSDUDPHWHUFDQWULJJHUORJJLQJ9ROWDJHDQGFXUUHQWGLVWXUEDQFHV
FDQ EH WULJJHUHG E\ SHDN YDOXH ZDYHVKDSH FKDQJH DQG F\FOHE\F\FOH 506
YDOXH FKDQJH 3UHHYHQW DQG SRVWHYHQW ZDYHIRUP FDSWXUH F\FOHV DUH XVHU
DGMXVWDEOH 9ROWDJH DQG FXUUHQW FKDQQHOV FDQ EH FURVVWULJJHUHG 6XLWDEOH IRU
ERWK DFGF SRZHU TXDOLW\ PHDVXUHPHQWV8QLYHUVDO 3RZHU 4XDOLW\$QDO\VHUV
'5$%0,3*DQDO\VHUVFDQEHXVHGIRUSRZHUTXDOLW\PHDVXUHPHQWVFXUUHQW
LQUXVK F\FOHE\F\FOH FXUUHQW ORJJLQJ IDXOW UHFRUGLQJ F\FOHE\F\FOH YROWDJH
ORJJLQJ ORQJ WHUP PRQLWRULQJ DQG FRQWLQXRXV ORJJLQJ DW VHF LQWHUYDOV 7KH
IRXUGLIIHUHQWLDOYROWDJHVDQGFXUUHQWFKDQQHOVFDQDOVREHXVHGLQGHSHQGHQWO\
'5$%0,3*LV&ODVV$FRPSOLDQWZLWK,(&6WDQGDUGµ3RZHU
4XDOLW\ 0HDVXUHPHQW 0HWKRGV¶ DOVR$6 '5$6 µ+DUPRQLF
,QWHUKDUPRQLF0HDVXUHPHQWV¶DQG$6µ)OLFNHUPHWHU¶$OOGDWDLV
FROOHFWHGDWVDPSOHVF\FOHFKDQQHO
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
Ż1(:Ż
Ż1(:Ż
Dranetz ac/dc Current Clamp 3 - 1500A RMS
'5$35
$81=
0D[FRQGXFWRUVL]HLVPP‘&XUUHQWFODPSLVVXLWDEOHIRUDQ\RIQHZ'UDQHW]
%0, PRGHOV '5$%0,3* '5$%0,3; '5$%0,3; &XUUHQW
FODPSSUREHLVYHU\XVHIXOIRUFXUUHQWPHDVXUHPHQWWKURXJK&7FXUUHQWWUDQVIRUPHU
&75DWLRFDQEHVHOHFWHGRQWKHQHZ'UDQHW]%0,DERYHPHQWLRQHGPRGHOV
Ż1(:Ż
'5$%0,&$)(7+(51(7
$8
&RPPXQLFDWLRQV$GDSWHU)LEUHWR(WKHUQHWZLWK1RGH/LQN6RIWZDUHDQG0R[D
1HWZRUNLQJ6RIWZDUHIRUWKHIROORZLQJ'UDQHW]%0,0RGHOV'5$%0,3;'5$
%0,3;'5$%0,3*
Ż1(:Ż
Dranetz Flexible Current Clamp 60/600/6,000A
'5$35$
'UDQHW]&RPPXQLFDWLRQV$GDSWHU)LEUHWR(WKHUQHWZLWK1RGH/LQN
6:
'UDQ9LHZ0DWK'ULYHU6RIWZDUH$GG21
$8
6HWRIÀH[LEOHFXUUHQWFODPSV$506PD[FRQGXFWRUVL]HOHQJWK
RIFODPSLV´&XUUHQWFODPSVDUHVXLWDEOHIRUDQ\RIQHZ'UDQHW]%0,0RGHOV
'5$%0,3*'5$%0,3;'5$%0,3;&XUUHQWFODPSSUREHLV
YHU\XVHIXOIRUFXUUHQWPHDVXUHPHQWWKURXJK&7FXUUHQWWUDQVIRUPHU&75DWLR
FDQEHVHOHFWHGRQWKHQHZ'UDQHW]%0,DERYHPHQWLRQHGPRGHOV
'5$%0,'90'6
$8
,QHVVHQWLDODUHDVWKH0DWK3DFNDJHZLOOLPSURYHPHDVXUHPHQWV
5HVFXH.LW(YHUKRRNHGXSDSUREHWKHZURQJZD\"0D\EHIRUJRWWHQWRFKHFN
LI WKH DFWXDO WLPH LQ \RXU LQVWUXPHQW LV UXQQLQJ FRUUHFWO\" 2U FRXOG \RX KDYH
SRVVLEO\IRUJRWWHQWRVHWWKHFRUUHFW.IDFWRUV"7KH0DWK3DFNDJHKHOSV\RXWR
FRUUHFWWKHVHHUURUVUHFDOFXODWHSDUDPHWHUVIURPDYDLODEOHZDYHIRUPGDWDLQYHUW
ZDYHIRUPVDQGPXFKPRUH
,PSURYH0HDVXUHPHQWV5HSRUWV&DOFXODWHDGGLWLRQDOSDUDPHWHUVIRU\RXU0XOWL
'$47$6.&DUGIDXOWUHFRUGHULQUXVKPRGHPHDVXUHPHQWVZLWKWKHPDWKGULYHU
WKHIROORZLQJDGGLWLRQDOWUHQGVZLOOEHFUHDWHGIRU0XOWL'$4GDWD¿OHV9UPV:DWWV
9$5¶V9$7UXH3)9WKGIXQGDPHQWDO,WKGDEVFXUUHQW9ROWDJH)UHTXHQF\
IRULQWHUQDOWULJJDQG1HW7RWDOV9UPV$PSV:9$59$
*HQHUDWH0RUHSDUDPHWHUVIURPZDYHIRUPGDWD6KRZLQJ'LVSODFHPHQW3RZHU
)DFWRU '3) LQVWHDG RI .IDFWRU 5HQDPH LQSXWV (QHUJ\ 212)) SHDN
FDOFXODWLRQV0DWKHPDWLFDOH[SUHVVLRQVDQGIRUPXODVFDQEHXVHGWRSORWDGGLWLRQDO
XVHUGH¿QHGFKDQQHOVZLWKLQERWKWKHWLPHSORWFKDUWDQGWKHZDYHIRUPFKDUW
$GYDQFHDQDO\VLVZDWWKDUPRQLFVV\PPHWULFDOFRPSRQHQWVHWF
Dranetz 646-3 Disturbance Recorder
'5$
Ż1(:Ż
Dranetz Current Clamp 1 - 30A 48Hz~10kHz
'5$75
$8
6HWRIFXUUHQWFODPSVa$506+]aN+]0D[FRQGXFWRUVL]H´
'HVFULSWLRQDVIRU'5$35$FXUUHQWFODPSVDERYH
$8
$FFHSWVXSWRDFOLQHLQSXWVa9QHXWUDOWRJURXQGLQSXWa9GF
YROWDJHLQSXWa90RQLWRUVDQGUHFRUGVLPSXOVHVVDJVVXUJHVXQGHUDQG
RYHUYROWDJHVDQGIUHTXHQF\YDULDWLRQVRQaSKDFa+],PSXOVHGXUDWLRQ
a—V
Dranetz 626 Power Disturbance Monitor
'5$
$8
)RUXVHZLWKXSWR[3$VHULHVSOXJLQV0RQLWRUVVDJVVXUJHVLPSXOVHVDQG
FKDQJHVLQIUHTXHQF\
Dranetz PA6003-1 3Ph Plug-in for 626
'5$3$
$80<
a9DFLQSXWa+]
Dranetz PA6002-A1 dc Plug-in for 626
Ż1(:Ż
'5$3$$
Dranetz Current Clamp Probe 0~10A RMS
'5$%0,75
$8
6HWRIFXUUHQWFODPSVa$5060D[FRQGXFWRUVL]H´'HVFULSWLRQDV
IRU'5$35$FXUUHQWFODPSVDERYH
Ż1(:Ż
Dranetz PA6002-C1 Hi Level dc Module for 626
'5$3$&
$8
+LOHYHOGFPRQLWRULQJPRGXOH5DQJHa9GF6HQVLWLYLW\a9GFLPSXOVH
aN9GF
Dranetz PA6020 RF Disturbance Monitor for 626
Dranetz-BMI, 128 MB Flash Memory Card (Industrial Grade)
'5$0%)0&
$8
a96LQJOHFKDQQHO0ŸLQSXW
$81=
6XLWDEOHIRUWKHIROORZLQJ'UDQHW]%0,0RGHOV'5$%0,3;'5$%0,3;
'5$%0,3*
'5$3$
$8
%URDGEDQGGHWHFWLRQIURP0+]a*+]RI5)LPSXOVHVGRZQWR—V$QWHQQD
LQFOXGHGZLWKPFDEOH
'UDQHW]3$1HXWUDO*URXQG0RQLWRUIRU
'5$3$
$8
0RQLWRUVDQGUHFRUGVGLVWXUEDQFHVEHWZHHQQHXWUDODQGJURXQG5DQJHVa9
DF,PSXOVHUDQJHWRN9
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
51
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
Dranetz PA6005 Current Monitor for 626
'5$3$
Voltech PM3000A 3 Phase Power Analyser
$8
7KUHH5DQJHV$SKDVH
ACR Voltage Disturbance Logger
$&532:(5:$7&+
1=
6LQJOHSKDVH9GLVWXUEDQFHORJJHU3OXJVLQWRDVWDQGDUG9SLQSRZHU
SRLQW 6WRUHV XS WR HYHQWV VXFK DV VDJV VXUJHV RXWDJHV LPSXOVHV IUHTXHQF\ YDULDWLRQV 6XSSOLHG ZLWK VRIWZDUH VHULDO FDEOH IRU SURJUDPLQJ
XSORDGLQJDQGSULQWLQJUHVXOWV
BMI 8800 Power Disturbance Analyser
%0,
$8
(LJKWLQSXWVJLYLQJVLPXOWDQHRXVYROWDJHDQGFXUUHQWRSWLRQDOSUREHVUHTXLUHG
PRQLWRULQJ RI XS WR FKDQQHOV HDFK )'' LQFOXGHG (DFK GLVF VWRUHV GLVWXUEDQFHVIRUWUDQVIHUWRWKHLQWHUQDOJUDSKLFVSULQWHU+DUPRQLFVPHDVXUHPHQW
RSWLRQLQFOXGHGIRUXSWRWKHWKKDUPRQLFRI+]0D[LQSXWYROWDJH9UPV
RUGF(LJKWH[WUDFKDQQHOVLQFOXGHGIRUVHQVRURXWSXWVHWF2SHUDWHVIURPDF
PDLQVRUa9GF,QEXLOW836
$8
)RU %0, 8VHV SUREH FKDQQHOV WR LQFUHDVH WKH QXPEHU RI YROWDJH
LQSXWV WKDW FDQ EH PRQLWRUHG 5DQJHV a9 UPV a9 GF ,PSXOVHV
9aN9SHDN
BMI A112 Current Probe for BMI 8800
%0,$
$8
)RU%0,0HDVXUHVFXUUHQWZDYHIRUPVWR$DQGDOORZVJUDSKLF
UHSUHVHQWDWLRQRQ%0,SULQWRXW-DZRSHQLQJPP7UXHUPVPHDVXUHPHQWV
IRUPRWRUVWDUWXSFXUUHQWVXUJHVHWF5DQJHFDQEHH[WHQGHGWRN$E\XVLQJ
'5$75LQVHFRQGDU\ORRSFRQ¿JXUDWLRQ
BMI A116 600 Amp Clamp-on Probe for 8800
%0,$
$8
$SHUWXUHPP‘%DQGZLGWKN+]
BMI A120 3000 A Clamp-on Probe for 8800
%0,$
$8
$SHUWXUH[PP%DQGZLGWKN+]
0HWURVRQLFV3))2YHUKHDG3URÀOHU
0(73))
$8
&DSDEOHRIPDNLQJPHDVXUHPHQWVRIDOOVWDQGDUGHOHFWULFDOFKDUDFWHULVWLFVRI
SKDVHVXSSOLHV0HDVXUHVLQUXVKFXUUHQWDQGFUHVWIDFWRUORDGLPSHGDQFH
DQGKDUPRQLFDQDO\VLVHQHUJ\DQGPD[GHPDQGH[WHQGDEOHXVLQJFXUUHQWDQG
SRWHQWLDOWUDQVIRUPHUV)UHTXHQF\UDQJHGFaN+]3DUDPHWHUV:9$9DU
9$3)SHDNYROWDJHDQGFXUUHQWFUHVWIDFWRULPSHGDQFHSHDNLQUXVKFXUUHQW
YROWDJH DQG FXUUHQW KDUPRQLFV WK RUGHU 7+' +] :K 9$K 9DUK$PSK
DYHUDJHSI,QSXWFRXSOLQJPD\EHDFRUDFGF2XWSXWVSULQWHUUHFRUGHUV
DQGRVFLOORVFRSHV,(((56&DQGFHQWURQLFVLQWHUIDFHVDQGZDYHIRUPRXWSXW
GHULYHGIURPFXUUHQWDQGYROWDJHLQSXWVDUHLQFOXGHG$FFXUDF\9$
SRZHU,QSXWUDQJHVYROWDJH9aN9UPVFXUUHQWa$UPV$
SHDN$FFHVVRULHV[N$FODPSRQ&7VDQG[SUHFLVLRQ$N$GXDOUDQJH
FXUUHQWWUDQVIRUPHUVQRWFODPSRQ
9ROWHFK30$ZLWK1$7$&DOLEUDWLRQ
92/30$1$7$
$8
6SHFL¿FDWLRQVDVDERYHEXWZLWK1$7$FDOLEUDWLRQ
LEM Analyst 2060 Hand-held 1 Phase Clamp-on Power Meter Analyser
BMI A-111 ac/dc Voltage Impulse Probe
%0,$
92/30$
$8
'LVWULEXWLRQOLQHSUR¿OHUVIRUFXUUHQWPHDVXUHPHQWRQSRZHUOLQHV/RJVFXUUHQW
FRQVXPSWLRQ WR LQWHUQDO PHPRU\ 6HW RI SUR¿OHUV ZLWK RQH GLVSOD\ PRGXOH
:LQGRZVVRIWZDUHLQFOXGHG&XUUHQWUDQJHa$5HVROXWLRQ$$FFXUDF\
“$&RQGXFWRUYROWDJHWRN9QRPLQDO6DPSOHUDWHVaPLQ0HPRU\
NUHDGLQJV'DWDVWRUDJHPRGHVVWRSZKHQIXOORUZUDSDURXQG'DWDUHWHQWLRQ
DIWHUORZEDWWHU\VKXWGRZQG0LQFRQGXFWRUVSDFLQJPP
/(0$1$/<67
$8
0HDVXUHUHFRUGDQGORJ:9$9$5N:KDQGSRZHUIDFWRU&XUUHQWWRN$
DXWRUDQJLQJDFRUGF3HDN&UHVW)DFWRU7+'')DQGIUHTXHQF\IRUYROWDJH
a9DQGFXUUHQW+DUPRQLFVWRWKHWKRUGHU7LPHEDVHLVVHOHFWDEOHIURP
PVGLYaPVGLY/DUJHEDFNOLWPXOWLSDUDPHWHUGLVSOD\ZLWKRVFLOORVFRSHDQG
FKDUWPRGHV0HPRU\VL]HVFUHHQVVPDUWVDYHDQGXSWRUHDGLQJV
-DZRSHQLQJFDSDFLW\PP‘7\SLFDOEDWWHU\[$$DONDOLQHOLIHKZLWKRXW
EDFNOLJKW
/(07RSDV3RZHU1HWZRUN$QDO\VHU
/(0723$6
$8
0HDVXUHVDOOUHOHYDQWSDUDPHWHUVLQRQHPHDVXUHPHQWV\VWHP,QSXWVLVRODWHG
YROWDJHFKDQQHOVP9aN9FXUUHQWFKDQQHOVVXSSOLHGZLWK[a$
a$DFFODPSRQ&7VDQG[XQLWSRZHUHGaN$/(0)OH[FXUUHQWVHQVRUV
&DQEHFRQ¿JXUHGIRUYROWDJHFKDQQHOV0HDVXULQJIXQFWLRQVUPV98YROWDJH
LPEDODQFHSRVLWLYHQHJDWLYH]HURSKDVHVHTXHQFHSKDVRUYHFWRUGLDJUDPV
DPSV,DSIN9$N9$UI+]HQHUJ\RQOLQHRVFLOORVFRSHSRZHUDQGPXOWLPHWHU
KDUPRQLFV E\ SRZHUGLUHFWLRQ PDJQLWXGH SKDVH LQWHUKDUPRQLFV 7+'
ÀLFNHUWUDQVLHQWVN+]a0+]ZLOOFDSWXUHHYHQWVIURP—VLQGXUDWLRQ
6RIWZDUHFRQ¿JXUHGPDQXDORUDXWRWULJJHUOHYHOVHWKHUQHWRUVHULDOLQWHUIDFH
PHPRU\!0E+''
Hawk 5000 3 Phase Power Demand Logger
+$:
1=
7KUHH SKDVH Z\H SRZHU GHPDQG ORJJHU 5HFRUGV N9$ N: 9 , )UHT 3)
8SORDGVGDWDWRD3&IRUJUDSKLQJDQGSULQWLQJ6XSSOLHGZLWKVRIWZDUHDQG[
N$FODPSV
Dranetz 808 Power Demand Analyser
'5$
$8
'LVSOD\VDQGSULQWVRQLQEXLOWSULQWHU9$3)N:N:KN9$N9$5GHPDQG
WLPHDQGGDWHIRUVLQJOHDQGWKUHHSKDVHV\VWHPV)RUXVHZLWK'5$*
WHUPLQDWLRQVRU75VHULHVFODPSRQFXUUHQWWUDQVIRUPHUV
Dranetz TR2013 Clamp-on Current Transformer
'5$75
$8
)RU'5$VZLWFKVHOHFWDEOHUDQJHVa$$aN$UPV
Dranetz TR2015 Clamp-on Current Transformer
'5$75
)RU'5$5DQJHVN$5HTXLUHV'5$*WHUPLQDWLRQ
52
$81=
L(00HPRER[1HWZRUN3HUIRUPDQFH$QDO\VHU
/(00(02%2;
$8
&RPSDFWOLJKWZHLJKWNJ,3ZHDWKHUSURRI3KDVH3RZHU$QDO\]HU+LJK
DFFXUDF\WR&ODVV$,(&6XLWDEOHIRU+]RU+]V\VWHPV/(0ÀH[
ÀH[LEOHFXUUHQWSUREHVZLWKUDQJHV$VXLWDEOHIRUFRQGXFWRUV
XSWRPP‘9ROWDJHUDQJHVIURPa9RQRUZLUHV\VWHPV0HDVXUHV
9$N:N9$N9$5N:+U3)+]FUHVWIDFWRUGLVWRUWLRQSRZHU7+'LQGLYLGXDO
KDUPRQLFVRIYROWVFXUUHQWXSWRWKKDUPRQLFÀLFNHUDQGULSSOHFRQWUROVLJQDO
OHYHOV3RZHUPHDVXUHPHQWVE\HLWKHURUZDWWPHWHUPHWKRG3RZHUVXSSO\
a9HLWKHUIURPPHDVXUHPHQWOHDGVRUVHSDUDWHVXSSO\0HPRU\VL]H0E
ZLWK VDPSOLQJ LQWHUYDOV 6DPSOLQJ LQWHUYDOV VHOHFWDEOH IURP VaPLQ
6DPSOHLQWHUYDORIPLQUHFRUGVIRU!'D\V/LQHDURUFLUFXODURYHUZULWHVHDUOLHVW
GDWDRQFHIXOOPHPRU\5HFRUGVDYHUDJHPVPLQPVPD[LQHDFKLQWHUYDO
&DSWXUHVPRWRUVWDUWFXUUHQWVSLNHVZLWKFRUUHVSRQGLQJYROWDJHGLSV&DSWXUHV
XSWRYROWDJHVDJVXUJHHYHQWVPVRUORQJHU
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
LEM Elmes 693 3Ph Power Logger
/(0
Megger PA9Plus Portable Power Quality & Demand Analyser
1=
7KUHHSKDVHSRZHUYROWDJHFXUUHQWDQG3)ORJJHU7UXH5069$9$U3)9ROWV
$IUHTXHQF\6DPSOLQJUDWHLVV6WDWLVWLFDOPHDVXUHPHQWLQWHUYDOFDQEHVHW
IURP aPLQ 6XSSOLHG ZLWK ÀH[LEOH N$ 5RGRZVNL &7V $ FOLSRQ &7V DQG
VRIWZDUHIRUSURJUDPPLQJDQGXSORDGLQJUHVXOWV$FFXUDF\DFWLYHSRZHU“
UHDFWLYHSRZHU“SKDVHDQJOH“YROWDJH“
Reliable Power Systems 1600 Analyser
5(/
$8
3RZHUDQDO\VHUIRUSDUDPHWHUGHPDQGDQGGLVWXUEDQFHPHDVXUHPHQWDQGORQJ
WHUPPRQLWRULQJ3&UHTXLUHGIRUGRZQORDGQRRQERDUGGLVSOD\&RPSOHWHZLWK
N$&7¶V$&7¶V9,VDPSOHGDWN+]PLQPD[YDOXHVKDYHF\FOHUHVSRQVH
,PSXOVHVVDPSOHGDW0+]VRIWZDUHVHOHFWDEOH0D[LQSXWYROWDJH9UPV
1RWHERRN3&ZLWK:LQDQG2I¿FHLQFOXGHG$OWHUQDWLYH3&UHTXLUHPHQWV
3HQWLXP0E5$00EKDUGGLVFVSDFH:LQRU17RSHUDWLQJV\VWHP
DQG2I¿FHIRUUHSRUWJHQHUDWLRQ
Algodue UPM6001 Power/Demand Analyser
$/*830
$8
,QFOXGHV[N$FOLSRQFXUUHQWWUDQVIRUPHUV,QWHJUDOGLJLWDOGLVSOD\DQGSULQWHU
0HPRU\NESOXV56LQWHUIDFHIRUGDWDWUDQVIHU0HDVXUHVHDFKSKDVH
DQGWRWDO9$SRZHU3)9$9$50HDVXUHVGHPDQGRYHUDGH¿QHGLQWHUYDO
KDUPRQLFGLVWRUWLRQDQGSURYLGHV))7DQDO\VLV5HFRUGVPD[LPDDQGPLQLPD
&XUUHQW LQSXWV DUH DW 9 RU $ IRU H[WHUQDO &7¶V 9ROWDJH GURS GHWHFWLRQ IRU
GXUDWLRQVH[FHHGLQJPV6RIWZDUHSURYLGHVWLPHSORWVDQGUHPRWHGLVSOD\
RIPHDVXUHPHQWSDUDPHWHUV+LJKHUVSHHG))7KDUPRQLFSORWSRVVLEOHXSWR
WKKDUPRQLF
Algodue UPM6100 Uni Power Meter 500Hz & Rogowsky 3kA Options
$/*830
$8
3RZHUPHWHUN$5RJRZVNLFXUUHQWWUDQVGXFHUÀH[LEOH&7Va+]KDUPRQLF
GLVWRUWLRQFXUUHQWDQGYROWDJHWKRUGHU/DUJH0EPHPRU\
Algodue Ret Set of 3 Rogowski Transducer
$/*5(7
)RUXVHZLWKWKH$/*8305DQJHV$N$3RZHUHGIURPDQDO\VHU
Hioki 3196 3 Phase Power Quality Analyser
+,234$
$8
+LJKVSHHG—V0+]¿HOGXQLW&KDQQHOVYROWDJHa9UPVUDQJHV
LVRODWHGFXUUHQWaN$SKDQGQHXWUDOUPVUDQJHV6XSSOLHGZLWK[N$
ÀH[LEOHFODPSRQ&7VOHQJWKPP0HPRU\0ELQWHUQDO0EFRPSDFW
ÀDVKFDUG'LVSOD\LQWHUQDOKLJKUHVROXWLRQFRORXU/&'5HFRUGV9$SII+]
N9$N9$UN:KDUPRQLFV7+'DQGLQGLYLGXDOWRWKRUGHUÀLFNHU,(&
7RWDOHQHUJ\WDULIIVPD[GHPDQGVWUDQVLHQWDQGVXEF\FOHGLVWXUEDQFHV6RIWZDUH
SURYLGHVJUDSKVDQGVXPPDULHVWR3&,QWHUIDFHV56DQGEDVHHWKHUQHW
0(*3$3/86
$8
,QWHJUDO JUDSKLF EDFNOLW /&' DQG FRPSDFW ÀDVK FDUG PHPRU\ 0HDVXUHV DQG
UHFRUGV DOO YROWDJHFXUUHQW SRZHU DQG ZDYHIRUP DFWLYLW\ ,QSXW YROWDJH GLIIHUHQWLDOFKDQQHOVDXWRUDQJLQJEHWZHHQaa9DF9GFVFDOHV
DFFXUDF\“RIUHDGLQJ“RIUDQJHWRWKHUGKDUPRQLF&UHVWIDFWRU
YROWDJHOLPLWHGWRN9SHDN&XUUHQWRIIXOOVFDOHDWSHDNLQSXW&XUUHQW
FKDQQHOVUHVROXWLRQIVDFFXUDF\“RIUHDGLQJ“RIUDQJH
WR WKH UG KDUPRQLF )UHTXHQF\ IXQGDPHQWDO +] UHVSRQVH GF WR N+]
UGKDUPRQLF5HVROXWLRQ+]6DPSOHUDWHF\FOHFXUUHQWDQGYROWDJH
VLPXOWDQHRXVO\+DUPRQLFGLVWRUWLRQFXUUHQWDQGYROWDJHWRWKHUGRUGHUDQG
7+'3RZHUVXSSO\a9DF+]a9GFHLWKHUYLDFKDQQHORUIURP
LQGHSHQGHQW,(&OHDG0HPRU\0ELQWHUQDO0EFRPSDFWÀDVKFDUG&XUUHQW
VHQVRUV[a$5RJRZVNLÀH[LEOH5HSRUWJHQHUDWLRQVRIWZDUHLQFOXGHG
6HWXSDQGGRZQORDGFDQEHGRQHWKURXJK56RUÀDVKFDUG
CHK PM20 Power Quality Analyser/Logger
&+.30
$8
7KUHH SKDVH ZHDWKHUSURRI ,3 ¿HOG XQLW 7KUHH YROWDJH FKDQQHOV a9
LVRODWHG)RXUFXUUHQWFKDQQHOVaN$UPVSKQHXWUDO6XSSOLHGZLWK[
N$FODPSRQ&7VFDEOHFDSDFLW\PPN$IRUODUJHFRQGXFWRUVDQG$IRU
QHXWUDOVFODPSRQ&7VDUHDYDLODEOH0HPRU\0E,QEXLOWOLQH/&'GLVSOD\
5HFRUGV9$SII+]N:N9$N9$U7+'WRWDOHQHUJ\DQGWDULIIVKLJKVSHHG
UPVZDYHIRUPFDSWXUHHYHQWVRXWVLGHSUHVHWOLPLWVPVLQWHUYDOV6RIWZDUH
SURYLGHVJUDSKVDQGVXPPDULHVWR3&'RZQORDG¿OHVZKLOHORJJLQJ56
LQWHUIDFH3&XVLQJ:LQRU1726LVUHTXLUHGZLWKWKH&+.32:(5YLHZ
VRIWZDUHWRFRQ¿JXUHWKLVXQLWEHIRUHRSHUDWLQJ
GridSense CHK PM30 Plus 3 Phase Powermonic Logger/Logger
&+.303/86
$8
:HDWKHUSURRI,3¿HOGXQLW&KDQQHOVYROWDJH9LVRODWHGFXUUHQW
WRN$SKQHXWUDOUPV6XSSOLHGZLWK[ÀH[LEOHN$FODPSRQ&7VÀH[LEOH
&7OHQJWKPPPP‘&ODPSRQ&7VRIN$N$IRUODUJHFRQGXFWRUV
DQG $ $ IRU QHXWUDO FRQGXFWRU FXUUHQW PHDVXUHPHQW DUH DYDLODEOH
0HPRU\0E,QEXLOWOLQH/&'GLVSOD\5HFRUGV9$SII+]N9$N9$UN:
KDUPRQLFV7+'DQGLQGLYLGXDOWRWK7RWDOHQHUJ\WDULIIVPD[LPXPGHPDQGV
WUDQVLHQWDQGVXEF\FOHGLVWXUEDQFHV6RIWZDUHSURYLGHVJUDSKVDQGVXPPDULHV
WR3&'RZQORDG¿OHVZKLOHORJJLQJYLD56LQWHUIDFH3&XVLQJ:LQ
17;326LVUHTXLUHGZLWKWKH&+.32:(5YLHZVRIWZDUHWRFRQ¿JXUH
WKLVXQLWEHIRUHRSHUDWLQJ
Hioki 9694 Clamp-on CT 5A
+,2&7$
$8
5DWHG SULPDU\ FXUUHQW $ DF $PSOLWXGH DFFXUDF\ “ UGJ “ IV DW
a+]+]aN+]“RUOHVV0D[FLUFXLWYROWDJH9UPVLQVXODWHGZLUH
&RUHMDZPP‘6L]HZîGîKPPFRUGOHQJWKP
Hioki Clamp-on 100A ac CT
+,2&7$
$8
5DWHG SULPDU\ FXUUHQW $ DF $PSOLWXGH DFFXUDF\ “ UGJ “IV DW
a+]+]aN+]“RUOHVV0D[FLUFXLWYROWDJH9UPVLQVXODWHGZLUH
&RUHMDZPP‘6L]HZ[G[KPPFRUGOHQJWKP
Fluke 43 Power Quality Analyser
)/8
1=
6LQJOH SKDVH SRZHU TXDOLW\ DQDO\]HU &RPELQDWLRQ SRZHU TXDOLW\ DQDO\]HU
PXOWLPHWHUDQGVFRSH6FRSHGLVSOD\VYROWDJHDQGFXUUHQWZDYHIRUPV0HDVXUHV
WUXHUPVYROWDJHFXUUHQWDQGIUHTXHQF\0HDVXUHVYROWDJHFXUUHQWDQGSRZHU
KDUPRQLFVXSWRVWKDUPRQLF7RWDOKDUPRQLFGLVWRUWLRQ7+'3KDVHDQJOHRI
LQGLYLGXDOKDUPRQLFV&RQWLQXRXVO\PHDVXUHYROWVDQGDPSVRQDF\FOHE\F\FOH
EDVLVIRUXSWRK8VHFXUVRUVWRUHDGWLPHDQGGDWHRIVDJVDQGVZHOOV6XSSOLHG
ZLWK$FXUUHQWSUREHVRIWZDUHDQGFDEOH
Fluke 43B 1 Phase Power Quality Analyser
)/8%
1=
&RPELQHVWKHFDSDELOLWLHVRIDSRZHUTXDOLW\DQDO\VHUVFRSHDQGPXOWLPHWHULQ
DVLQJOHHDV\WRXVHLQVWUXPHQW(1&$7,,98/DQG&6$OLVWHG
5HFRUGLQJWLPHVPLQaGVHOHFWDEOH
CHK PM30 3 Phase Powermonic Power Logger
&+.30
$81=
:HDWKHUSURRI,3¿HOGXQLW&KDQQHOVYROWDJHa9LVRODWHGFXUUHQW
aN$SKQHXWUDOUPV6XSSOLHGZLWK[N$FODPSRQ&7VFDEOHFDSDFLW\
PP&ODPSRQ&7VRIN$N$IRUODUJHFRQGXFWRUVDQG$$IRU
QHXWUDOFRQGXFWRUFXUUHQWPHDVXUHPHQWDUHDYDLODEOH0HPRU\0E,QEXLOWOLQH
/&'GLVSOD\5HFRUGV9$SII+]N9$N9$UN:KDUPRQLFV7+'DQGLQGLYLGXDO
WRWK7RWDOHQHUJ\WDULIIVPD[GHPDQGVWUDQVLHQWDQGVXEF\FOHGLVWXUEDQFHV
6RIWZDUHSURYLGHVJUDSKVDQGVXPPDULHVWR3&'RZQORDG¿OHVZKLOHORJJLQJYLD
56LQWHUIDFH3&XVLQJ:LQ17;326LVUHTXLUHGZLWKWKH
&+.32:(5YLHZVRIWZDUHWRFRQ¿JXUHWKLVXQLWEHIRUHRSHUDWLQJ
CHK 3 Phase Converter for CTs 1A Input to 200mA Output
&+.&.
$8
$GDSWRUIRU&7VZLWK$VHFRQGDU\RXWSXWVWKLVXQLWKDVDP$RXWSXWWRVXLW
&+.30
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
53
Power Analysis
Test & Measurement
PowerMonic Power Quality Analysers
Designed and Manufactured for Australia
x
x
x
x
WEATHERPROOF & RUGGED
PORTABLE & FIXED INSTALLATIONS
REMOTE DATA COMMUNICATION
EASY TO USE POWERFUL SOFTWARE
x
Tables & graphs of 3 phase V, A, pf,
dpf, kW, kVA, kVAr, THD, Harmonic
Phase Angle, Individual harmonics up
to 48th, frequency, total energy & tariffs
x
Motor
starts-high
disturbance capture
x
Transients -high speed
disturbance capture
speed
RMS
Waveform
Try our PowerView Demo analysis software at
http://www.gridsense.net/bin/gsn-pvdemo-351.exe
For more information please contact
CHK GRIDSENSE PTY LTD
Tel: +61 (0)2 8 8 7 8 7 7 0 0
Fax: + 6 1 ( 0 ) 2 8 8 7 8 7 7 8 8
Email: [email protected]
Website: www.gridsense.net
Power Analysers & Recorders (cont’d)
0HWUL[0;DFGF&OLSRQ3RZHU0HWHU
Ż1(:Ż
MET,MX200
External modem 56k for CHK PM20, CHK PM30, CHK PM30PLUS or any other
power quality analyzer. Modem gives remote access control to set-up/download
any connected Instrument.
&+.3KDVH&RQYHUWHUIRU&7V$,QSXWWRP$2XWSXW
0HWUL[0;DFGF&ODPSRQ0HWHU
CHK,MODEM-56K
CHK,CK5
AU
AU
Adaptor for CTs with 5A secondary outputs, unit has a 200mA output to suit
CHK,PM30/20
&+.&5&ODPSRQ&7
CHK,CR100
AU
Jaws 43mmØ inside. Use with CHK,PM20 or PM30 for use as fourth CT to measure
neutral current. Accuracy Class 1.
&+.&5&ODPSRQ&7
CHK,CR500
AU
Jaws 43mmØ inside. Use with CHK,PM20 or PM30 for use as fourth CT to measure
neutral current. Accuracy Class 1.
&+.&7//DUJHN$3ULPDU\&ODPSRQ&7
CHK,CT1000L
Large 123 x 35mm 1kA primary clamp-on CT for CHK,PM20/30.
*ULGVHQVH$PSV)OH[&7PP
CHK,CT3000 PLUS
&+.&7//DUJHN$3ULPDU\&ODPSRQ&7
CHK,CT3000L
Large 123 x 35mm 3kA primary clamp-on CT for CHK,PM20/30.
54
AU/MY
Ranges 19.99 & 199.9A. Measures voltage to 750V, frequency to 999Hz, power
1.99 & 19.99kW, apparent power 1.99 & 19.99kVA, & pf. Recorder output via
special leads (supplied) for current range only, 5mV/A on 199.9A range. Switch
in battery compartment gives ac as well as dc output. Internal battery for 70h
operation. Clamp capacity 23mmØ or 20 x 10mm bars.
([WHUQDO0RGHPN5HPRWH&RPPXQLFDWLRQIRU&+.3034$
AU
AU
MET,MX2040
AU/NZ
Measures A, V, Hz, kW, kVA, kVAR, kWH, PF and resistance. Ranges 200A
& 2kA, 600V & 1kV, 20, 200kW & 2MW & kWH. Scale length 3,000. 1 & 3ph
operation. Motor rotation indication. Peak, min, max, average, rms, and crest
IDFWRULQGLFDWLRQ3HDNUHVSRQVHWLPH—V$QDORJXHRXWSXWRSWLRQ¿WWHGJLYLQJ
dynamic signals and calculated parameters (energy, etc).
Ż1(:Ż
0DUWLQGDOH3KDVH6HTXHQFH&RQWLQXLW\,QGLFDWRUa9+]
MAR,PSCI424-585
AU
Tester may be used, on 3ph circuits, to check the presence & sequence of the
phases. Important on motor circuits as a phase reversal will cause a motors
direction to reverse. Tester will give visual indication of loss of phase or an
incorrect sequence. Tester is supplied in 2 forms - Probe style, the connection
to the tester is via 3 insulated cables to 3 fused test probes, 1 with an insulated
FURFRGLOHFOLS3OXJVW\OHD$SLQSKHDUWK%6SOXJLV¿WWHGWRWKH
tester. Use as a socket tester prior to plugging in 3ph equipment. Testers supplied
in a plastic wallet, with full instructions. Caution, the unit should be checked for
correct operation using a known voltage before use.
AU
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Power Analysers & Recorders (cont’d)
<RNRJDZD&:'HPDQG+DUPRQLFV$QDO\VHU
<(:&:
$81=
,QFOXGHV [ $ FOLS RQ FXUUHQW WUDQVIRUPHUV MDZV PP‘ LQVLGH &XUUHQW
WUDQVIRUPHUVDUHDFFXUDWHDWFXUUHQWVRI$)RUFXUUHQWDSSOLFDWLRQVLQH[FHVV
RI$XVH'5$7575&7+DVZLULQJFKHFNPDSVSRZHU9$5+]
9$3):RUNVDWIUHTXHQFLHVIURP+]aN+]+DUPRQLFVWRWKRUGHU(OHFWULF
HQHUJ\PRGHWRPHDVXUH:K9DUK0RQLWRUDQGFRPSDUHVHSDUDWHORDGV(YHQW
DQGH[WHUQDOWULJJHULQSXWVDQG'$RXWSXWV3RUWDEOHEDWWHU\SRZHUHGZLWKODUJH
/&'VFUHHQDQGVRIWNH\VIRURSHUDWLRQ6XSSOLHGZLWK5LRQ&3SULQWHU
Ż1(:Ż
Programma Magnus 2.2kV Step Up Transformer for Testing CT’s
3520$*186.9
$8
8VH LQ KLJKYROWDJH VXEVWDWLRQV DQG LQGXVWULDO HQYLURQPHQWV 3URWHFWHG ZLWK
WKHUPDOFXWRXWVPDLQVYROWDJH9DF“a+]SRZHUFRQVXPSWLRQLV
N9$0DLQO\XVHGIRUSUHSDULQJH[FLWDWLRQFXUYHVIRULQVWUXPHQWWUDQVIRUPHUV
DQGIRUGHPDJQHWL]LQJFXUUHQWWUDQVIRUPHUFRUHVTXLFNO\DQGHDVLO\$OVRXVHG
WRFRQGXFWWXUQUDWLRWHVWVRQYROWDJHWUDQVIRUPHUV3URYLGHV$DWN9RXWSXW
7ZRKDQGFRQWUROHQKDQFHVSHUVRQDOVDIHW\:KHQSRZHUV\VWHPVDUHSXWLQWR
RSHUDWLRQRUZKHQIDXOWVRFFXULWEHFRPHVQHFHVVDU\WRFKHFNWKHLQVWUXPHQW
WUDQVIRUPHUVWRPDNHVXUHWKDWWKH\DUHSURYLGLQJWHVWLQVWUXPHQWVDQGSURWHFWLYH
UHOD\HTXLSPHQWZLWKWKHFRUUHFWRXWSXWV:HLJKVNJ$VVWDQGDUGLVVXSSOLHG
ZLWKDVSHFLDOKLJKYROWDJHFDEOHDQGDUREXVWWUDQVSRUWFDVH
Out performs
Out features
The 3-phase,
4-channel,
5 star solution!
The New Fluke 430 series: Unbeatable for solving power problems
The rugged and easy-to-use Fluke 434 and 433 threephase power quality analysers pinpoint power problems
faster, more safely and in greater detail.
• AutoTrend – Every measurement is always automatically
recorded to instantly show changes over time – even as you
analyse earlier readings.
• Four channels – measure voltage and current on all three
phases and ground simultaneously.
• Highest safety rating – The only power quality
analyser that meets the stringent CAT IV 600 V and
CAT III 1000 V safety ratings.
• System-Monitor – A single push of a button allows a
quick check of system performance against user
defined limits and drills down to view detailed events.
• Fast and easy to use – Display updates five times
faster than other units and user friendly menus make
this a “must have”
To find out more go to www.fluke.com/3phase
or contact Fluke Australia Pty Ltd
PH: (02) 8850 3333 Fax: (02) 8850 3300 Email: [email protected]
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
55
Power Analysis
Test & Measurement
Protection Relay Testing Systems
Ż1(:Ż
Ż1(:Ż
Omicron CMC256-6 Advanced Protection Relay Test Set
Omicron CMC156-3 Advanced Protection Relay Test Set
20,&0&
$8
7KHFRPSDFWVROXWLRQIRUWKUHHSKDVHWHVWLQJRIUHOD\VPHWHUVDQGWUDQVGXFHUV
:HLJKVNJ)RUDSSOLFDWLRQVUHTXLULQJSRUWDELOLW\URXWLQHWHVWLQJHWF
‡[9RXWSXWV‡[$RXWSXWV‡[ORZOHYHORXWSXWVUHDUVLGH‡
[FRXQWHULQSXWVUHDUVLGH‡[ELQDU\RXWSXWV‡GFPHDVXULQJLQSXWV‡[
ELQDU\ LQSXWV 7\SLFDO DSSOLFDWLRQV DUH GLJLWDO GLVWDQFH UHOD\ WHVWLQJ RU WHVWLQJ
RI WUDQVIRUPHU RSHUDWHG HQHUJ\ 6LJQDO JHQHUDWLRQ LV SHUIRUPHG GLJLWDOO\ '36
WHFKQRORJ\7KHELW'$FRQYHUVLRQUHVXOWVLQDKLJKTXDOLW\VLJQDOHYHQWDW
VPDOOVLJQDODPSOLWXGHV,QDGGLWLRQWRWKHRXWSXWVRIWKHDPSOL¿HUVHFWLRQ
LQGHSHQGHQWFKDQQHOVZLWKORZOHYHOVLJQDOVDUHDYDLODEOHDWWKHEDFNRIWKHXQLW
7KH\FDQEHXVHGWRFRQWUROH[WHUQDODPSOL¿HUVIRUDSSOLFDWLRQVUHTXLULQJPRUH
WKDQYROWDJHRUFXUUHQWSKDVHVHJWHVWLQJRIGLIIHUHQWLDOUHOD\VRUDSSOLFDWLRQV
UHTXLULQJKLJKHUFXUUHQWVRUYROWDJHV7KH\DUHDOVRXVHIXOZKHUHWKHUHLVDQHHG
IRU RXWSXW SRZHU KLJKHU WKDQ WKDW SURYLGHG E\ WKH &0& 7KLV DGYDQFHG
SURWHFWLRQ UHOD\ WHVW VHW FRPHV ZLWK 7HVW 8QLYHUVH 6RIWZDUH /RDGHG RQ
GHGLFDWHG/DSWRS
20,&0&
$8
$GYDQFHGSKG\QDPLFDXWRPDWLFSURWHFWLRQUHOD\WHVWV\VWHP&XUUHQWLQWHJUDO
SKFXUUHQWVRXUFHPD[9$RXWSXWVRXUFHVUHVROXWLRQ—$VXLWDEOHIRU
PRVW UHOD\ W\SHV LQFOXGLQJ VRPH KLJK EXUGHQ XQLWV 9ROWDJH SK aUPV
$X[LOLDU\GFVXSSO\a9$5HOD\PRQLWRULQJWULSPRQLWRULQJLVRODWHG
LQSXWVFDQEHFRQ¿JXUHGWREHYROWDJHIUHHRUa9&RQWDFWRXWSXWVLVRODWHG
FKDQJHRYHUUHOD\FRQWDFWVVRIWZDUHFRQWUROOHG0D[9DF$RU9GF
$ ,QWHUIDFH FRQQHFWRU 77/ GLJLWDO LQSXWV DQG RXWSXWV 6FRSH DQDORJXH
LQSXWVLVRODWHGDQDORJXHLQSXWV“9SHDNPD[ELWUHVROXWLRQ,QSXWVXSSO\
a9GF+],QWXLWLYHRQOLQHKHOS/DSWRSDQG7HVW8QLYHUVHVRIWZDUHXS
WR789VXSSOLHGZLWKWHVWVHWLQWHUIDFHSDUDOOHOSRUW
RES Automatic/Manual 3Ph Protection Relay Test System
5(6$376
Omicron CMC256-6 EP Advanced 3Ph Protection Relay Test System
20,&0&(3
$8
([WHQGHGSUHFLVLRQ&XUUHQWLQWHJUDOSKFXUUHQWVRXUFHPD[9$RXWSXW
VRXUFHV UHVROXWLRQ —$ VXLWDEOH IRU PRVW UHOD\ W\SHV LQFOXGLQJ VRPH KLJK
EXUGHQXQLWV9ROWDJHSKYROWDJHaUPV$X[LOLDU\GFVXSSO\a9$
5HOD\PRQLWRULQJWULSPRQLWRULQJLVRODWHGLQSXWVFDQEHFRQ¿JXUHGWREHYROWDJH
IUHHRUa9&RQWDFWRXWSXWVLVRODWHGFKDQJHRYHUUHOD\FRQWDFWVVRIWZDUH
FRQWUROOHG0D[9DF$RU9GF$,QWHUIDFHFRQQHFWRU77/GLJLWDO
LQSXWVDQGRXWSXWV6FRSHDQDORJXHLQSXWVLVRODWHGDQDORJXHLQSXWV“9
SHDNPD[ELWUHVROXWLRQ,QSXWVXSSO\a9GF+],QWXLWLYHRQOLQH
KHOS1RWHERRNRUEHWWHU:LQRU17GLVSOD\69*$RUEHWWHU
,QWHUIDFHSDUDOOHOSRUW
Omicron CMGPS Syncronisation Control Unit
20,&0*36
$8
*36EDVHGV\QFKURQLVDWLRQXQLWZKLFKLVXVHGWRV\QFKURQLVH&0&3URWHFWLRQ
5HOD\ WHVW VHWV 8VHG ZKHQ SHUIRUPLQJ HQGWRHQG WHVWV RI OLQH SURWHFWLRQ
VFKHPHV WKH XQLW SURYLGHV D VWDUW VLJQDO SXOVH EDVHG RQ WKH *36 FORFN WLPH
EDVH6RIWZDUHLVERWKLQWHJUDWHGLQWKHWHVWLQJPRGXOHV6WDWH6HTXHQFHUDQG
FDQDOVREHXVHGDVDVWDQGDORQHDSSOLFDWLRQ7ZRLQGHSHQGHQWWLPLQJSXOVHV
DUHDYDLODEOHYLDVHSDUDWHFRQQHFWRUVRQDSLQSOXJSXOVHRXWZKLFKLV
FRQQHFWHGZLWKWKH&0&WHVWVHWH[WHUQDOLQWHUIDFHDQGRQ[PPEDQDQD
SOXJVSXOVHRXW6XSSOLHGZLWK*36DQWHQQDPDQWHQQDH[WFDEOHSOXJLQ
SRZHUVXSSO\&0&&0*36LQWHUIDFHFDEOHXVHUVPDQXDOIDEULFFDUU\EDJDQG
DWUDYHOFDVH:HLJKVNJV
Omicron C-Probe-1 Clamp-on CT ac/dc
20,&352%(
$8
$QDFWLYHDFGFFXUUHQWSUREHZLWKYROWDJHRXWSXW5HFRPPHQGHGDFFHVVRU\
IRUPHDVXULQJFXUUHQWVZLWKWKH&0&7ZRPHDVXULQJUDQJHV$$
)UHTXHQF\ UDQJH GF N+] $FFXUDF\ HUURU IRU FXUUHQWV XS WR $ DQG
IUHTXHQFLHVXSWRN+]3KDVHHUURUO#+]/HQJWKPP
56
$8
,QWHJUDO SK FXUUHQW VRXUFH FDSDEOH RI 9$ 6XLWDEOH IRU DOO UHOD\ W\SHV
LQFOXGLQJKLJKEXUGHQXQLWV0D[SHDNYROWDJH“9UHVROXWLRQ$9ROWDJH
SKYROWDJHaUPVUHVROXWLRQ9RYHUFXUUHQWSURWHFWLRQ$$X[LOLDU\GF
VXSSO\a9UHVROXWLRQ$RYHUFXUUHQWSURWHFWLRQ$5HOD\PRQLWRULQJ
WULSPRQLWRULQJLVRODWHGLQSXWV&DQEHFRQ¿JXUHGWREHYROWDJHIUHHRUa9
&RQWDFWRXWSXWVLVRODWHGFKDQJHRYHUUHOD\FRQWDFWVVRIWZDUHFRQWUROOHG0D[
9DF$RU9GF$,QWHUIDFHFRQQHFWRU77/GLJLWDOLQSXWVDQGRXWSXWV
6FRSHDQDORJXHLQSXWVLVRODWHGDQDORJXHLQSXWV“9SHDNPD[,QSXWVXSSO\
a9GF+],QWXLWLYHRQOLQHKHOS5HTXLUHVQRWHERRNRUEHWWHU:LQ
RU17GLVSOD\69*$RUEHWWHULQWHUIDFHSDUDOOHOSRUW
Programma Sverker 760 Relay Test Set
35269(5.(5
$8
5HOD\WHVWVHWIRUSKSURWHFWLYHUHOD\HTXLSPHQW7KUHHSKDVHUHOD\VFDQEH
WHVWHGSKDVHDWDWLPHRUE\V\QFKURQLVLQJPRUHWKDQRQHXQLW&XUUHQWUDQJHV
WR$ZLWKIXOOORDGFXUUHQWWR$$&RXWSXWVWR9GFRXWSXWVWR9
,QEXLOWFDSDFLWRUDQGUHVLVWRUVIRUFXUUHQWRXWSXWSKDVHVKLIWLQJ,QEXLOW
WLPHU DPPHWHU DQG YROWPHWHU 0HDVXUHV SKDVH DQJOH 3) DQG LPSHGDQFH
56FRPPXQLFDWLRQVDQGFRQWUROLQWHUIDFH
T&R DVS3-HP Static Relay Test System
75'96+3
$8
7HVWV\VWHPIRUWHVWLQJYROWDJHDQGIUHTXHQF\SURWHFWLRQUHOD\VDQGWUDQVGXFHUV
7HVWV$XWRPDWLF9ROWDJH5HJXODWLQJ$95UHOD\VZLWKOLQHGURSFRPSHQVDWLRQ
XQGHUDQGRYHUYROWDJHUHOD\VGLUHFWLRQDORYHUaFXUUHQWUHOD\VGIGW52&2)
UHOD\VYHFWRUVXUJHVWHSFKDQJHRISKDVHUHOD\VDQGFKHFNV\QFKURQLVLQJUHOD\
*HQHUDWHVDSKYROWDJHRXWSXWIURPDSKVXSSO\DQGPD\EHXVHGLQFRQMXQFWLRQ
ZLWKDFXUUHQWVRXUFHWRWHVWGLUHFWLRQDOSURWHFWLRQ5HTXLUHVSK+]VXSSO\
RI 9 RU 9 “ 8QLW DXWRPDWLFDOO\ VHOHFWV WKH FRUUHFW UDQJH 0D[
SRZHUUHTXLUHPHQWRIWKHXQLWLVN9$'96+3KDVSKVWDUFRQQHFWHGRXWSXW
DQGWKHUDWLQJRIHDFKSKDVHLVYROWDJHa9SKDVHWRQHXWUDOFXUUHQWPLQ
RQPLQ RII P$ # 9 RU P$ FRQWLQXRXV SKDVH ORFN +]a+]
YDULDEOHIUHTXHQF\a+]YDULDEOHSKDVHDQJOH“O'HOWDORDGVPD\
EHFRQQHFWHGGLUHFWO\WRWKHRXWSXWRUWKURXJKWKH'96797ER[0D[YROWDJH
REWDLQDEOHLV9EHWZHHQDQ\SKDVHQHXWUDODQG9EHWZHHQSKDVHVLI
WKHSKDVHDQJOHVRIWKHSKDVHVDUHVHWWRODSDUW'96797ER[PD\EH
XVHGWRGRXEOHWKHVHRXWSXWYROWDJH5DWLR
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Hi Pot Testers
Ż1(:Ż
Ż1(:Ż
+LJK9ROWDJH7HVW6HWN9+]$&+L3RW7HVWHU
HIV,PFT303
30 kV AC Hipot Test Set
+LJK9ROWDJH3)7N9DF7HVW6HW
HIV,PFT503
+LJK9ROWDJH7HVW6HW9/).Y
AU
AU
Rated 1kVA into resistive load, 3kVA into capacitive load. Duty cycle at 3kVA ½h
on 2h off, at 2kVA 1h on 1h off.
+LJK9ROWDJH,QF9HU\/RZ)UHTXHQF\9/)N9+LSRW7HVW6HW
HIV,VLF6022
+,99/)
$8
9HU\ORZIUHTXHQF\9/)&0DFKLSRWWHVWVHWZLWKN9DFSHDNRXWSXWLV
VXLWDEOHIRUWHVWLQJFDOEHVXSWRN9+LJKORDGFDSDFLW\HQDEOHVLWWRWHVWXS
WR DSSUR[ PLOHV RI FDEOH GHSHQGLQJ RQ W\SH 0RGHO LQFOXGHV DQ HQKDQFHG
IHDWXUHV SDFNDJH D FKDUJLQJ FXUUHQW DQG ORDG FDSDFLWDQFH PHWHU WHVW GZHOO
WLPHUDQGSRODULW\LQGLFDWLQJOLJKWV2XWSXWYROWDJHDQGIUHTXHQF\VLQXVRLGDO
aN9DFSHDNVHOHFWDEOH+]7HVWIUHTXHQF\DQGUDWHGORDGV
ZLWKDSSUR[LPDWHFDEOHOHQJWKVDUH+]—)PRIFDEOH+]—)
P RI FDEOH +]—) P RI FDEOH .LORYROWPHWHU ´ VFDOHG
aN9DFSHDNDPPHWHU´VFDOHGaP$DFa—)ORDGFDSDFLWDQFH
7RWDOZHLJKWRIWKHXQLWLVNJV+9&DEOHRXWSXWLVPÀH[LEOHVKLHOGHG[UD\
ZLWKDOOLJDWRUFODPSLQWHUFRQQHFWFDEOHOHQJWKPVKRUWLQJVWLFNPOHDGZLWKFOLS
$SSOLFDWLRQV¿HOGWHVWLQJ+9VHUYLFHDJHGFDEOHVIRUGHJUDGDWLRQDJHGFDEOH
UHSODFHPHQW SURJUDPV IRU +9 FDEOH QHWZRUNV FDEOH PDQXIDFWXULQJ IRU TXDOLW\
DVVXUDQFHUHVHDUFKRQKLJKYROWDJHFDEOHV\VWHPVFRPPLVVLRQLQJDQGSURRI
WHVWLQJIRUQHZDQGUHSDLUHGFDEOHV$OVRIRULQVXODWLRQFRQGLWLRQPRQLWRULQJRI
WUDQVIRUPHUVVZLWFKJHDUEXVKLQJVHWF
AU
)RU ¿HOG WHVWLQJ RI DF KLJKPHGLXP YROWDJH FDEOHV EXVKLQJV DQG LQVXODWRUV
,QSXW9+]$SHDN$DYHUDJH2XWSXWVLQXVRLGDOaN9DFSHDN
frequency 0.1, 0.05 & 0.02Hz. Duty continuous. Test load capacitance 1.1µF
DSSUR[NPVRIFDEOHDW+]—)DSSUR[RIFDEOHDW+]—)
DSSUR[NPVRIFDEOHDW+]'LVSOD\aSHDNN9,QWHUFRQQHFWFDEOH
OHQJWKPFRQWUROXQLWWR+9WUDQVIRUPHU5*8RXWSXWFDEOHOHQJWKP6KRUWLQJ
VWLFNEUDLGP+9WDQNDQGFRQWUROXQLWVVKLSSHGLQWUDYHOFDVHVZHLJKLQJ
NJVUHVSHFWLYHO\
%DXU3*.+LJK9ROWDJHN9'&,QVXODWLRQ7HVWHU
%$83*.
$8
0D[ RXWSXW N9 DW P$ ,QEXLOW WLPHU ]HUR VWDUW LQWHUORFN DQG DXWRPDWLF
GLVFKDUJHGHYLFH
+LJK9ROWDJH,QF9/)N9+LSRW7HVW6HW
HIV,VLF4022
75N9N9DF+LSRW7HVW6HW
T&R,KV30-40
AU
aN9PD[RXWSXWP$ZLWKDGXW\F\FOHRIPLQRQPLQRII0D[FRQWLQXRXV
FXUUHQWP$2YHUORDGWULSPD\EHVHWIURPaP$=HURLQWHUORFNDQGNH\
operated safety features.
AU
)RU¿HOGWHVWLQJRIDFPHGLXPYROWDJHFDEOHVEXVKLQJVDQGLQVXODWRUV&RQVLVWV
RIFRQWUROXQLWDQG+9WDQN,QSXW9+]$SHDN$DYHUDJH2XWSXW
VLQXVRLGDOaN9DFSHDNIUHTXHQF\+]'XW\FRQWLQXRXV7HVW
ORDGFDSDFLWDQFH—)DSSUR[NPVRIFDEOHDW+]—)DSSUR[NPVRI
FDEOHDW+]—)DSSUR[NPVRIFDEOHDW+]'LVSOD\aSHDNN9
,QWHUFRQQHFWFDEOHOHQJWKP5*8RXWSXWFDEOHOHQJWKP6KRUWLQJVWLFNEUDLG
P+9WDQNDQGFRQWUROLQWUDYHOFDVHVZHLJKLQJNJVUHVSHFWLYHO\
0HJJHU)7,RQLVDWLRQ/HDNDJHDQG%UHDNGRZQ7HVWHU
0(*)7
$80<
$&UDQJHVaN9aN9GFUDQJHVaN9aN92XWSXWFXUUHQWVP$
P$DFP$P$GF%UHDNGRZQDQGÀDVKRYHULQGLFDWLRQE\ODWFKLQJ
LQGLFDWRUIRUSHULRGVH[FHHGLQJPV&XUUHQWWKUHVKROG—$aP$,RQLVDWLRQ
LQGLFDWLRQE\LQWHUQDOVSHDNHU0HWHULQGLFDWLRQRIDFGFDQGDFFDSDFLWLYHFXUUHQWV
&RPSOHWHZLWKSUREHV
'DQEULGJH7\SH-3$,QVXODWLRQ7HVWHU
'$1-3$
$81=
'&KLJKYROWDJHLQVXODWLRQWHVWHU2XWSXWYROWDJHaN9aN9aN9LQ
UDQJHV0D[RXWSXWVKRUWFLUFXLW—$$XGLEOHLQGLFDWLRQRILRQLVDWLRQ&XUUHQW
DQGYROWDJHPHWHUVZKLFKPD\EHXVHGWRFDOFXODWHUHVLVWDQFH
0HJJHU%0,QVXODWLRQ7HVWHU
0(*%0
1=
$QDORJXHGLJLWDO LQVXODWLRQ DQG FRQWLQXLW\ WHVWHU ,QVXODWLRQ WHVW YROWDJHV DUH
9GF5HVLVWDQFHUHVROXWLRQLV0ȍ9ROWDJHUDQJH
LVa9DF
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
57
Power Analysis
Test & Measurement
Electrical Transducers
Model
Type
Input Type (V)
Input Ranges
Output (V)
<(:
+LJKVHQVLWLYLW\FODPSRQDPPHWHU
DFGFFXUUHQW
P$$DFGF
aP9DFGF
$/*&
+LJKVHQVLWLYLW\FODPSRQDPPHWHUHDUWKOHDNDJH
$OJRGXHRQO\
a$
P9a9$
+,2
&ODPSRQDPPHWHU
DFFXUUHQW
+,2
%(/&*$
81,3&
DFGFFXUUHQW
aP9GF
aDFGFa9
$
aDFGF
N$
aaDFGF
N$
aGF
&+$'1
N$
a$DF
)/8,6
aaa$
1mA/A
$N$
aP9DF
$
aF
&XUUHQWFODPS
+,2
<(:
&XUUHQWVKXQW
/*),&
DFFXUUHQWGFYROWV
-5&7
<(:&7
DFFXUUHQW
0HGYROWDJHFXUUHQWWUDQVIRUPHUN9
52%
5RJRZVNLFRLO
/(0/(0)/(;,,
83,&79
7UXH506WUDQVGXFHU
/*),&(
750
<(:
DFYROWDJH
,QVWUXPHQWWUDQVIRUPHU
750
0HGYROWDJHWUDQVIRUPHUN9
025)'7
<(:
aDF
aDF
)UHTXHQF\WUDQVGXFHU
&,
DF
N$
aGF
N$
a$DF
1A ~ 2MA
aDF
N$
aDF
9DF
aGF
9
aGF
99UPV
aDFUPV
9UPV
aDFUPV
9N9
aDF
aN+]
aGF
a+]
aP9GF
aP$
&:(9
7UDQVGXFHU
DFYROWDJH
9
P99
&$575$16
&RQYHUWHU
DFFXUUHQW
$
a9GF
Algodue C173 Precision Clamp-on CT Microamps to 1Ka
$/*&
HSI PSD Programable DC isolating interface
$8
+6,36'
1=
+LJKUHVROXWLRQFODPSRQ&7IRUPHDVXULQJGLIIHUHQWLDODQGRUHDUWKORRSRUOHDNDJH
FXUUHQW&RPSDWLEOHZLWK$OJRGXH830DQGWKHODWHU830DQDO\VHU¶V
IRXUWKFXUUHQWFKDQQHO&XUUHQWUDQJHaaa$$aN$
%DQGZLGWK+]aN+]0D[MDZRSHQLQJPP
7UDQVPLWWHUIRULQGXVWULDOLQWHUIDFLQJWRFKDUWUHFRUGHUVDQGORJJHUV,QSXWUDQJHV
P9a9—$aP$%LSRODURXWSXWUDQJHV9a9a9a9aP9
aP9aP$aP$aP$aP$$FFXUDF\LQSXWRXWSXW
Bell CG-120A Current Gun (Clamp-on Probe)
6+,
%(/&*$
$8
&ODPSRQKDOOHIIHFWFXUUHQWSUREH)RUSULPDU\a$DFRUGFWZRVFDOHVa
a)UHTXHQF\UHVSRQVHGFWRN+]2XWSXW9IXOOVFDOHVXLWDEOHIRU
'00V7HUPLQDWLRQVKLHOGHGPPEDQDQDSOXJV-DZRSHQVWRDFFHSWPP‘
FRQGXFWRUV%DWWHU\9DONDOLQHW\SLFDOOLIHK
230Vac to 230mVdc Transducer
&:(9$&
1=
,QWHUIDFHZLWKRXWSXWWRPPEDQDQDPDOHSOXJVVXLWDEOHIRUFRQQHFWLQJWR'00
RUUHFRUGHU,QSXWUDQJHa9DF2XWSXWaP9GF
Carrel & Carrel 5A ac to 10Vdc Converter
&$575$16
Fluke 1kA ac Current Clamp
)/8,6
7KUHHUDQJHVa$a$a$-DZRSHQLQJLVPP
Shimaden 4~20mA to 0~1V Isolating Interface
1=
1=
6XLWDEOHIRUXVHZLWKFKDUWUHFRUGHUVORJJHUVDQGRWKHUGHYLFHVUHTXLULQJLVRODWLRQ
IURPaP$SURFHVVVLJQDOV
Hioki 3109 ac/dc Clamp-on Current Meter
+,2
$8
&XUUHQWPHWHUZLWKUHFRUGHURXWSXWV,QGFPRGHLVDYROWDJHZDYHIRUP5DQJHV
$N$0HDVXUHVWRN$ZLWKUHGXFHGDFFXUDF\9ROWDJHUDQJH
DFGF $FFXUDF\ )6' 5HFRUGHU RXWSXW 9)6'
2SHUDWHVIRUKIURPGU\EDWWHULHVRUYLDH[WHUQDODF
Hioki 3285 ac/dc Clamp-on Meter with Analog Output
+,2
1=
7KUHHDFFXUUHQWWRGFYROWDJHWUDQVGXFHUVIRUXVHZLWK$&7VDQGDUHFRUGHURU
ORJJHU,QSXWLVa$DFRXWSXWLVa9GF$FFXUDF\LVEHWZHHQa$
DW+]
58
$N$
$N$N+]
$8
5DQJHV$N$DFGF0HDVXUHYROWVUDQJHV9DFGF)UHTXHQF\
UDQJHV+]N+]'LVSOD\/&'FRXQWVPD[FXUUHQWYROWDJH
DQGIUHTXHQF\2XWSXWYROWDJH9IRUFRXQWIVIRUHDFKFXUUHQWUDQJH
FDQVHOHFW5HFUPVRXWSXWUHVSRQVHWLPHDERXWPVULVHWLPHIDOODERXWPV
6HOHFW0RQIRUZDYHIRUPRXWSXW9LVSURGXFHGIRUFRXQWRQIXOOVFDOH
IUHTXHQF\UDQJH2XWSXWQRWDYDLODEOHIRUYROWDJHPHDVXUHPHQWV6XSSOLHGZLWK
VLJQDORXWSXWFRUGPPWR%1&FRQYHUWRUFDUU\FDVHDQGDFDGDSWRU3RZHUHG
ZLWKLQWHUQDO9EDWWHU\RUDFDGDSWRU
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Electrical Transducers (cont’d)
UPI CTV True rms Transducer 0~300Vac to 1~5Vdc
Crompton 235/50 Frequency Transducer
83,&79
$8
&RQYHUWVa9DFWRa9GF
&,
$8
,QSXW9DFa+]RXWSXWaP$
Moore FDT Frequency to Volts Transducer
Landis & Gyr FIC-511 Current Transducer
/*),&
$8
025)'7
$8
$&FXUUHQWWRGF9WUDQVGXFHUV,QSXWa$DF+]RXWSXWa9GF8VH
ZLWKFKDUWUHFRUGHUV
,QSXWUDQJHaN+]DWXSWR9SHDNWRSHDN2XWSXW9GFDWN+]
Yokogawa 3228-11 Clip-on Ammeter
<(:&7
<(:
$8
Yokogawa CT90 Current Transformer
$8
a$WXUQVPD[YROWDJHN9
+LJK VHQVLWLYLW\ UDQJHV P$a$ $& RU GF RSHUDWLRQ )UHTXHQF\ UDQJH
+]aN+]%DWWHU\RSHUDWHG$QDORJXHRXWSXWDWIXOOVFDOHP9UPV
Yokogawa 2261-01 2.2kV Potential Transformer
Landis & Gyr FIC-51E Voltage Transducer
N99SULPDU\WR9VHFRQGDU\
/*),&(
$8
$&YROWDJHWRGFYROWDJHWUDQVGXFHU0D[LQSXW92XWSXWYROWDJH9GFSHU
9DFLQSXW
Tech-Rentals,M05 Instrument Transformer
750
$8
3HUPLWV PRQLWRULQJ RI DF SRZHU OLQHV ZLWK ORZ LQSXW OHYHO LQVWUXPHQWV ,QSXW
a9 UPV 2XWSXW a9 UPV 'LVWRUWLRQ OHVV WKDQ %DQGZLGWK
+]aN+]
Tech-Rentals M10 Instrument Transformer
750
$8
3HUPLWV PRQLWRULQJ RI DF SRZHU OLQHV ZLWK ORZ LQSXW OHYHO LQVWUXPHQWV ,QSXW
WDSSHGDW9RXWSXW9UPV'LVWRUWLRQOHVVWKDQ%DQGZLGWK
+]aN+]
Hioki 3128 Clamp-on Current Transducer
+,2
$8
&ODPSRQ FXUUHQW PHWHU ZLWK UHFRUGHU RXWSXW 5DQJHV IXOO VFDOH $~N$
2XWSXWP9GFIXOOVFDOH%DWWHULHVQRWUHTXLUHG2XWSXWLVLQWHQGHGRQO\IRU
ORZVSHHGUHFRUGHUV
Yokogawa 2288-15 FrequencyTransducer 50 Hz
<(:
$8
,QSXWa9DFa+]'&RXWSXWIRUFKDUWUHFRUGHU
Yokogawa 2255-01 10A ~ 5A Current Transformer
<(:
$8
,QSXW$DFRXWSXW$DFPD[FLUFXLWYROWDJHN9EXUGHQ9$DFFXUDF\
RIUDWHGYDOXHEXVEDUFRQQHFWRUV
Yokogawa 2215 Current Shunt
<(:
$80<
<(:
$8
Jacobs Radio CT-005 Current Transducer
-5&7
$8
5DQJH N$ N$ N$ 9 GF RXWSXW 7UDQVIRUPHU FDQ EH VSOLW LQ WZR WR
DFFRPPRGDWHFDEOHRUEXV[PP
Universal Technic P75.3C dc/ac Amp Clamp
81,3&
$8
0D[FXUUHQW$GFDFSHDN%DQGZLGWK.+]0LQUDQJHN$$FFXUDF\
DW$RIUHDGLQJ)6DFFXUDF\RIUHDGLQJ0D[EXVVL]H[PP
RU[PP0D[FDEOHVL]HPP%DWWHU\9OLIHK2XWSXWVRFNHWV
PP'&FXUUHQWJLYHVGFRXWSXWDFFXUUHQWJLYHVDFRXWSXWN$UDQJHP9
SHUDPSN$UDQJHP9SHU$
Robinson 543 Linear ac Current Transducers
52%
$8
:LGHEDQGZLGWKDQGYHU\ZLGHG\QDPLFUDQJH6XSSOLHGZLWKDQRSHQHQGHG
ÀH[LEOHFRLORIPOHQJWKZKLFKPD\EHZUDSSHGDURXQGDYHU\ODUJHFRQGXFWRURU
SRZHUSROHHWF)UHTXHQF\UDQJH+]aN+]ZLWKDFFXUDF\&XUUHQWUDQJH
IRUZUDSRIFRLO$a0$DW+]3KDVHHUURUGHJ0LQEHQGLQJUDGLXV
PP([WHUQDOLQVXODWLRQLVUHTXLUHGIRUPHWDOOLFFRQGXFWRU2XWSXWYROWDJH9
UPVDFZDYHIRUP$OVRGFUHFWL¿HGRXWSXW,QEXLOWGLJLWDOGLVSOD\
LEM FLEXII 30, 300 & 3,000A Transducer
/(0/(0)/(;,,
$8
)OH[LEOHZUDSDURXQGDFFXUUHQWWUDQVGXFHU/HQJWKPP5DQJHV$
N$)UHTXHQF\UHVSRQVHaN+]$FFXUDF\3KDVHHUURUO2XWSXW
9UPV # IXOO VFDOH 5HTXLUHV XQLWV IRU SK 'HVLJQHG IRU PXOWLPHWHUV DQG
RVFLOORVFRSHVPPEDQDQDSOXJRU%1&FRQQHFWRUVEXWFDQDOVREHXVHGZLWK
WKH'5$UHTXLUHVDGDSWRUOHDGRU92/30$2WKHULQVWUXPHQWVPD\
EHDWWDFKHGSURYLGLQJWKHFRUUHFWDGDSWRUWUDQVGXFHUDQGFRQQHFWLRQLVDYDLODEOH
2SHUDWHVIRUKIURP[9EDWWHULHV
P9RXWSXWDYDLODEOHLQUDQJHRI$aN$
Did you know?
TECHRENTALS offers rental with an option to purchase (RPO).
When you enter into an RPO you can exercise your oprtion to purchase the rented equipment after the agreed
minimum rental term.
RPO is an ideal arrangement for companies who need to conserve capital, allocate expenditure, preserve
credit and optimise asset management over the longer term.
Our friendly staff will be pleased to provide details.
Some conditions may apply , not available for all equipment.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Call now!
TECHRENTALS
59
Power Analysis
Test & Measurement
Electrical Testers
Ż1(:Ż
AVO Penta-Plus DMM Analyser
$923(17$3/86'00
Phase Sequence Meter 110 - 600 volts 50 / 60 Hz
.<2360
$8
3KDVHLQGLFDWRUZLWKRSHQSKDVHFKHFNHUDQGSKDVHLQGLFDWRUGHVLJQHGWRFKHFNWKH
SUHVHQFHRIRSHQSKDVHDQGDOVRWKHSKDVHVHTXHQFHE\URWDWLQJGLVNDQGODPSV
&KHFNDZLGHUDQJHRISKSRZHUVRXUFHIURPa92SHUDWLRQDOYROWDJH
a9DFWLPHOLPLWIRUFRQWLQXRXV!9ZLWKLQPLQ)UHTXHQF\UHVSRQVH
a+]DFa9a+]DFa9VDIHW\VWDQGDUG,(&
&$7,,,9SROOXWLRQGHJUHHZLWKVWDQGYROWDJHN9DFIRUV'LPHQVLRQV/
î:î'PPZHLJKWJDSSUR[&RUGP5UHG6ZKLWH7EOXH
$8
0XOWLIXQFWLRQ PHWHU IRU PHDVXULQJ SK YROWV DF SULPDU\ DQG VHFRQGDU\
FXUUHQWWUXHDQGUHDFWLYHSRZHUDPSOLWXGHDQGSKDVHDQJOHDQGDOVRIUHTXHQF\
(DVLO\ FRQ¿JXUHG WR PHDVXUH WKH DPSOLWXGH DQG SKDVH DQJOH EHWZHHQ DQ\ FXUUHQWRUYROWDJHLQSXWV'LVSOD\HGVLPXOWDQHRXVO\RQDEDFNOLJKWJUDSKLF/&'
VFUHHQ ,QWHUQDO PHPRU\ UHFRUGV XS WR WHVW UHVXOWV /RJJLQJ YLD 56&
SRUW 3DUDOOHO SULQWHU SRUW 9ROWDJH a9DF UDQJHV ZLWK UHVROXWLRQ
0D[N9&XUUHQWa$DFLQUDQJHVZLWKUHVROXWLRQ3KDVHDQJOH
aOZLWKOUHVROXWLRQ3RZHUWUXHDQGUHDFWLYH“N:“aN9$U
)UHTXHQF\a+]7LPHUa/LQHRUEDWWHU\RSHUDWHGKFRQWLQXRXV
RQIXOOFKDUJH
Midtronics Micro 400 Battery Tester
0,'0,&
$8
)RU 9 DXWRPRWLYH EDWWHULHV 'LVSOD\V YROWDJH FRQGLWLRQ DQG DYDLODEOH
SRZHU
Metrix MX120 Multicore Clamp-on Meter
0(70;
Beha 5774E 3 Phase Sequence/Rotation Indicator
%(+(
$8
)RUGHWHUPLQJWKHURWDWLRQDOGLUHFWLRQDQGVHTXHQFHRIDSKVXSSO\1HFHVVDU\
WRSUHGHWHUPLQHWKHFRUUHFWURWDWLRQDOGLUHFWLRQRISKPRWRUV
.,.3/=:
$80<
9ROWDJHUDQJHa9&XUUHQWUDQJHa$,QEXLOWRVFLOODWRUSURYLGHVIRU
G\QDPLFORDGWHVWLQJE\VZLWFKLQJEHWZHHQWZRGLIIHUHQWORDGOHYHOV/RDGFXUUHQW
PD\EHUHPRWHO\FRQWUROOHGE\YROWDJHRUUHVLVWDQFHVLJQDOV0XOWLSOHXQLWVPD\EH
RSHUDWHGLQSDUDOOHO,QEXLOWGLJLWDOYROWFXUUHQWPHWHU)RUGFLQSXWVRQO\
$8
6LQJOH SKDVH FDQ EH XVHG RQ SK LQGLYLGXDO SKDVH ZLQGLQJV 7XUQV UDWLR
a ([FLWLQJ FXUUHQW a$ $FFXUDF\ +DQG FUDQNHG
RSHUDWLRQ
$8
0HDVXUHV7UXHUPVSHDNPLQPD[KROG5DQJHVDXWRPDQXDOFXUUHQW$
$N$UPV9ROWDJH9N9PD[5HVLVWDQFHNŸ)UHTXHQF\
a+]+]aN+]-DZFDSDFLW\PP‘PPRSHQLQJ%DWWHU\OLIH
DSSUR[KFRQWLQXRXV
Hioki 3283 Clamp-on Leakage Current Tester
+,2/($.$*(7(6
Biddle 550005 Turns Ratio Test Set
%,'
Hioki 3282 Clamp-on Hi Tester (V, I, Hz & T)
+,2
.LNLVXL3/=:(OHFWURQLF/RDG
$8
0HDVXUHVFXUUHQWLQRUZLUHFDEOHV1RQHHGWRVSOLWFDEOHVRUUHPRYH
FRYHUV5DQJHVRUZLUHa$ZLUHa$UHVROXWLRQ$$FFXUDF\
ZLWKRUZLUHRYDORUÀDWFDEOHZLWKURXQGFDEOHZLWKVLQJOHZLUH
%DWWHU\RSHUDWHG'LVSOD\òGLJLW
$8
$QDO\VHUIXQFWLRQVIRU¿OWHULQJDQGRXWSXWVLJQDOV:LGHEDQGZLGWK+]aN+]
KLJK VHQVLWLYLW\ ZLWK D IXOO VFDOH RI P$ UDQJHV P$ P$ $ $ $SULPDU\5HVROXWLRQ—$KLJKDFFXUDF\DW“7UXHUPVPHDVXUHPHQW
2XWSXW PRQLWRU DQG UHFRUG PRGHV DFGF RXWSXW a9 IXOO VFDOH %DWWHU\ 9
DSSUR[K
Equimp HT2035 Electrical Tester
(48+7
1=
&RPSOLHVZLWK&(,&(,(LJKWLQVWUXPHQWVLQWKHRQHFDVHZKLFK
LQFOXGHVSULQWHU56&LQWHUIDFH
7HVWVDUH/RZŸUDQJHaŸUHVROXWLRQZLUHHDUWKUHVLVWDQFH
PHDVXUHPHQWUDQJHaŸ,QVXODWLRQUHVLVWDQFHa0Ÿ
9 506 DF a9 UHVROXWLRQ 6KRUW FLUFXLW ORRS LPSHGDQFH
aŸUHVROXWLRQ)DXOWORRSLPSHGDQFHPHDVXUHPHQWaŸ
)DXOWORRSUHVLVWDQFHaŸ5&'WHVWHU
Current Injectors
SMC PET-100-C Secondary Current Test Set
60&37(&
T&R PCU1/E 2000 A Primary Current Test Set
$81=
$8
&RPSULVHVFRQWUROXQLWDQGN$ORDGLQJXQLW&RQWUROXQLWLQFOXGHVWLPHUFXUUHQW
DQGYROWDJHPHWHUVDQGYDULDEOHRXWSXWWUDQVIRUPHU&XUUHQWRXWSXWWR$DW
9DF$DW9DF9ROWDJHRXWSXWWR$DW9DF([WHUQDOORDGLQJXQLW
RXWSXWWR$DW9DF2XWSXWVN$DWa9N$DWa97ZRXQLWVZHLJK
NJSOXVFDEOHV
Multi-Amp MS-2 High Current Test Set
75$'0
08/06
$8
'HVLJQHGWRWHVWRYHUORDGUHOD\VFLUFXLWEUHDNHUVDQGHDUWKIDXOWWULSGHYLFHV,QSXW
9+]2XWSXWFRQWLQXRXVO\DGMXVWDEOHLQUDQJHV9$9$
9$9$6KRUWWHUPRYHUFXUUHQWRIVHYHUDOWLPHVWKHUDWHGFXUUHQW
UDQJHVLVSRVVLEOH'LJLWDOFXUUHQWPHWHUKDVUHDGDQGKROGIDFLOLWLHVIRUVKRUW
GXUDWLRQ FXUUHQWV 'LJLWDO WLPHU PHDVXUHV HODSVHG WLPH EHWZHHQ HQHUJLVDWLRQ
DQGWKHWHVWGHYLFHRSHUDWLQJ
60
753&8(
$& FXUUHQW DQG YROWDJH RXWSXWV LQ UDQJHV 9$ 9$ 9$ 9$$GGLWLRQDORXWSXWVDFYROWDJHa9DW$$PLQGFYROWDJH
a9DW$$PLQGFYROWDJHa9DW$¿[HG9DFDW$
7LPHUPVaV$GGLWLRQDOIXQFWLRQVLQFOXGHPHDVXUHPHQWRIWKHSKDVHDQJOH
EHWZHHQWKHYROWDJHDQGWKHFXUUHQWRXWSXWWDSVHOHFWHGDQGWKHPHDVXUHPHQWRI
WKHLPSHGDQFHRIWKHORDGFRQQHFWHGLQWKHFXUUHQWRXWSXWWDSV
T&R 200 ADM Current Injection System
$8
6LQJOH SKDVH SRUWDEOH FXUUHQW LQMHFWLRQ V\VWHP ZLWK PDLQ DQG DX[LOLDU\ DF GF
FXUUHQWDQGYROWDJHRXWSXWV2XWSXWUDQJHVPDLQYROWDJH9DF
9GF0DLQFXUUHQWFRQWLQXRXVa$LQWHUPLWWHQWXSWR$$X[LOLDULHV
VWDELOLVHGGFLVRODWHGDQGSURWHFWHG$#9a$#99DULDEOHP$
#a9DF5HVROXWLRQP9P$3KDVHO7LPLQJUDQJHaZLWK
UHVROXWLRQPV0HWHULQJ/&'EDFNOLWWUXHUPVZLWKDPHPRU\DPPHWHU,QWHUIDFH
563URWHFWLRQPDLQRXWSXWGXW\F\FOHDQGDX[LOLDULHVHOHFWURQLFWKHUPDODQG
IXVH6XSSO\UHTXLUHPHQWVSKa9DF+]N9$PD[
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Power Analysis
Test & Measurement
Current Injectors (cont’d)
T&R CIT/LU2000 Primary Current Injection Test Set
75&,7
T&R 200A-3PH/ED 3 Phase Current Injection Tester
$8
75$3+(',7
&RPSULVHVFRQWUROXQLWDQGN$ORDGLQJXQLW/8&RQWUROXQLWLQFOXGHVWLPHU
FXUUHQWDQGYROWDJHPHWHUVDQGYDULDEOHRXWSXWWUDQVIRUPHU([WHUQDOORDGLQJ
XQLWRXWSXWaN$GXW\PLQRQPLQRIIDW9DFFRQWLQXRXVaN$DW9DF
7ZRXQLWVZHLJKWNJSOXVTXDGPP2FDEOHVHWVHDFKPORQJ&RQWURO
XQLWFRQQHFWVWR/8ZLWKVXSSOLHGLQWHUIDFHFDEOH
$8
a$SKDVHRXWSXWFDSDFLW\3RZHUVXSSO\ZLUH$SKDVHSK9
7\SLFDOO\$SLQSKDVHVRFNHWRXWOHW+30
Power Line Conditioner/UPS
0RGHO
7\SH
&DSDFLW\9$
&207836
$3&
($7.9$
6%$
6%9$
&+/
&+/$&7,9(
836
&+/$&7,9(
$3&68
&+/
6%
6%
&RQGLWLRQHU
6%
+,2%$77(5<7(67
%DWWHU\
6%%$77
%DWWHU\3DFN
Sola 66-102-8 2kVA Electronic Power Conditioner 2kVA
6%
&RPSDT2QOLQH:DWW836
$8
,QSXWYROWDJH9(I¿FLHQF\'LVWRUWLRQ
($7.9$
$8
,QSXWUDQJH9“IRUUHJXODWLRQ0D[GLVWRUWLRQRQOLQHDUORDGV
RQW\SLFDOFRPSXWHUORDGV(I¿FLHQF\
Sola 0601-2000A 2kVA On-line UPS
6%$
6%9$
$8
1=
5XQWLPHPLQRUPLQDWKDOIORDG1RYHOO56FRPPXQLFDWLRQVLQWHUIDFH
LQFOXGHGSURYLGLQJUHOD\FRQWDFWVIRUPDLQVIDLOXUHDQGORZEDWWHU\LQSXWIRUUHPRWH
VKXWGRZQDQG56VHQGUHFHLYHDOOYLDD'%FRQQHFWRU
APC Pro 1000 UPS
$3&
1=
Eaton Corp Powerware 9120 2kVA Online UPS
Sola 210-26-725 2.5kVA Power Conditioner
6%
&207836
1=
.9$ OLQH LQWHUDFWLYH XSV ZLWK EXLOWLQ ¿OWHUV IRU VDJV VXUJHV DQG WUDQVLHQWV
6ZLWFKHVWREDWWHU\SRZHULQPVLQWKHHYHQWRIDSRZHURXWDJH
1=
7KH GRXEOH FRQYHUVLRQ RQOLQH 3: ZLWK LWV ZLGH LQSXW YROWDJH LV FDSDEOH
RI ZRUNLQJ ZLWK PDLQV SRZHU LQ PRVW FRQGLWLRQV ZLWKRXW GLVFKDUJLQJ EDWWHULHV
&DSDFLW\N9$PLQ,(&$$XVW$[[PP
‡'RXEOH&RQYHUVLRQWHFKQRORJ\
‡,QYHQV\VVRIWZDUHVXLWHLQFOXGHG
‡:LGHLQSXWYROWDJHUDQJH
‡6103:(%PRQLWRULQJFDSDELOLW\
‡3OXJ3OD\XSWRN9$
‡$%0±ORQJHUEDWWHU\OLIH
‡/&'GLVSOD\
‡&XVWRPLVDWLRQZLWKRSWLRQV
‡([WHQGHGUXQWLPH
‡5REXVWGHVLJQ
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
61
Power Analysis
Test & Measurement
Power Line Conditioner/UPS (cont’d)
Sola 625 Battery Pack
Chloride Active 3kVA UPS
6%%$77
1=
&+/$&7,9(
6%9$
1=
2XWSXWUHJXODWLRQLV“UXQWLPHDWIXOOORDGLVPLQRUPLQDWKDOIORDG
RYHUORDGFDSDFLW\IRUV
Sola Basic 3500VA 110V OP Power Conditioner
6%
Hioki Battery HiTester
1=
+,2%$77(5<7(67
9$IHURUHVRQDQWSRZHUFRQGLWLRQHU9LQSXWDQG9DFRXWSXW)LOWHUV
RXWVDJVVXUJHVDQGWUDQVLHQWV
$8
5XQWLPHPLQDWIXOOORDG1HWZRUNVRIWZDUHLQFOXGHG:HLJKWNJ
Chloride Powerlan 2.2kVA UPS
&+/
$8
7DNHV RQWKHVSRW PHDVXUHPHQWV RI WKH LQWHUQDO UHVLVWDQFH YROWDJH DQG
WHPSHUDWXUHRIOHDGDFLGEDWWHULHVSULQFLSDOO\IRU836DQGVLPLODUDSSOLFDWLRQV
ZLWKRXWQHHGLQJWRVKXWRIIWKHEDWWHU\,QVWDQWDQHRXVUHVXOWVRQDWKUHHUDQN
VFDOHRI3DVV:DUQLQJRU)DLOXVLQJDFRPSRVLWHGHFLVLRQEDVHGRQWKHLQWHUQDO
UHVLVWDQFH DQG WKH YROWDJH 5HVROXWLRQ RI —Ÿ QHFHVVDU\ IRU KLJK FDSDFLW\
EDWWHULHVRIDWOHDVW$K,QFOXGHV+LRNLFOLSW\SHWHPSHUDWXUHOHDGV
APC SU3000 3kVA On-line UPS
$3&68
$8
'RXEOHFRQYHUVLRQVLQHZDYHRXWSXW'XDO3&LQWHUIDFHV7\SLFDOUXQWLPHPLQ
,QSXWQRPLQDO9DFSK12XWSXW9DFSK1“
(I¿FLHQF\!'LPHQVLRQVZ[G[KPP:HLJKWNJ0RS836
3URIHVVLRQDOVRIWZDUHIRUV\VWHPPRQLWRULQJDQGVKXWGRZQLQFOXGHG86%SRUW
56FRPPXQLFDWLRQSRUWIRU836PRQLWRULQJDQGPDQDJHPHQW
Sola 625-3000VA On-line UPS
$8
6LQHZDYHRXWSXW'XDO3&LQWHUIDFHV7\SLFDOUXQWLPHPLQ:HLJKWNJ
9LJLODQWQHWZRUNLQWHUIDFLQJVRIWZDUHLQFOXGHG
Chloride Powerlan 5kVA UPS
&+/
$8
6LQHZDYHRXWSXW'XDO3&LQWHUIDFHV7\SLFDOUXQWLPHPLQ:HLJKWNJ
9LJLODQWQHWZRUNLQWHUIDFLQJVRIWZDUHLQFOXGHG
Chloride Active 2kVA Double Conversion UPS
&+/$&7,9(
$8
'RXEOHFRQYHUVLRQVLQHZDYHRXWSXW'XDO3&LQWHUIDFHV7\SLFDOUXQWLPHPLQ
,QSXWQRPLQDO9DFSK12XWSXW9DFSK1“
(I¿FLHQF\!'LPHQVLRQVZ[G[KPP:HLJKWNJ0RS836
3URIHVVLRQDOVRIWZDUHIRUV\VWHPPRQLWRULQJDQGVKXWGRZQLQFOXGHG86%SRUW
56FRPPXQLFDWLRQSRUWIRU836PRQLWRULQJDQGPDQDJHPHQW
Power Transformers
Model
Type
Phases
VA
)(5
)(5
Output (VAC)
3RZHU7UDQVIRUPHU
1
)(5
9$5
9$5
9DULDF
9$5
Ferguson 115-2000 2 kVA 240/115V Transformer
)(5
a3K3K
9$5
$80<
N9$9DULDFa9DFRXWSXW
Variac 16000-3 3ph 20A
)HUJXVRQ9:7UDQVIRUPHU
$8
a9DF9$VWHSGRZQWUDQVIRUPHU
9$5
$8
N9$SK9DULDF$SHUSKDVH
Variac 6500-3 3ph 6.5kVA
)HUJXVRQ9N:7UDQVIRUPHU
)(5
$3K
a
Variac 3000VA 0~260Vac
$8
N9$a9DFWUDQVIRUPHU
)(5
$3K
9$5
$8
a9DFN9$VWHSGRZQWUDQVIRUPHU
9$5
$81=
9DULDFSKN9$a9DFRXWSXWIRU9DFLQSXWPD[FXUUHQW$SK
Variac 2kVA 0~260Vac
9$5
$8
N9$9DULDFa9DFRXWSXW
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
63
Power Analysis
Test & Measurement
AC Sources/Inverters/Generators
Model
Type
(/*
VA
$&3RZHU$PS
%(+%/&
Output (VAC)
a
5(''$
0RWRUJHQHUDWRU9
3&,
6LQH:DYH,QYHUWHU9
3&,
3RZHU,QYHUWHU9
3&,
3RZHU,QYHUWHU9
+21(8,
3HWURO*HQHUDWRU
<$0()L6(
3HWURO*HQHUDWRU,QYHUWHU6HW
75$
7UDQVIRUPHU
Elgar 501 ac Power Source
(/*
$8
(EEHWWN:'&WR$&,QYHUWHU
(%%
1=
$& SRZHU DPSOL¿HU 2SHUDWHV IURP 9 SK DF 2XWSXW UDQJHV RQ WDSSHG
WUDQVIRUPHUaaa9DF2XWSXWSRZHU9$$OWHUQDWLYHRVFLOODWRUV
DYDLODEOHIRU+]aN+]RSHUDWLRQ$PSOL¿HURXWSXWUDWHGRYHU+]aN+]7ZR
XQLWVPD\EHFRQQHFWHGIRUN9$RXWSXW7KUHHXQLWVPD\EHXVHGZLWKDVLQJOH
RVFLOODWRUWRJLYHDSKRXWSXWDWN9$
9GFa9DF+]VLQHZDYHLQYHUWHU&RQWLQXRXVUDWLQJ9$,QWHUPLW
WHQWXVH9$6XUJHPRWRUVWDUW9$2YHUORDGSURWHFWHGZLWK
DXWRPDWLFVRIWVWDUW2XWSXW9DF“)UHTXHQF\+]“7KUHHSLQ
RXWOHWVRFNHW
%HKOPDQ%/&9$3RZHU$PSOLÀHU
<$0().,6(
%(+%/&
$8
$&SRZHUDPSOL¿HUZLWKRVFLOODWRU0D[SRZHURXWSXWN9$0D[FXUUHQW$
RQa9UDQJH$RQa9UDQJH2XWSXWIUHTXHQF\a+]([WHUQDO
IUHTXHQF\V\QFKURQLVLQJLQSXW5HPRWHa9GFSURJUDPPLQJRIRXWSXWIUHTXHQF\
DQGYROWDJH'LJLWDOWUXHUPVUHDGRXWRIYROWDJHDQGFXUUHQW8QLWVPD\EHVWDFNHG
IRUKLJKHUSRZHURUSKDVHRSHUDWLRQ
Yamaha EF3000iSE 3kVA Petrol Generator/Inverter Set
$8
2XWSXWDFN9$N:#9+]PD[KDUPRQLFGLVWRUWLRQPDLQVVXSSO\
FDQH[FHHG9GF#$6RXQGDWWHQXDWHGHQFORVXUHOHYHOG%$#
PZLWKZKHHOV'LPHQVLRQVZ[G[KPP'U\ZHLJKWNJ(QJLQH
VWURNHDLUFRROHGRKYIXHOWDQN/XQOHDGHGGXUDWLRQDWORDGKZLWK
DXWRWKURWWOHRQ(OHFWULFDQGSXOOVWDUW
Rediline DA3179 12/240V dc-ac Inverter
5(''$
$80<
0RWRUJHQHUDWRU9GFWR9DFVLQHZDYHRXWSXW&RQWLQXRXVUDWLQJ:
,QWHUPLWWHQWXVH:/RZHUGXW\F\FOHRQRIIN:DXWRVWDUWV
RQ ORDG 2YHUORDG SURWHFWHG :HLJKW NJ 2YHUDOO IUHTXHQF\ UHJXODWLRQ
a+]
Power Conversions 250I Inverter
3&,
$8
:VLQHZDYHLQYHUWHU9GFLQSXW
3RZHU,QYHUWHU:9GF2XWSXW9
3&,
Honda EU10i 1kVA Petrol Generator
230 to 115 VAC Transformer 1 kVA
+21(8,
75$
0D[LPXPSRZHULVN:86$SRZHUVRFNHW
64
$8
6LQHZDYHLQYHUWHU2XWSXW3RZHUFRQWLQXRXVSHDN:N:)UHTXHQF\
+]“
1=
$8
3RUWDEOH JHQHUDWRU 9 ZLWK N9$ FDSDFLW\ 5XQ WLPH K SHU WDQN RI IXHO
1RLVHOHYHOG%2XWSXW9$GF,QYHUWHUEDVHGRXWSXWGHOLYHULQJVLQHZDYH
FRPPHUFLDOTXDOLW\HOHFWULFLW\VXLWDEOHIRUXVHZLWKFRPSXWHUDQGVLPLODUVHQVLWLYH
SURGXFWV
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data Acquisition & Recording
Test & Measurement
Data Loggers
Data Loggers
DE,DT605
DE,DT605-3
DE,DT800
DE,DT800-4PRO
Analogue in
(Ch)
Digital
in
(Ch)
Digital
dc
out
supply
(Ch)
10
(30 unbal)
5
5
25mV~100V
12
(42 unbal)
16
8
10mV~10V
Yes
YEW,DA100-40CH
40
20mV~50V
8
0~50mV
0~10V
1
RS232
3.6k
LAN
Analogue in
(channels)
Digital in
(channels)
HIO,8835-01
HIO,8841
8
HIO,8842
16
64M
100kHz
64
1
8Mb
256
8Mb
512
0.5
512kB
0~10kHz
4~20mA
RS232
15.9k
1s
0~10V dc
No
Comms
RS232C
Yes
No
No
No
RS232C
Chart Speed
(mm/s)
FDD
Voltage Ranges
Memory
per ch
RS232
Sample
Rate
No
1MHz
100kW
100
16
9
Yes
100mV – 400V
200
HIO,9335
SRAM 1
USB
Chart Paper
(mm)
4
1
RS232
0~2.5V
HIO,8835
YEW,ORM1300
64M
Yes
Flashcard
MB
13.65k
10BaseT/
RS232
No
Sample
Rate (Hz)
Yes
J,K
TIN,TGPR-0704-2.5V
Memory Recorders for transient
& continued signals
Yes
Memory
166.538k
No
TIN,TGPR-0804
TIN,TGPR-0704-10VDC
Comms
Yes
100mV~60V
32
TC
Yes
19.5mV~2.5V
HIO,8422-51
FOU,DAQPRO
Strain
Gauge
RS232
16
HIO,8421-51
FOU,DAQPRO-2
RTD
Yes
DE,TPRO
HIO,8421-01
Voltage
Ranges
1Megaword
1M
2M
Graphing Software for Hioki 8835, 8835-01, 8841, 8842
16
200
YEW,ORM1200
YEW,ORP1200
100
Yes
100mV – 500V
128k
100kHz
3k
8
YEW,DL708E
100
Yes
50mV – 800V
Hybrid & Pen Recorders
Analogue in
(Ch)
Chart
Paper
(mm)
Chart Speed
YEW,3057-22
2
150
10mm/s
10mV – 50
YEW,3712-31
3
250
YEW,3712-41
4
250
1,200mm/min
10mV – 200
YEW,3750
10
YEW,3750-DC
20
YEW,3760
30
250
YEW,DR130
20
150
150
dc
Supply
FDD
TC
20mV – 50
1,500mm/h
RTD
Yes
Sample Rate
(Hz)
135
Yes
Yes
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Voltage Ranges
(V)
1M
Yes
0.5
10MHz
RS232
Yes
Yes
Yes
TECHRENTALS
65
Data Acquisition & Recording
Test & Measurement
Data Loggers (cont’d)
Fourier DAQPRO 8 Channel Data Logger
FOU,DAQPRO
DataTaker DT800 Data Logger
AU/NZ
Portable, hand held, battery operated 8 channel data logger. 16-bit resolution, built
in graphic LCD, for setting up, graphical display of logged data. PC communications
via USB interface. Signal inputs 0-24mA, 0-50mV, 0-10V. Temperature input
via NTC 10kOHM, 100kOHM, range -25~150OC, PT100 range -200~400OC,
T/C ranges J type, -300~1500OC, K type -250~1100OC, T type -200~400OC.
Frequency input one channel only, 20~4000Hz, sensitivity 20mV, pulse counter
one input 0~65000 counts. Memory capacity 512KB, sampling rates from 1S/Hr
to 4,000S/sec. Supplied with analysis and setting up software.
DE,DT800
Datataker DT800 Data Logger with Delogger 4Pro & Transit Case
DE,DT800-4PRO
Fourier DAQPRO8 Batter Operated hand held 8 Channel Data Logger
FOU,DAQPRO-2
AU
Portable, hand held, battery operated 8 channel data logger. 16-bit resolution, built
in graphic LCD, for setting up, graphical display of logged data. PC communications
via USB interface. Signal inputs 0-24mA, 0-50mV, 0-10V. Temperature input
via NTC 10kOHM, 100kOHM, range -25~150OC, PT100 range -200~400OC,
T/C ranges J type, -300~1500OC, K type -250~1100OC, T type -200~400OC.
Frequency input one channel only, 20~4000Hz, sensitivity 20mV, pulse counter
one input 0~65000 counts. Memory capacity 512KB, sampling rates from 1S/Hr
to 4,000S/sec. Supplied with analysis and setting up software.
DataTaker Thermapro Plus Oven Logger 16 Channel
DE,TPRO
AU
Oven and hostile environment logger. Provides in-situ 16 channels of thermocouple,
voltage and current measurement for up to 390min for 75OC, 135min for 100OC,
90min for 150OC and 25min at an ambient of 350OC. For longer periods use
DE,TPROB-240. Suitable for use on industrial oven conveyer belt systems.
DataTaker Thermal Barrier 240 mm
DE,TPROB-240
AU
Thermal barrier for DE,TPRO logger 240mm barrier 75OC @ 35h, 100OC @ 19h,
150OC @ 12h & 350OC @ 3h.
DataTaker 1Mb PCMCIA Card for DT Series 2
DE,DT-MEM1024
Memory card for DataTaker DT600 series loggers. Capacity 1.024Mb.
DataTaker Software Delogger Pro/+ & Decipher
DE,SOFTWARE
AU
Software package for the DT600, DT605 & DT50 DataTaker, Delogger Pro and
Detransfer version 2.00.
DataTaker DT500/600 Expansion Module
DE,CEM-AD
AU
Channel expansion module for DT500 & DT600 data loggers. Adds 10 differential
analogue and 20 digital state inputs. Also adds 10 digital outputs.
DataTaker DT5LTP-R One Channel Logger
DE,DT5LTP-R
AU
One channel platinum resistance probe temperature logger. Range -50~50OC
up to 0.1 resolution, -50~250OC up to 0.3 resolution. Memory store up to 4,048
readings. External probe. Lithium battery.
DataTaker DT605 Data Logger
DE,DT605
AU/NZ
Input capacity 100V. LCD display enabling use as a measuring instrument if
preprogrammed for channel parameters. Ten differential or 30 single ended
channels. Channels/sec 25. Digital inputs 4TTL/CMOS. Three counter channels
up to 1MHz. Up to 120 alarms with 1 digital I/O and 3 front panel LED’s. Internal
memory up to 11,000 readings. Optional memory card to 170,000 readings.
RS232C data communications port and RS485 port for networking up to 32
loggers. Maths processing included. Inputs voltage 25mV~2.5Vdc & 100Vdc.
Max sensitivity 2µV. Current 0.25~25mA. Current loop 4~20 mA. Resistance up
WRNŸ7KHUPRFRXSOHV%&'(*-.156DQG7IURPaOC.
Thermistors and RTD’s. Strain gauges. Supplied with Determinal and Delogger
software. Operates from internal battery, external battery or ac mains.
DE,DT605-3
AU
Input capacity 100V and built in SRAM Card Slot. LCD display enabling use as a
measuring instrument if pre-programmed for channel parameters. Ten differential
or 30 single ended channels. Channels/sec 25. Digital inputs 4TTL/CMOS.
Three counter channels up to 1MHz. Up to 120 alarms with 1 digital I/O and
3 front panel LED’s. Internal memory up to 166,530 readings. Optional 1Mb
memory card to 343,980 readings. RS232C data communications port and
RS485 port for networking up to 32 loggers. Maths processing included. Inputs
V 25mV~2.5Vdc & 100Vdc. Max sensitivity 2µV. Current 0.25~25mA. Current
ORRSaP$5HVLVWDQFHXSWRNŸ7KHUPRFRXSOHV%&'(*-.15
S and T from -250~1,800OC. Thermistors and RTD’s. Strain gauges. Supplied
with Determinal and Delogger software. Operates from internal battery, external
battery or ac mains.
Call Now
66
AU
Universal input channels 12 balanced or 42 unbalanced analog channels. Eight
bi-directional digital channels & 8 digital input channels. Solid state multiplexer
protected to ±40V. Max in/out voltage ±12V. Serial sensor channel can be used
with GPS systems. Measures V, 4~20mA, strain, TC, RTD etc. Sampling rate
200Hz up to 100kHz in burst mode. Instrument has RS232, RS422, USB, ethernet
(10baseT) and PC card modem communications. Plugable 64Mb memory card
stores up to 300,000 (compressed) readings per Mb. Instrument stores 600,000
(compressed) readings in internal memory. Total memory capacity 10.2Mb
(compressed). Supplied with Delogger 4Pro & IP67 PE-800 portable enclosure
with mounting frame.
Data Taker DT605-3 Series 3 Data Logger
AU
AU/NZ
Universal input channels 12 balanced or 42 unbalanced analog channels. Eight
bi-directional digital channels & 8 digital input channels. Solid state multiplexer
protected to ±40V. Max in/out voltage ±12V. Serial sensor channel can be
used with GPS systems. Measures V, 4~20mA, strain, TC, RTD etc. Sampling
rate 200Hz up to 100kHz in burst mode. Instrument has RS232, RS422, USB,
Ethernet (10baseT) & PC card modem communications. Plugable 64Mb memory
card stores up to 300,000 (compressed) readings per Mb. Instrument stores
600,000 (compressed) readings in internal memory. Total memory capacity
10.2Mb (compressed).
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data Acquisition & Recording
Test & Measurement
Data Loggers (cont’d)
Hioki 8421-01 16 Channel Data Logger with Colour Display
HIO,8421-01
Hioki 3641-20 Temperature/Humidity Logger with RS-232C & USB
AU
Sixteen analogue, 4 pulse input channels data logger with colour display, PCMCIA
card slot, LAN interface built in, TCP/IP communication supports real time PC
logging, FTP, SMTP and HTTP. Signal inputs 100mVdc, 1Vdc, 10Vdc, 60Vdc,
1~5Vdc fs. Thermocouples K,E, J, T, N, W (WRe5~26) R, S, B, -100~100OC,
-200~500OC, -200~2,000OC, RTD Pt100 -200~800OC. Pulse input, accumulation
50,000 counts fs, 500,000 counts fs, 5M counts fs, 100M counts fs, 2,500M counts
fs. Rotation 5,000/n (r/s) fs. Recording interval is selectable from 100, 200, 500ms,
1, 2, 5, 10, 20, 30s, 1, 2 & 5min. Max sampling rate is dependent upon type of
input signal. Internal Memory 8Mb, 256Mb Flashcard, 9334 logger communicator
software, 9642 LAN cable, 9641 pulse signal input cable all supplied.
Hioki 8421-51 16 Channel Data Logger with Colour Display
HIO,8421-51
16 Analogue, 4 pulse input channels data logger with colour display, PCMCIA card
slot, LAN interface built in, TCP/IP communication supports real time PC logging,
FTP, SMTP and HTTP. Signal inputs- 100 mVdc, 1Vdc, 10 Vdc, 60Vdc, 1-5Vdc
f.s. Thermocouples K,E, J, T, N, W (WRe5-26) R, S, B, -100~100OC, -200~500OC,
-200~2000OC, RTD Pt100 -200~800OC. Pulse input, accumulation 50,000C
f.s, 500,000C f.s, 5MC f.s, 100MC f.s, 2,500MC f.s. Rotation 5,000/n (r/s) f.s.
Recording interval is selectable from 100ms, 200ms, 500ms, 1s, 2s, 5s, 10s, 20s,
30s, 1min, 2min, 5min. Max sampling rate is dependent upon type of input signal.
Internal Memory 16MW, 512MB PCMCIA FLASH card, 9334 Logger Communicator
software, 9642 LAN cable, 9641 pulse signal input cable all supplied. Improved
common mode rejection- 100dB or better when 50/60Hz, 140dB or better when
+]XVLQJFKWRFKLQWHUYDOVGLJLWDO¿OWHU+]VHOHFWHG)DVWHUVDPSOLQJ
when using Pt100, improved temperature characteristics.
Hioki 8422-51 32 Channel Data Logger Logger
HIO,8422-51
AU
Thirty two analogue, 4 pulse input channels data logger with colour display, PCMCIA
card slot, LAN interface built in, TCP/IP communication supports real time PC
logging, FTP, SMTP and HTTP. Signal inputs: 100mV, 1, 10 & 60Vdc, 1~5Vdc fs.
Thermocouples K,E, J, T, N, W (WRe5-26) R, S, B, -100 ~100OC, -200~500OC,
-200~2,000OC. Pulse input, accumulation 50,000 counts fs, 500,000 counts fs,
5M counts fs, 100M counts fs & 2,500M counts fs. Rotation 5,000/n (r/s) fs.
Recording interval is selectable from 100, 200, 500ms, 1, 2, 5, 10, 20, 30s, 1, 2 &
5min. Max sampling rate is dependent upon type of input signal. Internal Memory
8Mb, 512Mb PCMCIA FLASH card, 9334 Logger Communicator software, 9642
LAN cable, 9641 pulse signal input cable all supplied.
HIO,3641-20
AU
Includes 1 x RS232C & 1 x USB communication base, utility software, RS232C &
USB interface cables. Temperature range -40~85OC, humidity range 0%~100%RH.
Accuracy temperature -40~-0.1OC ±1, 0~35OC ±0.5, 35.1~70OC ±1 & 70.1~85OC
±2. Humidity typical between ±5~±10%RH depends on temperature and
humidity range.
Ż1(:Ż
Hioki 3641-20-Kit of 8 Temperature & Humidity Loggers
HIO,3641-20-KIT
AU
Kit of 8 x temperature and humidity loggers. Includes 1 x RS232C and 1
x USB communication base, utility software, RS232C and USB interface
cables. Temperature range -40OC~85OC, humidity range 0.0%RH to 100% RH.
Accuracy: Temperature -40~-0.1OC +/- 1.0OC , 0.0~35OC +/- 0.5OC, 35.1~70OC
+/- 1OC, 70.1~85OC +/- 2OC. Humidity typical between +/-5 to +/-10% depends
on temperature and humidity range. 8000 data points X 2 channels, recording
interval 2,5,10,15,20,30 sec,1,2,5,10,15 ,20,30,60 min.
)RXULHU0LFURORJ7HPS+XP/RJJHU.LWZLWK:LUHOHVV&UDGOHV
FOU,MICROLOG-KIT
AU
Set of 5 temperature and humidity loggers mounted in RF transmitter cradles, one
receiver for PC. Transmission range up to 300m or RS232C & USB interface also
included if direct connection to PC for down loading required. Temperature range
-30~50OC, accuracy ±1O, 0~100%RH accuracy ±3%RH, 2 digit LCD, memory
FDSDFLW\GDWDSRLQWVEHWZHHQFKDQQHOV8VHUGH¿QHGVDPSOLQJUDWH
from 10s~2h. MicroLog Plus management control software included to control
and monitor all the loggers remotely on PC within transmission range.
Escort Temperature Humidity Logger Set of 10
ESC,HUM/T-KIT
ESC,HUM-KIT
AU
NZ
Includes software and communication base for down loading of data from loggers
to a PC. Data presented in table or graph form. Max sample rate 1min.
Escort Analogue Adaptor
ESC,ANALOGUE
NZ
Analogue adaptor for dc voltage and dc current inputs. Inputs: 0~20mA, 0~2
VDC, 0~10Vdc.
Escort Four Channel Temperature Logger
ESC,4 EXT
NZ
Range -20~60OC. Resolution 0.3OC. Accuracy 0.5OC. Stores 30,000 readings.
Supplied with software, interface and 3m long temperature sensors.
Escort Three Channel Low Temperature Logger
Yokogawa MV200 Twenty Channel Logger
YEW,MV200
ESC,3EXT-LO/SS
NZ
Twenty channel voltage, RTD and thermocouple logger. Color LCD display 10.4”
7)7UHPRYDEOH3&0&,$$7$ÀDVKPHPRU\FDUG6XSSRUWVGDWDFROOHFWLRQRYHU
ethernet networks. Supplied with RJ-45 cable and standard software.
Yokogawa Data Logger for PC Acquisition
YEW,DA100-40CH
AU
PC based datalogger with dc supply. Channels 40, 50V max input 0.05% basic
accuracy. Accepts RTD and TC inputs. Must be used in conjunction with a PC
includes analysis software. Scan rate 2s.
Yokogawa 2423A Six Channel Logger
YEW,2423A17
NZ
Portable voltage and thermometer logger. Ranges are 10, 1 & 0.1V. Type K, E, J,
T, R, S, B, L, U thermocouples. Memory stores 14,000 data points. Min logging
interval is 10s. Large LCD display, analogue and RS232 output. Supplied with
software for uploading data to CSV or TXT format.
NZ
range -40~40ºC, accuracy 0.5ºC, resolution 0.3ºC. Supplied with 3 temperature
sensors and software.
Escort Internal Temperature Logger
ESC,INT-LO
NZ
Single channel low temperature logger. Range -40~40ºC, resolution is 0.5ºC,
accuracy is 0.3ºC. Can be immersed in liquid. Stores 24,000 readings. Supplied
with software and serial interface for uploading data.
Escort pH Adaptor
ESC,PH-ADAPTOR
NZ
Glass electrode type pH adaptor probe. Range 0~14pH, resolution 0.015pH.
User calibration via offset and slope adjustment screws. Supplied with 10m
temperature compensation probe. WARNING!! Do not use the electrode in
SHUFKORUDWHVLOYHUVXOSKLGHRUDQ\K\GURÀXRULFVROXWLRQVFRQWDLQLQJPRUHWKDQ
1M acid or base, or at temperatures more than 50ºC. Use at high temperatures
may shorten the life of the electrode.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
67
Data Acquisition & Recording
Test & Measurement
Data Loggers (cont’d)
Escort Autoclave Logger
ESC,AUTOCLAVE
NZ
Temperature logger suitable for use in autoclave sterilizers. Temperature range
is 25~150ºC, resolution: 0.5ºC, accuracy: ±0.5ºC. Rated to 150ºC for 30min
RUž&IRULQGH¿QLWH0D[LPXPRIPLQHQGXUDQFHIRUGU\KHDWRYHQ#
150ºC. Stainless steel body with 1 external sensor, stores 2000 readings in
LWVPHPRU\,3UDWHGWREDU6XSSOLHGZLWKFDOLEUDWLRQFHUWL¿FDWHVRIWZDUH
and serial interface for programing & uploading.
Tiny Tag One Channel 0~20mA Current Input Logger
TIN,TGPR-0804
AU
Testo 177-H1 Logger with Displyay
MY
TES,177-H1
Parameters: Humidity/Temp/Dew Point. Sensors: Humidity Sensor/NTC(internal).
No of Channels: 4 CH. Measuring Range: 0~100%RH & -20~+70 celcius(internal).
Memory: 48,000 readings.
Testo 177-T4 Logger with Displyay
MY
TES,177-T4
Parameters: Temperature(C/F). Sensors: Thermocouple Type-K. No of
Channels: 4 CH(external). Measuring Range: -100~+1000 celcius(external).
Memory: 48,000 readings
Logger 4~20mA single channel. Readings 15,900. Re-scalable IP68 78w x 50d
x 34hmm. Two level alarm leds. Accuracy 0.6% 0.1mA.
Tiny Tag TGPR~0704~10Vdc Data Logger
TIN,TGPR-0704-10VDC
AU
Single channel 0~10Vdc logger , 8 bit A to D resolution. Stores 15,900 readings.
2 alarms with red indicator LED. Reading interval from 1s~10d. Range:
0~10Vdc, max input 14V, accuracy ±40mV, ±UGJNŸLPSHGDQFH%DWWHU\
operated.
Tiny Tag TGPR~0704~2.5Vdc Data Logger
TIN,TGPR-0704-2.5V
AU
Single channel 0~2.5V logger, 8 bit A to D resolution. Stores 15,900 readings.
2 alarms with red indicator LED. Reading interval from 1s~10d. Range 0~2.5V
range, max input 3.5V, accuracy ±10mV. Battery operated.
Instrumentation Amplifiers
9LVKD\(LJKW&KDQQHO,QVWUXPHQW$PSOLÀHU
VIS,2100
AU
(LJKWFKDQQHOVLJQDOFRQGLWLRQHUDPSOL¿HUV\VWHPFRPSULVLQJGXDODPSOL¿HUVZLWKSRZHUVXSSO\GLJLWDORXWSXWGLVSOD\DQGUDFNIUDPH$FFHSWVORZOHYHOVLJQDOVDQG
FRQGLWLRQVDQGDPSOL¿HVWKHPWRGULYHUHFRUGHUV%ULGJHEDODQFLQJIRUTXDUWHUŸKDOIIXOOEULGJHaNŸ4XDUWHUEULGJHGXPP\UHVLVWRUVSURYLGHG
*DLQa%DQGZLGWKGFaN+]DWG%N+]DWG%2XWSXW“9#P$P$LQWRŸP$LQWRŸ7\SHGLJLWDOUHDGRXWFDQEHVZLWFKHG
to each output in turn and also to an external source. Ranges ±1,999mV & 19,999mV.
Memory Recorders
Yokogawa ORP1200 8 Channel Memory Recorders
YEW,ORP1200
Hioki 8810 4 Channel Memory Recorders
AU/MY
Iin-built waveform display. Input ranges 100mV~500V. Max input voltage is 500V
peak or 350V rms ac. Memory 32k per channel, may be combined for 2 channel
128k operation. Memory may be divided into 16 blocks of 2k. 128k memory at
1kHz sampling (20 points of 50Hz cycle) gives 128s storage. Real time recording
10mm/hr~100mm/s. Real time recorder with memory trigger facility. 4 triggers
including high, low, rise, fall, with and/or facility. X-Y operation with up to 4
channels. Memory card facility for storing memory dumps and setups. Memory
card not included.
Yokogawa ORM1300 16 Analogue Channel Memory Recorders
YEW,ORM1300
Similar to YEW,ORM1200 except it has 16 analog channels rather than 8.
Yokogawa ORM1200 8 Channel Memory Recorders
YEW,ORM1200
AU
AU
Similar to YEW,ORP1200 except it has 128K RAM per channel (ie. 512K when
used as a 2 channel recorder) includes FDD.
Yokogawa DL708 8 Channel Recorder/Digital Scope
YEW,DL708E
8 channels 10M/s sampling 10 bit 8M word of memory, 1.2Gb HDD (100k/s
sampling continuously to disk). In-built printer, FDD, RS232, GPIB and VGA.
Input ranges 5mV/div~200V/div . 800V isolated input capability (using x10 probes).
,QSXW¿OWHUV))7FRORUGLVSOD\PHDVXUHPHQWRIZDYHIRUPSDUDPHWHUV6LPSOH
and advanced trigger including a window trigger.
HIO,8810
Hioki 8811 3 Analogue 8 Digital Channel Memory Recorders
HIO,8811
AU/MY
Four functions, memory X-T, continuous X-T, memory X-Y & continuous X-Y.
7KUHH FKDQQHO ;< LV SRVVLEOH ,QSXW DPSOL¿HU EDQGZLGWK aN+] OLPLWHG
by max sampling rate of 4µs in memory mode and 100~200µs in continuous
mode. Memory size per channel 8k with 8 bit resolution. Paper 110mm x 30m.
Full scale 90mm in 10 divisions. Time axis up to 160 divisions in memory mode
giving 32ms~1,600s display. Continuous mode chart speed 1s~50min/div in 12
VWHSV,QSXWÀRDWLQJP9a9GLYLQVWHSVZLWKIXOOVFDOHRIIVHW,QWHUQDOWULJJHU
with level control. External trigger TTL or contact closure. Successive transient
recording possible. Multiple recorder synchronization possible. Hioki 9306 and
9307 probes optional.
Call Now
68
AU
4 functions: memory X-T, continuous X-T, memory X-Y, continuous X-Y. 3 channel
;<LVSRVVLEOH,QSXWDPSOL¿HUEDQGZLGWKaN+]OLPLWHGE\PD[VDPSOLQJ
rate of 4µs in memory mode and 100~200µs in continuous modes. Memory size
per channel 8k with 8 bit resolution. Paper 110mm x 30m. Full scale 90mm in
10 divisions. Time axis up to 160 divisions in memory mode giving 32ms~1,600s
GLVSOD\&RQWLQXRXVPRGHFKDUWVSHHGVGLYaPLQGLYLQVWHSV,QSXWÀRDWLQJ
10mV/div~5V/div in 12 steps with fs offset. Internal trigger with level control.
External trigger TTL or contact closure. Successive transient recording possible.
Multiple recorder synchronization possible.
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data Acquisition & Recording
Test & Measurement
Memory Recorders (cont’d)
+LRNL&KDQQHO:DYHIRUP&KDQQHO0HPRU\5HFRUGHUV
HIO,8835
AU
Memory 12 bits x 100k per channel or 500k for a single channel. Analog input
channel ranges 10mV~50V/div, 10X div, 400Vdc, 240Vac rms max. In-built FDD
and type-III PC card slot. Fastest sampling rate 1MHz. Paper 110mm x 30m.
Colour TFT display. Additional functions include waveform parameter calculation
including rms values, area value, rise and fall times. AC mains operation.
+LRNL$QDORJXHORJLF&KDQQHO:DYHIRUP5HFRUGHU
HIO,8835-01
AU
Memory 12 bits x 1 megaword per channel or 4 megaword for a single channel.
Analog input channel ranges 10mV~50V/div, 10X div, 400Vdc, 240Vac rms max.
In-built FDD & type-III PC card slot. Fastest sampling rate 1MHz. Paper 110mm
x 30m. Colour TFT display. Additional functions include waveform parameter
calculation including rms values, area value, rise and fall times. AC mains
operation. Logic probes must be rented seperately.
Ż1(:Ż
+LRNL:DYH3URFHVV6RIWZDUH
HIO,9935
AU
Waveform Processor software, displays, converts to CSV, calculates and prints
ZDYHIRUPVZLWKD3&5HYLHZVWRUHGELQDU\¿OHVIURP+LRNL
DQGPHPRU\UHFRUGHUV2QO\ZD\VWRUHGELQDU\¿OHVFDQEHYLHZHGRQD3&
ZLWKRXWKDYLQJWRUHVDYHWKHPZLWKPHPRU\UHFRUGHUDV7H[W¿OHV
Hioki 9305 Trigger Cord for Hioki Memory Recorders
HIO,9305
AU
Plug each end of cable 3.5mm. Trigger cord enables master slaving of the Hioki
8835, 8810 and 8811 memory recorders. One end connected to the trigger output
socket of master recorder the other end connects to the trigger input socket of the
second recorder which is the slave. Trigger pattern set up for the master and the
slave recorder set just to external trigger.
Hioki 4 Channel Digital Probe for use with HIO,8835
HIO,9306
AU
Contact interface for HIO, 8811, 8835, 8835-01, 8841 & 8842 memory recorders.
7KUHVKROGGLJLWDO!9PD[LPXPLQSXW9&RQWDFWFORVXUHLQSXWNŸLQSXW
resistance 30V allowable input. Response time 2µs.
Hioki 9320 4 Channel Contact & Digital Logic Probe
HIO,9320
AU
For HIO, 8811, 8835, 8835-01, 8841 & 8842 memory recorders, 4 channels per
probe, max of 4 probes per recorder. Use in conjunction with 9321 line logic probe.
Threshold digital selectable 1.4V, 2.5V & 4V. Response time 500ns max. Relay
dry contact detection. Max allowable input 50Vdc.
Hioki 8841 8 Analogue, 16 Channel Memory Recorder
HIO,8841
AU/NZ
Memory 12 bits x 4 megawords/ch for 2 analog ch, to 1 megawords/ch for 8ch. InEXLOW)''W\SH,,,3&0&,$FDUGVORWIRUÀDVKFDUG+''XSWR0E6DPSOLQJ
rate of 1MHz max. Functions memory, real time record, rms, real time/memory, X-Y
memory, FFT. Trigger functions level, window in, window out, voltage drop, rms
level, cycle, logic pattern trigger 1,0 or x (disregard). When using logic channels,
logic probes must be rented seperately. Measurement range 400Vdc, 240V rms,
ORZSDVV¿OWHUV+]+]N+]RUN+]LQSXWFRXSOLQJGF*1'DF/DUJH
10.4” colour TFT display for settings and waveform display, wide thermal printer
¿WWHG2QVFUHHQKHOSIXQFWLRQ$OOVHWWLQJVDQGZDYHIRUPVFDQEHVDYHGWRPHGLD
ZDYHIRUPVFDQEHVDYHGDVELQDU\WH[WRUEPS¿OHV
+LRNL$QDORJXH/RJLF&KDQQHO:DYHIRUP5HFRUGHU
HIO,8842
Hioki 9321 Line Logic Probe
AU
Memory 12 bits x 16 megawords/ch for 2 analogue ch, to 2 megawords/ch for 16
ch. Analogue input channel ranges 10mV~50V per div, 10X div, 400V dc, 240V
DFUPVPD[,QEXLOW)''W\SH,,,3&0&,$FDUGVORWIRUÀDVKFDUG+''XSWR
520Mb). Sampling rate of 1MHz max. Functions memory, real time record, rms,
real time/memory, X-Y memory. Trigger functions level, window in, window out,
voltage drop, rms level, cycle, logic pattern trigger 1,0 or x (disregard). When using
logic channels, logic probes must be rented seperately. Measurement range 400V
GF9UPVORZSDVV¿OWHUV+]+]N+]RUN+]LQSXWFRXSOLQJGF
GND, ac. Large 10.4” colour TFT display for settings and waveform display, wide
WKHUPDOSULQWHU¿WWHG2QVFUHHQKHOSIXQFWLRQ$OOVHWWLQJVDQGZDYHIRUPVFDQEH
VDYHGWRPHGLDZDYHIRUPVFDQEHVDYHGDVELQDU\WH[WRUEPS¿OHV
HIO,9321
AU
Four channels (insulated) per probe. Detection of 60~150Vac, 170~250Vac,
20~150Vdc & 70~250Vdc in 2 ranges. Response time slope rise 1ms, fall 3ms.
Max input low range 150V rms, high range 250V rms. Max rated voltage to earth
250V rms. Connector cable 1.5m. Probe tip cable 1m.
Hioki Kit of Three 9322 High Voltage True rms Interface
HIO,9322-KIT
AU
Used with many memory recorders, eg. Hioki 8835. Operating modes 3. DC
mode for waveform monitor output dc to 3MHz, ac mode detection of power surge
QRLVHN+]a0+]5HFWL¿HGWUXHUPVRXWSXWRIGFDFYROWDJHV+]aN+]
response speed 200ms or less. Max voltage dc 2kV, ac 1kV CATII, ac/dc 600V
CATIII, balanced differential input 1/1,000 divider.
Call Now
70
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Data Acquisition & Recording
Test & Measurement
Memory Recorders (cont’d)
Hioki 520 Mb PCMCIA Hard Disk for HIO,8835 & 8841
HIO,8835-HD520
AU
'DWDFDQEHVWRUHGDVPHP¿OHZKLFKLVELQDU\GDWDFDQEHUHSOD\HGRQUHFRUGHU
W[W¿OHZKLFKLVWH[WVRDVGDWDFDQEHUHDGXVLQJH[FHOEPS¿OHVRVFUHHQGXPSFDQ
EHVDYHGIRULPSRUWWRZRUGGRFXPHQWVLQJOHRUGXDO))7ELQDU\¿OHIRUSOD\EDFN
RQUHFRUGHU)LOHFDQEHVDYHGDVVHWWLQJ¿OHXVHIXOIRUFXVWRPHUVZKRUHQWWKH
PHPRU\UHFRUGHUIRUVDPHDSSOLFDWLRQVDJDLQ7UDQVIHU¿OHVWRD3&DQGUHORDG
next time recorder is rented, saves time in use of recorders. Card can be plugged
LQWRD3&0&,$7\SH,,,VORWRQDODSWRS¿OHVFDQEHVWRUHGRUYLHZHG
Hioki 9555 Current Sensor
Hioki 9132 Clip-on ac Current Transducer
HIO,9132
AU/NZ
Ranges 20~1kA fs. Short term overload capability 2kA. Output 0.2Vac. For use
with Hioki 8800 series recorders, for current waveform recording.
Hioki 9018-10 500A ac Clamp-On Transducer
HIO,9018-10
AU
Selectable ranges 10~500A. Output voltage 200mVac fs per range selected. Up
to 3kHz frequency response. BNC connection.
Hioki 3270 Sensor with 150A ac/dc Clamp-On Transducer
AU
HIO,3270-9276
For HIO,9278 clamp on CT. Output designed for waveform recording and depends
on CT.
Frequency bandwidth dc to 1MHz, rated output 1.5V for fs of range. Clamp
20mmØ. Suitable to view waveforms with memory recorders.
Sandisk Compact Flash Card 512MB with PCMCIA Adaptor
AU
Hioki 9555 Signal Conditioner with 9278 200A ac/dc Clamp-On
Transducer
HIO,9555
COM,FLASH512MB
Compact Flash Card 512MB typeI with PCMCIA Adaptor.
Hioki 9278 Universal Clamp-on CT
HIO,9278
For use with HIO,9555. Range 0~200A, dc 100kHz, 20mmØ max jaw.
AU
AU
HIO,9555-9278
AU
Frequency bandwidth dc to 100kHz, rated output 2V for fs of range. Clamp
20mmØ. Suitable to view waveforms with memory recorders.
Hioki 9304 Input Attenuator for 8800 Series Recorders
HIO,9304
Max input 600Vdc/ac peak.
AU/NZ
Strip Chart Recorders
Yokogawa 3057-22 2 Pen Portable Recorder
YEW,3057-22
AU/NZ
Twelve input ranges 10mV~50V fs, 150mm x 15m Z fold or roll chart, speeds
20mm/h~600mm/min. Accuracy 0.5%. Power 240/50Hz, rechargeable NiCad
battery or 12Vdc external.
Yokogawa 3712-31 3 Pen Vertical Chart Recorder
YEW,3712-31
AU
Input ranges dc voltage 10mV~200V fs. Thermocouples including type T & K. Chart
speed 10mm/h~20mm/s. Pen offset compensation. Memory card optional.
Yokogawa 3712-41 4 Pen Vertical Chart Recorder
YEW,3712-41
AU
Input ranges: dc voltage 10mV~200V fs. Thermocouples including type T &
K. Chart speed 10mm/h~20mm/s. Pen offset compensation. Memory card
optional.
Yokogawa 3750 10 Channel Multipoint Recorder
YEW,3750
YEW,3750-DC
YEW,3760
AU
$QDORJXHDQGGLJLWDOSULQWRXW7HQFRORXUZLWKFKDQQHOLGHQWL¿FDWLRQQXPEHU6FDQV
in 2s. Chart speeds 1~1500mm/h. Inputs dc (20mV~50V range), thermocouple
(R, S, B, K, E, J, T, L, U, N, W, Kp) & RTD. Memory card reader. Memory card
included with several typical set-ups.
Yokogawa DR130 Hybrid 20 Channel Recorder FDD
YEW,DR130
AU
,QFOXGHV´)'',QSXWXQEDODQFHGÀRDWLQJP9a9GF7&57'DQGFRQWDFW
Accuracy 0.05%. Reads 20 channels in 2s. Recording width 150mm. Data can
be saved to 500k of internal RAM either directly or due to alarm conditions. The
VDYHGGDWDFDQEHFRSLHGWRD´)''¿OHVXLWDEOHIRULQFOXVLRQLQVWDQGDUG
spreadsheet programmes.
Yokogawa 512K Memory Card for Yokogawa Recorders
YEW,MEM512
AU
Ten channel hybrid recorder. Input ranges dc 20mV~20V, thermocouple, RTD.
Scans 10 channels in 2s. AC mains operation.
Yokogawa 3750-DC 20 Channel Hybrid Recorder
Yokogawa 3760 30 Channel Recorder
AU
Memory card 512k. For YEW,3750, YEW,3760, YEW,3712-31 YEW,3712-41 and
YEW,3701-85 recorders.
AU
Input ranges dc 20mV~50V, thermocouple & RTD. Scans 20 channels in 2s.
2SHUDWHVIURPa9H[WHUQDOGF56&LQWHUIDFHRSWLRQ¿WWHG
Voltage Current Recorders
Tech-Rentals CT Terminations for Hioki 8710, etc
TR,CT-5
AU
Termination box for 5A output current transformers. For use mainly with
+,2&RPSULVHVTXDQWLW\VKXQWVŸ2XWSXW9#$8VHZLWK
DRA,TR2015’s.
Hioki 8206 2 Channel Voltage & Current ac Chart Recorder
HIO,8206
AU
The chart records a true rms. Equivalent reading. AC voltage channel, 3 ranges
50~140V, 100~280V & 250~600V. AC current channel, 0~10, 0~20, 0~50, 0~100,
0~200 & 0~500. Chart speeds 600mm/h~20mm/h. Note the supplied 9651
clamp-on current probe will measure max 46mmØ conductor. Frequency range
of the clamp 40Hz~1kHz.
Hioki 8710 3 Channel ac/dc Recorder
HIO,8710
AU/NZ
Intended mainly for recording ac line voltage and current. Data is recorded
graphically and printed. Input voltage ranges 70~750V rms ac in 4 ranges with
optimised scale, 0.05~7.5V dc in 5 ranges. AC current ranges using 9008 and
9132 clamp-on probes 10~1000A. Uses type 9221 thermal paper 110mm x 30m.
The recorder is suitable for voltage measurements from PAM thyristor inverters
but not all voltage levels with PWM inverters. Chart speed up to 30 div/min (1div
is 9mm). Response time 0.6s.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
71
Data Acquisition & Recording
Test & Measurement
Tape Recorders
Teac MR-10 Instrumentation Tape Recorder
TEA,MR-10
AU
Four channel instrumentation recorder using Philips C90 audio cassette. Six
tape speeds from 11.9~381mm/s. Max bandwidth 10kHz. Operates from ac
mains only.
Teac 16 Channel DAT Instrumentation Recorder
TEA,RD145T
AU
16 channel DAT instrumentation/data tape recorder. 4ch~20kHz, 8ch-10kHz,
16ch~5kHz, ac/dc operation. Ch 1 can be selected for analogue or 14-bit digital.
Data recorded at slow speeds can be played back at double speed. Input ranges
9SLPSHGDQFHNŸXQEDODQFHGRXWSXWUDQJHVa9SYDULDEOH
LPSHGDQFHŸXQEDODQFHG$&RUa9GFRSHUDWLRQ
Plotter Printer
HP 7440A 8 Pen Plotter
HP,7440A
MY
0HGLDVL]HV;PP,62$;LQ$16,$5HJXODUSORWWHUSDSHUJORVV\SUHVHQWDWLRQSDSHUIDVWGU\RYHUKHDGWUDQVSDUHQF\¿OP¿EHUWLSSHQVDXWRPDWLF
pen changing & capping. Max plotting area: Y-axis 191mm (7.5in) for A & A4 size paper, X-axis 257mm (10.1in) for A size paper.
Resolution: addressable step size:
0.025mm (0.001 in). Pen Velocity: pen up 52 cm/s (20 in/s). pen down max 40 cm/s (16 in/s), programmable 1 to 40 cm/s in 1 cm/s increments. Acceleration: approx
1.2 g’s. Interface Options: RS-232-C/CCITT V.24 Asynchronous serial, ASCII, 60-byte buffer size.Switch selectable baud rates: 75~9600. Switch selectable parity: odd,
even, or off. HPIB: Switch selectable addresses: 0~31 (31 sets listen-only mode). Size: 308(d) x 460(w) x 125(h)mm. Weight: Plotter 4.1kg. Power supply 1.4kg.
Did you know?
TECHRENTALS offers rental with an option to purchase
(RPO).
When you enter into an RPO you can exercise your
oprtion to purchase the rented equipment after the
agreed minimum rental term.
RPO is an ideal arrangement for companies who need
to conserve capital, allocate expenditure, preserve
credit and optimise asset management over the longer
term.
Our friendly staff will be pleased to provide details.
Some conditions may apply , not available for all equipment.
Call now!
Call Now
72
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Physical Measurement
Test & Measurement
High Speed Video
Redlake Motionscope SR500 High Speed Video
Redlake Motionmeter High Speed Digital Camera
RED,MOTIONMETER
AU/NZ
Up to 1,000frames/s, selectable 50, 60, 125, 250, 500 & 1,000frame/s, exposure
UDWHV;;;;;;;WKHUHFRUGLQJUDWH0DQXDOUHFRUGWULJJHU
record, adjustable pre trigger 0~100%. Storage 4,098 frames. Playback rates
IUDPHV 2XWSXW FRPSRVLWH
YLGHR176&RU3$/PRQRFKURPHDOVRVXSSOLHGZLWKYLGHRWR86%FRQYHUWHU
ÀRRGOLJKWVDQGWULSRG
RED,SR500
AU
Triggering facilities similar to a digital oscilloscope. 2,048 frames can be captured
up to 500frames/s. Shutter speeds 1/60~1/5,000s. Images can be viewed from
a frame by frame basis to real time. Monochrome image. PAL video output. TTL
trigger input. Use any standard oscilloscope to supply the signal. C mount interface
on camera. System with C mount adaptor can be used with endoscope.
Redlake 1000 Frames/Sec Motion Scope
RED,S1000
AU
Triggering facilities similar to a digital oscilloscope. 4,096 frames can be captured
at up to 1,000frames/sec. Images can be viewed from a frame by frame basis to
UHDOWLPH6KXWWHUVSHHGVaV0RQRFKURPHLPDJH[[ELW
pixels. Weight 5.5kg. PAL video output. Trigger input TTL. Use any standard
oscilloscope to supply the signal. Adaptor can be used with endoscope.
Orion VPDC ac/dc Powered Video Recorder
ORI,VPDC
AU
PAL B/G portable video recorder includes NTSC Playback on PAL TV. Two rotary
heads, helical scanning system, 1 track audio.
Orion 10VRKT 23cm TV with built in VCR
ORI,10VRKT
AU
$&GFFRPELQDWLRQ´FPFRORXU79DQGYLGHRUHFRUGHU79FKDQQHOV9+)
UHF, audio output power 1.2W max. VCR PAL B/G, 2 head. Power 240Vac,
12Vdc. Supplied with remote control.
Pressure Vacuum Gauges/Recorders
Model
Type
Pressure (Bar)
BRI,1000-NATA
BRI,10000-NATA
Pressure recorder
690
Pressure logger
BRI,5000-NATA
HOB,PRES
STE,1000-NATA
69
690
Pressure gauge
&(&%$5
Yes
0.5%
1% fs
TR,PRESS-NATA
CEC,140BAR
Accuracy
STE,10000-NATA
STE,5000-NATA
NATA
69
Yes
0.5%
No
±0.1%
100
140
Digital gauge & logger
Tech-Rentals 4000, 6000 & 10000 KPA Pressure Gauges NATA
Calibrated
TR,PRESS-NATA
Stewart Buchanan 12 1,000 PSI Gauge NATA
STE,1000-NATA
AU
Three pressure gauges. Accuracy ±0.5% 4,000kPa, 6,000kPa & 10,000kPa.
Bristol Babcock 1,000 PSI Mech Chart Recorder
BRI,1000-NATA
BRI,5000-NATA
BRI,10000-NATA
Circular pressure chart recorder 10,000psi. 12”Ø. Accuracy ±0.5% NATA
calibrated. Fitted with 2 speed spring wound chart drive giving 7d or 24h
recording. Pressure connection ¼”NPT.
Stewart Buchanan 12 5,000 PSI Gauge NATA
AU
Stainless steel, accuracy ±0.5% NATA calibrated. Pressure connection ¼”NPT.
Stewart Buchanan 12 10,000 PSI Gauge NATA
STE,10000-NATA
AU
Stainless steel, accuracy ±0.5% NATA calibrated. Pressure connection ¼”NPT.
AU
Circular pressure chart recorder 5,000psi. 12”Ø. Accuracy ±0.5% NATA
calibrated. Fitted with 2 speed spring wound chart drive giving 7d or 24h
recording. Pressure connection ¼”NPT.
Bristol Babcock 10,000 PSI Mech Chart Recorder
AU
Stainless steel, accuracy ±0.5% NATA calibrated. Pressure connection ¼”NPT.
STE,5000-NATA
AU
Circular pressure chart recorder 1,000psi. 12”Ø. Accuracy ±0.5% NATA
calibrated. Fitted with 2 speed spring wound chart drive giving 7d or 24h
recording. Pressure connection ¼”NPT.
Bristol Babcock 5,000 PSI Mech Chart Recorder
AU
XP2i Digital Gauge & Logger 140Bar
CEC,140BAR
NZ
Intrinsically safe high accuracy temperature compensated pressure data logger
ZLWK,$1=FDOLEUDWLRQFHUWL¿FDWH5HFRUGVXSWRSUHVVXUHPHDVXUHPHQWV
Recording intervals or 1s~8h. Data download and analysis on any Windows
equipped laptop or PC. Data can be saved directly into MS Excel. Internal
EDWWHU\SRZHUVXQLWXSWRP&DQEHXVHGDVDUHIHUHQFHJDXJHZLWKRU
without a hand pump.
XP2i Digital Gauge & Logger 30Bar
&(&%$5
1=
As per description above.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
73
Physical Measurement
Test & Measurement
Pressure & Humidity Transducers
Model
Type
Analog
Out
Pressure
(Bar)
ASH,1000
1,000
DRU,PTX1400-4
4
DRU,PTX1400-25
4~20mA
DRU,PTX1400-40
DRU,PTX1400-400
DRU,PTX1400-600
Pressure
Operating Temperature
(°C)
0~1V
4~20mA
*(0%*&$8$
.8/+(0
High temp pressure
ROT,HTO45R001V
Temp & humidity
SHA,P1041-10000
Vacuum
25
40
42
*(0%*%$8$
0~100mV
24
100
<270
0~1V
0~100mV
25~90
0~5V
690
280mBar
Pressure
6+$3
5~50
715
SHA,P1241-500
SHA,P1241-10000
Yes
Yes
25
SHA,P1241-5000
Yes
TRA,8204-ID-20A
4~20mA
1
TRA,8891-4-10V
0~10V
4
4~20mA
4
TRA,8891-4-20A
9$,+03<
Temp & humidity
9$,+03<
Temp & humidity
Yes
0~100 %
0~5V
0~100 %
VEG,BAR20
1
(+30&%$5
a
E&H,PM-1BAR
1
Pressure
4~20mA
10
JUM,40BAR
40
-25~70
-40~85
Druck 580 PSI 40Bar Pressure Transducer 4~20mA
Ż1(:Ż
Druck PTX1400-25 25Bar Pressure Transducer 4-20mA
Yes
4
40
100
-80%$5
DRU,PTX1400-25
NATA
600
)/8391$7$
E&H,PMP-4BAR
E&H,PMP-40BAR
E&H,PMP-100BAR
Humidity
(%)
400
)/839
6+$3'
Differential
DRU,PTX1400-40
AU
3UHVVXUHWUDQVGXFHUaP$RXWSXWa%DUSVLLQSXW5HTXLUHVa9'&
Supplied with 12V, 500mA power pack.
AU
5HTXLUHVa9GF6XSSOLHGZLWK9SOXJSDFN
Druck PTX 1400 600Bar/9,000 PSI Pressure Transducer
DRU,PTX1400-600
AU
2XWSXWaP$5HTXLUHVa9GF6XSSOLHGZLWK9SOXJSDFN
Druck PTX1400 400Bar/6,000 PSI Pressure Transducer
DRU,PTX1400-400
AU
2XWSXWaP$5HTXLUHVa9GF6XSSOLHGZLWK9SOXJSDFN
Druck PTX1400 4Bar/60PSI Pressure Transducer
DRU,PTX1400-4
AU
2XWSXWaP$5HTXLUHVa9GF6XSSOLHGZLWK9SOXJSDFN3UHVVXUH
input connector G ¼” female.
74
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Physical Measurement
Test & Measurement
Pressure & Humidity Transducers (cont’d)
Vega Bar 20 0~1Bar Transducer with Display
(QGUHVV+DXVHU~3Bar Transducer
E&H,PMC-1~%$5
1=
3UHVVXUHWUDQVGXFHUZLWKÀXVKIDFHGLDSKUDP$FFXUDF\RI)60LQLPXP
vacuum 10mbar. Operating temp is -25~70ºC. Response time is 90% of FS in
PV2XWSXWaP$3UHVVXUHFRQQHFWLRQò´%63
(QGUHVV+DXVHU%DU7UDQVGXFHU
E&H,PMP-1BAR
NZ
3UHVVVXUHWUDQVGXFHUZLWKÀXVKDEOHGLDSKUDJP$FFXUDF\RI)62SHUDWLQJ
WHPS LV až& 5HVSRQVH WLPH LV RI )6 LQ PV 2XWSXW a P$
3UHVVXUHFRQQHFWLRQò´%63
(QGUHVV+DXVHU%DU7UDQVGXFHU
E&H,PMP-4BAR
NZ
Description as per E&H,PMP-4BAR
VEG,BAR20-1
AU
6XSSO\UHTXLUHGa9GF2XWSXWaP$/&'GLVSOD\DQGLVUDWHG,3
Over pressure resistant to 10bar & -1bar. Measurement accuracy 0.5%, linearity
deviation 0.085%. May be set to bar, psi, kpa, mpa, mmH2O, mH2O & mbar.
Output can be 4~20mA or 20~4mA. Integration time 0~10s. Density factor may
be entered for mm & m, output simulation indication module has 20 segment bar
JUDSKDQGGLJLWGLVSOD\ZKLFKPD\EHVFDOHGKDVIDFWRU\GHIDXOWUHVHW
Schaevitz P53363 500 PSI, 0~5V Pressure Transducer incl Snubber
6+$3
$8
Output 0~5V.
Schaevitz P1241 500PSI Pressure Transducer
SHA,P1241-500
AU
Output 0~5 V. Port ¼”%63I2SHUDWLRQ9GFRUPDLQV
(QGUHVV+DXVHU%DU7UDQVGXFHU
E&H,PMP-40BAR
NZ
Description as per E&H,PMP-4BAR
Fluke PV350 Vacuum/Pressure Indicator
)/839
(QGUHVV+DXVHU%DU7UDQVGXFHU
E&H,PMP-100BAR
Description as per E&H,PMP-4BAR
NZ
1=
)OXNH399DFXXP3UHVVXUH,QGLFDWRU1$7$&HUWLÀFDWH
Jumo 1030 10Bar Pressure Transducer
-80%$5
$8
&DQEHXVHGZLWKDGLJLWDOPXOWLPHWHUHJ0HWUL[0;WRDFWDVDQLQGLFDWRU
5DQJH SUHVVXUH WR SVL N3D YDFXXP a´+J aFP+J Results in either psi or kPa. Connector ½”137 P &DEOH P SURYLGHG
Battery powered.
Pressure transducer with 4~20mA output. Accuracy is 0.5%. Temperature range
LVaž&UHVSRQVHWLPHLVPV
)/8391$7$
Jumo 40Bar Pressure Transducer
Schaevitz P1241 10,000PSI 0~5V Pressure Transducer incl Snubber
JUM,40BAR
NZ
Pressure transducer with a 4~20mA output. Accuracy is 0.5%. Temperature range
LVaž&UHVSRQVHWLPHLVPV
SHA,P1241-10000
Pressure transducer 10,000psi, includes snubber, 0~5V output.
Ashcroft 1,000 Bar Pressure Transducer
ASH,1000
Schaevitz P3061-4D 4PSI Differential Pressure Transducer
6+$3'
$8
6SHFL¿FDWLRQDVDERYHEXWZLWK1$7$FHUWL¿FDWH
$8
AU
AU
5DQJHa9GFVXSSO\2XWSXWaP$ Connection ¼”1370
´ZDWHUJDXJHSVL/9'7W\SHZLWKEXLOWLQDPSOL¿HU2XWSXWa9GF2SHUDWHV
IURPa9GFRUDFPDLQV
*(0%*&$8$%DU3UHVVXUH7UDQVGXFHU
Kulite 5,000PSI High Pressure Temperature Transducer 260 C
&DQEHXVHGZLWKDGLJLWDOPXOWLPHWHUHJ0HWUL[0;WRDFWDVDQLQGLFDWRU
Transducer could be used with a chart recorder or data logger that can accept
aP$ VLJQDO LQSXW 3UHVVXUH UDQJH LV %DU .3D RU SVL
Transducer has a 4~20mA output. Power supply and connection leads are
supplied.
O
.8/+(0
Includes 10V regulated supply. Output 0.020mV/psi.
Trafag 8891 4Bar/58 PSI, 0~10 V, Pressure Transducer
TRA,8891-4-10V
$8
AU
Accuracy ± IV 2YHUSUHVVXUH EDU SVL 2XWSXW a9 3UHVVXUH
connection G ¼” male. Bandwidth 1kHz. Media temperature 125OC. IP65 rated.
3RZHUVXSSO\a9
Trafag 8891 4Bar, 58 PSI, 4~20 mA, Pressure Transducer
TRA,8891-4-20A
AU
Accuracy ±IV2YHUSUHVVXUHEDUSVL2XWSXWaP$3UHVVXUH
connection G ¼” male. Bandwidth 1kHz. Media temperature 125OC. IP65 rated.
3RZHUVXSSO\a9
Trafag 8204 1 Bar ,14 PSI, 4~20 mA, Differential Pressure Transducer
TRA,8204-1D-20A
AU
Accuracy ±IV2YHUSUHVVXUHEDUSVL2XWSXWaP$3UHVVXUH
connection G ¼” male. Bandwidth 1kHz. Media temperature 125OC. IP65
rated.
*(0%*&$8$
$8
Rotronic Temperature/Humidity Transducer for DataTaker DT600/605
ROT,HTO45R001V
AU
For use with DataTaker DE,DT600 or DE,DT605, etc. Humidity range 25~90%RH
P95+DFFXUDF\UHVROXWLRQ7HPSHUDWXUHUDQJHaOC, 10mV/1OC
accuracy 1O, rep 0.2OC. Supply 4.8~24Vdc draws 4mA. Datataker will supply
around 100mA through switched supply. Response time 10s humidity, 20s
temperature. Duct mount model 120mm long x 25mmØ.
Vaisala HMP 235Y 180OC Humidity Probe
9$,+03<
$8
High temperature humidity and temperature transmitter. Sensor head operates
from 0~180OC. Measurement range 0~100%RH. Accuracy of 1%RH at 20OC.
Output 0~5Vdc. Other outputs easily set including 4~20mA. Operates from
a9GFRUDFPDLQV
Vaisala HMP 135Y 160OC Humidity Probe
9$,+03<
6DPHVSHFL¿FDWLRQDVDERYHEXWVHQVRUKHDGRSHUDWHVIURPaOC.
$8
Position Transducers
Houston 1850-40 Position Transducers
HOU,1850-40
AU/NZ
/LQHDULW\WUDYHO´P&DEOHWHQVLRQJ0D[YHORFLW\FPV2XWSXW
LVDYDULDEOHUHVLVWDQFHDUUDQJHGWRSURYLGHERWKKLJKOHYHO9DQGORZOHYHOP9
outputs when powered from an external source.
8QLPHDVXUH33RVLWLRQ7UDQVGXFHU
UNI,P510-40
AU
7UDYHO ´ P 2XWSXW a9 RU a9 VHOHFWDEOH 5HTXLUHV a9GF
source.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
75
Physical Measurement
Test & Measurement
Inclinometers
:\OHU&OLQLWURQLF,QFOLQRPHWHU56&
WYL,CL45
AU/MY
Resolution 0.01O$FFXUDF\EHWWHUWKDQDUFVHF'LVSOD\LQFOLQDWLRQLQDOOFRPPRQPHDVXUHPHQWV,QFOXGHV56LQWHUIDFHIRUUHPRWHGLVSOD\RILQFOLQDWLRQDQG
also logging. Settling time <5s.
Distance Measurement & Surveying
'LJLUROO3OXV0HDVXULQJ:KHHO6XUYH\LQJ
DIG,PLUS
AU
Measuring wheel. For linear measurement and, area and volume calculation of
construction sites and buildings, etc.
Leica Disto Pro Laser Distance Measurement
LEI,DISTOPRO
AU/NZ
Typical accuracy ±1.5mm. Will average over 8 measurements for greater accuracy.
Built in function for height measurement and enclosed angles,etc. Memory can be
divided into groups, e.g. 200 groups with 5 measurements. Includes PC interface
DQGVRIWZDUHWHOHVFRSHWRKHOS¿QGGRWLQGD\OLJKWDQGEXEEOHOHYHOWRHQDEOH
horizontal measurement.
Mitutoyo 500-172 Digimatic Caliper
MIT,500-172
Phantom 53550 Radar Gun kph, with Case and Tuning Fork
3+$
$8
3URIHVVLRQDO GRSSOHU . EDQG *+] VWDWLRQDU\ UDGDU JXQ )DVW DFWLRQ
pull the trigger and the speed display appears instantly. Unit is invisible to all
UDGDU GHWHFWRUV 3RZHU UHTXLUHPHQWV a9GF 9GF QRPLQDO $
max, external source, connection via 6’ coiled power cord with fused lighter plug.
2SHUDWLQJHQYLURQPHQWaž&5+#ž&QRQFRQGHQVLQJ$FFXUDF\
“NSK $FFXUDF\ YHUL¿FDWLRQ WXQLQJ IRUN .%DQG LQWHUQDO NSK 6SHHG
UDQJHaNSK
AU
5DQJHaPPa´UHVROXWLRQPP´$EVROXWHPHDVXUHPHQW/&'
display. Temperature operating range 0~40OC, storage temperature -10~60OC.
Button settings ON/OFF, inch/mm. Origin, zero/ABS.
-HQRSWLN/(0*(2/DVHU5DQJH)LQGHU6SHHG*XQ
-(1/(0*(2
$8
,QFOXGHVSUHFLVLRQLQFOLQRPHWHUDQGFRPSDVV0HDVXUHVXSWRPKRUL]RQWDO
or sloping distances. Distance measurements updated at 50Hz so accelerations
FDQEHDQDO\VHGYLD56LQWHUIDFH2YHUDOODFFXUDF\±10cm. Rechargeable
batteries.
Hilti PR50 Rotating Laser Level
HIL,PR50
Mitutoyo Absolute Digimatic Height Gauge Caliper
0,7
$8
Digital height gauge for measurement of height of small components/parts.
)XQFWLRQV RULJLQ DEVROXWH RULJLQ VHWWLQJ$%6 DEVROXWH PHDVXUHPHQW ,1&
LQFUHPHQWDOPHDVXUHPHQWKROG0HDVXUHPHQWUDQJH´PPUHVROXWLRQ
0.0005”/0.01mm, error ±0.0020”/0.05mm, display 6 digit LCD.
AU
For facade installations, suspended ceilings, excavations, etc. PR50 is a self
OHYHOLQJURWDWLQJODVHU6\VWHPLQFOXGHVWULSRGDQGVW\OHVRIVLJKWWKH¿UVWPDNH
on audible alarm when the laser is detected, and the second when detected the
V\VWHPRVFLOODWHVRQWRSURYLGHJRRGGH¿QLWLRQRIWKHODVHULQKLJKDPELHQWOLJKW
conditions. Accuracy ±0.7mm in 10m horizontal, ±0.9mm in 10m vertical. Laser
UDQJHPRUPRUHZLWKEHDPFDWFKHUPRUPRUHZLWKODVHUGHWHFWRU
Hilti PM10 Multi Directional Laser
HIL,PM10
AU
7ULSOHODVHUDOLJQPHQWV\VWHP,QVWUXPHQWSURGXFHVYLVLEOHODVHUVHDFKDWO.
Supplied with contractors kit including clamps, magnetic bracket, targets in case.
$FFXUDF\“PPLQPVHOIOHYHOLQJIURP“O to horizontal.
Tachometers/Stroboscopes
Monarch Phaser Strobe Battery Operated
MON,PHASER
AU
Phaser-stroboscope includes optical and magnetic pickup. Operates from internal
re-chargable batteries or mains. Auto step mode provides slow motion appearance
IRUKLJKVSHHGUHSHWLWLYHHYHQWV6WRUHVDQGUHFDOOVODVWIXOOVHWWLQJVLQPHPRU\
6SHFL¿FDWLRQVaIPLQRUaIV$FFXUDF\“)ODVKUDWH
H[WHUQDOWULJJHULQJaIPLQaIVaIPLQ3KDVH
delay facility.
76
Hioki 3404 Optical/Contact Tachometer
+,2
$81=
$XWRUDQJLQJ GLJLW GLVSOD\ 5DQJHV LQ 530 PRGH a a 1,000~9999 x 10. Ranges in RPS mode 0.5~99.99, 100~999.9 & 1,000~1,600.
Analogue output 1mV/10RPM or 1mV/100RPM, accuracy 4%. Tripod mounting.
Internal battery or external ac operation. Contact adaptor included with cone and
peripheral ring.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Physical Measurement
Test & Measurement
Endoscopes
Model
Type
Diameter mm
FIB,MTFS15-1000
1.5
02506*,
025063,
MAC,FB5-1400A
8
Fibreoptic endoscope
Length - Metre
Semi rigid
1.25
8
OLY,IF11D4-20
11
OLY,IV6C6-20-ZOOM
6
2/<,9&
None
2/<,)&
OLY,IV6C5-20
Articulation
1
2 way
4 way
2
51
Video endoscope
2/<,9'
2 way
6
4 way
8.4
2
4 way
OLY,IPLEX-MX
6
4 way
OLY,CYF-E
6
2 way
12
0.95
4 way
9.1
None
FUJ,UGI-FP2
AQU,SNAKEEYE
Fibrescope endoscope
&RORXUYLGHRÀH[LEOHFDEOH
WHO,VIPER CAMERA KIT
Option for Minispring
51
-
Rotating head
WOH,MINISPRING
Colour video rigid push rod
22
20
None
WOH,VIS2000
&RORXUYLGHRÀH[LEOHFDEOH
51
5$'*$725&$0
RAD,GATORCAM-25-60
PEA,FLEXI-CAM
B&W videoscope and recorder
25
Colour video pipeline inspection system
6
Borescope
6<.$57+52
DYO,750
Rotating head
60
None
15
+(,7(&+12;
2/<*
PP
10
PP
4
180mm
Camera and video processor
Pearpoint Flexi-Cam Pipeline Inspection System
PEA,FLEXI-CAM
AU/NZ
:RKOHU9,6P[PP6WHHUDEOH&RORU&DPHUD
WOH,VIS2000
AU
&RPSDFW FRORXU YLGHR PP FRORXU FDPHUD ZLWK OX[ VHQVLWLYLW\ OLJKW VRXUFH
ZKLWH/('¶VRQPRIIXOO\UHWUDFWLQJÀH[LURG)OH[LFDPQDYLJDWHVPXOWLSOH
90OEHQGVLQPPSLSHVDQGLPDJHVDUHGLVSOD\HGRQWKHLQWHUQDOFRORXU7)7
VFUHHQ,PDJHVFDQEHUHFRUGHGWRDQH[WHUQDOYLGHRUHFRUGHUQRWVXSSOLHG
System operates from internal fully rechargeable batteries which provide up to
5h of continuous use when fully charged. Hand-held portability. Fully waterproof,
manually set focus camera. Inspects pipes 25~100mm.
)RULQVSHFWLRQRIYHQWLODWLRQGXFWVFKLPQH\VFKDPEHUVDQGÀXHJDVV\VWHPV
etc. Kit consists of color display with joy stick to control the camera. Flexible
PFDEOHRQDUHHOZLWKQRQZDWHUSURRIVSODVKUHVLVWDQWPP‘FRORXUFDPHUD
ZLWKLOOXPLQDWLRQ$FFHVVRULHVLQFOXGHGWRDVVLVWIRUFKLPQH\LQVSHFWLRQD¿[WXUH
to allow the camera to be lowered down chimneys, a guide to centre the camera
inside chimney-like spaces and a holder to allow the camera to look up rather
than down.
Radiodetection Gatorcam-25-30 Drain Video Inspection System
:RKOHU9LSHU&DPHUD.LWIRU0LQLVSULQJ
5$'*$725&$0
$8
0RQRFKURPHYLGHRVFRSHP[PP‘.LWLQFOXGHVYLGHRGLVSOD\DQG9&5
FRPELQDWLRQDQGN+]VRQGHFDSDELOLW\VRWKHFDPHUDORFDWLRQFDQEHGHWHUPLQHG
XVLQJWKH5$'5'3;/+DV¿[WXUHVWRFHQWUHWKHFDPHUDLQODUJHUGLDPHWHU
pipes. Camera includes variable illumination. Length of cable extended is
displayed and comments can be added to the image.
Radiodetection Gatorcam-25-60 Drain Video Inspection System
RAD,GATORCAM-25-60
AU
Monochrome video scope 60m x 25mmØ. Kit includes video display and VCR
FRPELQDWLRQDQGN+]VRQGHFDSDELOLW\VRWKHFDPHUDORFDWLRQFDQEHGHWHUPLQHG
XVLQJWKH5$'5'3;/+DV¿[WXUHVWRFHQWHUWKHFDPHUDLQODUJHUGLDPHWHU
pipes. Camera includes variable illumination. Length of cable extended is
displayed and comments can be added to the image.
:RKOHU0LQLVSULQJP[PP%:,QVSHFWLRQ&DPHUD
WOH,MINISPRING
AU
Semi rigid push rod 20m long with 22mm colour camera. Waterproof to 15m. Kit
includes a small battery operated display with a video output. Large display and
recorder option.
WOH,VIPER CAMERA KIT
AU
Optional camera with remote control movement of camera for WOH,MINISPRING.
Cannot be used on its own.
Aqua Snakeeye 9m x 25mm Video Inspection
AQU,SNAKEEYE
AU/MY
For remote inspection work. Very light and compact. Includes a 127mm TFT-LCD
GLVSOD\PP‘FDPHUDLQFOXGLQJLOOXPLQDWLRQ9DULRXVDGDSWRUVDUHVXSSOLHG
for mounting the camera to, your hand, 457mm with 90O articulation arm or 9.1m
extension cable.
Machida FB5-1400A 4.3mmØ[P(QGRVFRSH
MAC,FB5-1400A
AU
End section steerable in 2 axis, 120O. Instrument is fragile due to the narrow
diameter and lack of a thick protective sheath. Light source included.
0RULWH[06*,P[PP6HPLULJLG(QGRVFRSH
02506*,
02506*6
$8
1=
6L]H PP‘ [ P ORQJ .LW LQFOXGHV D O side view adaptor, when used
diameter is then 10.1mm. Includes battery light source. View angle 27O. Focal
OHQJWKPPaLQ¿QLW\:RUNLQJWHPSHUDWXUHaO&,PDJHSL[HO2SWLRQDO
video camera available.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
77
Physical Measurement
Test & Measurement
Endoscopes (cont’d)
Moritex PalmScope Video Capture Device for JPEG & Movie Clip
Recorder Inspection
0253$/06&23(
$8
Digital Video Recorder, image capture and storage. Used in conjunction with an
HQGRVFRSHERUHVFRSHRUYLGHRVFRSHWKH3DOP6FRSHLVDQDOWHUQDWLYHWRD9&5
IRURQVLWHLQVSHFWLRQDSSOLFDWLRQV8QLWUHFRUGVVWRUHYLGHRVHTXHQFHVDQGIXOO
IUDPH UHVROXWLRQ MSHJ LPDJHV RQ VXSSOLHG 0E &RPSDFW )ODVK &DUG 9LHZ
LPDJHVRQEXLOWLQ´7)7/&'VFUHHQ6WRUHVMSHJVWLOOLPDJHVDQGRUPMSHJ
PRYLHFOLSV6LJQDOLQSXWYLGHR176&RU3$/DXWRVHOHFWLQJ
Olympus IF11D4-20 11.3mm x 2m Length Endoscope
OLY,IF11D4-20
Olympus IV6C6-20-ZOOM Videoscope 6mm x 2m Long
OLY,IV6C6-20-ZOOM
Moritex 2C Mount Adaptor
025&02817
2C mount adaptor.
$8
AU
)LWWHGZLWK$7'1)RSWLFDODGDSWRU¿HOGRIYLHZOGLUHFWLRQRIYLHZIRUZDUG
GHSWKRI¿HOGPPaLQ¿QLW\$QJXODWLRQZD\OXSGRZQOHIWULJKWKHDY\
GXW\WXQJVWHQLQVHUWLRQEUDLGWXEH2SHUDWLQJWHPSHUDWXUHIRULQVHUWLRQWXEHLQ
DLUaO&LQZDWHUaOC. Liquid resistance for insertion tube - withstand
PDFKLQHRLOOLJKWRLODQGVDOWZDWHU6XSSOLHGZLWK,9$YLGHRFRQWUROXQLW
ZKLFKKDV]RRPLQJDQGYLUWXDOVFUROOLQJSDQQLQJZLWKPRYLQJLPDJHVIXQFWLRQ
extended exposure time for darker areas, built in image enhancement and freeze
frame. ILH-2B light source, Panasonic 7” LCD colour monitor mounted on
H[WHQVLRQDUPDOO¿WWHGWRWUDQVLWFDVHIRUHDVHRIXVH9LGHR9+6UHFRUGHUDOVR
included in package.
Olympus IV8D3-20 8.4mmØ, 2m Long Videoscope
Camera Mount for Moritex Eye Piece
025&$002817
AU
Working length 1.7m. Large sharp images with adjustable focus regardless of
GLVWDQFH'HSWKRI¿HOGRIYLHZPPaLQ¿QLW\¿HOGRIYLHZOGLUHFWLRQRIYLHZ
IRUZDUG(DV\XSGRZQOULJKWOHIWO angulation of bending section which
FDQEHORFNHGDWDQ\DQJOH,QFOXGHV2O\PSXV,/.OLJKWVRXUFHKDORJHQODPS
2SHUDWLQJWHPSHUDWXUHLQVHUWLRQWXEHLQFOXGLQJRSWLFDODGDSWRULQDLUaOC,
LQZDWHUaOC.
$8
2/<,9'
$8
Mount to allow the connection of a standard camera to a Moritex endoscope.
$GDSWRUVFRQQHFWWRZKHUH\RXZRXOGQRUPDOO\DGGD¿OWHUWRDFDPHUD5LQJ
VL]HVZKLFKWKLVFDQDGDSWWRLQFOXGHPPPPPPPP6RQ\0DYLFD
61<0$9,&$)'FDQEHXVHGRUFKHFNWKHVL]HRIWKH¿OWHUZKLFKLVXVHG
on the camera.
),QGXVWULDOÀH[LEOHYLGHRVFRSHPORQJPP‘GLVWDOWLSQRQUHPRYHDEOH¿HOGRI
YLHZOGHSWKRI¿HOGPP¿[HGIRFDOSRLQW$QJXODWLRQZD\O83
'2:1O5,*+7/()7+HDY\GXW\WXQJVWHQLQVHUWLRQEUDLGWXEH2SHUDWLQJ
WHPSHUDWXUHIRULQVHUWLRQWXEHLQDLUaO&LQZDWHUaOC. Liquid resistance
IRULQVHUWLRQWXEHZLWKVWDQGPDFKLQHRLOOLJKWRLODQGVDOWZDWHU6XSSOLHGZLWK
,9YLGHRSURFHVVRUXQLW,/.OLJKWVRXUFHDQG799LGHR9+6UHFRUGHU
Ż1(:Ż
Olympus IV8C6-35 Videoscope 8.4mm x 3.5m Long
2/<,9&
Olympus IPLEX- MX Portable Industrial Videoscope
2/<,3/(;0;
,3/(; 0; EDWWHU\ SRZHUHG LQGXVWULDO YLGHRVFRSH OLJKWZHLJKW MXVW NJ RXW
RI WUDQVLW FDVH PP‘ P OHQJWK WXQJVWHQ LQVHUWLRQ WXEH DUWLFXODWLRQ ZD\
83'2:1/()75,*+7O)LHOGRIYLHZOGHSWKRI¿HOGPPWRLQ¿QLW\
illumination method LED. Brightness adjustment 11 step, long exposure up to
VHF ]RRP HOHFWURQLF OLQHDU XS WR [ EXLOW LQ LQFK 7)7 IXOO FRORXU GLVSOD\
LPDJHUHFRUGLQJEXLOWLQLPDJHIRUPDW-3(*RYHULPDJHVZLWKVXSSOLHG&)
FDUG3RZHUHGIURPHLWKHUUHFKDUJDEOH/LLRQ;EDWWHU\SDFNVKRXUVRU$&
adaptor.
$8
)LWWHGZLWK$7'))RSWLFDODGDSWRU¿HOGRIYLHZOGLUHFWLRQRIYLHZIRUZDUG
GHSWKRI¿HOGPPWRLQ¿QLW\$QJXODWLRQZD\OLQXSGRZQOHIWULJKWKHDY\
GXW\WXQJVWHQLQVHUWLRQEUDLGWXEH2SHUDWLQJWHPSHUDWXUHIRULQVHUWLRQWXEHLQ
DLUaO&LQZDWHUaOC. Liquid resistance for insertion tube - withstand
PDFKLQHRLOOLJKWRLODQGVDOWZDWHU6XSSOLHGZLWK,9YLGHRFRQWUROXQLW
,/+$OLJKWVRXUFHDQG799LGHR9+6UHFRUGHU
Dyonics Model 750 Video Camera & Processor
'<2
$8
)RU HQGRVFRSHV DQG ERUHVFRSHV ZLWK %ULWLVK VWDQGDUG H\H SLHFH 799LGHR
recorder not included.
Heine Techno 6mm x 320mm T.05.26.302 Borescope
+(,7(&+12;
$8
70O GLUHFWLRQ RI YLHZ ZLWK DQJOHG H[WHQVLRQ WXEH O x 120O %DWWHU\ SDFN
LQFOXGHGGFVXSSO\FRUGEDWWHU\FKDUJHUDQGPDLQVSRZHUSDFN
Olympus G100-034 090 55 Borescope
2/<*
Olympus Endoscope/Recorder TV Camera Inspection
OLY,VIDEO
AU
9LGHRFDPHUDPRQLWRU9&5DQGDGDSWRUNLWWRVXLW2O\PSXVHQGRVFRSHV
Two mount adaptor.
$8
/HQJWKPHIIHFWLYHPPP‘DQJXODWLRQUDQJHGLUHFWLRQXSGRZQO,
ULJKWOHIWOOLJKWJXLGHFDEOHOHQJWKP2SWLFDODGDSWRU¿WWHG$7'))¿HOGRI
YLHZOIRUZDUGYLHZLQJGHSWKRI¿HOGPPaLQ¿QLW\2XWHUGLDPHWHUPP
2SHUDWLQJWHPSHUDWXUHLQDLUaO&LQZDWHUaOC. Operating pressure
ZDWHU aK3D aDWP DLU K3D DWP )OXLG UHVLVWDQFH
LQVHUWLRQWXEHZLWKVWDQGVPDFKLQHRLOOLJKWRLO2QO\LQVHUWLRQWXEHFDQEHSODFHG
LQZDWHU6XSSOLHGZLWKH\HSLHFHDQGOLJKWVRXUFH
78
Stryker Borescope 4 mmx 180 mm Long, 27.5O View
6<.$57+52
$8
6XSSOLHGZLWK4XDQWXPOLJKWVRXUFHFDPHUDKHDGDQGYLGHRSURFHVVLQJ
XQLW9HU\KLJKTXDOLW\V\VWHP
Olympus IF8C5-30 8mm x 3m Long Endoscope
2/<,)&
$8
*VHULHVULJLGERUHVFRSHPPPP‘GLUHFWLRQRIYLHZO¿HOGRIYLHZ
O6WDLQOHVVVWHHOLQVHUWLRQWXEHRSHUDWLQJWHPSHUDWXUHaOC. Includes
2O\PSXV,/.FROGOLJKWVRXUFH6RQ\&&',5,6FRORXUYLGHRFDPHUD
$.&DGDSWRUIRU6RQ\&&',5,69LHZYLDH\HSLHFHRUYLDYLGHRFRQQHFWLRQ
to TV.
Fibrescope MTFS15-1000 1.5mm x 1m Endoscope
),%07)6
$8
:RUNLQJOHQJWKPP‘[PP,QFOXGHVOLJKWVRXUFH2SHUDWLQJWHPSHUDWXUH
aOC at atmospheric pressure.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Physical Measurement
Test & Measurement
Microscopes
Olympus CH2 Binocular Microscope
6FDODU9/(;9LGHR0LFURVFRSH
OLY,CH2
AU
0DJQL¿FDWLRQRIH\HSLHFH[0DJQL¿FDWLRQRIREMHFWLYHOHQV;;;;
RLOW\SHWRJLYHDPD[PDJQL¿FDWLRQRI,QEXLOWOLJKWVRXUFH
Proscope SCA-12770 Video Microscope Kit
PRO,SCA-12770
AU
Hand-held USB video microscope complete kit. Includes 200X, 100X, 50X, 1~10X
interchangeable lenses, C Mount adaptor, stand and carry case. Connects to a
PC via USB interface. Software allows snap shot still images and real time movie
¿OHVWREHVDYHG5HVROXWLRQLV[SL[HOV
SCA,VL-7EX
NZ
Handheld video microscope. View and capture images to a PC or TV/video
UHFRUGHU6XSSOLHGZLWKD;OHQVYLGHRWR86%DGDSWRUDQGZLQGRZVVRIWZDUH
Optional 14” TV/video is available.
Polaroid Microcam Microscope Camera
POL,MICROCAM
AU
,QVWDQW¿OPFDPHUDIRUELQRFXODUPLFURVFRSHV6LPSOHRYHUH\HSLHFH¿WWLQJSHUPLWV
use with virtually any model.
Chroma 7310 Video Microscope
&+5
$8
+LJKUHVROXWLRQFRORXUFDPHUD;;PDJQL¿FDWLRQ,QFOXGHVLOOXPLQDWLRQ
auto gain control, auto white balance adjustment, etc. Freeze picture and compare
function.
Force Gauges
Model
Type
Analog Out (V)
RS232
Nata
Range(kg)
AME,CADET-25N
MEC,AFG-1000N
Force gauge
0~1
Yes
MEC,AFG-1000NALC
Ametek Cadet 25 Digital Force Gauge
AME,CADET-25N
AU
56&LQWHUIDFH5DQJHa1NJUHVROXWLRQ1JDFFXUDF\RI
IXOOVFDOH'HÀHFWLRQPP'LVSOD\GLJLW/&'%LGLUHFWLRQDOZLWKSHDNKROGIRU
compression & tension. NiCd operated. 1Vdc recorder output.
Mecmesin AFG-1000N Digital Force Gauge
MEC,AFG-1000N
AU
5DQJH a1 DFFXUDF\ WRQ GLJLW GLVSOD\ 6DPSOLQJ UDWH N+]
2YHUORDGSURWHFWLRQDQGFRXQWHU2XWSXWVDQDORJ560LWXWR\R$FFHVVRULHV
WHVWKRRNPP‘FRPSUHVVLRQSODWHPPPPH[WHQVLRQURGV
No
Resolution (g)
2.5
12.5
100
100
Mecmesin AFG-1000NALC Digital Force Gauge
MEC,AFG-1000NALC
AU
Range 0~1000N accuracy 0.1%. 5 digit back lit display. Peak data sampling rate
N+]RYHUORDGZDUQLQJGLVSOD\LQYHUWUHYHUVHIXQFWLRQGXDOPD[PD[
WHQVLRQPD[FRPSUHVVLRQSOXVFXUUHQWUHDGLQJ2XWSXWVDQDORJXH56
0LWXWR\R$FFHVVRULHVWHVWKRRNFRPSUHVVLRQSODWHPPPPH[WHQVLRQ
rods, rotary coupling. Mounting tapped holes x 2, M5 x 0.8 x 5.5mm deep max.
Optional smart sensors can be used, such as TW60 static torque wrench.
0HFPHVLQ7:7RUTXH:UHQFK
MEC,TW60
AU
Range to 60Nm, optional accessory to be used with MEC,AFG-1000NALC
Force Gauge. Smart interface, as soon as plugged into force gauge scaled
accordingly.
Load Cells
Model
Type
Range (kg)
BAR,MTC-150
68
BAR,STC-500
BAR,STC-500NATA
J
AIC,SG-AST-500
500
BAR,STC-4400
Load cell
2,270
BAR,STC-10000
BAR,STC-20000
9,072
BAR,STC-25000
12,000
EMC,100KG
100
EMC,200KG
Tension load cell
STR,1590C
DIL,ED2000R
DIL,EX2000 – 5K
AND,WEIGH-BEAMS
Compression load cell
Crane scale
Platform Scale
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
0~5
0~2
0~10
2,000
BAR,STC-5000
EMC,1000KG
Output (V)
0~5
200
Yes
1000
Yes
8,000
20,000
5,000
56
2,000
TECHRENTALS
79
Physical Measurement
Test & Measurement
Load Cells (cont’d)
Ż1(:Ż
Barlo 25,000 lb/12,000 kg Load Cell and Display
AND,WEIGH-BEAMS
&RPSOHWH ZLWK P FDEOH ,QFOXGHV ' VKDFNOHV DQDORJ DQG 56 RXWSXW
OENJORDGFDSDFLW\
$1'0HUFXU\3ODWIRUP:HLJKEHDPVIRU3DOOHWXSWRNJ
BAR,STC-25000
AU
For pallet weighing. Total weight capacity 2000kg for the two weigh beams. Two
stainless steel weigh beams supplied, length 1200mm, width 100mm, height
DSSUR[LPDWH PP ZHLJKW RI HDFK EHDP NJ &RQQHFWLRQ FDEOH OHQJWK PHWUHV$'GLVSOD\VXSSOLHG56RXWSXW7UDQVLWFDVHZLWKKDQGOHVDQG
wheels for ease of handling.
Barlo MTC-150 150lb/68kg Load Cell
BAR,MTC-150
AU
5DQJHOENJFRPSUHVVLRQDQGWHQVLRQ&RPSOHWHZLWKLQWHUIDFHRSHUDWLQJ
from 12Vdc or ac mains giving 0~5Vdc output.
AIC SG-AST-500 500kg S Type Load Cell with Panel Display
AIC,SG-AST-500
AU
(0&NJ7HQVLRQ/RDG&HOO
EMC,100KG
(0&NJ7HQVLRQ/RDG&HOO
EMC,200KG
Barlo STC-500 500lb/230kg Load Cell
(0&/RDG&HOO&RQGLWLRQHU
Complete with conditioning electronics. Output 0~2V. Uses ½”UNF thread.
Barlo STC-500 500lb/230kg Load Cell NATA Calibrated
BAR,STC-500NATA
6SHFL¿FDWLRQDVDERYHEXWZLWK1$7$FDOLEUDWLRQ
Barlo STC-4000 4,400lb/2,000kg Load Cell
BAR,STC-4400
BAR,STC-5000
AU
AU
5DQJH OEV NJ FRPSUHVVLRQ DQG WHQVLRQ ,QWHUIDFH RSHUDWHV IURP
12Vdc or ac mains. Output 0~5Vdc. Display resolution 1kg.
Barlo STC-10000 10,000lbs/5,000kg Load Cell
BAR,STC-10000
EMC.L/CELL-COND
Strainstall 8,000kg Compression Load Cell
STR,1590C
NZ
NZ
AU
'LOORQ('&UDQH6FDOHNJZLWK5DGLR5HPRWH&RQWURO
DIL,ED2000R
AU
Complete with shackles and radio remote control unit. Range 20,000kg. Accuracy
0.1%, i.e. 20kg uncertainty. Units of measure kg, kt, mt, & lb. Resolution 5kg.
3URRIORDGRIUDWHGORDG'LVSOD\VJURVVDQGQHWIRUFH56DQG56
data outputs. Continuous measurement and peak hold.
'LOOLRQ('NJ&UDQH6FDOH
DIL,ED2000-5K
AU
Complete with shackles. Range 5,000kg. Accuracy 0.1%. Resolution 1kg. i.e.
NJXQFHUWDLQW\8QLWVRIPHDVXUHNJNWPWOE3URRIORDGRIUDWHG
load. Displays gross and net force. Continuous measurement and peak hold.
5DQJH OE NJ FRPSUHVVLRQ DQG WHQVLRQ ,QWHUIDFH RSHUDWHV IURP
12Vdc or ac mains. Output 0~5Vdc.
8:(NJ'LJLWDO&UDQH6FDOH
Barlo STC-20000 20,000lb/10,000kg Load Cell
Battery powered digital crane scale complete with hook & shackle. Load capacity
40kg~5,000kg, resolution 2, accuracy is ±10kg. Built in large LED display, wireless
remote control, and charger.
BAR,STC-20000
AU
5DQJH OE NJ FRPSUHVVLRQ DQG WHQVLRQ ,QWHUIDFH RSHUDWHV IURP
12Vdc or ac mains. Output 0~5Vdc.
UWE,CS-5T
Materials Testing
Hydramotion Viscolite 700 Portable Viscometer
HYL,V700S-21
AU
Advanced portable viscometer with stainless-steel probe. Operating range
aP3DSVF3ZLWKLQWHJUDOWHPSHUDWXUHFRUUHFWLRQaž&3UREH
WLS PP‘ LPPHUVLRQ OHQJWK PP YLVFRVLW\ RQO\ RU PP YLVFRVLW\
WHPSHUDWXUH$FHWDOSRO\PHUSUREHEDVHIRUKDQGKHOGRUFODPSHGRSHUDWLRQZLWK
coiled-cable connection to meter unit with 5 digit display. Battery powered.
80
NZ
NJ6W\SHWHQVLRQORDGFHOOZLWKGLJLWDOLQGLFDWRU$FFXUDF\“RIUHDG
ing. Operating temperature range -18~65ºC. Safe overload is 150% of rated
capacity. Supplied with threaded eye hooks. Analogue output.
8,000 kg compression pedestal load cell.
5DQJHOENJFRPSUHVVLRQDQGWHQVLRQ&RPSOHWHZLWKVHULHVLQWHUIDFH
operating from 12Vdc or ac mains. Output 0~5Vdc. Cable to digital display unit
6m. Uses ¾”UNF thread.
Barlo STC-5000 5,000lb/2,270 kg Load Cell
EMC,1000KG
Load cell conditioning unit with a recorder output. AC mains powered.
AU
NZ
NJ6W\SHWHQVLRQORDGFHOOZLWKGLJLWDOLQGLFDWRU$FFXUDF\“RIUHDGLQJ
Operating temperature range -18~65ºC. Safe overload is 150% of rated capacity. Supplied with threaded eye hooks. Has an analogue output.
(0&NJ7HQVLRQ/RDG&HOO
AU
NZ
NJ6W\SHWHQVLRQORDGFHOOZLWKGLJLWDOLQGLFDWRU$FFXUDF\“RIUHDGLQJ
Operating temperature range -18~65ºC. Safe overload is 150% of rated capacity.
Supplied with threaded eye hooks. Analogue output.
Tension and compression 500kg. Nominal output 2mV/V, max excitation 15V dc,
IP67 protection, safe load 125%, compensated temperature range -10~40OC.
Thread M12 X 1.75P. Supplied with 2 x detachable rod end bearings, PM4 -SGdc-5E load cell panel meter, power 12~48V dc, ac adaptor also supplied, output
0~10V. Panel indication in kg.
BAR,STC-500
AU
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
NZ
Physical Measurement
Test & Measurement
Scales & Balances
Model
AND,GR-202
AND,FC-10K
Type
Analytical balance
$1'+)*
AND,HP-40KA
MET,PB8000I
RS232
Range (g)
Resolution (g)
Yes
210 or 42
10kg
0.1mg or 0.01mg
0.02
Yes
0.001
Counting scale
20kg
0.5
8.1kg
100mg
,6+&&6
25kg
5mg
OHA,EXP4100
4,100
0.01
AND,AD4714
AND,MX50
Moisture balance
Yes
70
0.01
51
0.001
AND,FG-150KB
Platform scale
150kg
0.05
AND,HL400
Scale
400
0.1
15kg
1
AND,FS-15KA
MET,15KG
Weighing Scales
15kg
MET,60KG
AND,WEIGHBEAMS
60kg
Platform Scale
Yes
AND,WEIGH-BEAMS
0.05
A&D Mercury FG-150KB 150kg Scales
Ż1(:Ż
$'0HUFXU\3ODWIRUP:HLJKEHDPVIRU3DOOHWXSWRNJ
2000
AND,FG-150KB
AU
For pallet weighing. Total weight capacity 2000kg for the two weigh beams. Two
stainless steel weigh beams supplied, length 1200mm, width 100mm, height
DSSUR[LPDWH PP ZHLJKW RI HDFK EHDP NJ &RQQHFWLRQ FDEOH OHQJWK PHWUHV$'GLVSOD\VXSSOLHG56RXWSXW7UDQVLWFDVHZLWKKDQGOHVDQG
wheels for ease of handling.
AU
&DSDFLW\ NJ UHVROXWLRQ ,QFOXGHV 56 SRUW 1DWLRQDO 6WDQGDUGV
&RPPLVVLRQDSSURYHG16&
A&D HF-300G Mercury 300g Counting Scales
$1'+)*
$8
6FDOHVJUHVROXWLRQUHSHDWDELOLW\,QFOXGHV56SRUW,QFOXGHV
counting software. Can be used as counting scales.
Ishida 25kg Digital Counting Scales
,6+&&6
1=
0D[LPXPFDSDFLW\NJUHVROXWLRQJ)HDWXUHVXQLWZHLJKWVDPSOHZHLJKW
and tare.
Ż1(:Ż
A&D Mercury MX50 Moisture Analyser
AND,MX50
A&D Mercury AD4714 Moisture Balance Scales
AND,AD4714
AU
0RLVWXUHFRQWHQWWR6DPSOHZHLJKWaJ,QFOXGHVWLPHUDQG56
interface. Weight readability 0.01g. Max temperature 200OC, heater 185W
infrared.
2KDXV(;3J%DODQFHDQG&RXQWLQJ6FDOH
OHA,EXP4100
AU
Maximum sample weight capacity 51g, resolution 0.001g, moisture content
accuracy over 1g, 0.1%, over 5g, 0.02%. ,Halogen lamp heater, 400W max. Drying
temperature 50~200OC. Measurement programs 20 sets, measurement mode
moisture content, wet or dry, dry content, ratio, weight. Heating mode standard,
DXWRPDWLFTXLFNWLPHUPDQXDO'LVSOD\ODUJH9)'LQWHUIDFH56&&'520
software supplied. Pan sample size diameter 85mm.
AU
Capacity 4.1kg. Display resolution 0.01g. Multi-unit display. Repeatability 0.005g.
56LQWHUIDFH
$'0HUFXU\)6NJ:HLJKLQJ6FDOHV
AND,FS-15KA
AU
High resolution 15kg scales. Display resolution 1g. AC & Nicad battery
operation.
A&D Mercury FC-10K Counting Scales
AND,FC-10K
AU
High resolution 10kg scales with sample counting facility. Display resolution 1g,
internal resolution 0.02g. Sample size user selectable – normally 10 pieces. Max
count size up to 999,999. AC & NiCd battery operation.
A&D HP-40KA 40kg Counting Scale
AND,HP-40KA
AU
Capacity 40kg with 0.5g resolution. Can be used to determine battery weight
change with charge, etc.
Mettler PB8001 8kg Counting Scales
MET,PB8001
AU
Capacity 8.1kg with 0.1g readability. Sample size selectable 5~100. Can do taring,
percent and dynamic weighing. Powered by battery eliminator.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
81
Physical Measurement
Test & Measurement
Scales & Balances (cont’d)
A&D Mercury HL400 Scale 400g x 0.1g
AND,HL400
Battery operated balance, range 400g, resolution 0.1g
A&D GR-202 Mercury Dual Range Analytical Balance
AND,GR-202
0HWWOHUNJ:HLJKLQJ6FDOHV
AU
MET,15KG
MY
0HWWOHUNJ:HLJKLQJ6FDOHV
MET,60KG
MY
AU
Two-layer construction, splash-proof keyboard and front operating door-lever.
Range 210g x 0.1mg & 42g x 0.01mg. One-touch calibration and automatic
self-calibration outside preset temperature limits. Functions include multiple
weighing units, counting or %, data memory, adjustable environment setting and
*/3PDQDJHPHQW%LGLUHFWLRQDO56&VWDQGDUG/RZYROWDJHRSHUDWLRQZLWK
ac adaptor.
Did you know?
TECHRENTALS offers rental with an option to purchase
(RPO).
When you enter into an RPO you can exercise your
option to purchase the rented equipment after the agreed
minimum rental term.
RPO is an ideal arrangement for companies who need to
conserve capital, allocate expenditure, preserve credit
and optimise asset management over the longer term.
Our friendly staff will be pleased to provide details.
Some conditions may apply , not available for all equipment.
82
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Non - Destructive Testing
Test & Measurement
Vibration & Alignment Analysis
Model
Type
Application
Features
ARL,EL-235
Ground vibration logger
Monitoring vibration for
pile driving and general
construction vibration
Logging outdoors
enclosure
BK,2635
Accelerometer charge amp
BK,4230
Sound level meter calibrator
Max
Acceleration (G)
NATA
BK,4333
BK,4343
Frequency
Range
(Hz)
2~10,000
Accelerometer
2~12,000
BK,8301
10,000
BK,4370
0.2~5,4kHz
2,000
BK,4371
0.2~12.7kHz
20,000
dc~300
20
Single axis accelerometer
PCB,300A20
Low G will operate down to DC
TEX,ATM
Blast logger and ground vibration
logger
Explosion and general
construction vibration
monitoring
Logging outdoor
enclosure, tri-axial
geophones
BLA,UMX-SM-6
Blast logger
Explosion monitoring
Tri-axial geophones
CSI,ULTRASPEC
Balancing system & vibration analysis
Balancing & spectral analysis
LAB,LW-140-141
Vibration table (requires frequency
source)
Shake source for testing
purposes
Optical machinery shaft alignment
Allow for the alignment of non
rotating shafts
Printer
For use with RIO,VA-10
PRU,ROT
PRU,ROT-ULTRA
RIO,CP-10
Includes thermal
growth analysis
Hand held
accelerometer
RIO,VA-10
Hand held & magnetic
accelerometer
PC memory card
capability
Vibration analyser
Machinery condition monitoring
RIO,VM82
Vibration meter
Machinery and monitoring
Magnetic
accelerometer
SVA,912A & SVA,SV06A
Tri-axial accelerometer & analyser
Whole body vibration
measurement
Includes whoopee
cushion
TIN,SHOCKSET
Single axis shock logger
Shipping and packaging
analysis
Logging capability
PIE,308B
Accelerometer with amp
RIO,VA-11
MAD,SHOCK101
4.5~500
Tri-axial Bump Logger
+/-50
1~3kHz
Logging vibration for
transportation i.e. trucks,
containers
Tri-axial transportation
logging
Ż1(:Ż
Pruftechnik Rotalign Ultra Laser Shaft Alighment
PRU,ROT-ULTRA
AU
Laser based rotating shaft alignment system. Maximum separation between
emitter and receiver 10m. Aligns horizontal and vertical machines, aligns coupled
and uncoupled shafts equally well. Ultra modern computer design, backlit colour
display, Intel XScale 400MHz CPU, USB for peripheral devices, PC, printer, also
Bluetooth communication. Backlit keyboard, rechargeable Li-Ion battery pack.
Machine train alignment- 14 machines. Alignment results in 3 quick steps, thermal
growth computation. Rotalign Ultra Reader software included.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
83
Non - Destructive Testing
Test & Measurement
Vibration & Alignment Analysis (cont’d)
B&K 4333 Accelerometer
Ż1(:Ż
Pruftechnik 1500mm length Tension Chains
PRU,AL12.116
1500mm length tension chains for PRU,ROT-ULTRA.
Pruftechnik Rotalign Shaft Alignment
PRU,ROT
BK,4333
AU
AU
Max alignment distance 10m. Aligns horizontal and vertical machines. Graphical
display of alignment condition. Resolution 1micron, angular better than
10µRad.
Pruftechnik Magnetic Sliding Bracket
PRU,MAG-BRKT
AU
B&K 4343 Accelerometer
BK,4343
MY
Accelerometer. Frequency range: 2~12,000Hz. Charge sensitivity 10~mV/g.
Charge sensitivity 10pc/g. Maximum shock 10000g.
B&K 4370 Accelerometer
BK,4370
AU
Designed to be used with the Rotalign. Used when shafts to be aligned cannot
be rotated. A bracket is required for each non-rotating shaft to be aligned (ie.
usually 2 will be required).
Frequency range 0.2Hz~5.4kHz. Voltage sensitivity 100mV/G or 8mV/ms2
DSSUR[LPDWHO\ LQWR *Ÿ &KDUJH VHQVLWLYLW\ 3&* RU 3&PV 0D[
sinusoidal acceleration 2,000G. Max shock 2,000G. Requires 1 charge
DPSOL¿HU
Ż1(:Ż
B&K 4371 Accelerometer
0DGJHWHFK8OWUDVKRFN(%7UDQVSRUWDWLRQ/RJJHU
MAD,ULTRASHOCK-EB
BK,4371
AU
Ultrashock-EB transportation abient temperature, humidity, pressure and 3 axis
shock acceleration logger. Ranges: -40~180OC, 0-95%RH, 0~30PSIA (0-200kPa),
-50g~+50g. Memory 23,831 readings per channel. Logging interval from 1 reading
per 2 second to 1 reading per 12 hours. Sampling rate 2ms. Includes RS232
interface and setting up, downloading, graphing software.
0DGJHWHFK6KRFN(%75$[LDO7UDQVSRUWDWLRQ/RJJHU
MAD,SHOCK101
NZ
Battery powered, stand alone 3-axis shock recorder, extended battery life of up
to 60 days typical. Measures and records shock as the peak acceleration levels
RYHUWKHXVHUGH¿QHGLQWHUYDO'HVLJQHGIRUGRFXPHQWLQJG\QDPLFHQYLURQPHQWV
such as moving vehicles, containers, ships, etc.
Tiny Tag, Set of 6 Loggers: 3 x Shock, 2 x Temperature, 1 x Humidity
TIN,SHOCKSET
For shipping and transport testing. Includes 3 x shock loggers; these record the
max G force in the programmed period. Includes a humidity logger, an internal
temperature logger and temperature logger with external probe. Set also includes
an f computer to download and view the results.
Svantek 912A Sound Vibration Analyser
SVA,912A
AU
Type 1 sound level meter including a single axis accelerometer. Provides standard
sound measurements and vibration measurements including 1/1 octave, 1/3
octave and full spectrum. Unit will store 1Mb of spectrum analysis information
for waterfall plots etc. PC interface software included. Unit can make part body
vibration measurements. If whole body vibration measurements are to be made
the SVA,SV06A accessory must be used.
Svantek SV06A Tri-axial Accel Interface for 912A
SVA,SV06A
AU
Accessory kit for human whole body vibration measurement. Provides 4
accelerometer inputs for the SVA,912A and a tri-axial accelerometer ‘whoopee
cushion’ for whole body vibration. Can operate as an interface for a standard B
& K tri-axial accelerometer.
PCB Low G Accelerometer dc to 300 Hz
PCB,300A20
AU
6LQJOHD[LVDFFHOHURPHWHULQFOXGHVFKDUJHDPSOL¿HU5DQJH“JIUHTXHQF\
“GFa+]“a+]6KRFNOLPLW“NJ2SHUDWLQJWHPSHUDWXUH
-40~85OC. Weight 15g. Voltage sensitivity 100mV/g.
%.&KDUJH$PSOLÀHU
BK,2635
AU/MY
Frequency range 0.2Hz~12.7kHz. Voltage sensitivity 10mV/G or 0.8mV/Ms2
DSSUR[LPDWHO\ LQWR *Ÿ &KDUJH VHQVLWLYLW\ 3&* RU 3&06 0D[
sinusoidal acceleration 6,000G. Max shock 20,000G. Requires 1 charge
DPSOL¿HU
B&K 8301 Accelerometer
BK,8301
MY
Accelerometer. Frequency range: 2~12000Hz. Sensitivity 10mV/g. Charge
sensitivity 10pc/g. Maximum shock 10000g.
B&K Vibration Impact Hammer
BK,8202
AU
For determining frequency response functions. Individually calibrated force
transducer. Comes with 3 different tips and additional mass to enable pulse
duration and frequency range to be determined.
3LH]RWURQLFV$FFHOHURPHWHUDQG$PSOLÀHU
PIE,308B
AU
$FFHOHURPHWHU IUHTXHQF\ UDQJH +]aN+] “ +]aN+] “ YROWDJH
VHQVLWLYLW\P9JRUP9PV“5DQJH“J“9RXWSXWUHVROXWLRQ
0.001g, vibration max 500G, shock max 5,000G. Supplied with PCB482A10 ICP
line power unit.
Linear Accelerometer +/-1G dc Response
LIN,LSPC-1
AU
'HVLJQHGIRUYHU\ORZIRUFHOHYHOV“*PHDVXUHPHQWUDQJH2SHUDWHVGRZQWRGF
LQIUHTXHQF\2XWSXW“9/LQHDULW\UHVROXWLRQ6KRFN6XUYLYDELOLW\
100g. Natural Frequency 100Hz.
Rion VM82 Vibration Meter
RIO,VM82
NZ
Single axis. Measure acceleration from 0.02~200m/s2. Velocity from 0.1mm~1m/s
rms. Displacement from 0.001~100mm. AC/dc output of 1V full scale.
Rion VA-10 Vibration Analyser
RIO,VA-10
AU/MY
Vibration analyser for rotating machinery. Measures acceleration, velocity and
displacement. Stores 500 readings. LCD display with waveform, spectrum and
data readout. Auto measurement function. Includes printer interface.
5LRQ&3563ULQWHU9$1/1/
RIO,CP-10
Printer for RIO,VA-10. Operates from optional NiCd battery pack.
Rion VA-11 Vibration Analyser
AU/MY
Built-in integrators for displacement and velocity. Sensitivity to 10V/PC. Bandpass
¿OWHUV2SHUDWHVDOVRIURPH[WHUQDOa9GFRU“9GF%DWWHU\RSHUDWHGK
life. Required with accelerometers.
84
MY
Accelerometer. Frequency range: 2~10,000Hz. Voltage sensitivity 14~24mV/g.
Charge sensitivity 14-20pc/g. Maximum sinusoidal acceleration 7500g. Maximum shock 10,000g.
RIO,VA-11
AU/MY
AU/MY
Includes 2 pickup types hand held (PV55) and magnetic type (PV57). Instrument
will measure acceleration, velocity and displacement. Displays rms, peak and crest
factor. Uses FFT to display power and vibration spectrum. Incorporates PCMCIA
FDUGÀDVKPHPRU\IRUGDWDVWRUDJH56LQWHUIDFHLVDYDLODEOH6SHFL¿FDWLRQV
PV57 1Hz~5kHz, PV55 3Hz~20kHz (velocity 3kHz, displacement 500Hz).
Acceleration 0.02~316mm/s2 rms. Velocity 0.1~1,000 mm/s rms. Displacement
a(433+LJKSDVV¿OWHU+]+]N+]/RZSDVVN+]N+]
& 20 kHz. Stores 500 measurements.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Non - Destructive Testing
Test & Measurement
Vibration & Alignment Analysis (cont’d)
7H[FHO$70([SORVLRQDQG*URXQG9LEUDWLRQ/RJJHU
TEX,ATM
$5/(/7ULD[LDO*URXQG9LEUDWLRQ/RJJHU
ARL,EL-235
AU
AU
Portable logger with human exposure capability. Monitors ground and
building vibration for long periods. Calculates and stores tri-axial vibration
stats, vector sum stats, peak particle velocity (PPV), rms particle velocity
and human exposure (HEF) stats. Includes PC based analysis software.
Sensor frequency response 1Hz~500Hz. Logs interval, date, time, Leq,
Lmax, temperature, battery, L0.1, L1.0, L10 & L90. Event mode logs date,
time, max and duration (Real time mode = 1000 samples/s). Stores up
to 4,096 intervals or events. Power 70mA @ 12V.
Triaxial geophone and overpressure (airblast) microphone with logger used to
determine explosion and ground vibration characteristics. Geophone range to
“PPVUHVROXWLRQPPVXSWRPPVPPVXSWR
55.9mm/s. Microphone range 80-dBL~140dBL, resolution 0.049Pa up to 122dBL
(25Pa), 0.40Pa up to 140dBL (201Pa). Sample rate 20, 50, 100, 200, 500Hz &
1kHz. Bandwidth: geophone 4.5Hz~500Hz, microphone 2Hz~500Hz. Includes
software and download cable. Internal memory 2Mb. Power internal 12V dc 7Ah
batteries. Continuous operation 240h. Supplied with 90~260V 50/60Hz charger,
recharge time 8h approx. Instrument with 16 character LCD display, built into
weatherproof pelican enclosure, rated IP65. Operating temperature range 0~70OC,
display 0~50OC. Also supplied with alarm light, reset button and 2 x 15m cable,
ideal for vibration sensitive construction projects. External dc power supply cable
also supplied.
%ODVWURQLFV80;60([SORVLRQ/RJJHU
BLA,UMX-SM-6
AU
Triaxial geophones, microphone with logger used to determine explosion
FKDUDFWHULVWLFV*HRSKRQHVDXWRUDQJLQJWRPPVUHVROXWLRQ“
0LFURSKRQHDXWRUDQJLQJWRG%/UHVROXWLRQ“G%6DPSOHUDWH
250, 500Hz & 1kHz. Bandwidth geophones 4.5~500Hz. Microphone
2~500Hz. Includes software and download cable. Internal memory 4Mb.
Power internal 6Vdc 2,600mAh Gel-cells, operating consumption 40mA,
sleep mode 10mA. Continuous operation 65h, with 1w programmable
timer schedule. Instrument has a display.
/DEZRUNV/:9LEUDWLRQ7DEOH
LAB,LW-140-141
AU
Capable of random and sine movement. Sine force 489N, random force
334N, shock force 1kN, max displacement 25mm, max velocity 17.8m/s,
accel bare table 110g pk, accel 45kg 55g pk, accel 2.2kg 18g pk. Max
accel resonant 150g pk, max accel peak shock 200g pk. Unit requires a
signal source and an accelerometer to measure the acceleration. Signal
source could be a function generator or random noise generator.
Gloss Measurement
(OFRPHWHU*ORVVPHWHU
ELC,402
AU
0HDVXUHVWKHJORVVRUVSHFXODUUHÀHFWLRQIURPDYDULHW\RIVXUIDFHV5DQJHaJORVVXQLWVSHU,620HDVXULQJDQJOHVO & 20O. Aperture 16 x
33mm ellipse. Digital display. Statistical functions – min, max, average, standard deviation. Stores up to 4,000 readings. RS232C interface for a printer. Operates
from ac mains or internal rechargeable batteries.
Automotive
Translock Brake Tester and Light Transmittance Meters
TLI,BTM2-LTM2
AU
.LWFRQWDLQVDEUDNHWHVWHUDQGDOLJKWWHVWHUFKHFNYHKLFOHFRQIRUPDQFHIRUWKH16:5RDG:RUWK\&HUWL¿FDWH%UDNHWHVWHUPHDVXUHVWKHGHFHOHUDWLRQUDWHRIWKHYHKLFOH
and the light tester measures the transmission levels of light through the windscreen.
Non - Destructive Testing
3K\QL[)HUURXV1RQ)HUURXV&RDWLQJ7KLFNQHVV7HVWHU
PHY,SURFIX FN
Defelsko POS100-C3 Ultrasonic Thickness Gauge
AU
Thickness tester with memory and statistics. Supplied with external probe,
calibration standards and carry pouch. Measurement range 0~1,500µm or
aPLOVVHOHFWDEOHWROHUDQFH“—PRIUHDGLQJUHVROXWLRQ—P'LVSOD\
back light, 4 digit alphanumeric. Min measuring 5 x 5mm, min substrate thickness
type F 0.5mm, type N 50µm. Calibration factory, zero, foil. Data memory 80
readings max. Interface infra-red down load data to PC utilising hyper terminal.
(OHNWURSK\VLN0LQL)1&RDWLQJ7KLFNQHVV0HWHU
ELE,MINI-100FN
DEF,POS100-C3
AU
Measure coatings on concrete, paint and lacquer on wood, paint on plastic, paint
RQJODVVJOD]LQJRQFHUDPLFÀRRUFRDWLQJVHWF5DQJH—aPP“—“RI
reading. Calculates max, min, mean, tolerance and SD. Stores 1,500 readings in
100 groups for statistical calcs. PC interface & software. Battery operated.
AU
0HDVXULQJUDQJHa—PWROHUDQFH“—PRURIUHDGLQJ2SHUDWHVRQ
both ferrous and non-ferrous substrates.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
85
Non - Destructive Testing
Test & Measurement
Non - Destructive Testing (cont’d)
'HIHOVNR)16)HUURXV1RQ)HUURXV&RDWLQJ7KLFNQHVV7HVWHU
DEF,FNS2
AU
Storage of up to 250 readings. Supplied with external probe, calibration standards
and carry pouch. Measurement range 0~1.5m or 0~60mils (selectable),
WROHUDQFH aPP “PP RI UHDGLQJ JUHDWHU WKDQ PP “—P resolution 0.1mm. Backglow display, HiLo limits audible and visible alerts when
PHDVXUHPHQWVH[FHHGVSHFL¿HGOLPLWV&RQWLQXDOO\GLVSOD\VXSGDWHVDYHUDJH
standard deviation, min/max thickness and number of readings while measuring.
Hi resolution mode for greater precision. Built in infra red port for down loading
data.
Mitutoyo SJ-201P Surface Roughness Tester
MIT,SJ201
AU
Comprises LCD display and a detachable detector/drive unit. Parameters
measured in Ra, Rq, Ry, Rz, Rt, Rp, R3z, Rk, Rpk, Rvk, S, Sm, Pc, mr, Mr1, Mr2,
A1, A2, Vo units. Ranges: 350, 100, 50µm & 10µm, resolution from 0.01~0.4µm.
Tip radius 5mm. Data output. NiCd batteries.
Mitutoyo 293-330 Digital Micrometer
MIT,293-330
AU
Water resistant and coolant proof (IP65) digimatic micrometer, measuring range
a´aPP5HVROXWLRQ´PPTXDQWL]LQJHUURU“FRXQW/&'
display. Temperature operating range 5~40OC, storage -10~60OC. Button settings:
origin, zero/ABS, inch/mm, hold.
Defelsko Positest Pull Off Adhesion Tester for Concrete & Metal
DEF,POSITEST
AU
0HDVXUHVWKHIRUFHUHTXLUHGWRSXOODVSHFL¿HGWHVWGLDPHWHURIFRDWLQJDZD\IURP
its substrate using hydraulic pressure. Pressure is displayed in both MPa and PSI
on a precision dial indicator and can be related to the strength of adhesion to the
substrate. Suitable for coatings on both metal and concrete surfaces. Conforms
with standards ASTM D4541 and ISO 4624.
3&:,+L/LJKWHU+ROLGD\'HWHFWRU
PCW,HI-L
AU/NZ
Detects pinholes in coatings and wrappings on metal substrates such as pipes and
tanks. 0~20kV, 3½ digit LCD display of voltage, variable alarm level. Portable with
rechargeable batteries, includes probe and handle, extension probes and a variety
RIEUDVVZLUHEUXVKHVIRUERWKÀDWDQGFXUYHGVXUIDFHVVXFKDVSLSHV
Ż1(:Ż
3&:,N9'&3RULVLW\+ROLGD\'HWHFWRU
PCW,DC30
AU
DC Porosity (Holiday) detector. Detects pinholes in coatings above 150um on
metal substrates such as pipes and tanks. 0-30kV, 3.5 digit LCD display with battery
indicator, display of voltage level. Alarm indicated on front panel, supplied with
rechargeable battery, 10h charger, probe handle with neon and 2m length cable,
PPFRQQHFWRUIRUÀDWEUXVKHVPHDUWKFDEOHZLWKFODPSIDQEUXVKPP
ÀDWEUDVVZLUHEUXVKPPSUREHH[WHQVLRQ'U\FRQGLWLRQV
Panametrics 26 mg Pocket Thickness Gauge
PAN,26MG
Panametrics 25DLHP Thickness Gauge
PAN,25DLHP
PCW,DC30-PULSE
Ż1(:Ż
3DQDPHWULFV1'7'/3OXV8OWUDVRQLF7KLFNQHVV*DXJH
PAN,37DL-PLUS
MIT,S-211-NATA
AU
AU
Surface roughness tester comprising an LCD display and a detachable detector/
drive unit. Parameters measured in Ra, Rz, and Rmax units. Tip radius 5mm.
Data output. NiCd batteries.
86
AU
Thickness gauge with large display (A-scan), which will display the returned
waveform. It has echo-echo through-paint capability. Supplied with WIN37DL
PLUS software and cable. The supplied probe is 11 mm diameter with a 1~500
mm operating range and a -20~500OC temperature operating range. The instrument
has a MIL-STD-810E hazardous area operation.
Pulse Porosity (Holiday) detector. Detects pinholes in coatingsand wrapping above
150um on metal substrates such as pipes and tanks. Can be used on dry or wet
surfaces. 0-40kV output, 4 digit LED display of voltage, alarm sensitivity setting
between dry and wet. Supplied with rechargeable battery, 10 hr charger, red probe
KDQGOHDQGPOHQJWKRIUXEEHUFRDWHGFDEOHPPFRQQHFWRUIRUÀDWEUXVKHV
PHDUWKFDEOHZLWKFODPSIDQEUXVKPPÀDWEUDVVZLUHEUXVKPPSUREH
extension and 80mm probe extension.
0LWXWR\R66XUIDFH5RXJKQHVV*DXJH1$7$&HUWLÀFDWLRQ
AU
'HVLJQHGIRU¿EHUJODVVUXEEHUFRPSRVLWHVDQGFDVWLQJV0HDVXUHVVWDQGDUGVWHHO
copper, etc. Does echo-echo measurements. Measures the thickness of material
under paint, etc. Built in 5,000 reading datalogger and an RS232 port.
Ż1(:Ż
3&:,N93XOVH3RURVLW\+ROLGD\'HWHFWRU
AU/NZ
Range 1~500mm, fast min mode. Resolution 0.01mm. Probe operates 20~150OC.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Non - Destructive Testing
Test & Measurement
Non - Destructive Testing (cont’d)
Panametrics 36DL Plus Thickness Gauge
PAN,36DLPLUS
AU
Large display (A-scan), which displays the returned waveform. Echo-echo throughpaint capability. Supplied with WIN95 software and cable. Supplied probe is
11mmØ with 1~500mm operating range and -20~500OC temperature operating
range. Instrument has a MIL-STD-810E hazardous area operation.
Sonatest Thickness Gauge
SON,T-GAGE-IV+
AU/MY
Range 0.63~500mm, resolution 0.01mm, high speed scanning mode, selectable
backlight, alarm mode, differential mode, RS232C output, data send using hyper
terminal. Supplied with high temperature probe, temperature range 0~340OC.
Krautkramer DMS Thickness Gauge
KRA,DMS
AU
&RPSOHWH ZLWK HFKR YHUL¿FDWLRQ DQG ORJJHU ,QFOXGHV KLJK WHPSHUDWXUH SUREH
and cable. Incorporates a wave form display for accurate assessment of material
under test, measurement of thickness whilst ignoring external paint. Probe will
operate to 200OC without cooling, up to 540OC with cooling. Measurement ranges
0.75mm~250mm (for different ranges other probes are available). Resolution
0.01mm. Stores up to 80,000 readings or 1,200 readings with full waveform
information.
Concrete Testing Equipment
(/(7\SH(/&RQFUHWH&RYHU0HWHU
ELE,EL35-2020
Steinkamp BP7 Ultrasonic Concrete Tester
AU/NZ
STE,BP7
AU
Non-destructive measurement of concrete thickness above steel reinforcement
rods. Measures rod diameter. Depth range 360mm for rod diameters 6~40mm &
200mm depth for rod up to 6mmØ. Small search head 80H x 50mmØ. Provides
a high resolution capability when mapping out reinforcement structures. Range
100mm with 6mm bar to 120mm with 40mm bar. Battery operated.
Measures the time a signal takes to propagate through a material. Used for
FRQFUHWHUHIUDFWRU\EULFNVWLOH¿UHGDQGXQ¿UHGRXWFURSSLQJURFNVWXQQHOZDOOV
frozen ground, electrolytic carbon, plastics, adhesion, cast iron and wood etc.
Technique relies on the fact that the pulse velocity relates to the materials tensile
strength. Instrument can be used to determine % steel in concrete, variations in
the moisture content, measurements of crack depth, voids, etc.
+LOWL365HEDU&RSSHU3LSH(OHFWULFDO&DEOH/RFDWRU
Protimeter SM Moisture Meter
HIL,PS20
AU
Localise and position of reinforcement, (rebars) copper, aluminium pipes and
unshielded live electric cables. Depth range for detection of rebars 0~100mm,
for copper & aluminium pipes 60mm, rebar diameter 8~36mm, depth detection
DFFXUDF\aPP“PPDERYHPP“PP“GHSWKDERYHaPP
“PP“GHSWKEDVHGRQPPUHEDUV'HWHFWLRQRIFRSSHUDOXPLQLXP
pipes based on 10~30mmØ, only detection with depth of 0~60mm, no depth
reading, same for live electric cables, cannot detect live cables in metal conduit
or shielded cables.
PRO,SM
AU
Moisture meter for survey work. Very good for determining wet points. Can be
used on both concrete and timber. Subsequent accurate measurements can
then be made.
Ż1(:Ż
3URFHT1''LJL6FKPLGW7HVW+DPPHU
PRO,2000-ND
AU
Concrete hardness tester (Schmidt hammer). Supplied complete with inbuilt
graphical LCD for setting up and graphical display of results,up to 500 results
can be stored. RS232 interface and software supplied for down loading. Impact
energy 2.207Nm. Engineering units of results in N/mm2, MPa, psi, kg/cm2. For
concrete thickness greater than 100mm.
Profometer-4 Rebar Locator
PRO,PROFO-4
Rebar locator.
MY
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
87
Non - Destructive Testing
Test & Measurement
Concrete Testing Equipment (cont’d)
Proceq LR Concrete Test Hammer
PRO,LR
AU
Concrete hardness tester (Schmidt hammer). Supplied with in-built mechanical
chart recorder. Impact energy 0.735Nm, 0.075kgm. For concrete thickness less
than 100mm.
Hilti Ferroscan Concrete Reo Scanner
HIL,FERROSCAN
AU
Reinforced concrete imaging system. Displays depth of concrete coverage, location
of reinforcement rods and anchor setting points. Fast, simple operation. Depth
mode allows reinforcement rods at different depths to be viewed. Printer interface
and PC interface and software allow images to be printed and/or stored for further
use. Depth coverage up to 180mm. Reinforcement rod diameter measurement
range 6~36mm. Area covered in a single measurement run 600 x 600mm; 42
image memory allows total 15m2 coverage without downloading.
Protimeter CMIII Concrete Moisture Meter
PRO,CMIII
AU
Measures concrete moisture content using 2 methods. Firstly using impedance
as a direct instant method. Secondly an accurate method requiring placing a box
on the concrete and measuring the humidity generated by the concrete.
Ż1(:Ż
Protimeter Moisture Measurement System
PRO,MMS-PLUS
AU
Moisture meter for detection of moisture in non conductive solid materials such as
wood and masonry. Two measurement modes, search for qualitaive measurements
and measure mode for precise and locaised moisture content. Supplied with pin
type probes, deep wall probes, hygrometer probe and extention cord,for RH,
ambient temperature or dew point temperature. Hygrostick probe supplied for
surface temperature measurement. Logging software and RS232 computer
interface supplied.
Ż1(:Ż
Olsen FTG Concrete Thickness Gauge
OLS,FTG
AU
Concrete thickness gauge utilising the impact Echo test method. Can measure
concrete thickness in two ranges: 6 to 60cm and up to 1.8m. This concrete
WKLFNQHVVJDXJHLVDEDWWHU\RSHUDWHGKDQGKHOGV\VWHPIRUPHDVXULQJWKHÀDZV
and thickness of concrete slabs, pavements, walls and other plate-like structures
IURPRQHVLGH8SWRUHDGLQJVFDQEHVWRUHGLQWKH¿HOGEHIRUHWKHPHPRU\
is full. RS232 interface and transfer software supplied.
Hardness Testers
Krautkramer DynaPocket Rebound Hardness Tester
KRA,DYNAPOCKET
AU
Based on the Leeb’s method HL, utilising a 3mm tungsten carbide ball. Other
hardness scales can be selected, HS Shore, HB Brinell, HRB Rockwell B, HRC
Rockwell C, HV Vickers and N/mm2 tensile strength. Choice of 9 material groups
can be selected, they are St Low-alloy/unalloyed steel and cast steel, ASt Tool steel,
SSt Corrosion resistant steel, GCI Gray cast iron, NCI Nodular graphite cast iron,
AL Aluminium cast alloys, brS Brass, brZ Bronze, Cu Wrought copper alloys.
3URFHT(TXRWLS+DUGQHVV7HVWHU
PRO,EQUOTIP
AU
7HVWSUREHRQDÀH[LEOHOHDG3UREHW\SH'LVVWDQGDUGFDWHULQJIRUPRVWPDWHULDOV
Measurement ranges steels 80~650HB, 80~940HV, 20~68HRC, aluminium
castings 20~160HB, cast iron 90~380HB, brass 40~170HB & copper wrought alloys
43~315HB. Test hardness must not exceed 940HV. Battery operated.
%DUHLVV+3()06KRUH$+DUGQHVV7HVWHU
BAR,HPE-FM02177
AU
Durometer tester for general rubber, elastomer, soft plastic, tires, rubber rolls &
rubber hoses. Surface min 35mmØ, material thickness of 6mm are necessary
for a hardness test according to the standards. Hardness tests can be conducted
LQDYHUWLFDOKRUL]RQWDOSRVLWLRQVDQGRQSODFHVZKLFKDUHGLI¿FXOWWRUHDFK7HVW
WLPHVHWDEOHIURPaV5HDGLQJH[DFWQHVVRI“6KRUHDQGDFFRUGLQJWRVHW
GRZQVWDQGDUGVGHYLDWLRQRI“6KRUH
88
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Industrial Equipment
Test & Measurement
Industrial Calibrators
Analog
Out
Pressure
(Bar)
Vacuum
(Bar)
Battery
RS232
Accuracy %
Model
Type
AMB,CAL-20MPA
Pressure pneumatic
200
0.5 fs
AME,HL2700N
Dead weight tester hydraulic
225
0.05 reading
AME,PPCE-NATA*
Pressure hydraulic
700
0.04 reading
BEA,BIC200
Industrial incl. Pressure
1
DRU,DPI603-10-NATA*
10
DRU,DPI603-20
20
DRU,DPI603-2NA*
2
Pressure pneumatic
DRU,DPI603-20NA*
DRU,UPS-IS
0.85
0.075 fs
Yes
160
50
55
55
Yes
Current loop
Current
Source mA
50
100
20
DRU,DPI610-160
Current
mA
0.025 fs
24
0.25
55
FLU,725
FLU,725-NATA*
Industrial
110
FLU,743B
FLU,744
Industrial (hart)
FLU,700S/W-DPC-TRACK
S/ware for Fluke 743B & 744
GRA,W6-NATA*
Water bath
HAL,KAL84
Very low pressure
Yes
0.1
10
Yes
Linearity ±0.5%
DRU,DBC150TC
0.3°C
HAR,9100-A
0.5°C
HAR,9105-NATA*
Dry well temperature
0.1
Yes
HAR,9107-NATA*
HAR,9141-NATA*
0.1°C
0.5
JOF,LPC-NATA*
Pressure
SER,NOVA-1
Dry well temperature
Yes
Pressure pneumatic
SI,PC6-40-NATA*
10
0.8
2
0.85
Yes
0.1 fs
200m
0.1°C
SI,PC6-2-NATA*
SI,PC6-20-NATA*
22
YES
20
40
1.0
Yes
Yes
0.025 fs
No
Yes
±0.5°C
Yes
±0.01°C
50
50
SP,PC6-1000-NATA*
HAR,9150
Thermocouple furnance
HAR,9170R
Metrology well calibrator
HAR,3125
Temperature surface probe
calibrator
JOF,1200SE
Temperature calibrator
HAR,7102
Temperature micro bath
±0.5°C~200°C,
±1%~400°C
150~200°C
Yes
FLU,718
SI,PC6-PRO 350
DRU,DPI610-2-NATA
Yes
Pressure calibrator
DRU,DPI610-400-NATA
SI,HTP1
SI,TPI-40
±0.25°C
350
2
-1
400
Pressure pump
Yes
0.025°C
±55
0~24
Yes
0.025°C
±55
0~24
1,000
40
-1
* Nata Calibrated
90
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Industrial Equipment
Test & Measurement
Industrial Calibrators (cont’d)
Freq
kHz
Freq
Source
kHz
Loop
Power
V
Model
Type
AME,PPCE-NATA*
Pressure hydraulic
BEA,BIC200
Industrial incl. Pressure
48
Pressure pneumatic
24
Resist
Measuremt
RTD/
TC
Temp
Source °C
Voltage
Max V
Voltage
Source V
30
100
Ÿ
DRU,DPI603-10-NATA*
DRU,DPI603-20
DRU,DPI603-2NA*
50
DRU,DPI603-20NA*
DRU,DPI610-160
DRU,UPS-IS
FLU,725-NATA*
300
11
24
10
+50
10,24
+50
10,24
500
Industrial
FLU,743B
FLU,744
Industrial (hart)
FLU,700S/W-DPCTRACK
S/ware for Fluke 743B & 744
GRA,W6-NATA*
Water bath
HAL,KLA84
Very low pressure
50
5
24
NŸ
Yes
500
0~150
DRU,DBC150TC
-45 (below amb) ~ 150
HAR,9100A
40~300
HAR,9105-NATA*
10
Current loop
FLU,701-NATA*
FLU,725
24
40~650
Dry well temperature
HAR,9107-NATA*
-45~140
HAR,9141-NATA*
40~650
SER,NOVA-1
200~1,000
SI,PC6-2-NATA
SI,PC6-20-NATA*
Pressure pneumatic
SI,PC6-40-NATA*
24
SP,PC6-1000-NATA*
Pressure Hydraulic
HAR,9150
Thermal couple furnance
150~1,200
HAR,9170R
-45~140
JOF,1200SE
Metrology well calibrator
Temperature surface probe
calibrator
Temperature calibrator
150~1,200
HAR,7102
Temperature micro bath
-5~125
HAR,3125
35~400
FLU,718
SI,PC6-PRO 350
DRU,DPI610-2-NATA
Pressure calibrator
DRU,DPI610-400-NATA
SI,HTP1
SI,TPI-40
Pressure pump
* Nata Calibrated
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
91
General Industrial Equipment
Test & Measurement
Industrial Calibrators (cont’d)
Fluke 5500A Multi Product Calibrator with NATA Calibration
FLU,743B
AU/MY
Includes RS232 interface. DC voltage measurement 0.025%, 300V max, source
0.01%, 15V max. DC current measurement 0.025%, 110mA max, source 0.01%,
P$PD[5HVLVWDQFHPHDVXUHPHQWNȍPD[VRXUFHNȍ
PD[)UHTXHQF\PHDVXUHPHQWa+]VRXUFHFRXQW+]aN+]
‘K’ thermocouple measurement 0.3OC, source 0.3OC Pt100. RTDs measurement
0.3OC, source 0.1OC. Measures and simulates 4~20mA, t/c E, N, J, K, T, B, R, S,
&ZLUH57'VIUHTXHQF\WHVWOLPLWVZLWFKHV&DQXVHVFDOLQJIDFWRUV
for measurement & source. Built in calculator. Autostep function. Allows user
entered values. Operates as a 8k point data logger. Note PC software only
supports 15 tags.
Fluke 725 Process Calibrator
Fluke 744 DOC Calibrator with Hart
FLU,725
AU/NZ
DC voltage measurement 0.025%, 300V max, source 0.02%, 11V max. DC current
measurement 0.025%, 110mA max, source 0.01%, 22 mA max. Resistance
PHDVXUHPHQW Nȍ PD[ VRXUFH Nȍ PD[ )UHTXHQF\
measurement 5 counts 1Hz~50kHz, source 1 count 20Hz~5kHz. ‘K’ thermocouple
measurement 0.3OC, source 0.3OC. Pt100 RTD measurement 0.5OC, source
0.2OC. Measures and simulates 4~20mA, t/c E, N, J, K, T, B, R, S, & C, 2, 3 & 4
ZLUH57'VDQGIUHTXHQF\2SHUDWHVIURPGU\FHOOEDWWHULHV
Fluke 725 Process Calibrator NATA
FLU,725-NATA
6SHFL¿FDWLRQDVDERYHEXWZLWK1$7$FDOLEUDWLRQ
92
Fluke 743 Calibrator
FLU,5500A-NATA
AU
Calibrator sources direct voltage & current, alternating voltage and current,
with multiple waveforms and harmonics, 2 simultaneous voltage outputs or
voltage & current. Simulates power with phase control, resistance, capacitance,
thermocouples and RTDs. Selectable ranges include the following outputs
Vdc from 0~1.02kV, Vac from 1mV~1.02kV with output from 10Hz~500kHz.
AC current from 0.01µA~11A with output from 10Hz~10kHz. DC current from
a$ 5HVLVWDQFH YDOXHV IURP VKRUW FLUFXLW WR 0ȍ &DSDFLWDQFH YDOXHV
from 330pF~1,100µF. Temperature t/c B, C, E, J, K, L, N, R, S, T, U, RTD Pt385
ȍ3Wȍ3Wȍ3Wȍ3Wȍ3WNȍ1L
ȍ&Xȍ
AU
FLU,744
AU/NZ/MY
Documenting process calibrator which includes HART communication protocols
for communicating with and setting up smart transmitters. RS232 interface. DC
voltage measurement 0.025%, 300V max, source 0.01%, 15V max. DC current
measurement 0.025%, 110mA max, source 0.01% 22mA max. Resistance
measurement 0.05%, 11kȍ max, source 0.01% 11kȍ PD[ )UHTXHQF\
measurement 0.5%, +5, 40~500Hz, source 1 count 20~5kHz. ‘K’ thermocouple
measurement 0.3OC, source 0.3OC Pt100. RTDs measurement 0.3OC, source
0.1OC . Measures and simulates 4~20 mA, t/c E, N, J, K, T, B, R, S & C, 2, 3 & 4
ZLUH57'VIUHTXHQF\WHVWOLPLWVZLWFKHV8VHVVFDOLQJIDFWRUVIRUPHDVXUHPHQW
& source. Built in calculator. Autostep function. Allows user entered values.
Operates as an 8k point data logger. Note PC software only supports 15 tags.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Industrial Equipment
Test & Measurement
Industrial Calibrators (cont’d)
Fluke 700 Pxx Series Pressure Modules
FLU,700PXX
Hart 9100-A Dry Block Temperature Calibrator 30~300OC
NZ
HAR,9100-A
NZ
Assortment of Pxx series pressure modules for the Fluke 741/744 process
calibrators.
Stability is 0.2OC @ 50OC & 0.3OC @ 300OC. Accuracy for 35~200OC ±0.5 for
200~300OC ±1, for well holes greater than ¼” ±2OC.
Druck DBC150TC Dry Well Calibrator Calibrator
Ż1(:Ż
DRU,DBC150TC
AU
Temperature range -45(below ambient)~150OC. Accuracy 0.3OC, resolution
0.01OC, stability 0.03OC. Well standard insert supplied 145mm deep, 5, 6.6 &
9.8mmØ. Heating time 14min 20~120OC, cooling time 22min 25~-20OC. Calibrator
also measures sensor outputs, it can measure 5 types of RTD & 11 types of
thermocouple. Supports 2, 3, 4 wire RTD and provides cold junction compensation
for thermocouples.
Hart 3125 Surface Probe Calibrator 35~400OC
HAR,3125
Temperature range 35~400OC. Display accuracy +/-0.5~200degC, +/-1.0~400OC.
Stability +/-0.2~300OC, +/-0.3~400OC. Resolution 0.01deg. Heating time 25~400OC
22min. Cooling time 400~100OC 65min. Temperature surface plate 3.8” diameter
accessible.
Hart 9141 Dry Block Temperature Calibrator 50~650OC
HAR,9141-NATA
Hart 9105 Dry Block Temperature Calibrator -25~140OC NATA
HAR,9105-NATA
HAR,9105
AU
MY
AU
AU
Range 50~650OC, basic accuracy 0.5% (holes > ¼” 2OC). Insert hole sizes
1
/16”, 1/8”, 3/16”, ¼”, 3/8” & ½”. Includes PC software and interface cable. Heating
time 1min to 650OC. Cooling 25min from 650OC~100OC. Well depth 4.875”.
Stabilization time 7min.
Range -25~140OC, accuracy 0.1, resolution 0.01, stability 0.02. RS232 interface
for ramp and soak programming. Well dimensions 150mm deep, 19, 5, 3 & (2x)
PP‘+HDWVDQGFRROVLQOHVVWKDQPLQ1$7$FHUWL¿HG
Ż1(:Ż
Hart 9107 Dry Block Temperature Calibrator -45~140OC NATA
Temperature range 150~1200OC. Stability +/-0.5OC, display accuracy of +/-5OC
across entire range. Display resolution 0.1deg~999.9deg, 1deg above 1000OC.
Well diameter 1.25”, well depth 5.5”, insert type A. 1/16, 1/4, 3/8, 3/16, 1/8, 1/2”.
Heating time 35min to 1200OC, cooling time 140min.
HAR,9107-NATA
AU
Range -45~140OC, accuracy 0.1, resolution 0.01, stability 0.02. RS232 interface
for ramp and soak programming. Well dimensions 150mm deep, 19, 5, 3 & (2x)
PP‘+HDWVDQGFRROVLQOHVVWKDQPLQ1$7$FHUWL¿HG
Hart 9150 Furnance 150-1200OC
HAR,9150
Ż1(:Ż
Hart 9170-R Metrology Well Calibrator with built-in reference
HAR,9170-R
AU
Temperature range -45~140OC with bult in reference thermometry. Reference
input accepts (not supplied) 100, 25 and 10ohm PRT’s. Display accuracy +/0.1OC, stability +/-0.005OC full range, resolution 0.001dOC. Well depth 6.3”,
insert type A 1/4, 3/16, 1/4, 1/8, 1/4, 3/8”. Large LCD, numeric keypad and on
screen menus. Heating time 32min 23 to 140OC, 45 minutes -45~140OC, cooling
time 44min 23~-45OC, 19min 140~23OC. Supplied with RS232C interface and
CD-ROM software.
-RIUD6(3UHFLVLRQ7HPSHUDWXUH&DOLEUDWRU
JOF,1200SE
MY
Lightweight, portable for Lab and general use. Simple single step zero setting.
Temperature range 300~1200OC. Excellent performance characteristics.
Accuracy +2.0OC. Stability +0.5OC. Display in OC or OF to 0.1 resolution. Fast
cooling and heating. User-selectable slope rates for controlled thermo switch
testing. Self diagnostics Includes Semi-auto Switch Test and Hysteresis
Test.
Grant W6 Temperature Bath NATA Calibrated
GRA,W6-NATA
AU
Water/oil bath calibrator for calibrating temperature probes. Ranges water
ambient 100OC; silicon oil ambient; 150O&5HTXLUHV/RLOQRWVXSSOLHG'LJLWDO
temperature controller and display. Stability 0.004OC. Uniformity 0.01OC. Display
resolution 0.1OC. Tank size 300w x 150d x 150hmm.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
93
General Industrial Equipment
Test & Measurement
Industrial Calibrators (cont’d)
Ż1(:Ż
Hart 7102 Temperature Micro Bath temperature range -5~125OC
HAR,7102
Druck DPI603 2Bar Pressure Calibrator NATA Calibrated
AU
Temperature range -5~125OC. Tank diameter 1.9”, 5.5” deep, volume 0.75L,
includes tank lid. Accuracy +/-0.25OC, stability +/-0.015OC at -5OC, +/-0.03OC at
121OC, resolution +/-0.01OC. Heating time 25~100OC 30 minutes, cooling time
25~0OC 30 minutes. RS232C interface and CD-ROM sofware supplied.
DRU,DPI603-2NATA
AU
Accuracy 0.075% fs includes pump for vacuum and pressure. Pumps to 20bar
pressure & -850mbar vacuum. Measurements can be made to 2bar positive
pressure & -1bar vacuum. Unit has a 24V energising voltage. Monitors loop
current to 55mA dc loop voltage to 50V. Sealed to IP65. Rechargeable battery
operated. Displays in 24 different units. Interface 1/8”BSP.
SI PC6-2-NATA Pressure Calibrator & Pump -1~2Bar 0.025% Accuracy
SI,PC6-2-NATA
SI,PC6-2
AU
MY
Range is -1~2bar. Measures voltage 0~100mV (1µV resolution), 0~5V (0.1mV
resolution) & 0~50V (1mV resolution) & current 0~50mA (1µA resolution) all
at 0.025% accuracy. Will sources 0~10V (0.2mV resolution) & 0~50mA (1µA
resolution) also at 0.025% accuracy. Voltage output regulated 10V ±0.1%, current
30mA and unregulated supply 24V ±10% current 50mA. Pressure switch status.
Complete with a full range of pressure connection adaptors. Record logging
FDSDELOLW\ DQG 56 LQWHUIDFH GRZQORDG WR VSUHDG VKHHW ¿OHV %DWWHU\
operation 10h or mains operation via charger.
SI PC6 Pressure Calibrator & Pump 20 Bar 0.025% Accuracy
SI,PC6-20-NATA
Druck UPS-IS Current Loop Calibrator
DRU,UPS-IS
AU
Intrinsically safe 4~20mA source and measurement. Provides 24V loop power.
Accuracy 0.25%. Input and output resolution 10µA.
Beamex BIC200 Instrument Calibrator
BEA,BIC200
AU/MY
For both electronic and pneumatic instruments. Output ranges settable to 119.9%
of range 0~10V, 1~5V, 4~20mA, 0~20mA, 10~50mA & 0~50mA. Output source for
current ranges 24 & 48V. Input ranges to 4½ digit display 100mV, 1, 10 & 100V,
P$ aP$ Ÿ 3UHVVXUH PHDVXUHPHQW UDQJHV aEDU aEDU
Operates from internal NiCd batteries or external ac.
Ż1(:Ż
Halstrup KAL84 0-1kPa Portable Pressure Calibrator
HAL,KAL84
AU
Portable battery operated 0-1.000kPa (0-10mbar) low pressure calibrator. Linearity
+/- 0.5% +/- 1 digit, hysteresis 0.1%, medium - air and all non aggressive gases,
pressure connections 6.5mm hose NW5, interior tubing diameter 5mm. Analogue
output 0-1V , display 41/2 digit, power supply via mains adaptor 100-240VAC and
NiCd re chargable battery pack.
6,3&1$7$3UHVVXUH&DOLEUDWRU3XPS1$7$&HUWLÀHG
SI,PC6-40-NATA
SI PC6-PRO 350Bar Pressure Calibrator & HTP1 Hydraulic Pump
SI,PC6-PRO 350
AU
Range to 10bar (145psi). Display 4½ digit, can display in bar, psi, mercury &
H2Og. Analogue output 2Vdc. Includes adaptors ¼”BSP to various BSP & NPT.
Measures pressure and vacuum. Battery operated.
94
MY
Basic accuracy is 0.025%. Range is 0~350Bar. Will also measure 0~100mV
(1uV resolution), 0~5V (0.1mV resolution), 0~50V (1mV resolution) and current
0~50mA (1uA resolution) all at 0.025% accuracy. Will source 0~10V (0.2mV
resolution) & 0~50mA (1uA resolution) also at 0.025% accuracy. Voltage output
regulated 10V +/-0.1% current 30mA & unregulated supply 24V +/-10% current
50mA. Pressure switch status. Pressure media oil, water & non corrosive gases.
10h battery operation or mains via charger. Comes complete with a full range of
pressure connection adaptors.
SI,PC6-700
JOF,LPC-NATA
AU
Basic accuracy is 0.025%. Range is 40bar. Measures voltage 0~100mV (1µV
resolution), 0~5V (0.1mV resolution) & 0~50V (1mV resolution) & current 0~50mA
(1µA resolution) all at 0.025% accuracy. Will source 0~10V (0.2mV resolution) and
0~50mA (1µA resolution) also at 0.025% accuracy. Voltage output regulated 10V
±0.1% current 30mA and unregulated supply 24V ±10% current 50mA. Pressure
switch status. Complete with a full range of pressure connection adaptors. Record
ORJJLQJFDSDELOLW\DQG56LQWHUIDFHGRZQORDGWRVSUHDGVKHHW¿OHV%DWWHU\
operation 10h or mains operation via charger.
SI PC6 700Bar Pressure Calibrator & HTP1 Hydraulic Pump
Jofra LPC Pressure Calibrator NATA Calibrated
AU
Pressure calibrator and pump. The basic accuracy is 0.025%. The range is
RXWSXWSUHVVXUHWR%DURXWSXWYDFXXPWR%DU1$7$FHUWL¿HG,QVWUXPHQW7KH
instrument will also measure voltage 0~100mV (1µV resolution), 0~5V (0.1mV
resolution) and 0~50V (1mV resolution) and current 0~50mA (1µA resolution) all
at 0.025% accuracy. The instrument will source 0~10V (0.2mV resolution) and
0~50mA (1µA resolution) also at 0.025% accuracy. Voltage output regulated
10V +/-0.1% current 30mA and unregulated supply 24V +- 10% current 50mA.
Pressure switch status. 10h battery operation or mains operation via charger.
Comes complete with a full range of pressure connection adaptors.
MY
Basic accuracy is 0.025%. Range 0~700Bar. Will also measure 0~100mV (1uV
resolution), 0~5V (0.1mV resolution), 0~50V (1mV resolution) and current 0~50mA
(1uA resolution) all at 0.025% accuracy. Will source 0~10V (0.2mV resolution) &
0~50mA (1uA resolution) also at 0.025% accuracy. Voltage output regulated 10V
+/-0.1% current 30mA & unregulated supply 24V +/-10% current 50 mA. Pressure
switch status. Pressure media oil, water & non corrosive gases. 10h battery
operation or mains via charger. Comes complete with a full range of pressure
connection adaptors.
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Industrial Equipment
Test & Measurement
Industrial Calibrators (cont’d)
SI PC6 Pressure Calibrator & Pump 1000 Bar 0.025% Accuracy
Druck DPI610-2-NATA 2 Bar Pressure Calibrator
Pressure calibrator and pump. The basic accuracy is 0.025%. The range is
1000Bar. Nata calibrated Instrument. The instrument will also measure Voltage
0~100mV (1uV resolution), 0~5V (0.1mV resolution) and 0~50V (1mV resolution)
and current 0~50mA (1uA resoultion) all at 0.025% accuracy. The instrument will
source 0~10V (0.2mV resolution) and 0~50mA (1uA resolution) also at 0.025%
accuracy. Voltage output regulated 10V+/-0.1% current 30mA and unregulated
supply 24 V +/- 10% current 50mA. Pressure switch status. Pressure media oil
and water (unit can measure non corrosive gases but not pump them). 10h battery
operation or mains operation via charger. Comes complete with a full range of
pressure connection adaptors.
Pneumatic pressure calibrator including pump and current voltage standard.
Pressure range -1~2bar, ±0.025%fs. Voltage input ±50Vdc, ±0.05%rdg,
±0.004%fs. Current input ±55mA, ±0.05%rdg, ±0.004%fs. Temperature 10~40°C, ±1 (ambient) switch open/closed. Voltage output 10Vdc, ±0.1% or 24V
±5%. Current output 0~24mA ±0.05% rdg ±0.01%fs. Data logger stores up to
YDOXHVP$UDPSFRQ¿JXUDEOH3UHVVXUHSRUW*1/8´ILQFOXGHVÀH[LEOH
hose kit. Pump includes screw adjustment.
SI,PC6-1000-NATA
SI Pressure HTP1 Pressure Pump
SI,HTP1
DRU,DPI610-2-NATA
AU
NZ
Hand operated hydraulic pressure pump, capable of up to 700bar/10,000psi. Quick
priming and pressure generation, using scissor action pump. High pressure/priming
selector. Fine adjustment control. Pressure release valve. Supplied with integral
,$1=FDOLEUDWHGGLJLWDOJDXJH8VHVSDUDI¿QRLODVWKHZRUNLQJÀXLG
SI Pressure TP1-40 Pressure Pump
SI,TP1-40
NZ
Fully portable hand operated dual source of pneumatic pressure and vacuum.
Generates up to 40bar/600psi pressure or 96% vacuum. Adjustable stroke to
provide over pressure protection. Supplied with thread adaptors. Reference gauge
LVUHTXLUHGVHHRSWLRQDO)OXNH3UHVVXUHPRGXOHV)/83[[
'UXFN'3,3UHVVXUH&DOLEUDWRU%DU1$7$&HUWLÀHG
DRU,DPI603-10-NATA
AU
Displays in 24 different units. Interface 1/8” BSP. Accuracy 0.075% fs, includes
pump for vacuum and pressure. Pumps to 20bar pressure & -850mbar vacuum.
Measurements can be made to 20bar positive pressure & -1bar vacuum. Unit has
a 24V energising voltage. Monitors loop current to 55mA dc @ ±0.075% reading &
0.005% fs. Monitors loop voltage to 50V @ ±0.15% of reading & 0.02% fs. Unit
is sealed to IP65. Battery life per charge is approx 40h (no 24V load).
Druck DPI603 Pressure Calibrator 20Bar
DRU,DPI603-20
Druck DPI610-400-NATA 400 Bar Pressure Calibrator
DRU,DPI610-400-NATA
AU
Hydraulic pressure calibrator including pump and current voltage standard.
Pressure range 0~400bar ±0.025%fs. Voltage input 50Vdc, ±0.05%rdg,
±0.004%fs. Current input 55mA, ±0.05%rdg, ±0.004%fs. Temperature
10~40ºC ±1ºC (ambient) switch open/closed. Voltage output 10Vdc ±0.1% or 24V
±5%. Current output 0~24mA, ±0.05% rdg, ±0.01%fs. Data logger stores up to
YDOXHVP$UDPSFRQ¿JXUDEOH3UHVVXUHSRUW*1/8” (f), includes ÀH[LEOH
hose kit. Pump includes screw adjustment.
AU/MY
Accuracy 0.075%fs. Includes pump. Pumps up to 20bar pressure & -850mbar
vacuum. Measures up to 20bar pressure & -1bar vacuum. In-built 24V energising
voltage. Monitors loop current to 55mA. Loop voltage to 50V. Interface 1/8”
BSP. Battery operated.
'UXFN'3,3UHVVXUH&DOLEUDWRU%DU1$7$&HUWLÀHG
DRU,DPI603-20NA
AU
1$7$FHUWL¿HG8QLWLQFOXGHVSXPSIRUYDFXXPDQGSUHVVXUHFDQGLVSOD\LQ
different units. Interface 1/8” BSP. Accuracy 0.075%fs. Unit will pump up to 20bar
pressure & -850mbar vacuum. Measurements can be made to 20bar positive
pressure & -1bar vacuum. Unit has a 24V energising voltage. Monitor loop current
to ±55mAdc @ ±0.075% reading & 0.005%fs. Monitor loop voltage to 50V @
±0.15% of reading & .02%fs. Unit is sealed to IP65. Battery life per charge is
approx 40h (no 24V load)
Ambit Calibration Kit 20MPa
AMB,CAL-20MPA
20MPa gauge with hydraulic hand pump, accuracy 0.5%fs.
Druck DPI610HC 160Bar Pressure Calibrator
DRU,DPI610-160
AU
$PHWHN33&(%DU3UHVVXUH&DOLEUDWRU
AME,PPCE-NATA
Ametek Hydralyte HL2700N Dead Weight Tester
AME,HL2700N
AU
Hydraulic pressure calibrator including pump and current voltage standard.
Pressure range 160bar ±0.025% fs. Voltage input ±50Vdc, ±0.05% reading &
±0.004%fs. Current input ±55mA, ±0.05% reading & ±0.004%fs. Temperature
10~40OC, ±1 (ambient) switch open/closed. Voltage output 10Vdc, ±0.1% or
24V ±5%. Current output 0~24mA, ±0.05% reading & ±0.01% fs. Datalogger
VWRUHVXSWRYDOXHVP$UDPSFRQ¿JXUDEOH3UHVVXUHSRUW*1/8“ (f). Pump
includes screw adjustment.
AU/MY
High pressure calibrator with pump 700bar (10,000psi). Digital display with 5 digit
resolution. Accuracy over 70bar ±0.07. Accuracy below 70bar ±0.35. Current
and voltage measurement ranges 4~20mA, 0~50mA & 0~30V.
AU/MY
Dual range interchangeable piston:-100~4,500kPa, 0.5kPa increments,
500~22,500kPa, 1kPa increments. Accuracy 0.05% of reading. Includes special
calculator for high accuracy pressure calculations and also conversion of units.
Ultrasonic Baths
Soniclean 1000HT Ultrasonic Cleaning Bath
SON,1000HT
Tank size 495w x 295d x 150h mm includes heater and timer.
AU
Soniclean 2000HT Ultrasonic Cleaning Bath
SON,2000HT
Tank size 495w x 295d x 299h mm includes heater and timer.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
AU
95
General Industrial Equipment
Test & Measurement
Environmental Test Chambers/Ovens
Model
AES,LH-6
ACS,CH160C
Type
Temperature & humidity chamber
LAB,OTWMD18
MEM,ULE400
TEN,TJR
Temperature°C
Humidity %RH
Size (litres)
-20~94
20~98
150
-70~180
20~95
178
30~200
Laboratory oven
Temperature chamber
$&6&+&7HPSHUDWXUH+XPLGLW\(QYLURQPHQWDO&KDPEHU
ACS,CH160C
ACS,TROLLEY
53
33.6
LAB,OTWMD18
AU
Fan forced laboratory oven, ambient to 200OC. Capacity 66L, digital temperature
controller.
7HQQH\7-5(QYLURQPHQWDO7HPSHUDWXUH&KDPEHU
TEN,TJR
AU
AU
AES,LH-6
MEM,ULE400
AU
Range 30~220OC. Capacity 53L, internal dimensions 400w x 400d x 330hmm. 2
shelves. Electronic temperature control with max deviation of 0.8~4OC.
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional fee you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected occurences - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
96
NZ
Internal dimensions 610w x 510d x 480hmm. External dimensions 1,170w x 840d
x 79hmm. Operating range temperature -20~94OC, ±0.5 at sensor. Humidity
20~98%RH ±2% at sensor. Includes self contained humidity system, 200 x 200mm
window, access port, microprocessor controller and high/low safety shut down.
Software for remote control of ACS,CH160C temperature and humidity chamber.
Remote programming and control of chamber plus report generation. Includes
&RPSDT$UPDGD ( 3HQWLXP ,,, 0+] QRWHERRN FRPSXWHU 56&
interface cable.
0HPPHUW8/(/DERUDWRU\2YHQ
AU
Range -80~200OC. Workspace 400w x 280h x 300d mm. In transit case 1,350w
x 720d x 1,050h mm. Operates in case with lid off. Programmable controller
24 step display resolution 1OC. Heating rates 25~100OC, 15min or 25~200OC,
55min. Cooling rates 25~
-40OC, 20min or 25~-80OC, 65min. 50mmØ access port.
$(6/+7HPSHUDWXUH+XPLGLW\&KDPEHU
ACS Winkratos Software for CH160C Temperature & Humidity
Chamber
ACS,WINKRATOS
30~200
-80~200
/DEHF27:0'/DERUDWRU\2YHQ
AU
Temperature range -70~180OC, humidity range from 20~95%RH in the range of
10~80OC, dew point range 5~79OC for continous tests. Realtive humidity accuracy
±1%~±3%. Useful capacity 178L, internal dimentions 560w x 564d x 560hmm.
External dimensions 760w x 1,115d x 1,370hmm. Control by micro PLC and
control panel placed on the door (4 lines alphanumeric display and keyboard).
PLC programs Temp & RH cycles and to control all chamber functions and alarms.
80Ømm entry port, door with 230 x 230mm window, internal lighting, 1 shelf,
RS232C interface. Dissipation at -55OC,100W. Electrical power 4.5kW (average
3.3kW). Voltage; 230V +6%, -10%, 50Hz, 1ph. Noise 60dBA measured at 1m from
the front in a non reverberating room. Weight; 390kg (excluding transit case).
$&67UROOH\IRU&+&(QYLURQPHQWDO&KDPEHU
66
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Temperature & Humidity Measurement
Test & Measurement
Temperature/Humidity/Barometric Recorders
Kane-May KM1242 5 Channel Indicator & Recorder
KM,KM1242
Weathertronics 7020 Barograph
AU
WEA,7020
AU
Five channel temperature indicator and recorder. Range -100~1300OC, resolution
0.1. Uses type K thermocouples. Gives average, max and min for period recorded.
Operates from NiCd batteries or ac adaptor.
Barograph 1 or 7d. Sensitivity 0.3mB, accuracy 1%.
Hanna HI98704, 4 Channel Thermocouple Printer
Range 0.5~16psia. Safe operating temp range -39~75OC. Size 46w x 148d x
15hmm & 255g. Stores 1,800 measurements, 42 preset intervals. Data can be
exported to spreadsheet. Logs in meters, feet, mbar and Hg. Battery life 2y.
HAN,HI98704
Hobo Pressure Logger
HOB,PRES
AU
Four channel thermocouple input temperature display and printer. Accepts all
common thermocouple types including K & T.
Haenni KRK Thermohygrograph
HAE,KRK501
Dickson PR500 Pressure Logger
DIC,PR500
MY
MIC,MM01
Recording ranges -10~50OC & 0~100%RH. Specify 7d or 24h charts.
NZ
Records pressure in water and gas lines. Compact size is perfect for tight
locations. Water resistant stainless steel case for use for outdoor applications.
Pressure range is 0~500PSI, accuracy is ±1% of full scale. Stores 7936 data
points. Programming and data recovery done by Tech-Rentals.
Temperature -10~50C. Humidity 0~100%. Accuracy: Thermograph: +/-1% of the
full scale. Hygrograph: +/-4% of the full scale.
Micromech MM-01 Thermohygrograph
AU
AU
Temperature Meters/IR Thermometers
Model
Type
Temperature
Range °C
Output
ANA,AN2406
Precision RTD thermometer
-20~200
Serial & analogue
FLU,54
FLU,54-2
FLU,54Flukeview
Logging with IR interface
RS232
-250~1,767
Dual channel digital logging thermometer
FLU,54-2Flukeview
Ratio
IR interface & software
Type Type J, T, E, N,
K
R, S
RTD
RTD
2 Ch
Yes
Logging with IR interface USB
FLU,80PK3
Type K surface probe
Probe
FLU,80TK
Type K transducer
Analog out
HAR,1521-NATA
Precision thermometer NATA
-200~420
MIC,M90H
IR thermometer, high temperature range
600~3,000
MIC,M90Z
,5WKHUPRPHWHUQDUURZ¿HOGRIYLHZ
-50~1,000
RAY,MX4+
IR thermometer laser sighted
RAY,MX6
IR thermometer laser sighted plus digital camera
Fluke 54 Dual Input TC with Logging
FLU,54
-30~900
AU
Yes
RS232
Analog out & RS232
180:1
60:1
Analog & USB
60:1
No
No
1 Ch
Hart 1521 NATA Precision Handheld Thermometer
HAR,1521-NATA
AU
Digital thermometer with data logging. Takes most t/c inputs. Accuracy ±0.05%
+0.3OC. Logging 500 points with date and time stamp. Records min, max or
avg. Logged data can be reviewed on meter or downloaded via IR port (see
FLU,54FLUKEVIEW).
Accuracy 0.025OC. Includes 5614 probe ¼”Ø x 12” long. Calibrated in the
-183~500OC range. Probe operating range -200~420OC (cable and transition
to 150OC max).
Fluke 54-2 Dual Input TC
ANA,AN2406
FLU,54-2
AU
DSeries 2, dual input digital thermometer with data logging. Will take J, K, T, E, R,
S, N T C inputs. Accuracy +/-0.05%+0.3OC. 500 point logging with date and time
stamp. Also records min, max or avg. Logged data can be reviewed on meter or
downloaded via IR port (see FLU,54FLUKEVIEW : Fluke 54 with IR/RS232 cable
and Flukeview software or FLU,54-2FLUKEVIEW : Fluke 54-2 with IR/USB cable
and Flukeview software.
Fluke 54 Dual Input TC with Flukeview Logging Software
FLU,54FLUKEVIEW
AU
6SHFL¿FDWLRQDVDERYH/RJJHGGDWDFDQEHUHYLHZHGRQPHWHURUGRZQORDGHG
via IR port using cable and Flukeview software included.
Fluke 54-2 Dual Input TC with Flukeview Logging Software
FLU,54-2FLUKEVIEW
AU
Series 2, dual input digital thermometer with data logging. Will take most TC inputs.
Accuracy +/-0.05% +0.3 deg C. 500 point logging with date and time stamp. Also
records min, max or avg. Logged data can be reviewed on meter or downloaded
via IR port RS232 interface, (using cable and Flukeview software included).
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Analogic Precision RTD Thermometer
NZ
Range -20~200ºC accuracy is ±0.1, resolution is 0.01. Supplied with a
calibrated probe of 150mm x 6mmØ. Serial and analogue outputs. AC or battery
operation.
CHY 505 Portable Digital Reference RTD Thermometer
CHY,505
NZ
Portable digital reference rtd thermometer. Range is -25~250ºC, resolution is 0.1,
accuracy including probe ±0.05% of reading 0.3ºC. Supplied with PT385 RTD probe
OHQJWKPP[PP‘DQG,$1=HQGRUVHGFDOLEUDWLRQFHUWL¿FDWH
Raytek MX4+ Infrared Thermometer
RAY,MX4+
AU/NZ
Range -30~900OC. Size of measurement target is indicated by lasers. Instrument
includes Type K t/c for additional temperature measurement to set emissivity.
Target size 1/60 of distance. Built in emissivity table, audible/visible high low alarm.
Max, min, dif and ave display. RS-232 and analog output, windows software and
cable included. Accuracy ±1%, ±1OC. Response time 250m/s. Display resolution
0.1OC. Continuous measure mode.
TECHRENTALS
97
Temperature & Humidity Measurement
Test & Measurement
Temperature Meters/IR Thermometers (cont’d)
Raytek MX6 Photo Temp Infrared Thermometer, Built in Camera
RAY,MX6
AU/NZ
Range -30~900OC with built in digital camera. Min measurement 19mmØ, laser
class II, 16 point circle spot. Includes adjustable emissivity from 0.1~1.0 x 0.01.
Target size 1/60 of distance. Max, min, dif and av display with backlit lcd with
bar graph. Data output USB or 1mV/OC, windows software and cable included.
Accuracy ±0.75% of reading or ±1OC which ever is greater. Response time
250m/s. Display resolution 0.1OC. Continuous measure mode. Digital camera
DQGÀDVKEXLOWLQ
Micron M90H Infrared Thermometer
MIC,M90H
Mikron M90Z-B Infrared Thermometer
MIC,M90Z
AU
Features through lens sighting and sharp focusing. Temperature displayed
LQ YLHZ ¿QGHU 'DWD KROG SHDN YDOOH\ DQG DYHUDJH IXQFWLRQV 7HPSHUDWXUH
range -50~1,000OC. Accuracy 1%, 1OC. Field of view for measurement 1:180.
Rechargeable NiCd batteries give 8h life.
Fluke 80TK Thermocouple Module
FLU,80TK
AU
Use with DVM’s and recorders. Accepts K thermocouples. Temperature range
-50~1,000OC. Output 1mV/OC. Type 80KP-1 probe included.
AU
Range 600~3,000O&)RFXVLQJPPWRLQ¿QLW\)LHOGRIYLHZIRUPHDVXUHPHQW
1:180 (1/3O). Resolution 1OC. Accuracy 0.4% of reading. Recorder output 1mV/OC.
RS232C interface. Battery operated.
Thermal Imaging Cameras
ISI 525 Snapshot Thermal Camera
Ż1(:Ż
Flir Systems E45 ThermaCam Thermal Imaging Camera
FLI,E45
ISI,IR777
AU
Real time thermal imaging camera, hand held compact in size. Built in 2.5” colour
LCD, detector resolution 160 x 120, spectral range 7.5 to 13um, temperature range
-20~250OC.Accuracy +/- 2OC or +/-2%, imaging frame rate 50Hz, video output
standard RCA composite video, storage 200 pictures, standard JPEG, image run or
freeze. Image down load to PC via USB. Temperature operating range -15~45OC.
Also supplied with download software and Panasonic digital camera. Single
moveable spot for temperature measurement. Built in tripod mounting, 1/4”-20.
AU/NZ
Uncooled thermal imaging system with a 4” high resolution TFT LCD display
which captures and stores an image to a PCMCIA card. A cursor on the display
can be driven to any point on the image and a temperature at that point read
out. Measurement range is 0~350OC. PAL video output. In-built PCMCIA card
stores 72 images.
External Battery Pack for ISI,IR777 Thermal Imaging Camera
ISI,BATTPACK-EXT
AU
Optional sealed lead acid battery pack for ISI,IR777 Thermal Imaging Camera.
Battery capacity 10Ah, includes carry case for battery with shoulder strap,
smartcharger and special connector with 2m of connection cable.
SAT S160 Real Time Thermal Imaging camera
SAT,S160
AU/NZ
Compact hand held unit with 2.5” colour LCD, detector resolution 160 X 120,
spectral range 8~14µm, temperature range -20~250OC ±2 or ±2%. Imaging frame
rate 50Hz, video output PAL, image storage 500 pictures, image run or freeze.
Image down load to PC via USB. Ambient operating range -15~50OC. Also supplied
with download software and Panasonic DMC-FZZA digital camera.
Marconi Argus2 Black & White Thermal Camera
MAR,ARGUS2
AU
Gives live thermal image, quick and clear image. Good for fast assessment.
Applications include general industrial work, electrical work, surveillance work and
termite inspection. Displays temperature in the centre of image. If the image needs
to be recorded you can use the NOG,USBVIDEO or the Cannon MV400i and use
the analog video in (The ARGUS2 video out is an NTSC signal). Range is 0~500OC
±2 or ±2%. Ambient temperature measurement is ±2OC or ±5%. Display indicates
a temperature difference of 0.1OC. Uses the 0.8~14µm thermal range. Dust and
water proof to IP67. Battery life is 120min per battery (4 supplied).
Humidity & Moisture Meters
Model
Type
Features
PAN,MMS35
Moisture meter for air & nat gas
Moisture content under pressure
PRO,SM*
Concrete & timber moisture meter
Two pin inspection mode & RF mode
PRO,CMIII*
Concrete moisture meter
Gel conductivity & standard surface humidity test
*See Concrete Testing Equipment
Panametrics MMS35 Air/Natgas Moisture Analyser
PAN,MMS35
AU
Intrinsically safe for compressed air systems and hydrocarbons such as natural gas. Displays dew point & ppm moisture by volume. Pressure set as a constant. Data
logging with RS232 port for download. Operating temperature range -110~70OC. Pressure range 5µHg~5,000psig. Accuracy 60~-60OC ±2, -66~-110OC ±3. Repeatability:
60~-60OC ±0.5, -66~-110O&“5HVSRQVHWLPHVIRUVWHSFKDQJH*DVÀRZUDQJHIURPVWDWLFWRFPVYHORFLW\#DWP
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS
99
Security Equipment
Test & Measurement
Security Equipment
Detec DH50 Hand-held Metal Detector
DET,DH-50
Simple to operate, no adjustment needed. Audible alarm.
Elbex Video Surveillance/Record System
AU
Ż1(:Ż
Detec DH50 Hand-held Metal Detector Kit of 4
DET,DH-50-KIT4
AU
.LWRI[KDQGKHOGVHFXULW\PHWDOGHWHFWRU6LPSOHWRRSHUDWHQRDGMXVWPHQW
needed. Audible alarm.
ELB,CCTV1
AU
Multi-camera time lapse CCTV surveillance system. Four input sequential switcher
supplied with 2 cameras suited to internal covert applications. One camera is
KRXVHGLQDµ¿UHGHWHFWRU¶KRXVLQJDQGWKHRWKHULVDSLQKROHW\SH)LHOGRIYLHZ
105O & 70O. Includes 24h VHS recorder which operates at normal speed (3h) on
DODUP6HH(/%(;0'IRUDODUPSDFNDJH6\VWHPLVPRQRDQGLQFOXGHVD
´PRQLWRU&DPHUDPRXQWHGPLFURSKRQHLVLQFOXGHGZLWK¿UHGHWHFWRUKRXVHG
camera.
Elbex EXMD931 In-Vision Alarm Detector
ELB,EXMD931
AU
$ODUPVHQVRUNLWZKLFKLQFOXGHVLQYLVLRQPRYHPHQWPRQLWRU7KLVDOORZVDZLQGRZ
WREHVHWIRUWKHYLGHRSLFWXUH&KDQJHVZLWKLQWKHSLFWXUHZLOOWULJJHUDQDODUP
Elbex EXPD19 Pin Hole Camera
ELB,EXPD19
AU
3LQKROHPRQRFKURPHFDPHUDIRUVXUYHLOODQFHDSSOLFDWLRQV2SHUDWHVIURP9
dc or ac mains. Standard line level video output.
Poptron CCD RF Camera and Receiver IR Lighting
POP,RF-CCD
AU
9LGHRVXUYHLOODQFHFDPHUDZLWKUDGLRIUHTXHQF\OLQN7UDQVPLWVYLGHRDXGLRIURP
DFDPHUDPaPGHSHQGLQJXSRQFRQGLWLRQVa0+]FDUULHU6WDQGDUG
YLGHRDXGLRRXWSXW,QIUDUHGLOOXPLQDWRULQFOXGHGUDQJHP
*DUUHWW&6:DON7KURXJK0HWDO'HWHFWRU
GAR,CS5000
Optalign RF Transmitter Detector System
AU
Detects all metals. Requires assembly on-site & set-up. Adjustable sensitivity.
Garrett Superscanner Hand-held Metal Detector
GAR,SUPERSCANN
For security applications.
AU
Swise Surveillance Digital Camera
6:,&2/25
$8
&DSWXUHV XS WR LPDJHV ,QFOXGHV PRWLRQ GHWHFWRU RQO\ WDNHV LPDJHV RI
FKDQJHV&DQEHFRQQHFWHGWRDPRGHPWRGLDODQGWUDQVPLWWKHLPDJHV&RQWDFW
LQSXWZKLFKDFWLYDWHVGLDOLQJVRLWFRXOGEHFRQQHFWHGWRD'DWD7DNHUIRUGLDORXW
DODUPV,QFOXGHVVRIWZDUHDQGFDEOHWRGRZQORDGWKHLPDJHVWRD3&GLUHFWO\RU
YLDDPRGHP:LOOQRWRSHUDWHXQWLOSRZHUHG:KHQ¿QLVKHGZLOOQRWRSHUDWHDIWHU
SRZHUGRZQ6\VWHPFDQEHFRQ¿JXUHGDQGGRZQORDGHGE\756HUYLFHVSOHDVH
UHTXHVWTXRWDWLRQV6\VWHPGUDZVP$#9RSHUDWHVIRUGRQ$KU9
EDWWHULHVRUIRUGRQDONDOLQH'FHOOVRUGRQODQWHUQEDWWHULHV
AVE Serial to Video Converter Including Video Mixer
AVE,VSIPLUS
AU
0L[HVVHULDOGDWDWH[WZLWKYLGHRVLJQDOVRWKDWDSLFWXUHLQFOXGHVWKLVWH[W8VH
ZLWKD*36HJ*$(75(;WRDGGDORFDWLRQUHIHUHQFHWRDYLGHRRUXVHGZLWK
FDVKUHJLVWHU56RXWSXWWRUHFRUGWUDQVDFWLRQVRQDVHFXULW\FDPHUDSLFWXUH
Elbex 1-Camera VCR Surveillance System
ELB,CCTV2
OPT,BUG
AU
5DGLR WUDQVPLVVLRQ GHWHFWRU V\VWHP XVHIXO IRU µEXJ¶ GHWHFWLRQ DQG QHDUE\
transmission interception. Comprises 3 principal units R10 FM interceptor which
DXWRWXQHVWRDQHDU¿HOGWUDQVPLWWHUUDQJHPW\SLFDOIRU:9+)8+),Q
EXLOWVSHDNHUDQGGHYLDWLRQLQGLFDWRU)UHTXHQF\UDQJH0+]a*+]5$0
LQWHUFHSWRUZLWKKHDGSKRQHRXWSXW)UHTXHQF\UDQJHN+]a*+]6LJQDO
VWUHQJWKEDUJUDSK6FRXWIUHTXHQF\FRXQWHUIRURIIDLUIUHTXHQF\LQGLFDWLRQRI
QHDU¿HOGWUDQVPLVVLRQV,QEXLOWORJJLQJSHUPLWVDZDONWKURXJKVXUYHLOODQFHRI
an area. Accessory antennas are included to optimise reception. An optional PC
SDFNDJHSHUPLWVORQJWHUPVXUYHLOODQFHVHHVHSDUDWHPRGHO
Optalign Optalog Scanning Software
OPT,OPTOLOG
AU
3&LQWHUIDFHDQGVRIWZDUHIRU237%8*6FRXWIUHTXHQF\FRXQWHU
Pacom 8 mm Colour Camera, Auto Iris, 6~15mm Lens
CAM,COL-AUTO
Colour surveillance camera 8mm CCD auto Iris 6~15mm lens.
4 Camera Surveillance Digital Stand-Alone Record System
CAM,DVMR-4C
AU
AU
GD\QLJKWFRORXUFDPHUDVZLWKVWDQGDORQHGLJLWDOYLGHRPXOWLSOH[UHFRUGHUFRPplete system with 15” colour LCD screen, 20m connection cables, power supplies
DQGYLGHRWR86%FRYHUWHUIRUGRZQORDGLQJRIGDWDWR3&
AU
6LQJOHFDPHUDWLPHODSVHYLGHRUHFRUGHU8VHVSLQKROHFDPHUDDQGKWLPH
ODSVH9+69&59&5FDQDFFHSWDQDODUPLQSXWIURPDPRWLRQGHWHFWRUHWFDQG
WKLVZLOOSURYLGHDWLPHVWDPSDQGWULJJHUDSHULRGRIUHDOWLPHUHFRUGLQJ&DPHUD
OHQVPPJLYLQJO¿HOGRIYLHZ9LGHRPRQLWRULQFOXGHG
Retail Traffic Flow Counters
7UDIÀF3UR3HRSOH&RXQWHU(YHQW/RJJHU
TRA,RETAILPACK
AU
&RXQWVWKHQXPEHURISHRSOHSDVVLQJDSDUWLFXODUSRLQW8VHGWRFKHFNWKHVXFFHVVRILQVWRUHSURPRWLRQVFRXQWLQJSHRSOHHQWHULQJVHFWLRQVRIDVWRUHHWF7KHXQLW
RSHUDWHVIURPLQWHUQDOEDWWHULHVDQGZLOOVWRUHRQH\HDUVZRUWKRIGDWDDWDKVDPSOHUDWH
100
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Security Equipment
Test & Measurement
Metal Detectors
Pulse Technology AQ-1B Underwater Metal Detector
PUL,AQ-1B
Cscope CS550 General Purpose Metal Detector
AU
Suitable for above ground use also. Hand-held, battery operated, complete with
high sensitivity 15” search coil, compact 8” coil, and small ferrite probe. Supplied
with a bone conduction phone for underwater use and headphones for above
ground use. Complete with charger.
Minelab SD2000 Gold Prospecting Metal Detector
MIN,SD2000
AU
Designed primarily for gold prospecting. Kit includes 2 search heads, battery
and 240V and in-car battery chargers. Incorporates multi-period sensing (mps),
allowing the unit to operate in highly mineralized soils (it will detect nuggets at 2~4
times the depth of a typical metal detector). Battery life 16h.
CSC,CS550
AU
Simple to use and light weight. Ideal for locating rings, etc. Works well in locating
metal underground services.
Excaliber 1000 Under Water Metal Detector
EXA,1000
MIN,EX-1000
AU
MY
Search coil 10”. Use effectively in or out of the water. Features 2 operating
modes all metal and discriminate. In discriminate mode, ignores most ferrous
objects and still detects the valuable non-ferrous objects such as gold and silver.
Rechargeable battery pack separated from the electronics cylinder allows easy
access for recharging.
Did you know?
When your presentation has to be spot-on,
TECHRENTALS has the solution.
Whether it’s a small board meeting or
international conference - with one of the largest
range of data projectors around, we’ll help you
look your best, every time.
Discuss your presentation needs with our
knowledgeable staff today.
Call now!
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 101
Flow Meters
Test & Measurement
Flow Meters - Liquid
Model
3$137
Type
8OWUDVRQLF
7UDQVLWWLPH
1RQFRQWDFW
3$137
Features
Temp
°C
Max Flow
'DWDORJJLQJ
56&
aP$
aPV
a
3$1&+57
6RIWZDUH37
3$1006
32/+<'5$6;
8OWUDVRQLF
'RSSOHU
1RQFRQWDFW
6PDOOGLDPHWHUSLSHV
a
:LGHWHPSHUDWXUHUDQJH
a
a
9HU\ZLGHWHPSHUDWXUHUDQJH
a
&ODPSRQ
a
6WRUDJH5HFDOO'RZQORDG
'XDOIUHTXHQF\
'DWDORJJLQJ
56&aP$
PV
a
aPV
a
/LTXLGV6OXUULHV
+LJKJDVVROLGVFRQWHQW
3LSHV
a
/RJUDWHV±ZHHN
)ORZ'HSWK7HPS
81,%
8OWUDVRQLF
'RSSOHU
81,%/&'
/RJUDWHV±ZHHN
)ORZ'HSWK7HPS
/&'GLVSOD\
+<6266%
3URSHOOHUÀRZFRXQWHUZLWK
¿HOGFRPSXWHU
6WDLQOHVVIDQ
$GMXVWDEOHGHSWK
VWRUDJHGRZQORDG
PV
GLO,FP101
3URSHOOHUÀRZFRXQWHU
7HOHVFRSLFKDQGOH
9HORFLW\DYHUDJLQJ
'LJLWDOFRXQWHU
PV
Global FP101 Digital Water Velocity Meter
GLO,FP101
a
a
7HPSHUDWXUHVHQVRUV
37
3$162)7:$5(
a
/LTXLGV(QHUJ\ÀRZ
/RZJDVVROLGVFRQWHQW
3LSHVFODPSRQ
1RWH1$7$YHUVLRQVDYDLODEOH
a
7UDQVGXFHUVHW
37
3$12.6
3$1&+57
Major
Application
'DWD/RJJLQJ
,5LQWHUIDFH
/DUJH/&'
3$1&/310
3$1&37+%
Pipe Ø
mm
AU
3RUWDEOHÀRZSUREHFXUUHQWPHWHUIRUZDWHUYHORFLW\PHDVXUHPHQWVLQVWUHDPV
FKDQQHOVDQGSDUWLDOO\¿OOHGSLSHV3URSHOOHUVHQVRULQPPGLDPHWHUKRXVLQJ
¿WWHG WR WHOHVFRSLF KDQGOH >[email protected] ZLWK JDXJLQJ PDUNV WR FP GHSWK 'LJLWDO
/&'ÀRZPHWHUGLVSOD\IRULQVWDQWDQHRXVOLTXLGYHORFLW\DQGDYHUDJHPD[LPXP
VWRSZDWFKRUFORFN0LQLPXPGHSWKDERXWPP5DQJHaPV“
/LTXLGV6OXUULHV
2SHQ&KDQQHO
/RJJLQJ6\VWHP
:DWHU&XUUHQW0HDVXUHPHQWV
+\GURORJ\
FPPLQ
GHSWK
5LYHUVVWUHDPV
,UULJDWLRQFKDQQHOV
Panametrics PT868 Ultrasonic Flowmeter
3$137
$81=
3RUWDEOH QRQFRQWDFW OLTXLG ÀRZPHWHU XVLQJ WUDQVLWWLPH SULQFLSOH ,QFOXGHV
WUDQVGXFHUVIRUSLSHGLDPHWHUVPPaPDQGWHPSHUDWXUHVaO&>DGGLWLRQDO
[email protected]¿[WXUH)ORZYHORFLW\UDQJHaPV
$FFXUDF\W\SLFDOO\'DWDORJJLQJFDSDFLW\$QDORJ>[email protected]&
RXWSXWVDQGDQDORJLQSXWVFRPSDWLEOHZLWKWHPSHUDWXUHWUDQVPLWWHUVIRUHQHUJ\ÀRZ
FDOFXODWLRQV7RWDOLVHGÀRZDQGWUHQGDQDO\VLV5HFKDUJHDEOH1L&GRSHUDWLRQIRU
aKRURSHUDWLRQIURPDFPDLQVRUH[WHUQDOGFa9VXSSO\
Panametrics Software for PAN,PT868 & PAN,MMS35
3$162)7:$5(
$8
6RIWZDUHIRU3$137ÀRZPHWHUDQG3$1006PRLVWXUHDQDO\VHU$OORZV
VWRUDJHUHFDOODQGGRZQORDGRILQVWUXPHQWVHWXSURXWLQHV9HUVLRQVDYDLODEOHWR
PDWFKLQVWUXPHQW¿UPZDUHUHYLVLRQV
3DQDPHWULFV37)ORZPHWHU1$7$&HUWLÀFDWLRQ
3$1371$7$
$8
6SHFL¿FDWLRQDVIRU37DERYHEXW1$7$FHUWL¿FDWLRQ
Panametrics 12~50mm Transducers
3$1&/310
$80<
7UDQVGXFHUSDLUIRU3$137WUDQVLWWLPHÀRZPHWHUWRVXLWSLSHaPP‘
&RPSOHWHZLWK&)/30PRXQWLQJEUDFNHW7HPSHUDWXUHUDQJHaO&
Panametrics -20~210OC Transducers
3$1&37+%
$8
+LJKWHPSHUDWXUHWUDQVGXFHUSDLUIRU3$137WUDQVLWWLPHÀRZPHWHU2SHU
DWHVRQSLSHVL]HVPPaP‘:RUNLQJWHPSHUDWXUHUDQJHaO&
102
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Flow Meters
Test & Measurement
Flow Meters - Liquid (cont’d)
Panametrics 2-CH TX for PT868/878 Energy Calcs
Panametrics -200~400OC Transducers
3$12.6
$8
9HU\KLJKWHPSHUDWXUHZLGHUDQJHWUDQVGXFHUSDLUIRU3$137WUDQVLW
WLPH ÀRZPHWHU 7HPSHUDWXUH UDQJH aO& IRU SLSH PPaPP‘
8VHVVSHFLDOFODPSV\VWHPVXSSOLHG$SSURSULDWHSURWHFWLRQDQGVDIHKDQGOLQJ
HTXLSPHQWLVUHTXLUHGIRU¿WWLQJDQGRSHUDWLRQDWYHU\KLJKRUORZWHPSHUDWXUHV
3$1&+57
$8
7ZR FKDQQHO aP$ 57' WUDQVPLWWHU UDQJH aO& IRU HQHUJ\ UDWH DQG
FRQVXPSWLRQPHDVXUHPHQWVZLWK3$137RU3$137XOWUDVRQLFÀRZPHWHUV
3URYLGHV VXSSO\ DQG UHWXUQ WHPSHUDWXUHV IRU ÀRZLQJ OLTXLG 3DQDPHWULFV FDEOH
DQGFRQQHFWRUVXSSOLHG)LWWHGZLWKSDLURIFODPSRQ3W57'VDQGFDEOHV
3RZHUHGIURPÀRZPHWHU
Panametrics PT878 Ultrasonic Flowmeter
3$137
$80<
3RUWDEOH QRQFRQWDFW OLTXLG ÀRZPHWHU XVLQJ WUDQVLWWLPH SULQFLSOH ,QFOXGHV
WUDQVGXFHUVIRUSLSHPPaP‘WHPSHUDWXUHVaO&YDULRXVDOWHUQDWLYH
WUDQVGXFHUVDYDLODEOHZLWKFODPSLQJ¿[WXUH)ORZYHORFLW\UDQJHaPV
$FFXUDF\W\SLFDOO\'DWDORJJLQJIRURYHU.GDWDSRLQWV$QDORJLQSXWV
FRPSDWLEOHZLWKWHPSHUDWXUHWUDQVPLWWHUVIRUHQHUJ\ÀRZFDOFXODWLRQV2XWSXWV
DQDORJaP$GLJLWDOSXOVHRUIUHTXHQF\DQGSULQWHUFRPSXWHU,QIUDUHGSRUW
/DUJH/&'GLVSOD\IRUYHORFLW\YROXPHWULFDQGHQHUJ\ÀRZUDWHWRWDOLVHGÀRZDQG
WUHQGGDWDLQDOSKDQXPHULFDQGJUDSKLFDOIRUPDWV5HFKDUJHDEOH1L0+EDWWHULHV
DQGDFSRZHUVXSSO\FKDUJHU
Unidata Open Channel Liquid Flow Logger with LCD module
81,%/&'
$8
2SHQFKDQQHOÀRZORJJHUZLWK¿HOG/&'GLVSOD\PRGXOHDQGPFDEOHPGHSWK
UDWLQJ0HDVXUHPHQWDQGORJJLQJRIÀRZYHORFLW\E\'RSSOHUGHSWKE\SUHVVXUH
DQGWHPSHUDWXUH3URJUDPPDEOHIRUÀRZFKDQQHOSUR¿OHODSWRS3&UHTXLUHGIRU
LQVLWXSURJUDPPLQJYLD56&2SHUDWLQJWHPSHUDWXUHUDQJHaOC9HORFLW\
aPPVHFGHSWKaPP7HPSHUDWXUHaOC
ORJLQWHUYDOVHFaZHHNPHPRU\N3URJUDPPDEOHRXWSXWWRFRQWURO
GHYLFHVVXFKDVZDWHUVDPSOHUV'HWHFWVDQGPHDVXUHVUHYHUVHÀRZV&KDUJHU
DQGEDWWHULHVVXSSOLHG:RUNKHDGGLPHQVLRQV[[PP
*(3DQDQPHWULFV37)ORZPHWHUZLWK1$7$&HUWLÀFDWLRQ
3$1371$7$
$8
6SHFL¿FDWLRQDVDERYHEXWZLWK1$7$FHUWL¿FDWLRQ
Polysonics Hydra SX30 Dual Frequency Doppler Liquid Flowmeter
32/+<'5$6;
$8
8OWUDVRQLF QRQFRQWDFW ÀRZPHWHU9HORFLW\ UDQJHaPV DFFXUDF\ “
3LSHVL]HUDQJHPPaP‘'DWDORJJLQJIRUSRLQWVZLWK3&VRIWZDUH
DQGLQWHUIDFHFDEOHIRUGRZQORDGYLD56&LQWHUIDFH7UDQVGXFHUWHPSHUDWXUH
UDQJHaO&$QDORJRXWSXWaP$%DWWHU\RSHUDWHGKFRQWLQXRXV Unidata Open Channel Liquid Flow Logger
81,%
$8
XVH>[email protected]
2SHQFKDQQHOÀRZORJJHUSURJUDPPHGLQVLWXIRUÀRZFKDQQHOSUR¿OHODSWRS3&
Hydrological Services Universal Current Meter OSS-B1
UHTXLUHG0HDVXUHPHQWRIÀRZYHORFLW\E\'RSSOHUGHSWKE\SUHVVXUHDQG
+<6266%
$8 WHPSHUDWXUH,QFOXGHVPFDEOH0HPRU\N56LQWHUIDFH/RJUDWH
:DWHUFXUUHQWPHWHUIRUPHDVXUHPHQWRIÀRZYHORFLW\LQULYHUVVWUHDPVFKDQQHOV VHFaZHHN2SHUDWLQJWHPSHUDWXUHUDQJHaOC9HORFLW\aPPVHF
DQG RSHQ ZDWHU 5REXVW VWUHDPOLQHG VWDLQOHVV ERG\ ¿WWHG ZLWK KLJK SUHFLVLRQ UHVROXWLRQGHSWKaPPUHVROXWLRQ7HPSHUDWXUH
PP‘IDQ>À[email protected] aOCUHVROXWLRQ3URJUDPPDEOHRXWSXWWRFRQWUROGHYLFHVVXFKDVZDWHU
WRP5HFKDUJHDEOH³+\GURPDWH´UXJJHGLVHG¿HOGFRPSXWHUZLWK,3FDVH VDPSOHUV'HWHFWVDQGPHDVXUHVUHYHUVHÀRZV&KDUJHUDQGEDWWHULHVVXSSOLHG
6WRUDJH RI IDQ FDOLEUDWLRQ IRUPXODH IRU GLUHFW UHDGRXW RI YROXPHÀRZ 7RXFK :RUNKHDGVL]H[[PP
VFUHHQHQWU\IRUVHWXSLQSXWVWRUDJHDQGGRZQORDG6XSSOLHGZLWK3&GRZQORDG
VRIWZDUHDQGFDEOH
Panametrics 2-CH RTD TX for PT868/878 Energy Calcs
3$1&+57
$8
7ZR FKDQQHO aP$ 57' WUDQVPLWWHU UDQJH aO& IRU HQHUJ\ UDWH DQG
FRQVXPSWLRQPHDVXUHPHQWVZLWK3$137RU3$137XOWUDVRQLFÀRZPHWHUV
3URYLGHVVXSSO\DQGUHWXUQWHPSHUDWXUHVIRUÀRZLQJOLTXLG3DQDPHWULFVFDEOH
DQGFRQQHFWRUVXSSOLHG)LWWHGZLWKSDLURIFODPSRQ3W57'VDQGFDEOHV
3RZHUHGIURPÀRZPHWHU
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 103
Flow Meters
Test & Measurement
Flow Meters - Gas
Pipe Ø
mm
Major
Application
PK
6XSSOLHG'1
$LUXQGHUSUHVVXUH
6DWXUDWHGVWHDP
7RWDOLVLQJUHFRUGHURXWSXWV
a$&)0
PP
PPRUPPWXUELQH
*DVHV
0DVVÀRZWKHUPDO
VHQVRU
³'LDO$*DV´IRUJDVHV
56&$QDORJRXWSXWV
VOSP
ó´DWPHWHU
/RZ±ÀRZJDVHV
.85
7KHUPDOPDVVÀRZ
LQVHUWLRQPHWHU
&ROGWDS¿WWLQJV56&
/RJJLQJaP$RXWSXW
VISP
a
PPa
*DVHV
39/&/,0$
,QVHUWLRQ
PLFURWXUELQH
+RWWDSULJ
563UHVVXUHWUDQVGXFHU
PV
a
aPP
PPZLWKRXWKRWWDS
&RPSUHVVHGDLU
76,
0DVVÀRZWKHUPDO
VHQVRU
7HPSPHDVXUHPHQW
56&0DLQVEDWWHU\
aVOSP
,QOLQHPP
&OHDQDLUÀRZ
8VHDVFDOLEUDWRU
76,
0DVVÀRZWKHUPDO
VHQVRU
7HPSPHDVXUHPHQW
56&0DLQVEDWWHU\
aVOSP
,QOLQHPP,62
&OHDQDLUÀRZ
8VHDVFDOLEUDWRU
Model
Type
Features
Max Flow
63,9)0
9RUWH[
aP$RXWSXW
)ORZ3UHVVXUH7HPSHUDWXUH
+2)+2)
RU+2)
7XUELQHÀRZPHWHU
6,(6
Ż1(:Ż
a
Ż1(:Ż
ClimaAir 3 Flow Meter for Compresses Air & Gases
39/&/,0$
Temp
°C
Portable Mass Flowmeter & Calibrator 0.01a20 SLPM
$8
3RUWDEOHJDVÀRZPHWHUIRUFRPSUHVVHGDLUDQGRWKHUDSSOLFDWLRQV)LWWHGZLWK
³&RPELVHQVRU´LQVHUWLRQSUREHIRUVLPXOWDQHRXVPHDVXUHPHQWRIÀRZSUHVVXUH
DQGWHPSHUDWXUH0HDVXULQJUDQJHVÀRZPLQLWXUELQHaPVSUHVVXUHWR
%DUWHPSHUDWXUHWRaºC6XSSOLHGZLWKYDOYHDQGDGDSWRUNLWIRUKRWWDSSHG
SLSHVDSSUR[aPP,'DQG¿WWLQJNLWIRUSLSHVWRPP)ORZFRPSXWHU
IXQFWLRQVLQFOXGHÀRZFRUUHFWLRQYROXPHFDOFXODWLRQDQGGDWDORJJLQJIRUDERXW
YDOXHV:LWK56LQWHUIDFHDQGFDEOHDQGVRIWZDUHIRUGDWDGRZQORDG
5HFKDUJHDEOHZLWK$&DGDSWRU
76,
$8
7KHUPDOPDVVÀRZPHWHURU¿HOGFDOLEUDWRUIRURSHUDWLRQLQWKHUDQJHa6/30
VWDQGDUGOLWUHVPLQ/&'GLVSOD\IRUÀRZWHPSHUDWXUHDQGSUHVVXUH6XLWDEOH
IRU IORZ PHDVXUHPHQWV RQ FOHDQ DLU RU IRU FDOLEUDWLRQ FKHFNV RQ SHUVRQDO
VDPSOLQJ SXPSV$FFXUDF\ “6/30 >ZKLFKHYHU LV [email protected] IRU DLU RU
R[\JHQ “6/30 IRU QLWURJHQ RU DLUPL[WXUHV 2SHUDWLQJ SUHVVXUH
UDQJHN3DDEVROXWH>DSSUR[[email protected]:LWK+(3$¿OWHUDGDSWRUVDQG
WXELQJ 56&DQDORJ FRQQHFWRU ZLWK FDEOHV VXSSOLHG$& DGDSWRU RU EDWWHU\
RSHUDWLRQ
Spirax Sarco Air Flow Meter
63,9)0
Ż1(:Ż
Portable Mass Flowmeter & Calibrator 0a300 SLPM
76,
$8
7KHUPDOPDVVÀRZPHWHURU¿HOGFDOLEUDWRUIRURSHUDWLRQLQWKHUDQJHa6/30
VWDQGDUGOLWUHVPLQ/&'GLVSOD\IRUÀRZWHPSHUDWXUHDQGSUHVVXUH6XLWDEOH
IRU ÀRZ PHDVXUHPHQWV RQ FOHDQ DLU RU IRU FDOLEUDWLRQ FKHFNV RQ SHUVRQDO
VDPSOLQJ SXPSV$FFXUDF\ “6/30 >ZKLFKHYHU LV [email protected] IRU DLU RU
R[\JHQ>“6/30IRUQLWURJHQRUDLUPL[[email protected]
N3D DEVROXWH >DSSUR[ N3D [email protected] :LWK +(3$ ¿OWHU DGDSWRU DQG
WXELQJ56&DQDORJFRQQHFWRUZLWKFDEOHVVXSSOLHG$&DGDSWRURUEDWWHU\
RSHUDWLRQ
$8
9RUWH[ PHWHU IRU PHDVXUHPHQW RI DLU XQGHU SUHVVXUH IRU DXGLW RI FRPSUHVVHG
DLUÀRZV\VWHPV2XWSXWaP$FRPSHQVDWHGIRUWHPSHUDWXUHDQGSUHVVXUH
&RQ¿JXUDEOHWRGLVSOD\YROXPHWULF>[email protected]ÀRZPDVVÀRZQRUPDOLVHGRUWRWDOL]HG
ÀRZ HWF 5DQJH aPKU RXWSXW a9 HTXLYDOHQW WR aPKU :DIHU
VDQGZLFKYHUVLRQ'1WR'1ZLWK37WUDQVGXFHUVXSSOLHGZLWK'1
SLSHRYHUDOOOHQJWKPPZLWK$16ÀDQJHV6XSSOLHGVHWXSWRPHDVXUH
DFWXDOÀRZZLOODOVRGLVSOD\SUHVVXUHDQGWHPSHUDWXUH
Hoffer 2000 Gas Flow Meter Indicator
+2)
$8
)ORZLQGLFDWRUWRWDOL]HUIRUXVHZLWKÀRZWUDQVGXFHUV'LJLWDOGLVSOD\ZLWKUHFRUGHU
RXWSXWVa9aP$56&LQWHUIDFH2SHUDWHVIURPDFPDLQV'LVSOD\RI
PHWULFXQLWVZLWKRSWLRQDOFRQYHUVLRQIDFWRU
Hoffer 1½” [38mm] Gas Flow Turbine/Transducer
+2)
$8
1ò´>[email protected]ÀDUHGJDVÀRZWXUELQHWUDQVGXFHUIRUXVHZLWK+2)ÀRZ
LQGLFDWRU$SSUR[LPDWHYROXPHWULFÀRZUDWHUDQJHaDFWXDOFIPJDVW\SH
SUHVVXUHDQGWHPSHUDWXUHFRUUHFWLRQPD\EHXVHGIRUPDVVÀRZXQLWVVXFKDV
6&)0NJPLQRU/[email protected]$SSURDFKSLSHOHQJWKPP´H[LWSLSHOHQJWKPP
ô´6XSSOLHGZLWKPP1ò´7DEOH()ODQJHV$SSURDFKSLSHOHQJWKPP
´([LWSLSHOHQJWKPP´
104
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Flow Meters
Test & Measurement
Flow Meters - Gas (cont’d)
Kurz 2443 Air Velocity Meter
Hoffer 2” [50mm] Gas Flow Turbine/Transducer
+2)
$8
´>[email protected]ÀDUHGJDVÀRZWUDQVGXFHUIRUXVHZLWK+2)ÀRZLQGLFDWRU
$SSUR[LPDWHYROXPHWULFÀRZUDWHaDFWXDOFIPJDVW\SHSUHVVXUHDQG
WHPSHUDWXUHFRUUHFWLRQPD\EHXVHGIRUPDVVÀRZXQLWVVXFKDV6&)0
NJPLQRU/[email protected]´7DEOH(ÀDQJHV$SSURDFKSLSHOHQJWK
PP´([LWSLSHOHQJWKPP´
6LHUUD6HULHV*DV0DVVÁRZPHWHUaOPLQ
6,(6
$8
6PDUW7UDNPDVVÀRZPHWHU'LJLWDOGLVSOD\RIPDVVÀRZUDWHIRUJDVHVLQWKHUDQJH
aOPLQ'LDO$*DVVHWXSIRUGLUHFWUHDGRXWRIÀRZIRUGLIIHUHQWFRPPRQ
JDVHVZLWKRXWDGMXVWPHQWRUUHFDOLEUDWLRQ$QDORJDQGVHULDO56SRUWVZLWK
VRIWZDUHDQGFDEOHSURYLGHGIRUFRQQHFWLRQWR3&3RUWDEOHFRQ¿JXUDWLRQZLWK
FDVHEDWWHU\DFSRZHUVXSSO\DQGÀH[LEOHJDVFRQQHFWLRQVHW
.85
$8
3RUWDEOHDLUYHORFLW\PHWHUDQGÀRZFRPSXWHU:RUNLQJYHORFLW\UDQJHaVI
PLQPVDWSUHVVXUHVWRDSSUR[EDUSUREHUDWHGWREDU7HPSHUDWXUH
UDQJHaO&ZLWKFRPSHQVDWLRQ8VHUVHOHFWHG(QJOLVKRUPHWULFXQLWVIRU
YHORFLW\RUPDVVÀRZ7KHUPDOVHQVRUSUREHPP‘PPORQJZLWKVHQVRU
VKLHOGZLWKFRPSUHVVLRQ¿WWLQJDQGQ\ORQIHUUXOHVIRUSUREHUHPRYDORUSRVLWLRQ
DGMXVWPHQWLQWDSSHGSLSH6XLWDEOHIRUXVHLQGXFWVRUSLSHVPLQSLSH‘PP
&DOLEUDWHGIRUDLUDQGVXLWDEOHIRUXVHZLWKRWKHUQRQKD]DUGRXVJDVHV5HFRUGLQJ
RIXSWRGDWDVHWVZLWKWLPHDQGGDWH7ZRDQDORJaP$RXWSXWVDQG
56&VHULDOSRUWIRUFRQ¿JXUDWLRQXSORDGDQGGDWDGRZQORDG5HFKDUJHDEOH
1L0+EDWWHULHV
Did you know?
TECHRENTALS offers rental with an option to purchase
(RPO).
When you enter into an RPO you can exercise your
oprtion to purchase the rented equipment after the
agreed minimum rental term.
RPO is an ideal arrangement for companies who need
to conserve capital, allocate expenditure, preserve
credit and optimise asset management over the longer
term.
Our friendly staff will be pleased to provide details.
Some conditions may apply , not available for all equipment.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Call now!
TECHRENTALS 105
Air Conditioning & Air Quality - HVAC & IAQ
Test & Measurement
Air Flow Measurement/Air Quality
Model
Type
SHO,CFM88-3
Air Velocity
m/s
Max
Temp OC
Pressure
Functions
Notes
12~944
Balometer
TSI,8373
Flow
l/s
Logging
15~1,000
TSI,8370
60
TSI,8371
TSI,8375
Accubalance modular air
balancing tool
0.13~41
depending on
probe
11~1,000
~14
~28
AIR,EDM2500
DRU,DPI705
HAL,EMA150
Manometer (electronic)
±3735Pa diff
135 kPa abs
Logging
125 Pa
500 Pa
2,500 Pa
Recorder output
0~20 kPa
Analog output
SHO,ADM-860
~50
0.025~14,700Pa
TSI,8704
1.25~78.5
-1245~3735Pa
Logging
RS232C
±200kPa
Recorder output
AIR,DM2
DPM,TT370S
Manometer (digital)
DPM,TT570CL
10~100
TSI,8345
0.15~30
10~100
Anemometer (hot wire)
TSI,8384
60
Anemometer
(vane, 100 mm)
0.25~30
70
SCH,MINI-2
Anemometer
(vane, 22 mm)
0.3~40
TES,450
Anemometer
(vane, 16mm)
0.4~40
AIR,AV6
AIR,UA6
AIR,UA30
106
0.15~50
0.1~50
AIR,AV2
NATA version available
Analog output
Logging
RS232C
130
Results
averaging
Min/Max display
70
Logging
RS232C
0~50
Anemometer (ultrasonic)
HOB,PRES
Pressure logger
KUR,2443-24
Air Velocity Meter
Without Pitot tube
Logging
RS232C
93
TSI,8355
With Velgrid
Pressure:
199.9Pa
1999Pa
7.0kPa
Pressure:
99.9Pa
999Pa
7.0kPa
1.2~100
Hood
Pitot
Velocity Matrix
0~30
0~60
75
500~110,000Pa
200
10*/20bar
Logging
Telescopic probe
/RZÀRZWXUEXOHQFH
/RZÀRZWXUEXOHQFH
Reads to 0.001 m/s
Flow – computer
:LWKSLSH¿WWLQJV
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Air Conditioning & Air Quality - HVAC & IAQ
Test & Measurement
Air Flow Measurement/Air Quality (cont’d)
Model
TSI,8520
Type
Temp
O
C
RH%
CO
ppm
CO2
ppm
NO
ppm
Particle measurement
ABA,301
Dust & Aerosol
Notes
0.001~100mg/m3
0.1~10µ
Logging
TSI,8520-1 Outdoor enclosure
0.3~5µ
Logging
0.01 ~ 5x105 particles/cm3
0.02~1µ
TSI,8525
8OWUD¿QHSDUWLFOH
measurement
TSI,8386A
Multifunction air quality
meter
60
5~95
Indoor air quality monitor
(multi-function)
50
5~95
500
5,000
YES,205-5
Multifunction air quality
logger
50
5~95
200
10,000
TES,645-1
Humidity and dewpoint
meter
120
2~98
Robust stainless probe
*
Air temp to 60º
Globe temp to 120º
Wet temp to 40º
WBGT index
RH + Dewpoint
TSI,8551
TSI,8554
CAS,MICROTHERM
Area heat stress monitor
*
Logging
Wet bulb
Dew point
Differential pressure
Ż1(:Ż
Portable Smoke Generating Machine
CSS,COLT4
Logging
RS232C/Software
300
Logging
'30776'LJLWDO0DQRPHWHU
DPM,TT370S
AU
Portable smoke generator with variable smoke emission rate. Suitable for air
ÀRZ YLVXDOLVDWLRQ +9$& GXFWZRUN OHDNWHVWLQJ ¿UH WUDLQLQJ DQG JHQHUDO ZRUN
3XPSIUHHRSHUDWLRQZLWKVPRNHÀXLGVXSSOLHGIURPFRQVXPDEOHDHURVROFDQV
RUUH¿OODEOHFRQWDLQHUV>[email protected]
operation and off-power facility. Maximum output 31 cubic meters/min at 1.5m
visibility. Operation for 18min from one can at maximum capacity.
NZ
Digital micromanometer with an extendable pitot tube kit. DP ranges are 199.9Pa,
1,999Pa & 7kPa. Velocity range with pitot kit is 1.2~100m/s. DP accuracy is 1%
of reading +2 counts. Recorder output of 1mV per count.
'3077&/'LJLWDO0DQRPHWHU
DPM,TT570CL
NZ
Digital micromanometer with an extendable pitot tube kit. DP ranges are 199.9Pa,
1,999Pa & 7kPa. Velocity range with pitot kit is 1.2~100m/s. DP accuracy is 1%
of reading +2 counts. Built-in data logger holds 1,400 readings.
'UXFN'30DQRPHWHUaN3D
DRU,DPI705
AU
Handheld digital manometer range 0~20kPa, accuracy 0.2 %. Displays all common
engineering units.
6KRUWULGJH$'0(OHFWURQLF0DQRPHWHU
SHO,ADM-860
AU/MY
Electronic micro manometer for air balance and similar applications. Measures
differential pressure, air velocity and temperature. Differential pressure range
0.0025~1,500mm wg. Velocity range 7.5~3,000m/min (750m/min with velgrid).
Memory 100 point with sum and average. Accessories include pitot tube and 16
point velgrid for face velocity work including exhaust hoods, clean room outlets,
DQGODUJH¿OWHUVRUFRLOV
76,'3&$/&0LFUR0DQRPHWHU
$LUÁRZ('0(OHFWURQLF0DQRPHWHUa3D
TSI,8704
AU
Pressure ranges 125, 500 & 2,500Pa. Air velocity measurement using pitot-static
tube with ranges 14 & 28m/s. Supplied complete with pitot static tube, balancing
valve, and tubing. Fitted with 1mA fsd recorder output. Battery operated.
0HDVXUHV GLIIHUHQWLDO SUHVVXUH YHORFLW\ DYHUDJH YROXPHWULF ÀRZ PD[ PLQ
With static pressure calculations, density correction and K factor. Pressure range
-1245~3735Pa. Velocity range 1.25~78.5m/s. Extendable pitot tube 20~980mm.
Datalogging 500 point with RS232C interface and software.
$LUÁRZ'00HGLXP3UHVVXUH0DQRPHWHU
$LUÁRZ3LWRW7XEH
AIR,EDM2500
AIR,DM2
AU/NZ
NZ
Handheld medium pressure digital manometer. Suitable for positive, negative
and differential pressure measuements. Displays readings in mBar, kPa & psi.
Ranges are ±2,000mBar, 200kPa & 29.99psi. Resolution is 1 or 0.1mBar & 0.1 or
0.01kPa. Accuracy on all ranges is 0.5% of reading. Serial interface for uploading
stored results. Maximum stored readings during logging is 700. Analogue output
of ±1V at 0.5mV per mBar.
AIR,PITOT-36
Pitot tube (36”) for use with manometers and micro manometers.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
AU
TECHRENTALS 107
Air Conditioning & Air Quality - HVAC & IAQ
Test & Measurement
Air Flow Measurement/Air Quality (cont’d)
.XU]$LU9HORFLW\0HWHU
KUR,2443-24
AU
3RUWDEOHDLUYHORFLW\PHWHUDQGÀRZFRPSXWHU:RUNLQJYHORFLW\UDQJHa
sf/m (60m/s) at pressures to approx 10bar (probe rated to 20bar). Temperature
range -40~200OC with compensation. Selectable English or metric units for velocity
RUPDVVÀRZ7KHUPDOVHQVRUSUREHPP‘[PPORQJZLWKVHQVRUVKLHOG
&RPSUHVVLRQ¿WWLQJDQGQ\ORQIHUUXOHVIRUSUREHUHPRYDORUSRVLWLRQDGMXVWPHQW
LQWDSSHGSLSH6XLWDEOHIRUXVHLQGXFWVRUSLSHVPLQSLSHPP‘DSSUR[
Calibrated for air and suitable for use with other non-hazardous gases. Recording
of up to 1,500 data sets with time and date. Two analog 4~20mA outputs, and
56&VHULDOSRUWIRUFRQ¿JXUDWLRQXSORDGDQGGDWDGRZQORDG5HFKDUJHDEOH
NiMH batteries.
6KRUWULGJH&)0(OHFWURQLF%DORPHWHU
SHO,CFM88-3
AU
0HDVXUHVVXSSO\DQGH[KDXVWÀRZLQFIPDQGOVHF5DQJHVaFIPVXSSO\
and 25~1500cfm exhaust. Compensated for air density and back pressure. Hood
sizes 600 x 600mm, 600 x 1,200mm & 300 x 1,200mm.
$LUÁRZ$9PP‘$QHPRPHWHUZLWK9ROXPHGLVSOD\
AIR,AV2
AU/NZ
Vane anemometer with 900mm (35”) telescopic probe extension. Velocity
measurement range 0.25~30m/s (50~6,000ft/min). Averaging mode available.
Volume display based on duct or other area. Head operating range -10~70OC
(lower limit of -30CC for short periods). Output 0~1V.
$LUÁRZ$9PP‘$QHPRPHWHU1$7$&HUWLÀFDWLRQ
AIR,AV2-NATA
AU
6SHFL¿FDWLRQDVDERYHEXWZLWK1$7$FHUWL¿FDWLRQ
$LUÁRZ$9PP‘$QHPRPHWHUZLWK9ROXPH
AIR,AV6
NZ
100mm diameter vane anemometer with an articulating extension handle.
0HDVXUHVYHORFLW\YROXPHÀRZDQGWHPSHUDWXUH9DQHKHDGRSHUDWLQJUDQJH
is -10~70ºC. -30 possible for short periods. Accuracy is +/-1% of reading +1
digit. Resolution is 0.01 m/sec. Velocity range is 0.25~30m/s. RS-232C interface
for data logging & real time data retrieval. Store up to 99 readings of velocity &
temperature. Analogue output of 0~1v.
Schilknecht Mini Air 2 Vane Anemometer
SCH,MINI-2
Pryde Measurement Averaging Pitot Tube
PRY,PITOT
AU
Comprises 2 parallel stainless tubes 500 x 5mm, with holes approximately every
75mm. Provides average pressure readings in duct work. Connects to ¼”‘WXELQJ
Supplied complete with ½”¿WWLQJV
76,$FFXEDODQFH%DORPHWHU
TSI,8370
MY
Balometer including 5-hood kit and hard case. Flow range 15a1,000 litres/sec (50
to 3,500m3/hr) accuracy +/-5%, reading +/- 2.4 l/s (8.5m3/hr). Operating temp
range 0-60OC. Weight (610 x 610mm hood) 3.4 kg hood provided 610 x610mm
(standard), 610 x 1220mm, 305 x 1220mm, 305 x 1525mm and 915 x 915mm.
76,$FFXEDODQFH%DORPHWHU
TSI,8371
NZ
[ PP DLUÀRZ KRRG 0HDVXUHV DLU YROXPH ÀRZLQJ WKURXJK UHJLVWHUV
diffusers, and grilles. Range is 15~1,000l/s, accuracy is ±5%. Temperature
range is 0~60ºC. Sample and hold function displays reading of one sample.
$XWRPDWLFFRQYHUVLRQEHWZHHQDFWXDODQGVWDQGDUGÀRZVZKHQXVHULQLWLDOO\LQSXWV
temperature and barometric pressure, variable time constant modes available
IRUDVWHDG\GLVSOD\ZKHQPHDVXULQJÀXFWXDWLQJÀRZV.IDFWRUIXQFWLRQHQDEOHV
ÀH[LELOLW\IRUPHDVXULQJDYDULHW\RIGLIIXVHUVEDFNOLWGLVSOD\LVHDV\WRUHDGLQ
poor lighting conditions.
76,%DORPHWHU:LWK/RJJLQJ
TSI,8373
AU
Flow range 15~1,000L/s (50~3,500m3KUDFFXUDF\“>WR“/[email protected]
temperature range 0~60OC. Includes 5 hood kit & hard case. Hoods provided
610 x 610mm (standard), 610 x 1,220mm, 305 x 1,220mm, 305 x 1,525mm &
915 x 915mm.
76,$FFXEDODQFH0RGXODU$LU%DODQFLQJ
TSI,8375
(NZ)
Balometer with detachable micromanometer for air balancing applications. 610
x 610mm air capture hood for measurements in the range 42~4,250m3/h with
automatic compensation for barometric pressure and air temperature, 450mm
pitot probe (range 0.13~41m/s), 16-point velocity matrix probe (0.13~13m/s) and
static pressure probes (differential pressure range ±3,735Pa with safe limit 37kPa,
absolute pressure range 47~135kPa). Accuracy typically 2% for pressure, 3% for
ÀRZ/DUJHPXOWLOLQHEDFNOLW/&'GLVSOD\IRUVLQJOHRUVWDWLVWLFDOUHDGLQJVZLWKPLQ
max and average of up to 1,000 values of each measured parameter. Manual result
storage or automatic data logging up to 1,000 time/date stamped readings. RS232
port for data transfer to PC or serial printer, with cable and “LogDat” download
software. Rechargeable with approx 12h operation, or ac adaptor.
108
AU
3UREHPP‘5DQJHaPV0LQPD[WLPHDYHUDJLQJIXQFWLRQVZLWK
0~1V analog output.
7HVWR9DQH$QHPRPHWHUZLWKPP9DQH
TES,450
AU
Anemometer with micro-vane probe. Digital display of air velocity and temperature.
Telescope mounted metal probe, diameter 16mm. Operating range 0.4~40m/s
±0.2 and to 60m/s ±unspec. Temperature range -30~140OC for short-term
measurements. Battery powered.
76,+RW:LUH$QHPRPHWHU
TSI,8345
AU
7KHUPDODQHPRPHWHUUDQJHaPVDFFXUDF\“YROXPHWULFÀRZGLVSOD\
averaging capability up to 255 readings. Probe operating temperature range 17.8~93.3O&3UREHPPORQJ[PP‘DWWLS'LJLWDOGLVSOD\56&SULQWHU
interface. Battery or mains operation.
76,+RW:LUH$QHPRPHWHU
TSI,8355
MY
Range 0.15~50m/s. Probe will operate over a temp range of -17.8~93.3ºC. Digital
display with averaging capability o up to 255 reading. Temperature measurement
range -17.8~+93.3 C RS 232 printer interface. Battery & AC operation.
76,+RW:LUH$QHPRPHWHU
TSI,8384
NZ
Handheld hot wire anemometer. Velocity range is 0.1~50m/sec, accuracy is ±3%
of reading or ±0.015m/s whichever is greater. Resolution is 0.01 m/s. Probe
temperature range is -10~60ºC and 0~80%RH. Stores 1,394 samples of velocity,
YROXPHWULF ÀRZUDWH DQG WHPSHUDWXUH ZLWK WLPH DQG GDWH VWDPSLQJ 'DWD FDQ
XSORDGHGWRD3&RUSULQWHG6XSSOLHGZLWKPP‘[PWHOHVFRSLFSUREH
76,$9HORFL&DOF$LU&RQGLWLRQLQJ(IÀFLHQF\0HWHU
TSI,8386A
AU
3RUWDEOHHI¿FLHQF\PHDVXUHPHQWV\VWHPLQFOXGLQJKRWZLUHDQHPRPHWHUVWDWLF
DQGGLIIHUHQWLDOSUHVVXUHWHPSHUDWXUHDQGKXPLGLW\PHDVXUHPHQWZLWKKHDWÀRZ
HI¿FLHQF\FDOFXODWLRQ9HORFLW\KRWZLUHaPVDFFXUDF\“7HPSHUDWXUH
-10~60OC, accuracy ±0.3. Wet bulb temperature 5~60OC. Relative humidity
0~95%RH, accuracy ±3%. Dewpoint -15~49OC. Static/differential pressure
a3DDFFXUDF\“3D3UREHOHQJWKPPWLSPP‘EDVH
PP‘,QFOXGHVGDWDORJJLQJDQGSULQWLQJ%DWWHU\RSHUDWHG
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Air Conditioning & Air Quality - HVAC & IAQ
Test & Measurement
Air Flow Measurement/Air Quality (cont’d)
$LUÁRZ8$+LJK5HVROXWLRQ8OWUDVRQLF$QHPRPHWHUaPV
AIR,UA30
AU/NZ
Precision anemometer range 0~30m/s, accuracy better than 1% of reading,
resolution 0.001m/s, non-directional. Temperature range 0~70OC, accuracy 1OC,
resolution 0.1OC. Flow turbulence range 0~99%. Capable of measuring very
low air velocities. Includes articulating telescopic rod 0.4~1.1m. Logs up to 99
readings of velocity, temperature and turbulence, intervals 1s~99min. RS232C
interface. Operates for 20h on alkaline batteries.
$LUÁRZ8OWUDVRQLF$QHPRPHWHUaPV
AIR,UA6
TES,635
NZ/MY
Temperature, humidity and dew point meter. Probe temperature range is -20~70ºC.
Humidity range is 0~100%RH resolution: 0.1%, accuracy is ±2%. Dew point
range is -50~40ºC.
7HVWR+XPLGLW\'HZSRLQW0HWHU
TES,645-1
AU
3RUWDEOHKXPLGLW\PHWHU¿WWHGZLWKUREXVWVWDLQOHVVSUREHIRUDPELHQWZRUNRUGXFW
measurements to 120OC. Displays relative humidity, absolute humidity, dew point,
GHJUHHRIKXPLGLW\HQWKDOS\DQGWHPSHUDWXUH2SHUDWLQJUDQJHa5+>±@
-20~120O&>±@%DWWHU\RSHUDWHG
Abacus Hand-held Airborne Particle Counter
ABA,301
AU
Portable particle measuring system typically used in clean room applications. 4
[¿[HGVL]HFKDQQHOVPLFURQ&RXQWGDWDDXWRPDWLFDOO\VWRUHG
in a 500 sample memory which can be downloaded to a PC. Selectable sample
WLPH ,QFOXGHV ]HUR FRXQW ¿OWHU IRU FKHFNLQJ EDFNJURXQGV :KHQ XVHG ZLWK
included software will check clean rooms to ISO 14644 and BS5295 requirements.
Battery operated.
9DLVDOD:$$:LQG6SHHG'LUHFWLRQ7UDQVGXFHU
VAI,WAA151
AU
Range 0.4~75m/s. Current output with selectable ranges including 4~20mA &
0~20mA. Requires indicator module such as DE,DT600 datalogger for indication
of windspeed and direction.
76,,QGRRU$LU4XDOLW\0RQLWRUZLWK/RJJLQJ
TSI,8551
AU/NZ
Indoor air quality (IAQ) monitor for temperature and humidity measurements, CO
and CO2 concentrations. Humidity range 0~95%, temperature range 0~50OC.
Electrochemical cell for CO 0~500ppm. NDIR cell for CO2 0~5000ppm. Data
ORJJLQJIRUGDWDSRLQWVZLWKLQWHUYDODGMXVWDEOHVaK)LWWHGZLWK56
interface, and software included for download, storage and reporting. Battery or
mains operation with ac adaptor.
AU
Range 0~50m/s, accuracy better than 1% of reading, resolution 0.01m/s,
non-directional. Temperature range 0~70OC, accuracy 1OC, resolution 0.1OC.
Flow turbulence range 0~99%. Capable of measuring very low air velocities.
Includes articulating telescopic rod 0.4~1.1m. Logs up to 99 readings of velocity,
temperature & turbulence, intervals 5s~99min. RS232C interface. Operates for
20h on alkaline batteries.
7HVWR+XPLGLW\'HZSRLQW0HWHU
76,47UDNSOXV,QGRRU$LU4XDOLW\0RQLWRUZLWK/RJJLQJ
TSI,8554
AU
Measures temperature, humidity, CO & CO2 concentrations. Humidity 5~95%RH,
CO 0~500ppm, CO2 0~5,000 ppm. Internal logging up to 63,000 data points;
LQWHUYDODGMXVWDEOHVaK56&LQWHUIDFHDQGVRIWZDUHLQFOXGHG%DWWHU\RU
mains operation.
<(6,QGRRU$LU4XDOLW\0RQLWRUZLWK/RJJLQJ
YES,205-5
AU
5 channels for temperature, humidity, CO2, CO & NO. Temperature range
0~50OC, resolution 0.1, accuracy ±0.5. Humidity 5~95 %RH, accuracy ±2%.
CO2 0~10,000 ppm, resolution 0.5ppm. CO 0~200 ppm, resolution 0.5ppm. NO
0~300 ppm, resolution 0.5ppm. Logging of CO and NO allows checking of indoor
air for contamination by vehicle emissions from nearby carparks, loading docks
etc. Includes interface and software. Mains/battery operation.
&DVHOOD0LFURWKHUP:%*7$UHD+HDW6WUHVV0RQLWRU
CAS,MICROTHERM
AU
Portable area heat stress WBGT monitor with real-time graphical display. Measures
KHDWVWUHVVSRWHQWLDO>:%*7LQGH[@DFFRUGLQJWR,62357'VHQVRUVZLWK
internal calibration-reference for wet-bulb, dry-bulb and globe temperatures.
Large LCD display for numerical or graphical indication of temperatures and
SURFHVVHGYDOXHVIRU:%*7>LQGRRURXWGRRUSOXV7:[email protected]\DQG
dewpoint. Simple keypad/menu setup. Data logging for up to 32 separate runs
and 49,100 records, with interval 30s~1h. RS232C port with included PC software
for download and reporting or realtime display. Low water-level warning, and
settable audible/visible WBGT alarm. Handheld, free-standing or tripod-mount.
Battery operated.
76,'XVW7UDN$LUERUQH3DUWLFOH0RQLWRU
TSI,8520
AU/NZ
Portable aerosol monitor. Laser photometer with 90O scattering detection, Range:
0.001~100mg/m3>&DOLEUDWHGIRU$WHVWGXVW,[email protected]
UHDGLQJRUSDUWLFOHVL]HUDQJHa—P,QWHUQDOSXPSÀRZUDWHa/
min (1.7 nominal). Data logging 30,000 data points (21d @ 1min), log interval:
1s~1h. RS232C interface and software included. Battery operated.
76,(QYLURQPHQWDO(QFORVXUHIRU'XVW7UDN
TSI,8520-1
AU
Weatherproof outdoor housing for TSI,8520 aerosol monitor. Rugged case with
WULSRGPRXQW¿WWHGZLWKVDPSOHLQOHWDQGZDWHUWUDS,QFOXGHVH[WHQGHGOLIHEDWWHU\
pack and charger/adaptor.
76,37UDN8OWUDÀQH3DUWLFOH&RXQWHU
TSI,8525
AU
Range 0.01~5 x 105 particles/cm3. Particle size range 0.02 to greater than
PLFURQ ,QFOXGHV 3& VRIWZDUH DQG FDEOH 6XLWDEOH IRU GHWHFWLRQ RI XOWUD¿QH
SDUWLFOHVDVVRFLDWHGZLWKSROOXWDQWV%DWWHU\SRZHUHG>KRSHUDWLRQXVLQJDONDOLQH
[email protected]
Air Conditioning Balancing Instruments
7RXU$QGHUVRQ&%,%DODQFLQJ0HWHU
TA,CBI
AU
Digital pressure balancing instrument with LCD display. For cooling water valve balancing in air conditioning plants and similar applications. Firmware revision 3A.
Includes facility for entry of Kv value to allow balancing of all hydronic valve types. Differential pressure range -0.5~20.5m water gauge at a total pressure of less than
200m. Resolution 0.001m. Flow resolution 0.001L/s. Battery operated.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 109
Air Conditioning & Air Quality - HVAC & IAQ
Test & Measurement
Leakage Detectors
+DORWHFN5HIULJHUDQW*DV/HDN'HWHFWRU
HAL,78000
AU
For use by refrigeration engineers. Rapid response 0.2s, audio output, zero warm up
time. Single control, battery operated, sensor tip insensitive to draughts. Sensitivity
better than 3g/y R12, 25g/y R134A. Responds to halogenated hydrocarbons and
PDQ\¿UHH[WLQJXLVKDQWJDVHV>DOVRVXOSKXUKH[DÀXRULGH6)@%DWWHU\OLIHK
Duty cycle continuous. Probe length 240mm. Weight 280g.
%DFDUDFK/HDNDWRU&RPEXVWLEOH*DV/HDN'HWHFWRU
BAC,LEAK10
*DV&KHFN3RUWDEOH*HQHUDOSXUSRVH/HDN'HWHFWRU
ION,GASCHECK3000
AU
Micro thermal-conductivity sensor for high-sensitivity detection of gases with
a thermal conductivity different to that of air, including helium, carbon dioxide,
UHIULJHUDQWVVXOSKXUKH[DÀXRULGHQDWXUDOJDVHWFLQJURXSV'LUHFWUHDGLQJ
of leak rate in ml/sec with audio and visible signals. Detection limit for helium
2E-5ml/s. Battery powered.
AU
Flexible probe with solid-state sensor for rapid area checks and pinpointing of large
or small leaks. Sensitive to combustible vapours including common solvents, and
JDVHVLQFOXGLQJQDWXUDOJDV$GMXVWDEOHVHQVLWLYLW\ZLWKGHWHFWLRQOLPLWDSSUR[LPDWHO\
SSP>[email protected],QGLFDWLRQE\XOWUDEULJKW/('VDQGDXGLEOHVSHDNHU%DWWHU\
powered.
Weather Stations
(QYLURQGDWD:HDWKHU0DVWHU:HDWKHU6WDWLRQ
ENV,WM20
AU
Measures air temperature -15~50OC ±0.2, relative humidity 10~90%RH ±5%, rainfall 0.2mm resolution. Wind speed starting threshold 1kph. Wind direction resolution
6O ±3%. One spare input channel. Capable of storing up to 3mths of data. Includes RS232 interface and software for download. Mounts on star-picket. Solarrechargeable batteries.
110
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Occupational Health & Safety
Test & Measurement
Light & UV Measurement
([WHFK'LJLWDO/LJKW0HWHU1DWD
Ż1(:Ż
,/,$%&5DGLRPHWHUIRU890HDVXUHPHQWV
ILI,1400ABC
EXT,407026
AU
International Light model 1400 radiometer with backlit LCD display, autozero
and autoranging. Continuous reading with hold function, or integrated “dose”
measurement up to 24h. Smart detectors with storage of units and detectorcalibration data. Analogue recorder output. Mains adaptor or battery power.
Supplied with three sensors: UV actinic hazard (UVC with B & A components
matched to OSHA requirements), range 2.50e-7 to 2.50e-3 W/cm2 eff. UVB +
A (total “solar” radiation), range 1.16e-7 to 4.07e-1 W/cm2. UVB, range 1.54e-6
to 1.54e-2 W/cm2.
NZ
NATA calibrated portable digital light meter. Ranges; 2,000, 20,000 & 50,000 lux.
$FFXUDF\LV“'LVSOD\VLQIRRWFDQGOHVRUOX[IRUWXQJVWHQGD\OLJKWÀXRUHVFHQW
sodium or mercury lamps. Data logging of measured values, Min/Max & Average,
software and serial interface for uploading results.
+LRNL'LJLWDO,OOXPLQDWLRQ/X[0HWHU
HIO,3423
MY
Digital lux hi tester. Maximum display of 199,9900 lux. Broad range of measurements,
remote measurement, display hold and backlight, analogue output.
7RSFRQ%0/XPLQDQFH0HWHU
TOP,BM-9-2
AU
Portable luminance meter with digital display. Field-of-view 5O, measurement
acceptance angle 2O, with 10mm min spot diameter. Measuring distance 0.35m
WRLQ¿QLW\6LOLFRQSKRWRGLRGHVHQVRUZLWKDXWRPDWLFRUPDQXDOUDQJHVHOHFWLRQ
Measurement range 0.01~199,900cd/m2 ±4% of reading. Built-in RS232C interface
and analogue output. Battery powered.
7RSFRQ,0''LJLWDO/X[PHWHU
TOP,IM-2D
AU
Digital illuminance meter. Measuring range from 0.1~19,999lx. Accuracy ±5%,
+1 digit. Autoranging with silicon sensor. Battery operated.
7RSFRQ,0'/X[0HWHU1$7$&HUWLÀFDWLRQ
TOP,IM-2D-NATA
Ż1(:Ż
0LQROWD&/&KURPD0HWHUIRULOOXPLQDQFH&RORXU0HDVXUHPHQW
MIN,CL200
AU
Digital illuminance meter with NATA certification. Measuring range from
0.1~19,999lx. Accuracy 5%, ±1 digit. Autoranging with silicon sensor. Battery
operated.
AU
Konica Minolta model CL-200 portable colour meter. LCD display for illuminance,
tristimulus values, chromaticity, correlated colour temperature and colour difference.
Illuminance range 0.1~99,990lx ±2%. Colour accuracy ±0.002 [xy] or ±20°K [Tcp].
Fitted with RS232C interface. Battery powered, or AC adapter.
7RSFRQ,0/X[0HWHU1$7$&HUWLÀFDWLRQ
TOP,IM-5-NATA
AU
'LJLWDOZLGHUDQJHLOOXPLQDQFHPHWHUZLWK1$7$FHUWL¿FDWLRQ0HDVXULQJUDQJH
0.01~199,000lx. Accuracy ±2% +1 digit. Autoranging with silicon sensor. Analog
output and RS232 interface. Battery operated.
0LQROWD7/X[0HWHU
MIN,T-1
NZ
Microprocessor controlled digital light meter. Measuring time can be adjusted for
DFFXUDWHUHDGLQJVRIERWKFRQWLQXRXVDQGÀLFNHULQJOLJKWVRXUFHV,OOXPLQDQFH
deviation between sources can also be determined, or integrated illuminance over
a period of time can be calculated. Range is 0.01~99,900lx. Accuracy is ±2%.
Sound Signal Analysis
+3$N+]'XDO&KDQQHO6SHFWUXP$QDO\VHU
HP,35660A
AU
401 line resolution. Displays frequency response, power spectrum, linear spectrum, coherence, cross spectrum, power spectral density, and time. Signal sources:
¿[HGVLQHUDQGRPQRLVHFKLUS%XLOWLQGLVNGULYH+3,%SORWWHULQWHUIDFH%DQGZLGWKLVN+]IRUVLQJOHFKDQQHOPHDVXUHPHQWVDQGN+]IRUGXDOFKDQQHO
measurements.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 111
Occupational Health & Safety
Test & Measurement
Noise & Sound Analysers
0RGHO
'HVFULSWLRQ
7\SH&ODVV
)HDWXUHV
BK,4443
Noise dosemeter
(2)
Built-in set up routines, 53,000 values
BK,2237A
40 data records, ac output
BK,2237A-NATA
1$7$FHUWL¿FDWHDFRXWSXW
2
RIO,NL-04
QUE,2400
ac & dc outputs
1$7$FHUWL¿FDWHDFRXWSXW
RIO,NL-11FP
2FWDYH¿OWHUSULQWHU
Sound level meter
RFWDYH¿OWHUDFGFRXWSXWV
RIO,NL14-NATA
1
RFWDYH¿OWHU
n/a
1$7$FHUWL¿FDWH'DWDORJJLQJ
Realtime frequency analysis
(1/1, 1/3 octave), “Flashcard”
(QKDQFHGVRXQGOHYHOPHWHU¿UPZDUH
Data logging, Frequency analysis
1$7$FHUWL¿FDWH
Compatible with BK4443, 2239A, 2238E-NATA
RIO,NL-32RTA-NATA
BK,2238E-NATA
Software
Environmental noise
logger
BK,2238NMT-KIT
Audio Analysis
System
2
7,500 data sets, Display
Weatherproof
1
25MB memory, Weatherproof
With sound level meter
1
Includes PDA, real time analysis, FFT, signal
generation, reverb, “seat-to-seat”, PC download
General
Yes
OH&S
General
Yes
OH&S
General
Analysis
Yes
n/a
Advanced applications
Yes
Long term outdoor logging
,YLH,(7\SH$XGLR$QDO\VLV6\VWHPV
General Analysis
Engineering, Audiovisual
Ż1(:Ż
Ż1(:Ż
IVI,IE35-2P
OH&S
General
2,048 data sets, Weatherproof
ARL,EL-215
IVI,IE35-2P
Yes
RFWDYH¿OWHU1$7$FHUWL¿FDWH
RIO,NL31
ARL,EL-315
OH&S
Recorder outputs
BK,2239A-NATA
BK,7815
0DMRU$SSOLFDWLRQV
ac & dc outputs
RIO,NL05
RIO,NL14
56&
AU
$XGLR$QDO\VHUZLWK'HOO$[LP;Y3'$)LWWHGZLWKKDOILQFKIUHH¿HOG7\SH
PLFURSKRQH DQG SUHDPSOL¿HU )XQFWLRQV LQFOXGH 63/ VRXQG OHYHO 5HDOWLPH
analysis, “seat-to-seat” variation for audio setup, reverberation measurement,
“strip-chart” recording on display, voltage and oscilloscope displays and signal
JHQHUDWLRQ 6XSSOLHG ZLWK ¿HOGFDOLEUDWRU PLFURSKRQH H[WHQVLRQ FDEOH VSDUH
battery and software for data-download to PC. SPL facilities include time and
frequency weightings - fast, slow, peak or impulse and A, C or Flat. FFT based Real
Time Analysis includes 1/1, 1/3, or 1/6 octave bands with a maximum resolution of
about 1/24 octave. Additional functions include spectrum subtraction, averaging,
Noise Critera or Reduction contours and reverberation-decay to ISO-20 and ISO30. Signal-generation includes sine, square, triangle and white or pink noise.
%.1RLVH0RQLWRULQJ7HUPLQDOZLWKPRGHO)6/0
B&K,2238NMT-KIT
Noise logging system with B&K model 2238F Class 1 Sound Level Meter equipped
with internal software for Basic SLM and Logging. Portable, wheeled weatherproof
case. Standard SLM operation for fast, slow and impulse time weighings and A,
C or linear frequency weightings RMS. Linear or C frequency weightings for peak
detection. Internal memory 2MB total for logging up to 12 parameters including
auxiliary signals. Fitted with serial RS232 interface, and provided with BKlink
VRIWZDUHIRUGRZQORDGRIORJJHGGDWDWR3&6XSSOLHGZLWK¿HOGFDOLEUDWRUFKDUJHU
and 12V, 18Ah battery, for operation for up to 14d logging at 15min intervals.
%.1RLVH'RVH0HWHUZLWK/RJJLQJ
BK,4443
AU/NZ
Fitted with remote microphone, for OH&S surveys. Logging of 1 or 2 parameters
IURP D UDQJH RI ZLWK YDULDEOH LQWHUYDO EXLOWLQ DQG XVHUGH¿QHG VHWXS
routines, 5 selectable statistical levels Lx. Storage of up to 53,000 values over 16
measurement periods, and download [or setup] via PC using software provided.
6XSSOLHGFRPSOHWHZLWK¿HOGFDOLEUDWRU%DWWHU\SRZHUHG
112
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Occupational Health & Safety
Test & Measurement
Noise & Sound Analysers (cont’d)
%.$7\SH,QWHJUDWLQJ6RXQG/HYHO0HWHU
BK,2237A
AU
Measures RMS and peak simultaneously. Linearly weighted analogue output
for sound recording, 0~0.5V ac (rms). Measurement range 30~140dB. Time
weightings fast, slow & impulse. Independent frequency weightings A [for RMS
readings SPL, MaxL, MinL, Leq, Inst] and C [for peak readings Peak and MaxP].
Real time clock for time and date stamp. Records 40 measurements for download
to PC. Calibrator included. Battery operated.
4XHVW7\SH6RXQG6RXQG/HYHO0HWHU
QUE,2400
NZ
Type 2 sound level meter with LCD display for sound pressure level (SPL) or
maximum level (MAX). Frequency weightings A & C, time weightings Fast and
Slow. Ranges 30~140dBA and 40~140dBC with overload indication. AC & dc
outputs. Battery powered.
5LRQ1/6RXQG/HYHO0HWHU
RIO,NL-04
MY
Meets IEC type 2. Five measurement functions: Lp(SPL), Leq, LAE, Lmax &
Lx(L5,L10,L50,L90,L95). 6 automatic measurements & data store. Built-in
RS232C interface for computer communication. 70dB dynamic range (digital
display), 27~130dB (A) measuring range. Wide range of time settings for Leq,
LAE, Lmax & Lx;10s,1,5,10, 15, 30min,1, 8, 24h & manual time setting (up to
99h 59min 59s). RMS: fast, slow,10ms. 4 digit LCD display, 0.1dB resolution,
updated every second, plus 60dB analog display display 1dB resolution
showing the instantaneous value. Memory battery back-up. AC & DC signal
RSIRUOHYHOH[SDQGLQJV\VWHPE\RSWLRQDO¿OWHUVPHPRU\FDUGRWKHUV
5LRQ1/7\SH6RXQG/HYHO0HWHU
RIO,NL-05
RIO,NL-11FP
MY
6RXQG OHYHO PHWHU FRPSOHWH ZLWK W\SH 1;$ RFWDYH ¿OWHU &3 SULQWHU FDOLEUDWRU0HDVXUHV/HT/H/D[6SODQGWLPH:HLJKWLQJ¿OWHUV$&DQGÀDW
Detector reads fast, slow, impulse, and peak (IEC 651). Measurement range 29
~140 dB rms.
%.$7\SH6RXQG/HYHO0HWHU1$7$&HUWLÀFDWLRQ
BK,2239A-NATA
AU
Type 1 (class 1) integrating sound level meter with backlit LCD display, NATA
FHUWL¿FDWLRQ 6LPXOWDQHRXV UPV $& SHDN & GHWHFWLRQ ZLWK LQGHSHQGHQW
frequency weightings. Measuring range 30~140dB. Time weightings fast, slow
and impulse. Parameters Leq, MaxP, MaxL, MinL, Peak, SPL and Inst. Memory
for 40 data records with realtime clock. Serial port for data download. Calibrator
included. Operates with 4 x AA alkaline batteries.
5LRQ1/7\SH6RXQG/HYHO0HWHU$QDO\VHU
RIO,NL14
AU/MY
Precision integrating sound level meter meeting IEC type 1 standard. Fitted with
1;VLQJOHRFWDYH¿OWHUPRGXOHUDQJHaN+]LQEDQGV6XSSOLHGZLWK
1&FDOLEUDWRU:HLJKWLQJV$&ÀDW0HDVXUHPHQWUDQJHZLWK$ZHLJKWLQJ
25~130dBA. Measurement functions Lp (SPL), Lmax, Leq, Lae, Lx. Time
weightings fast, slow, impulse, 10ms, peak hold. Leq time from 10s~100h. In-built
memory for up to 9,000 readings (LP). Outputs 1V ac rms, 3.5V dc, RS232C
interface. Continuous operation on batteries for 12h. AC adaptor included.
5LRQ1/6/0ZLWK2FWDYH)LOWHU1$7$&HUWLÀFDWLRQ
RIO,NL14-NATA
RIO,NL31
NZ
Complies with standards, IEC60651: 1979 Type 1, IEC60804: 1985 Type 1, IEC/
CDV: 61672-1 Class 1. Simultaneous measurement of: sound level (Lp), equivalent
continuous sound presure level (Leq), sound exposure level (LE), Maximum (Lmax)
& Minimum (Lmin), percentile sound pressure level (LN), 5 selectable settings.
0HDVXUHPHQWUDQJHVDUH$ZHLJKWLQJaG%&ZHLJKWLQJaG%ÀDW
38~138dB, peak sound level: 141dB. Time weightings are: fast, slow, impulse
(impulse is selectable only for auxiliary processing functions). Ranges 100dB
dynamic, frequency 20~12,500Hz (including microphone). Timer function for
automatic measurement over extended periods. Supplied with NX-21SA 1/1 and
RFWDYH¿OWHUFDUG
5LRQ1/6/0ZLWK57$1$7$&HUWLÀFDWLRQ
RIO,NL-32RTA-NATA
RIO,NL-32
AU
NZ
3UHFLVLRQLQWHJUDWLQJVRXQGOHYHOPHWHUWR,(&W\SHFODVVVSHFL¿FDWLRQZLWK
1$7$ FHUWL¿FDWLRQ 6XSSOLHG ZLWK 1& ¿HOG FDOLEUDWRU ,QWHUQDO ³)ODVKFDUG´
FRQQHFWRU¿WWHGZLWK1;57FDUGIRUUHDOWLPHRFWDYHDQDO\VLVGLVSOD\
DQGGDWDVWRUDJH)UHTXHQF\UDQJHa+]ZLWKZHLJKWLQJV$&ÀDW
Measurement range (A) 28~138dB. Measurement functions Lp (SPL), Leq, Lmax/
min, Lae, Lx, and selectable auxiliary functions. Time weightings fast, slow and
impulse. Measurement time (Leq) from 10s~200h. In-built memory for up to 100
data sets, or to limit of RTA card using manual or auto storage. AC or dc outputs,
RS232C interface and cable CC93 for serial printer. Download of card-data to PC
UHTXLUHVÀDVKFDUGUHDGHU$ONDOLQHEDWWHULHV>[email protected]
%.(7\SH,QWHJUDWLQJ6/0(QKDQFHG6RIWZDUH/RJJLQJ
AU
Sound level meter to IEC 651/1979 & IEC 804/1985 type 2 requirements. Measures
/S/PD[/HT/DH5HVSRQVHW\SHV$&DQGÀDW)DVWDQGVORZWLPHZHLJKWLQJV
Complete with calibrator. Internal memory and print-out for Leq data (printer CP-10
optional, also prints other parameters), RS232C interface. Recorder outputs 1V
ac rms & 3.5V dc. Operates from batteries or ac adaptor.
5LRQ1/)36RXQG/HYHO0HWHU6\VWHP
5LRQ1/7\SH6/0ZLWK2FWDYH)LOWHU
AU
BK,2238E-NATA
AU
Type 1 (class 1) Integrating sound level meter with additional functions including
enhanced software, frequency analysis and data logging. Standard routines include
functions for workplace measurements and general sound-level checks; enhanced
VRIWZDUH¿UPZDUHRIIHUVDGGLWLRQDOPHDVXUHPHQWVDQGVWDWLVWLFVIRUDVVHVVPHQW
of environmental noise problems; frequency analysis automates measurements in
WKHVLQJOHRFWDYHEDQGVDQGRFWDYHEDQGV6XSSOLHGZLWK¿HOGFDOLEUDWRU
Compatible with BK,7815 Noise Explorer Environmental software for download,
data analysis and display.
%.(QYLURQPHQWDO6RIWZDUH1RLVH([SORUHU
BK,7815
AU
Software package for downloading and reporting of noise data measured with B&K
meters. Compatible with sound level meters (2239, 2238) and noise dosemeters
(4443). Offers data transfer, formatting of data for export, display and print in
WDEXODU RU JUDSKLFDO IRUP ¿OH PDQDJHPHQW DQG FDOFXODWLRQ RI VRXQG SRZHU RU
sound reduction index from intensity measurements.
$5/(/(QYLURQPHQWDO1RLVH/RJJHU
ARL,EL-215
AU
Environmental noise logger. Portable, self-contained and weatherproof. Monitors
environmental noise continuously for up to 3 weeks. Calculates and stores 2048
sets of measured data. Continuous 90dB dynamic range. A and C frequency
weightings. Logs date, time, Leq, Lmax, L1, L5, L10, L50, L90, L95, L99, Lmin,
temperature and battery (plus additional sensor). Scan interval 1 min~1 hour.
RS232C interface. PC required for initial setup and results download.
$5/(/(QYLURQPHQWDO1RLVH/RJJHU
ARL,EL-315
AU/NZ/MY
(QYLURQPHQWDO QRLVH ORJJHU ZLWK GLVSOD\ IRU ¿HOGUHDGLQJ RI VXPPDU\ UHVXOWV
Portable, self-contained and weatherproof. Continuous 90dB dynamic range,
frequency weightings A and C. Monitors environmental noise continuously for up
to 3 weeks, calculates and stores over 7500 sets of Ln indices. PC required to
set up system and download data using software supplied. Set up also possible
from front-panel.
3UHFLVLRQ LQWHJUDWLQJ VRXQG OHYHO PHWHU WR ,(& W\SH FODVV VSHFL¿FDWLRQ
ZLWK1$7$FHUWL¿FDWLRQ6XSSOLHGZLWKRFWDYH¿OWHUPRGXOH1;DQG
FDOLEUDWRU 1& )UHTXHQF\ UDQJH a+] ZLWK ZHLJKWLQJV$ & ÀDW
Measurement range (A) 25~130dB. Measurement functions Lp (SPL), Lmax, Leq,
Lae, Lx. Time weightings fast, slow, impulse, 10ms, peak hold. Leq time from
10s~100h. In-built memory for up to 9,000 readings (Lp). Outputs 1V ac rms, 3.5V
dc fs, RS232C interface. Alkaline batteries 12h operation or ac adaptor.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 113
Occupational Health & Safety
Test & Measurement
OH&S & Environmental - General
76,6LGH3DN633HUVRQDO6DPSOLQJ3XPS
TSI,SP730
AU
3HUVRQDOVDPSOLQJSXPSZLWKLQWHUQDOGLJLWDOÀRZPHWHU)ORZUDQJHWRPOPLQ
ZLWKLQWHUQDOORZÀRZE\SDVVIRUSUHFLVHFRQWURODQGPHDVXUHPHQWDWORZDQG
high rates. Keypad programming with lockout option. Multimode operation for
manual control and preset programs with intermittent sampling. Supplied with
“TrakPro” data analysis software and USB interface. Battery powered, 2,700mAH
rechargable NiMH gives up to 18.5h at 1L/min. Intrinsically safe.
6HYHUQ0RGHO7RUWXV,,)ORRU6OLS7HVWHU
SEV,TORTUSII
AU
)ORRUIULFWLRQWHVWHU0HDVXUHVDQGUHFRUGVWKHG\QDPLFFRHI¿FLHQWRIIULFWLRQ
Applications in assessing floor safety, evaluating cleaning methods and
maintenance procedures, accident investigation, etc. Meets the draft requirements
of international, Australian and New Zealand standards.
/LRQ%UHDWK$OFRKRO$QDO\VHU
LIO,SD-400P
AU
Portable breath alcohol analyser with attached printer. Uses disposable
mouthpieces. Approved by most law-enforcement agencies.
Did you know?
Portable Appliance Testing (PAT) is required
by law.
To protect yourself, your employees and
customers test your portable appliances
regularly.
Make the job easier and rent the Seward
Supernova PAT system with printer and
scanner, which is fully compliant with
AS/NZS3760:2001/2003.
Talk to our friendly staff about this and other
solutions for making a safer workplace.
Call now!
114
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Test & Measurement
Gas Analysis & Monitoring
Gas Analysis & Monitoring
Model
NO
NO2
SO2 H2S
CH4
Efficiency
Calculations
Notes
Temp
°C
Max
Type
<
,QGXVWULDO
'RPHVWLFOLJKW
2LOJDVEXUQHUV
&RPEXVWLRQHI¿FLHQF\
<
'RPHVWLF
,QGXVWULDO
&RPEXVWLRQHI¿FLHQF\
&RPEXVWLRQ
)OXH*DVDQDO\VLV
&RPEXVWLRQHI¿FLHQF\
'RPHVWLF,QGXVWULDO
3RZHUJHQHUDWLRQ
&RPEXVWLRQ
)OXH*DVDQDO\VLV
O2E\=LUFRQLDVHQVRU
CO2 E\1',5
a
)OXHJDVDQDO\VLV
'XDOUDQJH
1',5PHWKDQHDQDO\VHU
a
)OXHJDVDQGJHQHUDO
DQDO\VLV
0HWKDQH
O2 CO
CO2
TES,325-1
<
<
<
7(60
<
<
<
<
7(6
<
<
<
<
<
<
<
7(6;/
<
<
<
<
<
<
<
/$16(5,(6
<
<
<
<
<
<
129&*$
<
<
'RPHVWLF
,QGXVWULDO
3RZHUJHQHUDWLRQ
*HQHUDO
<
<
,6&0'8
<
&DOFXODWHG
Model
LEL
(combustion)
O2
H2S
Other
SSP&+4) to
/(/
,6&,7;67'
,6&70;
CO
ppm
,6&0*
Notes
Applications
)XOOFRQ¿QHGVSDFHNLW
/RJJLQJGRZQORDG
)XOOFRQ¿QHGVSDFHNLW
/RJJLQJ
$,0
129
IURP
SSP
3HUVRQDOPRQLWRULQJ
&RQ¿QHGVSDFHHQWU\
3HUVRQDOPRQLWRULQJ
CO2a
=LUFRQLD1',5VHQVRUV
:LGHUDQJH
*HQHUDOSXUSRVH
6FLHQWL¿F
)RRGSDFNDJLQJ
&+4a
1',5VHQVRU
/RJJLQJGRZQORDG
*HQHUDOSXUSRVH
/DQG¿OOPHWKDQH
O3
aSSP
0DLQVRUEDWWHU\
/RJJLQJGRZQORDG
330)250
)RUPDOGHK\GH
aSSP
)RUPDOGHK\GHHPLVVLRQVIURP
UHVLQVIXUQLWXUHWH[WLOHVHWF
/,26'3
$OFRKRO
$SSURYHGGHVLJQ
%UHDWK±DOFRKRO
,6&0'8
$(5/
3RUWDEOH/RJJLQJ2]RQH0RQLWRU
,QGRRUDLUTXDOLW\
³6LFN%XLOGLQJ´V\QGURPH
5$(05
'HWHFWVVFUHHQVDQGPHDVXUHV92&FRQWDPLQDQWV6HQVLWLYHWR
%HQ]HQH$PPRQLD*DVROLQHYDSRXUDQGPDQ\PRUH
3KRWRLRQLVDWLRQGHWHFWRU
(QYLURQPHQWDO2+6
*HQHUDO
%$&/($.
3RUWDEOHOHDNGHWHFWRUIRUFRPEXVWLRQJDVHV'HWHFWVPHWKDQHWR
aSSP
9LVXDODXGLEOHOHDN
LQGLFDWLRQ
(QYLURQPHQWDO2+6
+HDWLQJ9HQWLODWLRQ$LUFRQ
³+9$&´
,21*$6&+(&.
3RUWDEOHOHDNGHWHFWRUXVLQJWKHUPDOFRQGXFWLYLW\
:LGHUDQJHRIJDVHVLQFOXGLQJKHOLXP
9LVXDODXGLEOHVLJQDO
*HQHUDOSXUSRVH
+LJKVHQVLWLYLW\
Testo 325-1 Combustion Gas Analyser
TES,325-1
AU
3RUWDEOH ÀXH JDV DQDO\VHU IRU PHDVXUHPHQWV DQG DGMXVWPHQWV RI RLO DQG JDV
EXUQHUV'HWHUPLQHVWHPSHUDWXUHWRO&GUDXJKWSUHVVXUHR[\JHQ
DQGFDUERQPRQR[LGHSSPFRQFHQWUDWLRQV&DOFXODWHV&22FRQFHQWUDWLRQ
DQGJURVVQHWHI¿FLHQF\6XSSOLHGDVNLWZLWKSUREHFRUGOHVVSULQWHUDQGSRZHU
VXSSO\IRUPDLQVRSHUDWLRQ2SHUDWLRQ9DFZLWKSRZHUVXSSO\RUDONDOLQH
EDWWHULHV$$DOVRUHTXLUHGE\SULQWHU
Testo 300M Combustion Gas Analyser
7(60
$81=0<
)OXHJDVDQDO\VHUIRUFRPEXVWLRQHI¿FLHQF\PHDVXUHPHQW7HPSHUDWXUHUDQJH
aO&““!ZLWKJDVSUREHRSHUDWLRQWRO&PD[
'UDXJKWSUHVVXUHUDQJHP%DU“*DVHVPHDVXUHG22a“
CO2>[email protected]&22PD[YRO“&2aSSP“
12aSSP“&DOFXODWHG
JURVVQHWHI¿FLHQF\aUHVROXWLRQ
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 115
Test & Measurement
Gas Analysis & Monitoring
Gas Analysis & Monitoring (cont’d)
Lancom Series II Combustion Gas Analyser
Ż1(:Ż
/$16(5,(6
Testo 350XL Portable Flue Gas Analyser
7(6;/
$8
3RUWDEOHÀXHJDVDQDO\VHU0HDVXUHV22, CO, CO2E\1',512122DQG622
FRQFHQWUDWLRQV SOXV GUDXJKW WHPSHUDWXUH H[FHVV DLU DQG JURVVQHW HI¿FLHQF\
YDOXHV 5DQJHV 22 a YRO &22 a YRO &2 ZLWK +2FRPSHQVDWLRQ
aSSPZLWKPHDVXULQJUDQJHH[WHQVLRQDQGVHOHFWDEOHGLOXWLRQIDFWRU12
aSSP122aSSP622aSSPGUDXJKWK3DWHPSHUDWXUH
aO&,QFOXGHVVZLWFKRIIDQGULQVHIXQFWLRQIRU&2FHOODQGIUHVKDLUULQVH
IRUORQJHUWHUPPHDVXUHPHQWV2SHUDWLRQIURPPDLQVRUUHFKDUJHDEOHEDWWHU\
$8
/LJKWZHLJKW SRUWDEOH ÀXH JDV DQDO\VHU ZLWK GDWD ORJJLQJ 0HDVXUHV 2 &2 SSP 622 SSP 12 SSP 122 SSP +2S
SSP &DOFXODWHV &22 HI¿FLHQF\ H[FHVV DLU DQG ORVV 3UREH WHPSHUDWXUH
O&FRQWLQXRXVO&LQWHUPLWWHQW)LWWHGZLWKVOHHSZDNHIDFLOLW\IRUVHPL
FRQWLQXRXVPRQLWRULQJ:LWKVHULDOSRUWDQGVRIWZDUH,QWHUQDOUHFKDUJDEOHEDWWHU\
DQGPDLQVSRZHUVXSSO\
Novatech O2 & CO2 Combustion Gas Analyser
129&*$
$8
2[\JHQDQGFDUERQGLR[LGHDQDO\VHUIRUÀXHJDVFRPEXVWLRQJDVDSSOLFDWLRQV
6SHFLDOYHUVLRQRIPRGHOZLWKVWHHOWUDQVIHUWXELQJFORVHG,5FHOOVDSSKLUH
ZLQGRZV DQG UXJJHGLVHG LQWHUQDO ÀRZ SDWK )LWWHG ZLWK ¿OWUDWLRQ V\VWHP IRU
PRLVWXUHSURWHFWLRQ9+]
ISC Gas Monitor for CH4, O2, CO & H2S
,6&70;
$81=
)RXU JDV PRQLWRU FRPSOHWH ZLWK FRQ¿QHG VSDFH HQWU\ NLW 'HWHFWV JDVHV
ÀDPPDEOH &+4 R[\JHQ 22 FDUERQ PRQR[LGH &2 DQG K\GURJHQ VXOSKLGH
+260HDVXUHV/(/ÀDPPDEOH22, SSP&2+26,QWULQVLFDOO\VDIH(([
LD7UDWHG$XVWUDOLDQ$SSURYHG&RQ¿QHGVSDFHHQWU\NLWLQFOXGHVVDPSOLQJ
SXPSWXELQJ¿OWHUVDQGFDUU\FDVH'HVLJQHGWRWHVWFRQ¿QHGVSDFHVIURPD
VDIHDUHDSULRUWRHQWU\6XSSOLHGLQFDUU\FDVHFRPSOHWHZLWKWUDLQLQJYLGHRDQG
EDWWHU\FKDUJHU2WKHUVHQVRURSWLRQVDYDLODEOHDWH[WUDFRVW%DWWHU\SDFNUXQ
WLPHKKZLWKOLWKLXPEDWWHULHV
,6&,7;*DV0RQLWRU&RQÀQHG6SDFH/RJJLQJ
Ż1(:Ż
ISC MG140 4-gas Personal Monitor for CH44 , O2, CO & H2S
,6&0*
,6&,7;67'
$8
)RXUJDVSHUVRQDOPRQLWRUIRUFRPEXVWLEOHJDVHV/(/R[\JHQO2FDUERQ
PRQR[LGHSSP&2DQGK\GURJHQVXOSKLGHSSP+2S,QWHUQDWLRQDODSSURYDOV8/
&6$FODVVJURXSV$%&'$XGLEOH>G%@DQGYLVXDODODUPV6XSSOLHG
ZLWKFDVHDQGEHOWORRSFDOLEUDWLRQFXSDQGEDWWHU\FKDUJHU5XQWLPHKRQ
IXOOFKDUJH
$8
0XOWLJDVPRQLWRUZLWKFRQ¿QHGVSDFHNLWDQGORJJLQJRSWLRQ&RQ¿JXUHGIRU
JDVHV FRPEXVWLEOH SSPa/(/ R[\JHQ a &2 aSSP +2S
aSSP ,QWULQVLFDOO\ VDIH ([ LD G ,,,& 7>[email protected] &RQ¿QHG VSDFH NLW
LQFOXGHVPRWRULVHGSXPSWXELQJFDOLEUDWLRQFXSDQGUHJXODWRU/RJJLQJRSWLRQE\
WLPHRUHYHQWXSWRKVXUYH\GDWDDWPLQLQWHUYDOVZLWKGDWDOLQNVRIWZDUHIRU
GRZQORDG,QFOXGHVWUDLQLQJYLGHR/LLRQEDWWHU\SDFNZLWKFKDUJHUDQGEDFNXS
DONDOLQHEDWWHU\SDFN
AIM 650 Four-Gas Monitor with Internal Logging
$,0
$8
)RXUJDVWR[LFFRPEXVWLEOHFRQ¿QHGVSDFHRUSHUVRQDOPRQLWRUZLWKGDWDORJJLQJ
DQG LQWHUQDO UHFDOO 0HDVXUHV FRPEXVWLEOHV &+4 HTXLYDOHQW a /(/
2a&2aSSP+26aSSP$ONDOLQHEDWWHULHVIRUaK
RSHUDWLRQ
Bacarach Leakator 10 Combustible Gas Leak Detector
%$&/($.
$8
3RUWDEOH OHDN GHWHFWRU IRU FRPEXVWLEOH JDVHV )OH[LEOH SUREH ZLWK VROLGVWDWH
VHQVRUIRUUDSLGDUHDFKHFNVDQGSLQSRLQWLQJRIODUJHRUVPDOOOHDNV6HQVLWLYH
WRFRPEXVWLEOHYDSRXUVLQFOXGLQJFRPPRQVROYHQWVDQGJDVHVLQFOXGLQJQDWXUDO
JDV$GMXVWDEOHVHQVLWLYLW\ZLWKGHWHFWLRQOLPLWDSSUR[LPDWHO\SSP>[email protected]
,QGLFDWLRQE\XOWUDEULJKW/('VDQGDXGLEOHVSHDNHU%DWWHU\SRZHUHG
PPM 400 Portable Formaldehyde Meter
Testo 350 Combustion Gas Analyser
7(6
330)250
$8
&RPEXVWLRQDQDO\VHU0HDVXUHV22, CO, CO212122DQG622FRQFHQWUDWLRQV
SOXVGUDXJKWWHPSHUDWXUHH[FHVVDLUDQGJURVVQHWHI¿FLHQF\YDOXHV5DQJHV
O2 aYRO&2ZLWK+2 FRPSHQVDWLRQaSSP12aSSP122
aSSP 622 aSSP GUDXJKW K3D WHPSHUDWXUH aO&
&RPSOHWHZLWKSULQWHUDQG56&LQWHUIDFH%DWWHU\DQGDFPDLQVRSHUDWLRQ
TSI CaCalc CA-6215 Combustion Analyser
76,&$
1=
3RUWDEOHFRPEXVWLRQDQDO\VHUIRUWXQLQJEXUQHUVIRUPD[HI¿FLHQF\0HDVXUHV
O2&21212[ÀXHJDVWHPSHUDWXUHGUDIWSUHVVXUH&DOFXODWHVHI¿FLHQF\
H[FHVV DLU &22 DQG HPLVVLRQ UDWHV (PLVVLRQ JDV FRQFHQWUDWLRQV XVH WKH
DGMXVWDEOH22UHIHUHQFH6WRUHVXSWRVDPSOHVIRUVLWHVDQGV\VWHPV
DQGVWRUHGGDWDLQFOXGHVIXHOSDUDPHWHUVWLPHDQGGDWHVWDPSLQJ+DV56
LQWHUIDFHIRUXSORDGLQJRIVWRUHGGDWDRUXQLWFDQEHVXSSOLHGZLWKRSWLRQDOSULQWHU
IRULQVWDQWKDUGFRS\RXWSXW
116
$8
3RUWDEOH )RUPDOGHK\GH PHWHU IRU PHDVXULQJ DLUERUQH IRUPDOGHK\GH LQ WKH
ZRUNSODFH (OHFWURFKHPLFDO VHQVRU ZLWK LQWHUQDO SXPS IRU UDSLG UHVSRQVH
2SHUDWLQJUDQJHaSSPZLWKUHDGRXWRQGLJLW/&'GLVSOD\.LWLQFOXGHV
¿HOGFDOLEUDWLRQVWDQGDUG2SHUDWHVIURP9DONDOLQHEDWWHU\
GasCheck 3000 Portable General-purpose Leak Detector
,21*$6&+(&.
$8
3RUWDEOHOHDNGHWHFWRU0LFURWKHUPDOFRQGXFWLYLW\VHQVRUIRUKLJKVHQVLWLYLW\GHWHFWLRQRIJDVHVZLWKDWKHUPDOFRQGXFWLYLW\GLIIHUHQWWRWKDWRIDLULQFOXGLQJKHOLXP
FDUERQGLR[LGHUHIULJHUDQWVVXOSKXUKH[DÀXRULGHQDWXUDOJDVHWFLQ¿YHJURXSV
'LUHFWUHDGLQJRIOHDNUDWHLQPOVZLWKDXGLRDQGYLVLEOHVLJQDOV'HWHFWLRQOLPLW
IRUKHOLXP(POV%DWWHU\SRZHUHG
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Test & Measurement
Gas Analysis & Monitoring
Gas Analysis & Monitoring (cont’d)
RAE Systems Minirae 2000 Portable PID
Portable Logging Ozone Monitor
$(5/
$8
3RUWDEOH R]RQH PRQLWRU ¿WWHG ZLWK ORZ FRQFHQWUDWLRQUDQJH GHWHFWLRQ KHDG
2SHUDWLQJUDQJHWRSSPR]RQHZLWKGLVSOD\LQSSPRUPJP*DV
VHQVLWLYHVHPLFRQGXFWRU>*[email protected]
UHVSRQVHDSSUR[LPDWHO\VHF2SHUDWLRQIURPPDLQVSRZHUVXSSO\RUEDWWHU\
SDFNKRXUVRSHUDWLRQ,QWHUQDOGDWDORJJLQJIRUSRLQWVZLWKVRIWZDUHDQG
FDEOHIRUGRZQORDGWR3&RUGDWDORJJLQJGLUHFWWR3&$SSOLFDWLRQIRULQGRRUDLU
TXDOLW\PHDVXUHPHQWV
5$(05
$8
3RUWDEOHKDQGKHOG92&9RODWLOH2UJDQLF&RPSRXQGPRQLWRUZLWKGDWDORJJLQJ
' 3,' VHQVRU 3KRWR,RQLVDWLRQ 'HWHFWRU ¿WWHG ZLWK H9 ODPS 5DQJHV
aSSPUHVROXWLRQRUaSSPUHVROXWLRQ92&H[SUHVVHGDV
LVREXW\OHQH%XLOWLQFRUUHFWLRQIDFWRUVIRUFRPSRXQGVIURPDWRWDOVWDQGDUG
OLEUDU\ RI ,QWHJUDWHG SXPS IRU ORFDO RU UHPRWH P VDPSOLQJ ZLWK VWDOO
SURWHFWLRQDJDLQVWOLTXLGLQJUHVV'RZQORDGDEOHGDWDORJJLQJIRUSRLQWVZLWK
WLPHGDWDDQGKHDGHU,QWULQVLFDOO\VDIH8SWRKRSHUDWLRQZLWKUHFKDUJHDEOH
1L0+RUDONDOLQHEDWWHULHV
Novatech O2 and CO2 Analyser/Transmitter
129
$8
2[\JHQDQGFDUERQGLR[LGHDQDO\VHUIRUSDFNDJLQJDWPRVSKHUHJHQHUDOLQGXVWULDO
DQG UHVHDUFK XVH 2[\JHQ VHQVRU UHDGLQJ SSP WR ZLWK DFFXUDF\
1',5FDUERQGLR[LGHDQDO\VLVa“RIIXOOVFDOH[aP$RXWSXWV
FRPPRQVHOHFWDEOHDODUPUHOD\V*DVFRQQHFWLRQ6ZDJHORN)ORZUDWH
ZLWKLQWHUQDOSXPSaFFPLQ$&RSHUDWLRQ
ISC MDU420 Logging Methane Monitor
,6&0'8
$8
'XDOUDQJH PHWKDQH PRQLWRU ZLWK QRQGLVSHUVLYH LQIUDUHG VHQVRU /RZ UDQJH
a/(/DQGDXWRUDQJHaPHWKDQHE\YROXPH,QWHUQDOSXPSIRU
DPELHQWDLURUVWUHDPVDPSOLQJ'DWDORJJLQJLQFOXGHGZLWKVRIWZDUHDQGFDEOH
IRUGRZQORDG6XSSOLHGZLWKPPVWDLQOHVVVWHHOSUREHIRUÀXHJDVDQDO\VLV
5HFKDUJHDEOHZLWKDONDOLQHEDWWHU\SDFNDVEDFNXS
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 117
Test & Measurement
General Environment
Electrochemistry, Water Quality
736:3&RQGXFWLYLW\6DOLQLW\7HPSHUDWXUH0HWHU
Ż1(:Ż
736:37XUELGLW\7HPSHUDWXUH0HWHUZLWKP&DEOH
TPS,WP88
736:3
AU
3RUWDEOHKDQGKHOGWXUELGLW\DQGWHPSHUDWXUHPHWHUIRU¿HOGRUODERUDWRU\XVH
6HQVRUSUREHGLDPHWHUPPZLWKPFDEOH7XUELGLW\UDQJLQJa178
“178ZLWKDXWRVHOHFWLRQ7HPSHUDWXUHFRPSHQVDWLRQDQGVHQVRUUDQJHaž&
“ž&&DVHZDWHUUHVLVWDQWWR,3FRQQHFWRUVWR,3ZLWKGHWDFKDEOHFDEOH
DQGVHQVRU0HQXGULYHQZLWKDOSKDQXPHULFGLVSOD\$XWRVWRUDJHRIWLPHGDWH
DQGUHVXOWVRIODVWFDOLEUDWLRQIRU*/356&LQWHUIDFHDQGPHPRU\IRU
UHDGLQJVRIGDWDWLPHDQGGDWHIRU1RWHSDGUHVXOWVFROOHFWLRQRUIRU$XWR/RJ
UHVXOWVFROOHFWLRQZLWKORJJLQJLQWHUYDOVEHWZHHQPLQDQGK5HFKDUJHDEOH
1L0+EDWWHU\JLYHVXSWRKRSHUDWLRQ6XSSOLHGZLWKGRZQORDGVRIWZDUHFKDUJHU
DQGFDOLEUDWLRQVROXWLRQV
$8
3RUWDEOH KDQGKHOG PHWHU IRU FRQGXFWLYLW\ 7'6 7RWDO 'LVVROYHG 6ROLGV DQG
WHPSHUDWXUH$XWRPDWLFUDQJHVHOHFWLRQZLWKUDQJHV&DVHZDWHUUHVLVWDQWWR
,3FRQQHFWRUVWR,30HQXGULYHQZLWKDOSKDQXPHULFGLVSOD\IRUIXOOWH[W
SURPSWLQJ6WRUDJHRIWLPHDQGGDWHRIODVWFDOLEUDWLRQIRU*/30HPRU\IRU
UHDGLQJVRIGDWDWLPHDQGGDWHIRU1RWHSDGUHVXOWVFROOHFWLRQRUIRU$XWR/RJUHVXOWV
FROOHFWLRQZLWKORJJLQJLQWHUYDOVEHWZHHQPLQK5HFKDUJHDEOH1L0+EDWWHU\
JLYHVXSWRKRSHUDWLRQ6XSSOLHGZLWKVHQVRUN FKDUJHUDQGVROXWLRQV
<6,''LVVROYHG2[\JHQ0HWHU
<6,'
736/&$3RUWDEOHS+0HWHU
736/&$
$8
%DWWHU\RSHUDWHGZLWK/&'GLVSOD\$XWRPDWLFWHPSHUDWXUHFRPSHQVDWLRQDQG
DQDORJXH UHFRUGHU RXWSXW &RPSOHWH ZLWK FRPELQDWLRQ HOHFWURGH WHPSHUDWXUH
SUREHZLWKDPD[WHPSHUDWXUHRIO&'LVSOD\KDVUDQJHVa3KaP9
aO&
7365HGR[(OHFWURGH
7365('2;
$8
6LOYHUFKORULGH5HGR[HOHFWURGHIRUXVHZLWK736/&$3KPHWHU6XSSOLHGZLWK
ERWWOHVRI=REHOOVROXWLRQIRUFDOLEUDWLRQGLOXWLRQJLYHVDSSUR[P9
736:3'LVVROYHG2[\JHQ0HWHU
736:3
$8
3RUWDEOHKDQGKHOGGLVVROYHGR[\JHQDQGWHPSHUDWXUHPHWHU2SHUDWLQJUDQJHV
aSSPaVDWXUDWLRQaJDVHRXVDQGSSPZLWKVDOLQLW\FRUUHFWLRQ
WHPSHUDWXUHUDQJHaO&&DVHZDWHUUHVLVWDQWWR,3FRQQHFWRUVWR,3
ZLWKPGHWDFKDEOHFDEOHDQG('HOHFWURGH0HQXGULYHQZLWKDOSKDQXPHULF
GLVSOD\ $XWR VWRUDJH RI WLPH DQG GDWH RI ODVW FDOLEUDWLRQ IRU */3 56&
LQWHUIDFHDQGPHPRU\IRUUHDGLQJVRIGDWDWLPHDQGGDWHIRU1RWHSDGUHVXOWV
FROOHFWLRQRUIRU$XWR/RJUHVXOWVFROOHFWLRQZLWKORJJLQJLQWHUYDOVEHWZHHQPLQ
K5HFKDUJHDEOH1L0+EDWWHU\JLYHVXSWRKRSHUDWLRQ6XSSOLHGZLWK
GRZQORDGVRIWZDUHFKDUJHUDQGVROXWLRQV
1=
0HDVXUHVGLVVROYHGR[\JHQLQPJ/RUSHUFHQWVDWXUDWLRQ5DQJHLVaPJ/
UHVROXWLRQLVPJ/DFFXUDF\LVPJ/3URYLGHVVLPXOWDQHRXVUHDGLQJVRI
O & O&'LVVROYHG2UHDGLQJVDUHDXWRPDWLFDOO\FRPSHQVDWHGIRUWHPSHUDWXUH
2IIHULQJSXVKEXWWRQFDOLEUDWLRQZLWKDEXLOWLQFDOLEUDWLRQFKDPEHUGLUHFWVDOLQLW\
DQGDOWLWXGHFRPSHQVDWLRQ6XSSOLHGZLWKPFDEOHWRSUREH
<6,$'LVVROYHG2[\JHQ0HWHUZLWKIW&DEOH
<6,$
1=
+DQGKHOGPLFURSURFHVVRUEDVHGGLVVROYHGR[\JHQPHWHUIRUXVHLQIUHVKZDWHU
VHD ZDWHU RU SROOXWHG ZDWHU 5DQJH aPJO UHVROXWLRQ LV RU $LU
VDWXUDWLRQUDQJHLVaUHVROXWLRQLVRUDLUVDWXUDWLRQ7HPSHUDWXUH
UDQJHLVƒ&aƒ&UHVROXWLRQLV)HDWXUHV6HOIGLDJQRVWLFVRQSRZHUXS
&RPSHQVDWLRQIRUDOWLWXGHVDOLQLW\WHPSHUDWXUHZDWHUSURRIWR,3SXVKEXWWRQ
FDOLEUDWLRQEXLOWLQFDOLEUDWLRQFKDPEHU2YHUKDONDOLQHEDWWHU\OLIHDWƒ&
6XSSOLHGZLWKPSUREHOHDG
<6,S+6DOLQLW\DQG&RQGXFWLYLW\0HWHU
<6,
1=
0HDVXUHV WHPSHUDWXUH S+ FRQGXFWLYLW\ DQG VDOLQLW\ 5DQJHV DUH aS+
UHVROXWLRQFRQGXFWLYLW\LVaP6FPRYHUUDQJHVVDOLQLW\LVaSSW
UHVROXWLRQWHPSHUDWXUHLVaO&UHVROXWLRQ6WRUHVUHDGLQJVZLWK
,' XVHUVHOHFWHG VFDOH RU DXWRUDQJLQJ IRU FRQGXFWLYLW\ 6XSSOLHG ZLWK D P
FDEOHWRSUREH
+RULED80XOWLIXQFWLRQ:DWHU4XDOLW\0HWHU
+258;'
$8
0XOWLSDUDPHWHUZDWHUTXDOLW\PRQLWRUZLWKPFDEOH:DWHUSURRI0HWHUXQLWUDWHG
WR,3ZLWK/&'GLVSOD\DQDORJRXWSXWDQG56&LQWHUIDFHIRUGDWDGRZQORDG
XVLQJVRIWZDUHVXSSOLHG'HWDFKDEOHSUREHPP‘ZLWKVWDLQOHVVVWHHOFRYHU
VXLWDEOH IRU XVH LQ PP ZHOOV ZLWK VHQVRUV IRU S+253 GLVVROYHG R[\JHQ
FRQGXFWLYLW\VDOLQLW\7'6VHDZDWHU VSHFL¿F JUDYLW\ WHPSHUDWXUH WXUELGLW\ DQG
GHSWK'DWDORJJLQJXSWRP#PLQLQWHUYDOV$ONDOLQHEDWWHU\RSHUDWLRQ
118
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Test & Measurement
General Environment
Electrochemistry, Water Quality (cont’d)
+\GURODE4XDQWD0XOWLSUREH:DWHU4XDOLW\0HWHU
+<'4703$
$QDOLWH1(37XUELGLW\0HWHU
$8
0XOWLSDUDPHWHUZDWHUTXDOLW\DQDO\VHUZLWKPFDEOH0HWHUXQLWUDWHGWR1(0$
ZDWHUSURRIZLWKVLPXOWDQHRXVSDUDPHWHUGLVSOD\UHDOWLPHPDQXDOVWRUDJHRI
IUDPHVRIGDWDDQG6',LQWHUIDFH7UDQVPLWWHUSUREHZLWKVDPSOHFLUFXODWRU¿WWHG
ZLWKVHQVRUVIRUWHPSHUDWXUHVSHFL¿FFRQGXFWDQFHVDOLQLW\GLVVROYHGR[\JHQS+
253DQGWXUELGLW\2SHUDWHVRQ[&VL]HEDWWHULHV
$1$1(3
1=
3RUWDEOH WXUELGLW\ PHWHU VXLWDEOH IRU SRWDEOH RU ZDVWH ZDWHU PHDVXUHPHQWV
GHSHQGLQJ RQ WKH SUREH W\SH 6XSSOLHG ZLWK HLWKHU 1(3 a178
ZDVWHZDWHUUHWURVFDWWHUSUREHRQDPFDEOHRU1(3a178SRWDEOH
ZDWHUSUREHZLWKPFDEOH'LVSOD\UHVROXWLRQIRUWKH1(3SUREHLV178
1(3SUREHLV1785HSHDWDELOLW\LV“GLJLWRQDOOUDQJHV'DWDORJJLQJ
XSWRWLPHGDWHVWDPSHGUHDGLQJVZLWKVDPSOHLQWHUYDOVIURPVaPLQ
$QDORJXHRXWSXWZLWKDUDQJHRIa9IVRQDQ\UDQJH56&LQWHUIDFHZKLFK
FDQRXWSXWUHDGLQJVRQUHTXHVWRUDWSUHVHWLQWHUYDOVIURPaVRUPLQ
'..72$0RGHO5&33RUWDEOH5HVLGXDO&KORULQH0HWHU
'..5&3'3
$8
3RUWDEOH GLUHFWUHDGLQJ UHVLGXDO FKORULQH PHWHU IRU ZDWHU DQDO\VLV 5DQJH
aPJ/>[email protected]ÀRDWDQG
VDPSOHFRQWDLQHUIRULQVLWXRUJUDEVDPSOLQJ&RPSDWLEOHZLWKGLUHFWFKORULQDWLRQ
K\SRFKORULWHRUGLFKORURLVRF\DQXUDWHGRVLQJ&DOLEUDWLRQGDWDVWRUHGLQHOHFWURGH
ZLWKFRUUHODWLRQZLWK'3'PHWKRGV:DWHUSURRIWR,3,62YDOLGDWLRQIXQFWLRQV
VWRUDJHRIPHDVXUHPHQWVDQG56SULQWHURXWSXW%DWWHU\RSHUDWHG
$TXDÁXRU+DQGKHOG)OXRULPHWHUIRU5KRGDPLQH:7)OXRUHVFHLQ
785$4)5)
736:DWHU4XDOLW\0HWHU
736)/7
$8
)LHOG PHWHU DQG ORJJHU IRU ZDWHU TXDOLW\ PHDVXUHPHQWV &RQILJXUHG ZLWK
LQGHSHQGHQW SUREHV IRU S+ FRQGXFWLYLW\VDOLQLW\>7'[email protected] GLVVROYHG
R[\JHQ>'[email protected]\&DEOHVPZLWKSUREHKROGHUDQGVDIHW\KDUQHVV/&'
GLVSOD\UHDGRXWZLWKVLPXOWDQHRXVGLVSOD\RIDOOPHDVXUHPHQWV0DQXDO³QRWHSDG´
VWRUDJHRUDXWRPDWHGGDWDORJJLQJIRUXSWRVHWVRIUHDGLQJVE\WLPHDQGGDWH
56&LQWHUIDFHZLWK:LQ736VRIWZDUHLQFOXGHG6XSSOLHGZLWKUHFKDUJHDEOH
EDWWHU\DQGFOLSOHDGIRURSHUDWLRQIURPD9VRXUFHVXFKDVDFDUEDWWHU\
$8
'XDOFKDQQHOKDQGKHOG¿HOGÀXRULPHWHU&RQ¿JXUHGIRUZDWHUWUDFLQJE\GHWHFWLRQ
RIUKRGDPLQH:7DQGÀXRUHVFHLQG\HVGHWHFWLRQOLPLWaSSE5:7FKDQQHO
H[FLWDWLRQ QP HPLVVLRQ !QP )OXRUHVFHLQ FKDQQHO H[FLWDWLRQ QP
HPLVVLRQ QP ,QWHUQDO GDWD ORJJLQJ IRU GDWD SRLQWV ZLWK GRZQORDG
%DWWHU\RSHUDWHG
6SHFWURQLF+HOLRV(SVLORQ6SHFWURSKRWRPHWHU9LVLEOH
689(36,/21
+DQQD3RUWDEOH7XUELGLW\0HWHUZLWK&DVH.LW
+$1+,&
$8
0LFURSURFHVVRUEDVHGSRUWDEOHWXUELGLW\PHWHURSHUDWLQJLQWKHUDQJHa)78
[)78RUa)78[)78178/RQJOLIH,5/('VRXUFHSHDNLQJDW
QPIRUUHGXFHGFRORXULQWHUIHUHQFH&RPSOLDQWZLWK,62UHTXLUHPHQWV
8QLTXH*/3IHDWXUHDOORZVDXWRPDWLFVWRUDJHDQGUHFDOORIODVWFDOLEUDWLRQYDOXHZLWK
WLPHDQGGDWH6XSSOLHGLQFDUU\FDVHZLWKPHDVXULQJFXYHWWHVDQGPDLQWHQDQFH
NLW%DWWHU\RSHUDWLRQ
$8
6LQJOH EHDP YLVLEOH VSHFWURSKRWRPHWHU aQP ZLWK QP EDQGZLGWK
RSHUDWLQJ LQ WKH UDQJH a$ :LGH YLHZDQJOH /&' GLVSOD\ DQG VHDOHG
PHPEUDQHNH\SDGZLWKSXVKEXWWRQDXWR]HUR6HDOHGRSWLFVZLWKZDYHOHQJWK
VOHZ!QPPLQ2SHUDWLRQDOPRGHVDEVRUEDQFHWUDQVPLVVLRQFRQFHQWUDWLRQ
DQGIDFWRU6XSSOLHGZLWKVWDQGDUGFHOOKROGHUIRUPPVTXDUHFHOOV56&
SRUWIRUFRPSXWHUDQGSDUDOOHOLQWHUIDFHIRUSULQWHU
9DQ(VVHQ'HSWK7HPSHUDWXUH*URXQGZDWHU/RJJHU0
9$17'
$8
*URXQGZDWHUGHSWKDQGWHPSHUDWXUHORJJHUIRURSHUDWLRQWRP,QGHSHQGHQW
SUREHPP‘[PPORQJZLWKLQWHUQDOPHPRU\IRU[PHDVXUHPHQWV
EDWWHU\OLIH a\ 5HDGHU IRU VHWXS DQG GRZQORDG RI GDWD XVLQJ VWDQGDUG
FRPSXWHU6XSSOLHGZLWK³%DUR'LYHU´DPELHQWVXUIDFHORJJHUIRUDWPRVSKHULF
SUHVVXUHFRUUHFWLRQ
,VFR6HULHV:DWHU6DPSOHUZLWK%XEEOHU)ORZ0RGXOH
,6.
$8
$GYDQFHGZDWHUVDPSOHUIRUIXOO\SURJUDPPHGFROOHFWLRQ6DPSOHVFDQEHFROOHFWHG
LQRUJODVVRUSODVWLFVDPSOHFRQWDLQHUVEDVHGRQWLPHÀRZDQGRU
SDUDPHWHUVHWSRLQWV)LWWHGZLWK1(0$;,3VHDOHGFRQWUROOHUIHDWXULQJDQ
H[FOXVLYHEXLOWLQSXPSÀDVKPHPRU\IRUHDV\SURJUDPPLQJFKDQJHVDQGDSOXJ
LQPRGXOHSRUWIRUFRQQHFWLRQRIDÀRZPHWHUPRGXOHRUSDUDPHWHUPHDVXUHPHQW
PRGXOHWRHQKDQFHPRQLWRULQJFDSDELOLWLHV3URYLGHGZLWKEXEEOHUÀRZPRGXOH
6DPSOHERWWOHVDYDLODEOH5XQIURPUHFKDUJHDEOH9VHDOHGEDWWHULHV
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 119
Laboratory
Test & Measurement
Spectroscopy
Shimadzu UV-Mini 1240 Spectrophotometer UV-Visible
SHI,UV-1240
X-Rite SP60 Portable Sphere Colour Spectrophotometer
AU
Single beam scanning UV-visible spectrophotometer, 190~1,100nm with 5nm
bandwidth. Large LCD display for on-screen viewing of results, calibration curves
and spectra. Standard applications include photometric measurement, spectrum
scanning and quantitation. IC data card system for storage of raw data, methods
and results, with optional program packs for additional applications. Interface
ports for printer or computer. 220~240V, 50/60Hz.
Spectronic Helios Epsilon Spectrophotometer Visible
SUV,EPSILON1
AU
XRI,SP60
Single beam visible spectrophotometer, 325~1,000nm with 8nm bandwidth,
operating in the range -0.1~2.5A. Wide view-angle LCD display and sealed
membrane keypad with push button auto-zero. Sealed optics, with wavelength
slew >4500nm/min. Operational modes absorbance, transmission, concentration
and factor. Supplied with standard cellholder for 10mm square cells. RS232C
port for computer and parallel interface for printer.
Materials Testing
Hydramotion Viscolite 700 Portable Viscometer
HYL,V700S-21
AU
Advanced portable viscometer with stainless-steel probe. Operating range
0.1~10,000mPaps (cps) with integral temperature correction -40~150ºC. Probe
tip 21mmØ, immersion length 115mm (viscosity only) or 145mm (viscosity/
temperature). Acetal polymer probe base for handheld or clamped operation, with
coiled-cable connection to meter unit with 5 digit display. Battery powered.
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional fee you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected occurences - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
120
AU
Portable spectrophotometer for surface colour measurements. Diffuse 8O [d/8]
RSWLFDOJHRPHWU\ZLWK¿[HGPPDSHUWXUH7XQJVWHQVRXUFHIRULOOXPLQDQWW\SHV&
D50, D65, D75, A, F2, F7, F11 & F12. Standard observers 2 & 10O. Blue-enhanced
photodiode detectors with spectral range 400~700nm. Measures opacity and
colour by chromatic, apparent or tristimulus calculation, with simultaneous included
DQGH[FOXGHGVSHFXODUFRPSRQHQWDQGVSHFWUXPDWQPLQWHUYDOV6WRUDJHRIXS
to 2,000 samples with results download to serial printer or computer. Operation
from internal rechargeable battery or ac adaptor.
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Audio Visual
Audio Visual
Ż1(:Ż
+\XQGDLµ+LJK5HVROXWLRQ3ODVPD6FUHHQ
+<83/$60$,1&+
´FPZLGHVFUHHQSODVPD79ZLWKEXLOWLQGXDO+'79WXQHU5HVROXWLRQ
3&[XSWR+]+'793$/%*'.,6(&$0//9DULDEOHDVSHFW
UDWLRQRUPDOZLGHDXWRZLGHSDQRUDPD]RRP3L[HOSLWFK[
%ULJKWQHVVFGP&RQWUDVWUDWLR
LEC Portable Lectern
LEC,PORTABLE LECTERN
/HFWHUQDPSOL¿HUGHVLJQHGIRUVSHHFKWHDFKLQJDQGPHHWLQJ,QFOXGHV:UPV
DPSOL¿HU DQG FROXPQ VSHDNHU ,QFRUSRUDWHV [ JRRVHQHFN PLFURSKRQH [
ODPS[DX[LQSXWIRUUDGLR/HIWULJKWVSHDNHUVFDQEHDGGHGWRDPSOL¿HU
2SWLRQDOFDQRSHUDWHRQ[VL]H'EDWWHULHV
Ż1(:Ż
+\XQGDL3ODVPD6WHUHR6SHDNHUV
+<83/$60$63($.(56
3ODVPDVWHUHRVSHDNHUV
0LSUR3RUWDEOH3$6\VWHP
0,33257$%/(3$
:UPVKLJK¿GHOLW\DQGKLJKHI¿FLHQF\SRZHURXWSXW&OHDUDQGQDWXUDOVRXQG
IURPKLJKHI¿FLHQF\IXOOUDQJHVSHDNHUV\VWHP)HDWXUHVPHWLFXORXVFLUFXLWGHVLJQ
OLJKWZHLJKWDQGFRPSDFWVL]HVWUXFWXUHH[FHOOHQWSHUIRUPDQFHFOHDUDQGSRZHUIXO
VRXQG%XLOWLQVSHDNHUVWDQGDGDSWRUDOORZVIRUWULSRGDVVHPEO\5HWUDFWDEOH
FDUU\KDQGOHDQGORZHUZKHHOVHQVXUHHIIRUWOHVVWUDQVSRUWDWLRQ%XLOWLQVWRUDJH
FRPSDUWPHQWIRUPLFURSKRQHVVSDUHEDWWHULHVDQGRWKHUDFFHVVRULHV$ZLUHG
PLFURSKRQHZLUHOHVVPLFURSKRQHV&'DQGFDVVHWWHSOD\HUDQGRWKHUDXGLR
VRXUFHVFDQEHPL[HGVLPXOWDQHRXVO\WRWKHLQSXW(TXLSVDGYDQFHGGXDOFKDQQHO
8+)9+)GLYHUVLW\UHFHLYHUPRGXOHIRUORQJUDQJHUHFHSWLRQDQGIUHHIURPVLJQDO
GURSRXWVDQGLQWHUIHUHQFHV%XLOWLQDQWHQQDGHVLJQHOLPLQDWHVLQFRQYHQLHQFHDQG
EUHDNDJH%XLOWLQXQLYHUVDODSSURYHGVZLWFKLQJSRZHUVXSSO\DQGEXLOWLQGXDO
EDWWHU\FKDUJHUHQVXUHKFRQWLQXRXVRSHUDWLQJSHUKFKDUJH6XLWVYHUVDWLOH
PRELOLW\DSSOLFDWLRQV[ZLUHOHVV8+)KDQGKHOGPLFURSKRQH+HDY\GXW\VWDQG
RSWLRQDO
UT810 Lapel Radio Microphone
/$30,&
/DSHOUDGLRPLFURSKRQHNLW
Ż1(:Ż
Microphone Desk Stand
0,&'(6.67$1'
1(&µ/&''LVSOD\0RQLWRU
1(&/&'
[UHVROXWLRQLQSXWVIRU;*$69LGHRDQGYLGHR6XSHUZLGHDQJOH
YLHZLQJDQGFRQWUDVWUDWLRRIIRUKLJKDPELHQWOLJKWLQJFRQGLWLRQV
:DOOPRXQWIRU1(&/&'µ'LVSOD\
1(&/&':$//02817
:DOOPRXQWLQJEUDFNHWWRVXLW1(&/&'1RWH0XVWEH¿[HGWRDZDOOFDSDEOH
RIVXSSRUWLQJ!NJ
Ż1(:Ż
(SVRQ(03$16,/XPHQ/&'3URMHFWRU
(36(03
0LSUR3$+HDY\'XW\6WDQG
0,33$67$1'
8VHGZLWK0LSUR3RUWDEOH3$
'HVNWRSYLGHRSURMHFWRULVSHUIHFWIRUWUDLQLQJVHPLQDUVRUFRQIHUHQFHURRPV
)HDWXULQJ KLJK EULJKWQHVV ORZ IDQ QRLVDH DQG DGYDQFH LPDJLQJ WHFKQRORJLHV
;*$[$16,OXPHQVFRQWDVWUDWLR
Ż1(:Ż
(SVRQ(033URMHFWRU
(36(03
,QFUHGLEOHEULJKWQHVVWRZHLJKWUDWLR$16,OXPHQV/LJKWZHLJKWNJ4XLFN
VWDUWXSDQGVKXWGRZQIRURQWKHJRSUHVHQWDWLRQV3DVVZRUGSURWHFWVHFXULW\
GXUDEOHFDUU\EDJDQGVXSHULRU/&'WHFKQRORJ\
3OXV&RUSRUDWLRQ8'DWD9LGHR3URMHFWRU
3/68
8OWUDSRUWDEOHGDWDYLGHRSURMHFWRUZLWK$16,OXPHQVRXWSXW[SL[HO
UHVROXWLRQ PDQXDO IRFXV QR ]RRP : OLJKW VRXUFH PLOOLRQ FRORXUV
SURMHFWLRQGLVWDQFHVaPLPDJHVL]H´a´GLDJRQDOLQSXWV5*%6
9LGHRFRPSRVLWHYLGHRDXGLRPLQLMDFNZHLJKVNJUHPRWHFRQWURO6XSSRUWV
176& 176& 3$/ 3$/0 3$/1 3$/ DQG 6(&$0 YLGHR IRUPDWV
+RUL]RQWDOV\QFKaN+]YHUWLFDOV\QFKa+]
122
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Audio Visual
Audio Visual (cont’d)
3OXV&RUSRUDWLRQ8$16,/XPHQ3URMHFWRU
3/68
[UHVROXWLRQGDWDYLGHRSURMHFWRUZLWK$16,OXPHQRXWSXWaPP
]RRPOHQVPLOOLRQFRORXUVZLOOSURMHFWIURPUHDUIURQWFHLOLQJWDEOHSRVLWLRQV
aP SURMHFWLRQ GLVWDQFH ZLWK GLDJRQDO LPDJH VL]H IURP aP 5*%
LQSXWV 6;*$ FRPSUHVVHG ;*$ WUXH 69*$9*$ H[SDQVLRQWUXH YLGHR
LQSXWV 176& 176& 3$/ 6(&$0 KRUL]RQWDO V\QF aN+] YHUWLFDO
V\QFa+]:PRQRDXGLR'LPHQVLRQVZ[G[KPP:HLJKV
NJ5HPRWHFRQWUROODVHUSRLQWHUDQGFDEOHVWRVXLWPRVWFRPSXWHUDQGYLGHR
RXWSXWV
Ż1(:Ż
9LGHRORJLF&KDQQHO6SHDNHUV
9,'63($.(56&+
3URYLGHV SOD\EDFN IURP VRXUFHV E\ XVLQJ LWV EXLOWLQ XSPL[LQJ IHDWXUH
6XU)(6XUURXQG)LHOG(QKDQFHPHQWLGHDOIRUXVHZLWKDVRXQGFDUG
7($&9+69LGHR3OD\HUZLWKµ6FUHHQ
7(&9+679
7RVKLED%&RPSDFW'DWD9LGHR3URMHFWRU/XPHQV
&RPELQDWLRQ9+6YLGHRSOD\HUZLWK´PRQLWRU)HDWXUHVERWK176&DQG3$/
SOD\EDFNFDSDELOLW\DQGIXOOIXQFWLRQUHPRWHFRQWURO&RPSRVLWH20326,7(YLGHR
LQSXWDQGRXWSXWYLD%1&
7267/3%
9LHZPDVWHU'9'&KDQQHO3OD\HU
[UHVROXWLRQPDQXDO]RRPIRFXVSURMHFWLRQGLVWDQFHaP:
8+3ODPSFRQWUDVWUDWLRLQSXWVLQFOXGH[5&$YLGHR[69LGHR[
VWHUHRDXGLRPLQLMDFN[5*%'VXESLQ56&PLQL',1176&3$/
6(&$0LQWHJUDO:VSHDNHUZHLJKVNJ
7RVKLED7/370$16,/XPHQV3URMHFWRU
7267/370
/LJKW RXWSXW $16, OXPHQ aPP ]RRP OHQV P PD[ GLVWDQFH
´PD[VFUHHQVL]HUHVROXWLRQ;*$[DXWRNH\VWRQHDGMXVWPHQW
3$/ 6(&$0 176& +'79 '9' 9&5 UHPRWH FRQWURO LQSXWV IRU FRPSXWHU
69LGHR9LGHR$XGLRDQGSDVVWKURXJKWRPRQLWRU56:LQWHJUDOVSHDNHU
:HLJKVNJ
7RVKLED7/30$16,/XPHQV'DWD3URMHFWRU
7267/30
/LJKWRXWSXW$16,OXPHQaPP]RRPOHQVPHWHUPD[GLVWDQFH
´PD[VFUHHQVL]HUHVROXWLRQ;*$[DXWRNH\VWRQHDGMXVWPHQW
3$/ 6(&$0 176& +'79 '9' 9&5 UHPRWH FRQWURO LQSXWV IRU FRPSXWHU
69LGHRYLGHRDXGLRDQGSDVVWKURXJKWRPRQLWRU56:LQWHJUDOVSHDNHU
:HLJKVNJ
9:0'9'$%.%
'9'SOD\HUUHPRWHFRQWURONDUDRNHIXQFWLRQVXUURXQGVRXQG¿HOGVEDQG
GLJLWDOHTXDOLVHUFRPSDWLEOHZLWK'9'6XSHU9&'9&'03&'%XLOWLQ'ROE\
'LJLWDODFGHFRGHUDQGVHSDUDWHFKDQQHORXWSXWV
/LWHRQ/9:'9'5HFRUGHU
/,7'9'5(&25'(5
'9'UHFRUGHUZLWK*%+''5HFRUGVRQWR+'''9'55:'9'55:
&'55:3OD\VEDFN'9'69'&9&'$XGLR&'03*'$703:0$
:$9-3(*DQG%03
:LQWHO'9'3OD\HU
:,1'9'3/$<(5
)XOO\FRPSDWLEOHZLWK'9'69&'9&''9&'032.2&'&'5:DQG
+'&'.RGDN3LFWXUH0RGH&&KDQQHOGHFRGHUEXLOWLQ'RXEOH'76
GHFRGHU &RD[LDO)LEUH 2SWLFDO69+65*% YLGHR RXWSXW 3URJUHVVLYH 6FDQ
0XOWLDQJOHODQJXDJHVDQGVXEWLWOHVN+]ELWGLJLWDODXGLEOHIUHTXHQF\
ELW9LGHR'$&OLQHVKLJKUHVROXWLRQSLFWXUHTXDOLW\RUSLFWXUH
SDQVFDQOHWWHUER[RUZLGH)XOOGLJLWDONDUDRNH)URQWSDQHOJROGSODWHGGXDOPLF
LQSXWZLWKHFKRDQGPLFYROXPHFRQWUROOHU0XOWLIXQFWLRQUHPRWHFRQWURO
(SVRQ(03$16,/XPHQV'DWD3URMHFWRU
(36(03
7RVKLED7'37'/3$16,/XPHQ'DWD3URMHFWRU
7267'37
/LJKWRXWSXW$16,OXPHQ[SL[HOUHVROXWLRQFRQWUDVWUDWLR
WRPHWHUSURMHFWLRQGLVWDQFHUDQJHUHPRWHFRQWURO[5&$YLGHRLQ[
6YLGHRLQ[3&LQ[VWHUHRPLQMDFNDXGLRLQ[5&$DXGLRLQ[5*%LQ
:HLJKVDSSUR[.JLQFDUU\EDJ
3URMHFWLRQGLVWDQFHaP:LGH[]RRPUDWLR&RQWUDVW.H\VWRQH
FRUUHFWLRQUDWLRUHVROXWLRQ;*$[
3$/6(&$0176&+'799&5DQG'9'UHPRWHFRQWURO&RQQHFWLYLW\[3&LQ
SRUWV[9LGHRLQSRUWV2XWSXWSRUWVDXGLRPRQLWRU(WKHUQHW/$1SRUW
ZDWWEXLOWLQVSHDNHU:HLJKVNJ
3URMHFWLRQ6FUHHQ
'$/6&5((1
0DWWHZKLWHSRUWDEOHWULSRGVFUHHQVXLWDEOHIRUPHGLXPVL]HDXGLHQFHYLHZLQJRI
GDWDRUYLGHRSURMHFWLRQ
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 123
Business Equipment
Scanners
Scanners - Film & Flatbed
Ż1(:Ż
&DQRQ3DJH&RORXU'RFXPHQW6FDQQHU'XSOH[
&$1'2&6&$1&
SDJHGXSOH[FRORXUGRFXPHQWVFDQQHU&RPHVZLWKIXOOYHUVLRQ$GREH$FUREDW
&DQRQ&DQRVFDQ)6PP)LOP6FDQQHU
&$16&$1)6
PP VOLGH DQG VWULS ¿OP VFDQQHU ZLWK UHVROXWLRQ RI GSL VFDQQLQJ SL[HOV
[6&6,LQWHUIDFHELWVFDQQLQJIRUHDFKFRORXU5*%,QFOXGHV
$GDSWHF3&,6&6,FDUGSLQKLJKGHQVLW\6&6,FDEOHSLQKLJKGHQVLW\[
6&6,SOXJFRQYHUWHU'VXESLQSLQKLJKGHQVLW\PP¿OPKROGHU$63
¿OPYLHZHUDQG$GREH3KRWRVKRS/(3&0DF
&DQRQ'5+LJK6SHHG'RFXPHQW6FDQQHU
&$1'5
&DSDEOHRISDJHVSHUPLQXWHVFDQQLQJDXWRPDWLFRUPDQXDOVLPXOWDQHRXV
VKHHWIHHGLQJVLPXOWDQHRXVVLGHGVFDQQLQJ6&6,,,LQWHUIDFH
0LQROWD(OLWH)LOP6FDQQHUGSL
0,16&$1(/,7(
ELW$'&RQYHUVLRQ$XWRORDGLQJFRQWLQXRXVVFDQQLQJIRUPXOWLSOHIUDPHV)LOP
W\SHFRORUEZQHJDWLYHSRVLWLYH$XWRPDWLFLPDJHFRUUHFWLRQZLWK$XWR'XVW
%UXVK3L[HO3ROLVK86%LQWHUIDFH6RIWZDUH$GREH3KRWRVKRS(OHPHQWV
VFDQQLQJVRIWZDUH
&DQRQX$VFDQQHU[GSL
&$16&$118
$ÀDWEHG[GSLVFDQQHUZLWK86%LQWHUIDFH
&DQRQ)66OLGH6FDQQHU
&$16&$1)6
6OLGHVFDQQHUGSL)LOPW\SHVPPFRORXUVOLGHVSRVLWLYHVQHJDWLYHV
PRQRFKURPHSRVLWLYHVQHJDWLYHVPRXQWHGVOLGH¿OP¿OPVWULS,QWHUIDFH86%
DQG6&6,:LOORSHUDWHRQ:LQGRZV0DFLQWRVK3DFNDJHLQFOXGHVVOLGH
PRXQWKROGHUPP¿OPVWULSKROGHU,[¿OPFDUWULGJHKROGHU6RIWZDUH$GREH
3KRWRVKRS/($UF6RIW3KRWR%DVHDQG3KRWR5HFRUG
Video Cameras - Digital
6RQ\759('LJLWDO9LGHR&DPHUD
3DQDVRQLF19'6'LJLWDO9LGHR&DPFRUGHU
61<759(
36&19'6
0LQL'9ZLWK&DUO=HLVVOHQV´WRXFK/&'VFUHHQUHPRWHFRQWUROPHPRU\VWLFN
FRPSDWLEOHPHPRU\VWLFNQRWLQFOXGHG86%FDEOH$9FDEOHHOHFWURQLFVXSHU
VWHDG\VKRWQLJKWVKRW]RRP[GLJLWDO[RSWLFDOEXLOWLQVSHDNHU
3DQDVRQLF*6&&''LJLWDO9LGHR&DPHUD
36&9,'*6
0EVWLOOSLFWXUHUHFRUGLQJRQ0E6'FDUG;RSWLFDO;GLJLWDO]RRP
/HLFD'LFRPDU/HQV´/&'GLVSOD\'LJLWDOYLGHRDQGVWLOOSLFWXUHVLPXOWDQHRXV
UHFRUGLQJ&RORXU1LJKW9LHZZLWK/LJKW3DQHO/X[5HPRWHZLWKQDUUDWLRQPLF
'9DQDORJXHLQSXWWKHFDPHUDKDVWHUPLQDOVLQERWK$9PLQL¿UPDWDQG'9IRUPDW
,((($QDORJXHLQSXWDOORZVWUDQVIHULQJIURPDQDORJXHYLGHRVWRGLJLWDOWDSH
86%)XOO6SHHG0RGH&DPHUDVHQVLWLYLW\,62$XWR
0D[DSHUWXUHIZLGHDQJOHaIWHOHSKRWR;RSWLFDOPDQXDO]RRP%XLOWLQ
ÀDVK&RORU/&'YLHZ¿QGHUDQGRSWLFDOYLHZ¿QGHU&RPSDFWÀDVKFDUG0E
%DWWHULHV[$$1L0+DQGUDSLGFKDUJHU9LGHRRXWSXW176&DQG3$/
&DQRQ9LGHR&DPFRUGHU09,
&$19,'(209,
:LWK3&0GLJLWDOVRXQGDWaELWRUaELWGXDOWDSHVSHHGV63/3IaI
OHQVZLWK;SRZHU]RRP;GLJLWDO]RRP77/DXWRIRFXVPD[VKXWWHUVSHHG
VPLQLOOXPLQDWLRQO[5HFRPPHQGHGLOOXPLQDWLRQPRUHWKDQO[´
/&'VFUHHQLPDJHVWDELOL]HUDQGGLJLWDOSKRWRPRGHZLWKXSWRVKRWVRQYLGHR
FDVVHWWH¿QHLPDJHVRQWKHVXSSOLHG0EPXOWLPHGLDFDUG
&DQRQ09,'LJLWDO9LGHR&DPHUD
&$19,'(209,
:LWK3&0GLJLWDOVRXQGDWELWRUELWGXDOWDSHVSHHGV63/3II
OHQVZLWK;SRZHU]RRP;GLJLWDO]RRP77/DXWRIRFXVPD[VKXWWHUVSHHG
VHFPLQLOOXPLQDWLRQO[5HFRPPHQGHGLOOXPLQDWLRQPRUHWKDQO[
´/&'VFUHHQLPDJHVWDELOL]HUDQGGLJLWDOSKRWRPRGHZLWKXSWRVKRWVRQ
YLGHRFDVVHWWH¿QHLPDJHVRQWKHVXSSOLHG0EPXOWLPHGLDFDUG
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 125
Business Equipment
Cameras & Accessories
Still Cameras - Digital
Ż1(:Ż
$UFKRV$9/LSVWLFN&DPHUD
ARC,AV500-CAM
High resolution mini-cam. Built-in remote with microphone, CCD sensor – low
light sensitivity. Record directly into MPEG-4 (Require AV 500).
&DQRQ(26'0HJDSL[HO6/5'LJLWDO6WLOO&DPHUD
CAN,EOS-300D
6.3 megapixel AF/AE SLR camera, with EF-S lens 18 - 55mm zoom & aperture
UDQJHII7)7LQFKFRORU/&'GLVSOD\EXLOWLQÀDVKKRWVKRHIRU
H[WHUQDOÀDVK0EFRPSDFWÀDVKFDUGGHSWKRI¿HOGSUHYLHZEXWWRQ[
selectable AF points, ISO range 100 - 1600, 3 x metering modes: evaluative,
average, spot, 5 x exposure modes: auto, program, shutter priority, aperture
priority & manual, USB 2 card reader. Full range of Canon EF lenses are suitable for this camera.
Ż1(:Ż
$UFKRV$90RELOH'LJLWDO9LGHR5HFRUGHU*E
ARC,AV500
Direct TV recording and video, photo and music on the go on a 4” color screen,
100Gb hdd, easy setup pod for TV recording & video playback, control your VCR,
cable or satellite receiver. Record directly to TV or make scheduled recordings,
photo wallet & music player . Stores up to 400h of video, 250 movies or 1 million
photos.
/DVWROLWHFROODSVLEOHUHYHUVLEOHEDFNGURS[P&1
LAS,BACKDROP-CN
Collapsible reversible (two color system) backgrounds with train, size 1.8m x
2.1m (6’ x 7’) with an extra 1.5m train. Backgrounds are portable and fold to
one third size in zip up bag. Colour code for this item = CN
/DVWROLWHFROODSVLEOHUHYHUVLEOHEDFNGURS[P)0
LAS,BACKDROP-FM
Lastolite collapsible reversible (two color system) backgrounds with train, size
1.8m x 2.1m (6’ x 7’) with an extra 1.5m train. Backgrounds are portable and
fold to one third size in zip up bag. Colour code for this item = FM
/DVWROLWHFROODSVLEOHUHYHUVLEOHEDFNGURS[P:8
LAS,BACKDROP-WU
Lastolite collapsible reversible (two color system) backgrounds with train, size
1.8m x 2.1m (6’ x 7’) with an extra 1.5m train. Backgrounds are portable and
fold to one third size in zip up bag. Colour code for this item = WU
Ż1(:Ż
$UFKRV$90RELOH'LJLWDO5HFRUGHU*Eµ/&'
ARC,AV700
Direct TV recording and video, photo and music on the go on a 7” color screen,
100Gb hdd, easy setup pod for TV recording & video playback, control your VCR,
Cable or Satellite receiver. Record directly to TV or make scheduled recordings,
photo wallet & music player. Stores up to 400h of video, 250 movies or 1 million
photos on the go.
0LQROWD'L0$*(L0HJDSL[HO'LJLWDO6WLOO&DPHUD
MIN,DIMAGE7
5.5 megapixel with ISO range through auto, 100, 200, 400 & 800. Max aperture:
IZLGHDQJOH IWHOHSKRWR ; RSWLFDO PDQXDO ]RRP EXLOWLQ ÀDVK FRORU
/&'YLHZ¿QGHUDQGRSWLFDOYLHZ¿QGHU&RPSDFWÀDVKFDUG0E%DWWHULHV
x AA Ni-MH and rapid charger. Video output: NTSC and PAL.
6LJPDPP)(;/HQV
SIG,50-500MM-F4-6.3E
&DQRQ'0HJDSL[HO3URIHVVLRQDO'LJLWDO&DPHUD
50-500mm f/4-6.3 APO EX Lens focal lengths from the 50mm “normal” to 500mm
ultra-telephoto; a 10:1 zoom ratio. For use with all Canon SLR & Digital SLR
cameras.
CAN,10D-PRO
Semi-professional SLR digital camera 6.3 megapixel CMOS sensor, 7 x selectable AF points, DIGIC (Digital Imaging Core) processor, simultaneous RAW
and JPEG processing with Canon EF lens 24-85mm zoom and aperture range
f3 5-4.5, 512Mb Compact Flash card, 1.8” LCD screen, ISO range 100~800,
3 x metering modes: evaluative, average, spot, 5 x exposure modes: auto,
program, shutter priority, aperture priority and manual, USB 2 card reader. Full
range of Canon EF lenses are suitable for this camera.
126
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Notebook Computers
Notebook Computers
Ż1(:Ż
$VXV30*+]*%5$0'/'9'%XUQHU
$6830*+=*%5$0
*+]*%''55$0*%'9'5:'/´:;*$:,),EJ
%OXHWRRWK,((([86%;33URQLF%XLOWLQFDUGUHDGHU
6'00&0&06352
&RPSDT1&*+]*E+''
&20(921&
´VFUHHQ0EVWDQGDUGPHPRU\'9'520&'5:FRPERGULYH,QWHJUDWHG
1,&0RGHP0E)''RSWLRQ0XOWLED\XQLW,QWHUFKDQJHVZLWKWKH'9'&'
5:'ULYH:LQ9LQ\O&DUU\%DJ
&RPSDT(923*+]*E+''
&20(92
Ż1(:Ż
$VXV01RWHERRN
$6830*+=0%
,QWHO 3HQWLXP 0 SURFHVVRU *+] &KLSVHW ,QWHO 30 ,&+0
:LQGRZV;33UR0%''56'5$0H[SDQGDEOHWR*E'LVSOD\7)7
´:;*$$7,0RELOLW\Œ5DGHRQŒ010%95$0+DUG'ULYH
'0$VXSSRUWHG*E2SWLFDO'ULYH;;;;;;;'9'
5:'9'5:[3&0&,$FRPSOLDQWN02'(0/$1RQERDUG
:L)L %* [ (33(&3 SDUDOOHO SRUW'VXE SLQ [ ,QIUDUHG SRUW
VXSSRUW,U'$9[79aRXW[KHDGSKRQHaRXWFRPERMDFN[PLFURSKRQHaLQ
MDFN[9*$SRUWPLQL'aVXEaSLQIRUH[WHUQDO''&PRQLWRU[86%
SRUWV[,(((SRUW$XGLR$&6:DXGLRZLWK'HIIHFWDQGIXOOGXSOH[
6RXQG%ODVWHU352FRPSDWLEOH%XLOWLQVWHUHRVSHDNHUDQGPLFURSKRQHDXGLR'-
RQWKHOHIWVLGH3OD\SDXVHVWRSIDVWIRUZDUGUHZLQG%DWWHU\SDFNOLIH/L,RQ
FHOOV9P$K:KUEDWWHU\SDFN6ZDSDEOHVHFRQGEDWWHU\VXSSRUW
XVLQJ2SWLFDO'ULYH%D\5XQGRZQOLIHKUVKUVZLWKWKHQG
EDWWHU\VXEMHFWWRGLIIHUHQWVSHFL¿FDWLRQV'LPHQVLRQVZHLJKWZ[G[
KPPNJZLWKWUDYHOOHU¶VGUDZHU
'LVSOD\ ´ &7)7 6;*$ GLVSOD\ ZLWK [ PD[ UHVROXWLRQ 0E
0+]6'5$00EPD['9'5203&,.9PRGHPLQWHJUDWHG
1,&[86%SRUWVSDUDOOHO5-5-69LGHR9*$LQIUDUHGPXOWLSRUW
$7,0RELOLW\5DGHRQELWJUDSKLFV0E''56'5$0ELWVWHUHRVRXQG
:LQGRZV;33523OHDVHQRWHXQLWGRHVQRWKDYH)''
+31;1RWHERRN3*+]*E+''
+3&203$41;
'LVSOD\´:;*$[0E[0E''56'5$00+]
'9'5:GULYH[86%SRUWVSDUDOOHOSRUW)LUHZLUHSRUW69LGHRSRUW
7\SH ,,, 3& &DUG SRUW 9*$ SRUW GRFNLQJ FRQQHFWRU SRUW KHDGSKRQHOLQH RXW
SRUW PLFURSKRQH LQ SRUW ,QWHJUDWHG . 9 PRGHP 1,& ,QWHO 3UR
LQWHJUDWHGEZLUHOHVV/$1%OXHWRRWKFHOO/LORQEDWWHU\DQGFDUU\EDJ
:LQ;33UR
Ż1(:Ż
6RQ\9DLR0*+=0%*%;*$'9'&'5:;33:,),
/$1
61<9$,29*1%*3
´;*$VFUHHQ*%0%30*+]'9'&'5:FRPER:,),EJ
1,&NPRGHP[86%[)LUHZLUH[3&0&,$:LQGRZV
;33DQGFDUU\EDJ
'HOO,QVSLURQ1RWHERRN30+]*E+''
'(/,163
0EPHPRU\'9'&'520GULYH´GLVSOD\NLQWHUQDOPRGHP1,&
[86%,((()LUHZLUH7UDFNSDGPLQLMR\VWLFN:LQ
)XMLWVX/LIH%RRN&3*+]*E+''
)8-/%22.3
'9'&'5:FRPERGULYH0E)''´7)7GLVSOD\3&0&,$SRUW[
86%SRUWV,((()LUH:LUHSRUWSDUDOOHOSULQWHUSRUW69*$PRQLWRURXWSXW
NH\ERDUGPRXVHSRUW7RXFK3DGLQWHJUDWHG9*$ZLWK'DFFHOHUDWRUDQG03(*
VXSSRUW1,&NPRGHP:LQ;33UR
)XMLWVX/LIH%RRN3*+]*E+''
)8-/%22.3
&DFKHNE0EPHPRU\PD[0E'9'&'5:FRPERGULYH0E
)''´7)7GLVSOD\3&0&,$SRUW[86%SRUWV,((()LUHZLUHSRUW
SDUDOOHO SULQWHU SRUW 69*$ PRQLWRU RXWSXW NH\ERDUGPRXVH SRUW 7RXFK3DG
LQWHJUDWHG ,QWHO 0* JUDSKLFV ZLWK ' DFFHOHUDWRU DQG 03(* VXSSRUW
1,&NPRGHP:LQ;33UR
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 127
Business Equipment
Notebook Computers
Notebook Computers (cont’d)
)XMLWVX/LIHERRN3*+=*%+''
)8-/%22.3
NEFDFKH0EPHPRU\PD[0E&'5:GULYH0E)''´
7)7 GLVSOD\ 3&0&,$ SRUW [ 86% SRUWV ,((( )LUH:LUH SRUW SDUDOOHO
SULQWHUSRUW69*$PRQLWRURXWSXWNH\ERDUGPRXVHSRUW7RXFK3DGLQWHJUDWHG
,QWHO0*JUDSKLFVZLWK'DFFHOHUDWRUDQG03(*VXSSRUW1,&N
PRGHP:LQ;33UR
7RVKLED6DWHOOLWH$1RWHERRN3*+]*E+''
7266$7$
3HQWLXP,9*+]SURFHVVRU0EPHPRU\*EKDUGGULYH'9'5:&'5:
GULYH´GLVSOD\[[86%69*$SRUWSDUDOOHOSRUW7UDFNSDG[
3&0&,$SRUW%OXH7RRWK:LQ;33
7RVKLED6DWHOOLWH$&*+]*E0E'9'
7266$7$&
'LVSOD\ ´ 7)7 2SWLFDO 'ULYH '9'&' 520 $XGLR VWHUHR VSHDNHUV
&RPPXQLFDWLRQVPRGHPHWKHUQHW%DWWHU\KFHOO3RZHUVXSSO\
:ZRUOGZLGHDFDGDSWRU.H\ERDUGNH\V'LPHQVLRQVZ[G[
KPP:HLJKWNJ6RIWZDUH:LQ;33URIHVVLRQDO63'ULYHUVIRUKDUGZDUH
'UDJµQ'URS&'
7RVKLED7HFUD61RWHERRN30*+]*E+''
7267(&5$6
7RVKLED7HFUD61RWHERRN30*+]*E+''
7267(&5$62));33
3HQWLXP0SURFHVVRURSHUDWLQJDW*+]*EKDUGGLVNGULYH'9'&'5:
GULYH0EPHPRU\H[SDQGDEOHWR*E´$FWLYH0DWUL[7)7FRORXUGLVSOD\
[ UHVROXWLRQ$7, 0RELOLW\ 5DGHRQ ' 0% JUDSKLFV ELW
DXGLR9NPRGHP(WKHUQHW(WKHUQHW,QWHJUDWHGZLUHOHVV
ODQDQWHQQDDELQWHJUDWHG%OXHWRRWKDQWHQQD5&$YLGHRRXW6'5$0
FDUGVRFNHW[3&0&,$VRFNHWV[86%SRUWVVHULDOSRUWSDUDOOHOSRUW36
SRUW6a9LGHRRXW69*$SRUWDXGLRLRSRUWVWRXFKSDGDQGDFFXSRLQWPRXVH
DQG:LQ;38SWRKEDWWHU\OLIH062I¿FH;33UROLFHQFHLQFOXGHG)''
RSWLRQDORQO\
7RVKLED7HFUD01RWHERRN30*+]*E+''
7267(&5$0
3HQWLXP0SURFHVVRURSHUDWLQJDW*+]*EKDUGGLVNGULYH'9'&'5:
GULYH0EPHPRU\H[SDQGDEOHWR*E´$FWLYH0DWUL[7)7FRORXUGLVSOD\
[UHVROXWLRQ$7,0RELOLW\5DGHRQ0%JUDSKLFVELWDXGLR9
N PRGHP (WKHUQHW ,QWHJUDWHG :LUHOHVV /$1$QWHQQD DE
LQWHJUDWHG %OXHWRRWK DQWHQQD 5&$ YLGHR RXW 6' 5$0 FDUG VRFNHW 6a9LGHR
RXW[3&0&,VRFNHWV[86%SRUWVVHULDOSRUW36SRUW69*$SRUWDXGLR
7RXFK3DGDQGDFFXSRLQWPRXVHDQG:LQ;33UR8SWRKEDWWHU\OLIH)ORSS\
GULYHVRSWLRQDORQO\
7RVKLED7HFUD6&HQWULQR*+]*E+''
7267(&5$6'9'5
1RWHERRNFRPSXWHUZLWK3HQWLXP0SURFHVVRURSHUDWLQJDW*+]*EKDUG
GLVNGULYH'9'&'5:GULYH*EPHPRU\´DFWLYHPDWUL[7)7FRORXUGLVSOD\
[UHVROXWLRQ$7,0RELOLW\5DGHRQ'0EJUDSKLFVELWDXGLR
9.PRGHP(WKHUQHW(WKHUQHW,QWHJUDWHG:LUHOHVV/$1
DQWHQQDDELQWHJUDWHG%OXHWRRWKDQWHQQD5&$YLGHRRXW6'5$0FDUG
VRFNHW[3&0&,$VRFNHWV[86%SRUWVVHULDOSRUWSDUDOOHOSRUW36SRUW
6a9LGHRRXW69*$SRUWDXGLRLRSRUWVWRXFKSDGDQGDFFXSRLQWPRXVHDQG:LQ
;33UR)''QRWLQFOXGHG
1HZWKLQDQGOLJKWGHVLJQLQFOXGLQJDPDJQHVLXPDOOR\FKDVVLVWRSURYLGHDGGHG
GXUDELOLW\PDNLQJLWWKHOLJKWHVWLQLWVFODVV([WHQGHGEDWWHU\OLIHRIXSWRKZLWK
RSWLRQDO LQWHUQDO 6HOHFW%D\ EDWWHU\ &'5:'9' RSWLFDO GULYH 0E 5$0
H[SDQGDEOHXSWR*E'JUDSKLFVZLWKQ9,',$DQGKLJKVSHHGFRPPXQLFDWLRQV
VXFKDV*ELW(WKHUQHWL/LQNDQGRSWLRQDOZLUHOHVV
7RVKLED7HFUD$&0*+]*E+''
7267(&5$$
'9'5:GULYH0E5$0H[SDQGDEOHWR*E´7)7GLVSOD\,QWHO*0(
80$JUDSKLFVLQWHJUDONPRGHP1,&5*%SRUW[86%SRUWV
KHDGSKRQHVRFNHWPLFURSKRQHVRFNHW[W\SH,,3&0&,$SRUWSDUDOOHOSULQWHU
SRUW:LQ;33
128
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Desktop Computers
Notebook Computers (cont’d)
7RVKLED6DWHOOLWH3UR1RWHERRN3*+]*E+''
72663
0HPRU\0EH[SDQGDEOHWR*E'9'&'5:FRPERGULYHH[WHUQDO)''
´7)7[GLVSOD\1,&NPRGHPQ9,',$*H)RUFH*2JUDSKLFV
DGDSWRU$FFXSRLQWPRXVH:LQ;33
Ż1(:Ż
7UDYHO3DFNZLWKXQLYHUVDOSRZHUDGDSWRUIRU1RWHERRNV
7593$&.
8QLYHUVDOQRWHERRNSRZHUDGDSWRUZLWK86%FKDUJLQJSRUWV,QSXWa9GF$
RUa9DF+]$2XWSXWVa9GF9GF&KDUJLQJWLPHIRU
QRWHERRNFRPSXWHULVXVXDOO\OHVVWKDQDQKRXUGHSHQGLQJRQWKHQRWHERRN
Ż1(:Ż
$/DSWRS&RPSXWHU:60'&'&0XOWL9ROWDJHLQ&DU%DWWHU\
-$<03
0XOWLYROWDJHFDUDGDSWRUSOXJVLQWR\RXUFLJDUHWWHOLJKWHUVRFNHWWRFKDUJHXS\RXU
ODSWRSFRPSXWHU6WDU%XUVWFRQWDLQV'HOO/DSWRSFRPSDWLEOHSOXJ,QSXWYROWDJH
9GFFDUEDWWHU\SRZHU6HOHFWDEOH2XWSXWYROWDJH$
DQG$:PD[6XSSOLHGZLWKFKDQJHDEOHRXWSXWSOXJV[PP
[PP[[PP[PP[PP'HOOW\SHODSWRSSOXJ
)HDWXUHVRYHUORDGDQGVKRUWFLUFXLWSURWHFWLRQWRSURWHFWLWIURPGDPDJH6WDELOLVHG
RXWSXWORZULSSOHDQGORZLQWHUIHUHQFHDGMXVWDEOHRXWSXWYROWDJH+LJKHI¿FLHQF\
DQGORZHQHUJ\FRQVXPSWLRQ3RZHU/('PRQLWRU
:DWW,QYHUWRU
,19&,*9
9:LQYHUWHUIURP9DXWRFLJDUHWWHOLJKWHU)RUXVHZLWKDOOQRWHERRNV
Desktop Computers
'HOO0LQLWRZHUZLWK30+]*E+''
0LQLWRZHU3*+]*E+''
'(/307
75306,
0EPHPRU\LQWHJUDWHG&201,&0E,QWHO$*3''JUDSKLFV
;&'520GULYHNEFDFKH:LQ6(
0E PHPRU\ 0E )'' ; &'520 GULYH &'5: GULYH 06,
PRWKHUERDUG0E*H)RUFH0;JUDSKLFVDGDSWRU1,&[86%
SRUWVSDUDOOHOSRUW[VHULDOSRUWVNH\ERDUGDQGPRXVH:LQ;33UR
'(//*;6OLPOLQH3&30+]*E+''
'(/*;3
7HFK5HQWDOV0LQLWRZHU3*+]*E+''
0EPHPRU\0E)''&'520GULYHNH\ERDUGPRXVH:LQ
75306,2))
+39HFWUD9/3*+]*E+''
0EPHPRU\0E)'';&'520GULYH06,PRWKHUERDUG0E
*H)RUFH0;JUDSKLFVDGDSWRU1,&[86%SRUWVSDUDOOHOSRUW
[VHULDOSRUWVNH\ERDUGPRXVH:LQ;33UROLFHQFHLQFOXGHG
+39/*
0EPHPRU\0E)''&'520GULYH1,&0EJUDSKLFVFDUGNH\ERDUG
PRXVH:LQ;33UR
7HFK5HQWDOV0LQLWRZHU3*+]*E+''
753
&DFKH NE 0E PHPRU\ 0E )'' ; &'520 *H)RUFH 0;
0EJUDSKLFVFDUG1,&NH\ERDUGPRXVH:LQ;33UR
0LQLWRZHU3*+]*E+''
753$686
$686 36 PDLQERDUG 0E PHPRU\ 0E )'' '9'520 0E
JUDSKLFV[86%VHULDOSDUDOOHONH\ERDUGPRXVH:LQ;33
Ż1(:Ż
7HFK5HQWDOV0LQLWRZHU3HQWLXP,9*+]5$0ZLWKEODFNFDVH
753);*%
*%5$0*%+''0%JUDSKLFVFDUGZLWK9*$'9,79RXWSXWV'9'
GXDOOD\HUEXUQHU1,&DXGLR[VHULDOSDUDOOHO[86%:LQGRZV
;33631HUR%XUQLQJ5203RZHU'9'DQG$FUREDW5HDGHU
0DWUR[3DUKHOLD$JS[*UDSKLFV&DUG
0$73$5+(/,$0E
+LJKHVWRXWSXWTXDOLW\ZLWKELWJDPPDFRUUHFWDEOH'$&6'XDO'YLRXWSXWVDW
[RU[UHVROXWLRQV3XUHYLGHRSUHYLHZVRQ176&DQG3$/
PRQLWRUV2SHQ*/DQG0LFURVRIW'LUHFW;DFFHOHUDWLRQ
7HFK5HQWDOV0LQLWRZHUZLWK$0'$WKORQ;3*+]*E+''
75$7+/21
0EJUDSKLFVDGDSWRU0E5$0;&'5200E)''1,&
[86%[3&,NH\ERDUGPRXVH:LQ6(
7HFK5HQWDOV3*+]*E+''
753
NFDFKH0EPHPRU\0E)'';&'520*H)RUFH0;0E
JUDSKLFVFDUG1,&NH\ERDUGPRXVH:LQ;33UR
Ż1(:Ż
/HDGWHN3&,4XDGUR1960E4XDG+
/($48$'520%
3&,4XDGUR1960E
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 129
PDA, Servers & Monitors
Business Equipment
PDA - Portable Data Appliance
Toshiba E800 PDA with Bluetooth Wireless Interface
TOS,E800-BT
Intel Xscale PXA-263MHz processor at 400MHz, Pocket PC 2003 operating
V\VWHP0E5$00E1$1'ÀDVK5200E&026ÀDVK520´
NFRORXUGLVSOD\49*$[9*$[XVHUVZLWFKDEOHSL[HO
WUDQVÀHFWLYH7)7/&'DQDORJUHVLVWDQFHVHQVLWLYHWRXFKVFUHHQV\VWHP&DUG
VORWVIRU6'VWRUDJH6',2DQG&)FDUG,QIUDUHGSRUWNEV9*$RXWSXWYLD
RSWLRQDOH[SDQVLRQSDFNULQJVWHUHRKHDGSKRQHDQGPLFURSKRQHMDFNE
:L)L¿WWHG6XSSRUWV03DQG:LQGRZV0HGLD5HSODFHDEOHUHFKDUJHDEOH/LW,RQ
EDWWHU\UDWHGDWP$K2YHUDOOVL]HZ[G[KPP:HLJKWJ
Toshiba E800 PDA with 802.11b WIFI Interface
T26(:,),
Intel Xscale PXA-263MHz processor at 400MHz, Pocket PC 2003 operating
V\VWHP0E5$00E1$1'ÀDVK5200E&026ÀDVK520´
NFRORXUGLVSOD\49*$[9*$[XVHUVZLWFKDEOHSL[HO
WUDQVÀHFWLYH7)7/&'DQDORJUHVLVWDQFHVHQVLWLYHWRXFKVFUHHQV\VWHP&DUG
VORWVIRU6'VWRUDJH6',2DQG&)FDUG,QIUDUHGSRUWNESV9*$RXWSXWYLD
RSWLRQDOH[SDQVLRQSDFNULQJVWHUHRKHDGSKRQHDQGPLFURSKRQHMDFNE
:L)L¿WWHG6XSSRUWV03DQG:LQGRZV0HGLD5HSODFHDEOHUHFKDUJHDEOH/L,RQ
EDWWHU\UDWHGDWP$K2YHUDOOVL]HZ[G[KPP:HLJKWJ
Servers
Dual 2.4 GHz Xeon Server
Tech-Rentals Server
756(59(5;
TR,SERVER
'XDO3HQWLXP;HRQ*+]VHUYHUZLWK*E,'(+''$VXVPRWKHUERDUG33
//:*EPHPRU\(&&''5)''&'520GULYH[86%SRUWV
1,&*+]1,&[VHULDOSRUWV[SDUDOOHOSRUW0EYLGHRFDUG.H\ERDUG
DQGPRXVH
'XDO*+]SURFHVVRU[*E6&6,+''QRQKRWVZDS0E)'';
'9'520*E5$08OWUD:LGH6&6,FDUGQHWZRUNFDUGDQG0E
YLGHRFDUG
CRT Monitors
HP 17” SVGA Colour Monitor
+369*$
PPGRWSLWFK[[[[+]035,,
SRZHUPDQDJHPHQWV\VWHPSOXJDQGSOD\FRPSDWLEOH
Panasonic 17” SVGA Monitor
36&69*$
PPGRWSLWFKPRQLWRUZLWK[UHVROXWLRQFDSDELOLW\DQGFRPSDFW
FDVH
Mitsubishi 17” SVGA Colour Monitor
0,769*$
PP GRW SLWFK [ UHVROXWLRQ FDSDELOLW\ # +] SOXJ DQG SOD\
FRPSDWLEOHDQGSRZHUPDQDJHPHQWPRGH
Touchscreen Monitors
Posbox 15.1” LCD Touchscreen
3%;728&+6&5((1B
,QFOXGHVVWDQGDQGGULYHUVRIWZDUH
130
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Monitors
LCD Monitors
Acer 19.1” LCD Monitor
NEC 20.1” Pivoting LCD Monitor
$&(/&'
1(&/&'
$FWLYHPDWUL[7)7FRORXUGLVSOD\ZLWK[UHVROXWLRQIXOO´YLHZDEOH
DUHDSL[HOSLWFKPP0FRORXUVFRQWUDVWUDWLREULJKWQHVVFG
m2UHVSRQVHWLPHPVLQSXWVLJQDODQDORJ'aVXE'9,'SRZHUFRQVXPSWLRQ
:PD['LPHQVLRQVZ[G[KPP3RZHUDGDSWRUH[WHUQDO:HLJKW
NJ,QWHUQDOVSHDNHU
Ż1(:Ż
PPGRWSLWFK5*%YHUWLFDOVWULSHFRORXU¿OWHUDUUDQJHPHQWFGP2ZKLWH
OXPLQDQFHW\SLFDODQGFRQWUDVWUDWLR5RWDWDEOH[ZLWKLQFOXGHGVRIWZDUH
5HFRPPHQGHGUHVROXWLRQODQG[#+]3RUW[#+]
:DUQLQJ'RQRWXVHDERYHO&RU5+
Mitsubishi 30” LCD Monitor
0,7/&'
+<1/&'$9
:LGHVFUHHQPRQLWRUZLWK[SL[HOUHVROXWLRQ:;*$PVUHVSRQVH
WLPHFRQWUDVWUDWLRFGPEULJKWQHVVOYLHZLQJDQJOHPXOWLSOHYLGHR
LQSXWVIRU3&799&'+'79'9'FDPFRUGHU5HPRWHFRQWURO3$/176&
FRPSDWLEOHWDEOHWRSVWDQG2SWLRQDOLWHPVQRWLQFOXGHGVSHDNHUVWXQHUZDOO
PRXQW
Ż1(:Ż
Ż1(:Ż
Hyundai 32” LCD Screen
´/&'VFUHHQZLWKRQERDUGVWHUHRVSHDNHUV%ULJKWQHVVFGP2+, contrast
UDWLR UHVSRQVH WLPH PV YLHZLQJ DQJOH UHVROXWLRQ [
FRORXU V\VWHP 3$/6(&$0 LQSXW WHUPLQDO 5*% 'aVXE '9, 69LGHR
FRPSRVLWH YLGHR FRPSRQHQW VFDUW DQWHQQD 5) 7LOW DQJOH O aO VZLYHO
WROHUDQFHOHIWO
Samsung 400PN - 40” LCD Screen
6$0/&'31
´ /&'VFUHHQ[QDWLYHUHVROXWLRQ)DVWPVUHVSRQVH QLWV
EULJKWQHVVFRQWUDVWUDWLRO+9DQJOHVQRLPDJHEXUQDVSHFWUDWLR
,QWHUIDFHDQDORJXHGLJLWDO,QSXWFRQQHFWRUV5*%SLQ'VXE'9,'
69LGHR%1&9LGHR%1&FRPSQHQW3&56&SLQ'6XEFRQWUDVWUDWLR
OO+9YLHZLQJDQJOHVZLGHDVSHFWUDWLR
CMV 17” LCD Screen
&09/&''
´/&'GLVSOD\,QSXWLQWHUIDFH'aVXE'9,'5HVROXWLRQ[6;*$
'LVSOD\&RORXU0%ULJKWQHVVFGP2&RQWUDVWUDWLR9LHZLQJ
DQJOHKRUL]RQWDOO5HVSRQVHWLPHPVSRZHUVRXUFH
Ż1(:Ż
Samsung LCD 400PN Speakers
6$0/&'3163($.(56
ZDWWV[FKDQQHO
Samsung 40” LCD display screen, 600:1 contrast, 1280 x 768
6$0/&'
´$QDORJ'9,'7)7/&'PRQLWRUFGPðEULJKWQHVVFRQWUDVWUDWLR
OO+9YLHZLQJDQJOHVZLGHDVSHFWUDWLRPVUHVSRQVHWLPH
&RPSRQHQWFRPSRVLWHDQG69LGHRFRQQHFWLRQV
CMV 19” LCD Display with Silver Bezel
&09/&'
´/&'GLVSOD\ZLWK9*$'aVXEDQG'9,'LQSXWV[UHVROXWLRQ
[:VSHDNHUVVLOYHUEH]HODQGEODFNFDVHGLPHQVLRQV:[+;'[
[PP
NEC LCD 40” Display Monitor
1(&/&'
[UHVROXWLRQLQSXWVIRU;*$69LGHRDQGYLGHR6XSHUZLGHDQJOH
YLHZLQJDQGFRQWUDVWUDWLRRIIRUKLJKDPELHQWOLJKWLQJFRQGLWLRQV
Wallmount for NEC LCD 40” Display
1(&/&':$//02817
:DOOPRXQWLQJEUDFNHWWRVXLW1(&/&'1RWH0XVWEH¿[HGWRDZDOOFDSDEOH
RIVXSSRUWLQJ!NJ
132
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Network Products
Network Products
DLink DWL 660 PCMCIA Wireless Network Card
DLink 15 Port HUB 12 x 10BASE-T & 3 x 100BASE
'/,':/
'/,3257+8%
3&0&,$EZLUHOHVVQHWZRUNFDUG
SRUW)DVW(WKHUQHWXQPDQDJHGVZLWFK[%$6(7DQG[%$6(
[FRPER,%$6(7$8,SRUW[GXDOVSHHG%$6(7DQG%$6(7;1:D\
SRUWV[0,,)DVW(WKHUQHWSRUW)XOOKDOIGXSOH[IRUHDFKSRUWH[FHSWIRU$8,
SOXJDQGSOD\0',,,FDVFDGLQJSRUWDXWRFRUUHFWLRQRI5;SRODULW\UHYHUVH873
673VXSSRUWHGGLDJQRVWLF/('VLQWHUQDO36´VWDQGDUGUDFNPRXQW
HP ProCurve Switch 2424, 24 Port 10/100 Unmanaged
+3376:
DLink Xtreme G Wireless Notebook Adaptor
'/,:,5(/(663&0&,$
)UHH¿UPZDUHXSJUDGHV'/LQNJ;WUHPH*SURGXFWVWREHXSWRWLPHV
IDVWHUWKDQE0ESVGDWDEDQGZLGWK7KHJ'/LQN;WUHPH*
':/*ZLWKHQKDQFHGGHOLYHUVFRQVLVWHQWGDWDUDWHWKURXJKSXW
Dlink Wireless PCI
'/,:,5(/(663&,
)UHH¿UPZDUHXSJUDGHV'/LQNJ;WUHPH*SURGXFWVWREHXSWRWLPHV
IDVWHUWKDQE0ESVGDWDEDQGZLGWK7KHJ'/LQN;WUHPH*
':/*ZLWKHQKDQFHGGHOLYHUVFRQVLVWHQWGDWDUDWHWKURXJKSXW
DLink 900AP Wireless Access Point
'/,':/$3
EFRPSOLDQW0ESVZLUHOHVVDFFHVVSRLQWRSHUDWLQJRQ*+]IUHTXHQF\
%URZVHUEDVHGPDQDJHPHQWDQGFRQ¿JXUDWLRQ
DLink DWL-520 Wireless PCI Card 11Mbps
'/,':/
3&,:L)LQHWZRUNFDUG&RQIRUPVWRE0ELWSURWRFROZLWKXSWR:(3
VHFXULW\8VHGZLWK'/LQNZLUHOHVVDFFHVVSRLQW0ELWVLVDYDLODEOH
Dlink DWL650+ PCMCIA Wireless Network Adaptor
'/,':/
3&0&,$ZLUHOHVVQHWZRUNDGDSWRUIRUE0ESVQHWZRUNV
DLink 16 Port 10/100Mb Unmanaged HUB
'/,37
(WKHUQHWSRUWVWDFNDEOHGXDOVSHHGKXEV[5-1:$<[5-XSOLQN
PDVWHUXQLWPD\KDYHXQLWVSHUVWDFNZLWKDPDVWHUFOLHQWUDWLRRISHUVWDFN
H[SDQVLRQVORWZLOOWDNHD%$6(7;RU%$6();VZLWFKPRGXOH
8QPDQDJHGSRUW(WKHUQHWVZLWFK,QFOXGHVRSHQPRGXOHVORWIRU*LJDELW
VWDFNLQJDQGXSOLQNV5021H[WHQGHG5021SURYLGHDGYDQFHGPRQLWRULQJ
FDSDELOLWLHV3RUWPRQLWRULQJOHWV\RXPRQLWRUWUDI¿FXVLQJDVZLWFKHGSRUWVR\RX
FDQYLHZVHYHUDOSRUWVDWRQHWLPHZLWKDQ5021SUREH:HELQWHUIDFHOHWV\RX
PRQLWRU\RXUZKROHQHWZRUNDWRQFHXSWRVHJPHQWVIURPDQ\3&RQWKH
QHWZRUNZLWKDZHEEURZVHU)LOWHULQJSURYLGHVWUDI¿FFRQWURO
HP ProCurve 408, 8 Port 10/100 Switch
+3376:
SRUW873QHWZRUNVZLWFKLQJKXE
Linksys 16 Port 10/100 Unmanaged HUB
/1.3257+8%
Packeteer Packet-Shaper 2000 UTP - WAN
3$.36+$3(5
7&3,3 EDQGZLGWK PDQDJHPHQW WRRO $OORZV FRQWURO RI :$1 WUDIILF EDVHG
RQSURWRFRO DGGUHVVHH DGGUHVV HWF&DQUHVWULFW WUDI¿F WRWDOO\ RUOLPLW LWWRD
SHUFHQWDJHRIWKHWRWDOEDQGZLGWK&DQUHVHUYHEDQGZLGWKIRUDJLYHQSURWRFRO
RUXVHULHZHEWUDI¿FWHOQHWWUDI¿FDQGHPDLOWUDI¿F
Retix NETXchange 4560 Local Router
57;1(7;
/RFDO(WKHUQHWEULGJHURXWHUHQDEOLQJQHWZRUNVWREHVHJPHQWHGLQWRPDQDJHDEOH
XQLWV5RXWHVDWXSWRISVDQG¿OWHUVDWQHDUZLUHVSHHGEULGJLQJDWISV
VXSSRUWVDOOSURWRFROVURXWDEOHDQGQRQURXWDEOHXVHV,(((GVSDQQLQJ
WUHHDOJRULWKP'\QDPLFDOO\UHFRQ¿JXUHVLIDOLQNIDLOVSURGXFHVWUDI¿FVWDWLVWLFV
DQGDQDO\VLV[$8,LQWHUIDFHVPDQDJHDEOHZLWK7HOQHWRU6103
Ż1(:Ż
USB Print Server
USB,PRINTSERVER
7RVKDUH86%SULQWHUYLDORFDO1HWZRUN
Facsimile Machines
Toshiba DP80F Facsimile Machine
Toshiba DP85F Plain Paper Fax Machine
726'3)
726'3)
3ODLQSDSHUODVHUIDFVLPLOHSDJHDXWRPDWLFGRFXPHQWIHHGHURQHWRXFK
GLDOLQJNH\VEURDGFDVWLQJDEEUHYLDWHGGLDOQXPEHUVPXOWLWUDQVPLVVLRQ
ORFDWLRQVSDJH$SDSHUWUD\FRS\IDFLOLW\DWPXOWLSOHSDJHVGSLODVHU
SULQWHUSULQWLQJDWSDJHVPLQ3DUDOOHODQGVHULDOLQWHUIDFHV3ULQWGULYHUVXSSRUWV
:LQGRZVDQG177RWDORISDJHVFDQEHVWRUHGLQWRPHPRU\
SDJHDXWRPDWLFGRFXPHQWIHHGHURQHWRXFKGLDOLQJNH\VEURDGFDVWLQJ
DEEUHYLDWHGGLDOQXPEHUVPXOWLWUDQVPLVVLRQORFDWLRQVSDJH$SDSHU
WUD\FRS\IDFLOLW\DWPXOWLSOHSDJHVGSLODVHUSULQWHUSULQWLQJDWSDJHVPLQ
3DUDOOHODQGVHULDOLQWHUIDFHV3ULQWGULYHUVXSSRUWV:LQGRZVDQG17$
WRWDORISDJHVFDQEHVWRUHGLQWRPHPRU\PRGHPVSHHGNESV
Did you know?
TECHRENTALS offers rental with an option to purchase (RPO).
When you enter into an RPO you can exercise your oprtion to purchase the rented equipment after the agreed
minimum rental term.
RPO is an ideal arrangement for companies who need to conserve capital, allocate expenditure, preserve
credit and optimise asset management over the longer term.
Our friendly staff will be pleased to provide details.
Some conditions may apply , not available for all equipment.
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Call now!
TECHRENTALS 133
Business Equipment
Point of Sale
Point of Sale
Ż1(:Ż
$[LFRQ%DUFRGH9HULÀHU
$;,3&
+DQG KHOG YHUL¿HU IRU UHWDLO EDUFRGHV &&' WULJJHU RSHUDWHG UHDGLQJ KHDG
$SHUWXUHDXWRPDWLFDOO\VZLWFKDEOHEHWZHHQDQGPLODSHUWXUHPLO PLFURQV6FDQZLGWKPPLQFOXGLQJOLJKWPDUJLQ,62&(1$16,YHUL¿FDWLRQ
VWDQGDUGWR&(1&ODVV$SHUIRUPDQFHWUDGLWLRQDOYHUL¿FDWLRQV\PERORJ\DXWR
GLVFULPLQDWLRQ DXWRPDWLF YDULDEOH DSHUWXUH VFDQ VWRUDJH DQG UHSOD\ YDULRXV
GLDJQRVWLFVFUHHQVZLWKUHPRWHGLDJQRVWLFVFDSDELOLWLHVVWDWLFUHÀHFWDQFHPHWHU
GLVSOD\RIQRPLQDOEDUZLGWKRSWLRQDO8&&($1GDWDFRQWHQWFKHFNRSWLRQDO
SURGXFWORRNXSRSWLRQDODXWRVDYHRIDOOGDWDLQWRDFVY¿OHIRUVWDWLVWLFDODQDO\VLV
XVLQJ([FHO/RWXVHWF&DOLEUDWLRQGDWDDXWRPDWLFDOO\UHFRUGHGLQFRPSOLDQFH
ZLWK,62:LQGRZVWPEDVHGSURJUDP3&FRPSDWLEOHUXQQLQJ:LQGRZV
RUKLJKHU0DFFRPSDWLEOHUXQQLQJ26;RUKLJKHU$YDLODEOHLQODQJXDJHV
(QJOLVK'DQLVK'XWFK)UHQFK*HUPDQ3RUWXJXHVHDQG6SDQLVKIXOOFRORXU
VFUHHQJUDSKLFV6\PERORJLHVYHUL¿HGDVVWDQGDUG566($1($183&$
83&(,7)&DVH&RGH&RGH&RGH&RGDEDU8&&($1+,%&
,WDOLDQ3KDUPDFRGH,0+&,3&,3&RGH6RJHF06,3OHVVH\&RGH
Ż1(:Ż
Denso BHT 6045 Portable Data Terminal
'(1%+7672&.7$.(
)RUVWRFNWDNHDQGDVVHWFRQWUROPDQDJHPHQWUHGXFHVWLPHUHTXLUHGE\XSWR
%LWUHDGLQJZLWKNEPHPRU\8SWROLQHGLVSOD\+ROGVaOLQH
LWHPV1XPHULFDQGIXQFWLRQNH\SDG'LUHFWLQWHUIDFHZLWK0<2%5HWDLO0DQDJHU
DYDLODEOHZLWKDGGLWLRQDOVRIWZDUHDOORZLQJIRUVHDPOHVVGDWDXSGDWHVIURPVFDQQHU
WR5HWDLO0DQDJHU
Denso BHT 6047 Portable Data Terminal
'(1%+73'(
)RU VWRFNWDNH DQG DVVHW FRQWURO PDQDJHPHQW UHGXFHV WLPH UHTXLUHG E\ XS WR
ELWUHDGLQJZLWK0E0HPRU\8SWROLQHGLVSOD\+ROGVa
OLQH LWHPV 1XPHULF DQG IXQFWLRQ NH\SDG 'LUHFW LQWHUIDFH ZLWK 0<2% 5HWDLO
0DQDJHUDYDLODEOHZLWKDGGLWLRQDOVRIWZDUHDOORZLQJIRUVHDPOHVVGDWDXSGDWHV
IURPVFDQQHUWR5HWDLO0DQDJHU
Denso BHT 8004 Data Terminal
DEN,BHT8004
3RUWDEOHOLJKWZHLJKWVFDQQHUZLWKPPVFDQQLQJUDQJH0E5$0ZLWK0E
XVHU0HPRU\NH\.H\SDGZLWKDFKDUDFWHU[OLQHGLVSOD\9LEUDWHIXQFWLRQ
DGYDQFHG&&'HQJLQHDQG,U'$'LUHFWFRQQHFWFDEOHLQFOXGHG
$[LFRQ%DUFRGH9HULÀHU
$;,3&
+DQGKHOGYHUL¿HUIRULQWHUPHGLDWHEDUFRGHV&&'WULJJHURSHUDWHGUHDGLQJKHDG
$SHUWXUHDXWRPDWLFDOO\VZLWFKDEOHEHWZHHQDQGPLODSHUWXUHPLO PLFURQV6FDQZLGWKPPLQFOXGLQJOLJKWPDUJLQ,62&(1$16,YHUL¿FDWLRQ
VWDQGDUGWR&(1&ODVV$SHUIRUPDQFHWUDGLWLRQDOYHUL¿FDWLRQV\PERORJ\DXWR
GLVFULPLQDWLRQ DXWRPDWLF YDULDEOH DSHUWXUH VFDQ VWRUDJH DQG UHSOD\ YDULRXV
GLDJQRVWLFVFUHHQVZLWKUHPRWHGLDJQRVWLFVFDSDELOLWLHVVWDWLFUHÀHFWDQFHPHWHU
GLVSOD\RIQRPLQDOEDUZLGWKRSWLRQDO8&&($1GDWDFRQWHQWFKHFNRSWLRQDO
SURGXFWORRNXSRSWLRQDODXWRVDYHRIDOOGDWDLQWRDFVY¿OHIRUVWDWLVWLFDODQDO\VLV
XVLQJ([FHO/RWXVHWF&DOLEUDWLRQGDWDDXWRPDWLFDOO\UHFRUGHGLQFRPSOLDQFH
ZLWK,62:LQGRZVWPEDVHGSURJUDP3&FRPSDWLEOHUXQQLQJ:LQGRZV
RUKLJKHU0DFFRPSDWLEOHUXQQLQJ26;RUKLJKHU$YDLODEOHLQODQJXDJHV
(QJOLVK'DQLVK'XWFK)UHQFK*HUPDQ3RUWXJXHVHDQG6SDQLVKIXOOFRORXU
VFUHHQ JUDSKLFV 6\PERORJLHV YHUL¿HG DV VWDQGDUG 566 ($1 ($1
83&$83&(,7)&DVH&RGH&RGH&RGH&RGDEDU8&&($1
+,%& ,WDOLDQ 3KDUPDFRGH ,0+ &,3 &,3 &RGH 6RJHF 06, 3OHVVH\
&RGHHWF
Ż1(:Ż
Zebra QL420 Mobile Label/Receipt Printer with Bluetooth
=(%4/%7
'HVLJQHGZLWKWKHPRVWDGYDQFHGWHFKQRORJ\LQUXEEHUL]HGRYHUPROGLQJWRPDLQWDLQ
ERWKUXJJHGFRQVWUXFWLRQDQGPLQLPDOZHLJKW:LWKFHQWHUORDGLQJPHGLDVPDUW
EDWWHU\PRQLWRULQJDQGDQRSWLRQDO/&'LWSURYLGHVXVHUIULHQGO\RSWLRQVWRNHHS
\RXUEXVLQHVVPRYLQJGRWVSHULQFKUHVROXWLRQGRWVSHUPP3ULQWZLGWK
´PPPD[LPXPPD[LPXPODEHODQGOLQHUZLGWK´PP
PD[LPXPODEHOOHQJWKZLWKGSLZLWKVWDQGDUGPHPRU\´PP
Datalogic Stargate RF Base Station
'$7*'55)67$5*$7(
6WDUJDWH5)VDWHOOLWHWUDQVFHLYHU%DVH5)7HUPLQDOIRUXVHZLWK)KDQGKHOG
5)VFDQQHUV56LQWHUIDFHXQLWDOORZLQJIRUXSWR+DQG+HOG5)XQLWVWR
EH XVHG DW D PD[ UDQJH RI P GHSHQGDQW RQ HQYLURQPHQWDO JHRJUDSKLFDO
FRQVWUDLQWV
Epson TM-T88 Thermal Receipt Printer
EPS,TM-T88
+LJKVSHHGFROXPQGURSDQGORDGSDSHUORDGLQJZLWKDXWRSDSHUFXWWHU
,QFOXGHVSRZHUVXSSO\DQGGDWDFDEOH
Epson TM210D Impact Receipt Printer
EPS,TM210D_IMPACT_PR
SLQGRWPDWUL[UHFHLSWSULQWHURUFROXPQVOLQHVSHUVHF%ODFN
DQGUHGSULQWXSWRSO\SDSHU,QFOXGHVSRZHUVXSSO\DQGGDWDFDEOH
134
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Point of Sale
Point of Sale (cont’d)
3RVLÁH[&DVKGUDZIRUXVHZLWK3&
Cipher Lab CPT 8001 USB Batch Scanner
'RFNHW SULQWHU GULYHQ 326 FDVK GUDZHU ZLWK P 5- PRGXODU FRQQHFWRU
FDEOH6XLWV3RVLÀH[(SVRQ6WDUDQGFXUUHQW&LWL]HQSULQWHUV6FUHZOHVVGHVLJQ
ZLWKWKUHHSRVLWLRQORFNFKHTXHVORWFDVKLQVHUWDQGDGMXVWDEOHFRLQDQGQRWH
FRPSDUWPHQWVORWV
5HFKDUJHDEOHSRFNHWVL]HSRUWDEOHGDWDWHUPLQDOa0E0HPRU\DOORZLQJIRU
0EDSSOLFDWLRQ0ERIGDWDVWRUDJHDOORZLQJIRUXSWROLQHLWHPV/RQJ
UDQJH&&'VFDQQHUJLYLQJDUDQJHRIaFP86%FUDGOHHQDEOLQJXSORDGDQG
GRZQORDGDQGFKDUJLQJ,QFOXGHV:LQGRZVEDVHGDSSOLFDWLRQVRIWZDUHDOORZLQJ
IXOOFXVWRPLVDWLRQDQGRXWSXWWR&69ZKLFKFDQWKHQEHUHDGE\SDFNDJHVVXFK
DV06([FHO06$FFHVVDQGPRVWGDWDEDVHSDFNDJHV
POS,CASHDRAW
3RVLÁH[33,PSDFW5HFHLSW3ULQWHU
POS,PP3000PRINTER
CIP,CPT8001-USB
GRW PDWUL[ SULQWLQJ DW DSSUR[ OLQHV SHU VHFRQG 6WDQGDUG ZLWK (SVRQ
HPXODWLRQ 6WDU HPXODWLRQ DYDLODEOH RQ UHTXHVW 6HOHFWDEOH 56SDUDOOHO
LQWHUIDFHYLDGLSVZLWFKMXPSHUVHWWLQJVYDOLGDWLRQSULQWLQJ,QFOXGHVSDSHUDGDSWRU
SDSHUWHDUEDUDQGGDWDFDEOH
3RVLÁH[/6/DVHU%DUFRGH6FDQQHU
326/6
/DVHU WHFKQRORJ\ PP UHDGLQJ DSHUWXUH aPP VFDQQLQJ GLVWDQFH DXWR
VHQVHPDQXDO WULJJHU IX]]\ ORJLF GLVFULPLQDWLRQ EHHSHU DQG /(' LQGLFDWRU
GHWDFKDEOH FDEOH DQG KDQGV IUHH VWDQG 56 RU .H\ERDUG :HGJH 36
LQWHUIDFH
3RVLÁH[337KHUPDO5HFHLSW3ULQWHU
3263335,17(5
+LJKUHVROXWLRQSULQWHUSURYLGLQJTXLHWRSHUDWLRQDQGWKHDELOLW\WRSULQWGHWDLOHG
JUDSKLFVDQGEDUFRGHVIRUXVHLQYDULRXVDSSOLFDWLRQV.H\IHDWXUHVLQFOXGH
(SVRQSULQWHUHPXODWLRQGRWVPPDQGGRWVOLQH/LJKWZHLJKWORZQRLVH
DQGFRPSDFW'URSDQGORDGVWUXFWXUHGHVLJQIRUHDV\SDSHUORDGLQJDQGSULQW
KHDGFOHDQLQJ$XWRFXWWHUSURYLGHVIXOORUSDUWLDOFXW
3RVLÁH[337KHUPDO5HFHLSW3ULQWHU
POS,PRINTER
OLQHVVKLJKVSHHGZLWK$XWRFXWWHU6HOHFWDEOH563DUDOOHO,QWHUIDFHYLD
GLSVZLWFKMXPSHUVHWWLQJV,QFOXGHVSRZHUDGDSWRU&DQEHFRQYHUWHGWR/DEHO
%DUFRGHSULQWHUZLWKDGGLWLRQDOVRIWZDUH
Ż1(:Ż
Symbol LS 2208 Laser Scanner - USB Interface
6<0/686%
$GYDQFHGODVHUEDUFRGHVFDQQHUZLWKDGYDQFHGGDWDIRUPDWLQJÀDVKPHPRU\
WZRFRORXU/('LQGLFDWRUZLWKDGMXVWDEOHEHHSHUYROXPH,QFOXGHVVWDQGZKLFK
FRQYHUWVVFDQQHUWRDKDQGVIUHHXQLW86%FRQQHFWLRQ
Cipherlab CPT 8001 USB Batch Scanner
CIP,CPT8001-USB-BAT
6SHFL¿FDWLRQDVDERYHEXWZLWKUHFKDUJHDEOHEDWWHULHV
3RVLÁH[*')%DWFK%DUFRGH6FDQQHUZLWK&UDGOH
3266&$1
6ROLGOLJKWZHLJKWEDWFKWHUPLQDOVFDQQHULGHDOIRUVWRFNWDNLQJ/DVHUVFDQQHU
ZLWKEXLOWLQ/&'VFUHHQ/&'GLVSOD\VXSWROLQHVRIFKDUDFWHUV0EPHPRU\
DOORZVVFDQQLQJRIXSWROLQHLWHPV,QFOXGHVFRS\RI3RZHU*HQ
$SSOLFDWLRQ*HQHUDWRU6\VWRROV&RPPXQLFDWLRQVRIWZDUH$OVRDYDLODEOH0<2%
5HWDLO0DQDJHU,QWHUJUDWLRQVRIWZDUHIRUWKH)VFDQQHUVDOHRQO\
Ż1(:Ż
3RVLÁH[737RXFK7HUPLQDO
32673
+LJKO\LQWHJUDWHG3&EDVHGVPDUWVWDQGWRXFKWHUPLQDO3URYLGHVDSDQHOVL]HRI
´KLJKOXPLQDQFHDFWLYHPDWUL[7)7/&'DEDVHVWDQGIRULQWHUQDOLQVWDOODWLRQ
RI836EDWWHU\DQGDSULPDU\,'(LQWHUIDFH+'')HDWXUHV&383&HOHURQ
*+]+''*%RUDERYHVXSSRUW:LQ:LQ;3H:LQ;33URDQG/LQX[
HQYLURQPHQW9HUWLFDOW\SH/&'SDQHOZLWKHDV\WLOWDQJOHDGMXVWPHQW/HDGLQJ
HGJH LQIUDUHG W\SH WRXFK VHQVRU IRU EURDG UDQJH RI DSSOLFDWLRQ ZKLOH JHWWLQJ
PXFK KLJKHU FRQWUDVW UDWLR DQG EULJKWQHVV RI /&' GLVSOD\ ZLWK ZHDU UHVLVWDQW
SDQHOVXUIDFH6SLOOSURRIZDWHUUHVLVWDQWVWUXFWXUHDOORZLQJHDV\FOHDQLQJ(DV\
PDLQWHQDQFHFRQVWUXFWLRQVHULDOSRUWVSDUDOOHOSRUW86%SRUWVRQH/$1
SRUWEDVH7(WKHUQHWXSJUDGHDEOHWR*ESVFDVKGUDZHUFRQWUROWKURXJK
RQHFRQQHFWRUZLWKGUDZHURSHQGHWHFWLRQRQHDXGLRRXWSXWSRUWZLWKVSHDNHUV
RQFDEOHFRYHUDQGRQHPLFURSKRQHLQSXWSRUW
3RVLÁH[737RXFK7HUPLQDO
326728&+7(50,1$/
3&DQGWRXFKVFUHHQDOOLQRQHKHLJKWDGMXVWPHQWV´/&'VFUHHQDQG
DQ HDV\WRDGMXVW VFUHHQ DQJOH 6FUHHQ FDQ EH VHSDUDWHG IURP WKH EDVH IRU
ZDOO PRXQWLQJ 6XSSRUWV GXDO LQGHSHQGHQW YLGHR RXWSXW IRU DQ DGGLWLRQDO
GLVSOD\WRVKRZDGYHUWLVLQJSURPRWLRQDOLWHPVHWFZKLOHWKHFKHFNHUYLHZVD
VWDQGDUGFDVKLHUVFUHHQ,QWHOŠ&HOHURQŒ&387RSUHYHQWDFFLGHQWDOSRZHU
GRZQLWFDQEHSURJUDPPHGWREHPHFKDQLFDOO\WXUQHG³21´RQO\DYDLODEOH
VHULDOSRUWV[86%SRUWV[SDUDOOHOSRUW36PRXVHDQGNH\ERDUGSRUWV
H[WHUQDOVSHDNHUSRUWLQGHSHQGHQWFDVKGUDZHUSRUWDQGDQDGGLWLRQDO&579*$
GLVSOD\SRUW%DVHKDVEXLOWLQ836EDWWHU\EDFNXS2SWLRQVLQFOXGH7KXPESULQW
ID security, Magstrip and smart card reader, and 24 key programmable keyboard
ZLWKQXPHULFNH\SDG
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 135
Point of Sale
Business Equipment
Point of Sale (cont’d)
Zebra TLP 2844 Thermal Barcode Label Printer
=(%7/3
Ż1(:Ż
6PDOOWRPHGLXPVFDOHODEHODQGEDUFRGHSULQWLQJRIXSWRODEHOVSHUGD\3ULQW
VSHHGPPV0D[ODEHOZLGWKPP,QFOXGHVGULYHUVDQGGHPRVRIWZDUH
-7(&2003
JTech Commpass Pager
3UHPLXP SDJLQJ V\VWHP (OLPLQDWHV QRLVH SROOXWLRQ FDXVHG E\ RYHUKHDG
SDJLQJV\VWHPVXVHRIQXPEHUHGOLJKWERDUGVH[FHVVLYHZDJHODERXU
FRVWVDQGFXVWRPHUFRPSODLQWV8QLWKDVDÀDVKLQJOLJKWYLEUDWLRQDQGVRXQG
WKDWQRWL¿HVDSDJH7KLVLVUHSHDWHGXQWLOWKHXQLWLVUHWXUQHGWRWKHFUDGOH
WRHOLPLQDWHDPLVVHGSDJH3DJHUKDVDTXLFNFKDUJHIDFLOLW\DQGDUDQJH
RIDSSUR[NP
Zebra T402 Thermal/Direct Thermal Label Printer
ZEB,T402BARCODE
5HVROXWLRQGSLGRWVPPSULQWZLGWKPPPD[PD[ODEHOOLQHUZLGWK
PPPD[ODEHOOHQJWKZLWKVWDQGDUGPHPRU\PP0D[LPXPSULQWVSHHG
PPV0HPRU\6WDQGDUG0E'5$00E)ODVK
Symbol PDT 1100 Stocktake Scanner
SYM,PDT1100PDE
8OWUD VPDOO 0E VWRFNWDNH VFDQQHU 6FDQQLQJ UDQJH RI aPP ZLWK ODVHU
WHFKQRORJ\NH\NH\SDGZLWKOLQH[FKDUDFWHU/&'GLVSOD\$OVRDYDLODEOH
LVLQWHUIDFHVRIWZDUHDOORZLQJIRUWKHHDV\,QWHUJUDWLRQZLWK0<2%5HWDLO0DQDJHU
,QFOXGHVZULVWVWUDSGLUHFWFRQQHFWFDEOH
Ż1(:Ż
JTech Commpass Pager Cradle & Charger
Symbol LS-1900 Cobra Scanner
-7(&2003&5
6<0/66&$11(5
6WRUHV DQG FKDUJHV XS WR SDJHUV 7KUHH FUDGOHV SDJHUV FDQ EH
FRQQHFWHGWRRQHSRZHUVXSSO\WRDYRLGDGGLWLRQDOSRZHUERDUGV,QFOXGHV
SRZHUVXSSO\
36NH\ERDUGZHGJHFRQQHFWLRQ$GYDQFHG&&'EDUFRGHVFDQQHUZLWKDGYDQFHG
GDWD IRUPDWWLQJ ÀDVK PHPRU\ FRORXU /(' LQGLFDWRU ZLWK DGMXVWDEOH EHHSHU
YROXPH,QFOXGHVVWDQGZKLFKFRQYHUWVVFDQQHUWRDKDQGVIUHHXQLW
Symbol LS-9100 Omni Directional Scanner
6<0/66&$11(5
)XOO 2PQLGLUHFWLRQDO 3DVV E\ ODVHU VFDQQHU ZLWK D aFP VFDQQLQJ UDQJH
$OORZVIRUTXLFNSDVVE\VFDQQLQJRIEDUFRGHGSURGXFWV,QFOXGHVGHVNWRSVWDQG
DQGSRZHUVXSSO\
Ż1(:Ż
JTech Compass UHF Transmitter with Antenna and PSU
-7(%7
8+)WUDQVPLWWHUIRUXVHZLWKWKH-7HFK&RPPSDVV&XVWRPHU3DJLQJ6\VWHP
)DFLOLWDWHVWKHSURJUDPPLQJRIRSWLRQDOIHDWXUHVIRUWKH&RPPSDVVSDJHUV
,QFOXGHVVWDQGDUGDQWHQQDDQGSRZHUVXSSO\
136
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
Business Equipment
Printers
I. D. Card Printer
Ż1(:Ż
Eltron P330 Plastic Card Printer
(/73
6LQJOHVLGHGFRORUFDUGSULQWHU+LJKVSHHGSULQWLQJFDUGVKRXUIRUFRORU
VLQJOHVLGH<0&.2FDUGVKRXUIRUUHVLQEODFN.0%LPDJHPHPRU\
VWDQGDUG :LQGRZVΠDQG ;3 GULYHUV &RORU SULQWLQJ FRORXU ULEERQ
SXUFKDVHGVHSDUDWHO\&RORUG\HVXEOLPDWLRQRUPRQRFKURPHWKHUPDOWUDQVIHU
SULQWLQJVHFRQGVSHUFDUGIXOOFRORUVLQJOHVLGHG<0&.2GSL
GRWVPPSULQWUHVROXWLRQ
Card Five I.D. Card Design Software
62)&$5'),9(B,'
&DUG)LYH3URIHVVLRQDOVRIWZDUH)RUXVHZLWKWKH(OWURQ3L,'FDUGSULQWHU
3RZHUIXOFDUGGHVLJQDQGSULQWLQJWRROZLWKYDULDEOHGDWD¿HOGVDYDLODEOHWKURXJK
NH\ERDUGLQSXWDQGLQWHUQDOFRXQWHUV$VZHOODVLQWHUQDOGDWDEDVHWKLVVRIWZDUH
DOORZVIRUFRQQHFWLYLW\ZLWK&697H[W)LOHV06$FFHVVDQGWKHYHUVDWLOLW\RI
IXOO2'%&GULYHUV
Printers - Inkjet
Epson Stylus 915 Inkjet Printer with Compact Flash Port
Epson Stylus 1290 A3 Inkjet Photo Printer
(3667</86
(3667</86
$6W\OXVSKRWRJUDSKLFLQNMHWSULQWHURSWLPLVHGGSL&RPSDFW)ODVKFDUG
VORWIRUXVHZLWKGLJLWDOFDPHUDV/&'SUHYLHZPRQLWRUSDSHUUROOKROGHUFRQWURO
SDQHODQGSKRWRDQGSULQWPDQDJHPHQWVRIWZDUH
)HDWXUHVFRORUV\VWHP[GSL%RUGHUOHVVSULQWLQJ$a$86%
SDJHVPLQ
Epson Stylus Photo 1200 A3 Printer
+3'(6.-(7&
(3667</86
$FRORXULQNMHWSULQWHUZLWKGSLUHVROXWLRQLQSKRWRTXDOLW\PRGH
Epson Stylus Photo 870 Colour Printer
(3667</86
HP Deskjet 930C Colour Printer
$FROXPQGSLSKRWRFDSDEOHLQNMHWSULQWHU+33KRWR5(WFRORUOD\HULQJ
WHFKQRORJ\FDQSURGXFH[GSLFRORULPDJHVXVLQJSKRWRSDSHU3ULQWV
XSWRSDJHVPLQLQEODFNSDJHVPLQLQFRORUIXOOSDJHFRORUVKHHW
LQSXWWUD\DQGVKHHWRXWSXWWUD\SDUDOOHODQG86%LQWHUIDFHV
$[GSLXOWUDKLJKTXDOLW\FRORXUSULQWHUZLWKSULQWVSHHGRISDJHVPLQ
LQEODFNSDJHVPLQIXOOSDJHFRORU,QWHUIDFHVDUH&HQWURQLFVSDUDOOHODQG86%
3ULQWHUGULYHUVIRU:LQGRZVDQG17
Printers - Dot Matrix
Epson DFX8500 Line Printer
Epson DFX8000 Line Printer
(36');
(36');
aSLQGRWPDWUL[SULQWHUZLWKKLJKVSHHGSULQWLQJDWFSVLQGUDIWPRGHDQG
FSVLQ1/4PRGHSXVKDQGSXOOWUDFWRUIHHGVXSWRSDUWIRUPSULQWLQJ
SDUDOOHODQGVHULDO56&LQWHUIDFHV
aSLQGRWPDWUL[SULQWHUZLWKKLJKVSHHGSULQWLQJDWFSVLQGUDIWPRGHDQG
FSVLQ1/4PRGHSXVKDQGSXOOWUDFWRUIHHGVXSWRSDUWIRUPSULQWLQJ
SDUDOOHODQGVHULDO56&LQWHUIDFHV
Printers - Laser
Canon Copier 680 Multifunction Device Copier/Facsimile/Printer
CAN,COPIER680
FRSLHVPLQGLJLWDOFRSLHU=RRPUDWLRaDWLQFUHPHQWV[
GSLODVHUSULQWHUSDJHVPLQ3DUDOOHO86%0RGHPVSHHGNESV
ID[PRGHP*XSWRSDJHVLQPHPRU\RQHWRXFKVSHHGGLDOVFRGHG
VSHHG GLDOV )D[7HO DXWR VZLWFK VKHHW SDSHU WUD\ DQG VKHHW PXOWL
SXUSRVHWUD\
HP LaserJet 4200N
+3/$6(51
1HWZRUNDEOH$EODFNDQGZKLWHODVHUSULQWHUSDJHVPLQ0E5$00+]
SURFHVVRU&RQQHFWLYLW\,(((FRPSOLDQWSDUDOOHOLQWHUIDFHRSHQ(,VORWV
+3-HW'LUHFWQIDVWHWKHUQHWLQWHUQDO(,2SULQWVHUYHU/DQJXDJH+33&/
+33&/H3RVW6FULSWHPXODWLRQ
Canon Copier 380 Multifunction Device Copier/Facsimile/Printer
CAN,COPIER380
FRSLHVPLQGLJLWDOFRSLHU=RRPUDWLRaDWLQFUHPHQWV[
GSLODVHUSULQWHUSDJHVPLQ3DUDOOHO86%0RGHPVSHHGNESV
ID[PRGHP*XSWRSDJHVLQPHPRU\RQHWRXFKVSHHGGLDOVFRGHG
VSHHG GLDOV )D[7HO DXWR VZLWFK VKHHW SDSHU WUD\ DQG VKHHW PXOWL
SXUSRVHWUD\
Ż1(:Ż
HP LaserJet 4250TN Twin tray Networkable Laser Printer
+3/$6(571
8SWRSDJHVPLQ$XSWR[GSL0E5$00+]SURFHVVRU
+LVSHHG86%SRUW,(((%FRPSOLDQWSDUDOOHO(,2VORWV+3-HWGLUHFW
(PEHGGHG3ULQW6HUYHUIRUIDVW%DVH7;/DQJXDJH+33&/+33&/
H+33RVW6FULSW/HYHOHPXODWLRQ
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
TECHRENTALS 137
Printers
Business Equipment
Printers - Laser (cont’d)
HP Laserjet 5000N A4/A3 Laser Printer
HP Laserjet 5si MX with Duplexer
+3/$6(51
+3/$6(56,0;
7ZLQWUD\0+]5,6&SURFHVVRUGSLSDJHVPLQ$ODVHUSULQWHUVXLWDEOH
IRU:LQGRZVDQG0DFLQWRVKDSSOLFDWLRQV3&/FRPSDWLEOH3RVW6FULSWOHYHO0E
5$0XSJUDGHVWR0ESDSHUWUD\VLQFOXGHVKHHWPXOWLSXUSRVHWUD\DQG
VKHHWLQSXWSDSHU$DQG$FDVVHWWHV,QWHUIDFHVLQFOXGHSDUDOOHO56&
SLQVHULDODQG+3-HW'LUHFW1
SDJHVPLQODVHU[GSL0E5$0GXDO$$VKHHWSDSHUWUD\V
[VKHHWPXOWLSXUSRVHWUD\GXSOH[HUIRUGRXEOHVLGHGSULQWLQJ+33&/
DQG$GREH3RVW6FULSWOHYHOODQJXDJH,QWHUIDFHVLQFOXGHSDUDOOHO+3-HW'LUHFW
(WKHUQHWDQG/RFDO7DON
HP Laserjet 4000T Printer
7(.3+$6(5'3
+3/$6(57
SDJHVPLQ0+]5,6&SURFHVVRU$ODVHUSULQWHUZLWKUHVROXWLRQXSWR
GSL[SDSHUWUD\VLQFOXGLQJ[VKHHWLQSXWWUD\VIRUOHWWHU$OHJDO
DQG%[VKHHWHQYHORSHPXOWLSXUSRVHWUD\0E5$0LQWHUIDFHVLQFOXGH
SDUDOOHO56&VHULDO
HP Laserjet 4000TN Printer
+3/$6(571
SDJHVPLQ0+]5,6&SURFHVVRU$ODVHUSULQWHUZLWKUHVROXWLRQXSWR
GSL[SDSHUWUD\VLQFOXGLQJ[VKHHWLQSXWWUD\VIRUOHWWHU$OHJDODQG
%[VKHHWHQYHORSHPXOWLSXUSRVHWUD\0E5$0LQWHUIDFHVLQFOXGH
SDUDOOHO56&VHULDO/RFDO7DON%DVH7EDVH
HP Laserjet 4050TN Laser Printer
+3/$6(571
SDJHVPLQ 0+] 5,6& SURFHVVRU$ ODVHU SULQWHU ZLWK UHVROXWLRQ XS WR
GSL[SDSHUWUD\VLQFOXGLQJ[VKHHWLQSXWWUD\VIRUOHWWHU$OHJDODQG
%[VKHHWHQYHORSHPXOWLSXUSRVHWUD\0E5$0LQWHUIDFHVLQFOXGH
SDUDOOHO56&VHULDO/RFDO7DON%DVH7%DVH
HP Laserjet 8100 DN
+3/$6(5'1
SDJHPLQ$$ODVHUSULQWHU0E5$0XSWR0E+3)DVW5HV
GSLTXDOLW\6WDQGDUGLQSXWFDSDFLW\VKHHWVVKHHWPXOWLSXUSRVH
[VKHHWLQSXWWUD\V6WDQGDUGRXWSXWFDSDFLW\VKHHWVVKHHWVXS
GRZQ6WDQGDUGDXWRGXSOH[LQJXQLWFDSDEOHRIKDQGOLQJ[VKHHWV+3
3&/+33&/HDQG3RVW6FULSW/HYHO,QWHUIDFHVDUHELGLUHFWLRQDOSDUDOOHO
+3-HW'LUHFW1IRUIDVW(WKHUQHW%DVH7;
Tektronix Phaser 8200DP Colour Laser Printer
6ROLGLQNFRORUSULQWHUGSLUHVROXWLRQ0E5$0%XLOWLQDXWRPDWLF¿UVW
SDJHSUHYLHZDXWRPDWLFVLGHGSULQWLQJDQGFROODWHGSULQWLQJPD[SULQWVSHHG
SDJHVPLQIDVWFRORUPRGHSDJHVPLQVWDQGDUGPRGHWUDQVSDUHQFLHVDW
SDJHVPLQIDVWFRORUPRGHSDJHVPLQVWDQGDUGPRGHVKHHWSDSHU
WUD\3ULQWHUGULYHUV:LQ;3:LQ17[6XQ6[0DFLQWRVK
QHWZRUN LQWHUIDFHV VWDQGDUG HWKHUQHW 86% DQG ELGLUHFWLRQDO SDUDOOHO
$GREH3RVW6FULSW3&/FHPXODWLRQZLWKDXWRPDWLFVHQVLQJDQGVZLWFKLQJ
Tektronix Phaser 850DP Colour Laser Printer
7(.3+$6('3
6ROLG LQN FRORU SULQWHU GSL SULQWLQJ EXLOWLQ DXWRPDWLF ¿UVW SDJH SUHYLHZ
FROODWHGSULQWLQJPD[SULQWVSHHGVSDJHVPLQIDVWFRORUPRGHSDJHVPLQ
VWDQGDUG PRGH WUDQVSDUHQFLHV SDJHVPLQ IDVW FRORU PRGH SDJHV
PLQVWDQGDUGPRGH3ULQWHUGULYHUVIRU:LQ:LQ176
0DFLQWRVK1HWZRUNLQWHUIDFHVHWKHUQHW86%DQGELGLUHFWLRQDOSDUDOOHO
SRUW
Tektronix Phaser 860DP A4 Colour Laser
7(.3+$6('3
6ROLGLQNFRORUSULQWHUGSLUHVROXWLRQ0E5$0EXLOWLQDXWRPDWLF¿UVW
SDJHSUHYLHZDXWRPDWLFVLGHGSULQWLQJDQGFROODWHGSULQWLQJPD[SULQWVSHHG
SDJHVPLQIDVWFRORUPRGHSDJHVPLQVWDQGDUGPRGHWUDQVSDUHQFLHVDW
SDJHVPLQIDVWFRORUPRGHSDJHVPLQVWDQGDUGPRGH3ULQWHUGULYHUV
:LQ:LQ1760DFLQWRVK1HWZRUNLQWHUIDFHVVWDQGDUG
HWKHUQHW86%DQGELGLUHFWLRQDOSDUDOOHO
Xerox Laser Printer and Copier XD155DF
;(5&23;'')
SDJHPLQGLJLWDOFRSLHUSDJHPLQODVHUSULQWHULQRQHXQLW,QFOXGHVDXWRPDWLF
GRXEOHVLGHGFRS\LQJSDJHGRFXPHQWIHHGHU[VKHHWSDSHUWUD\V
[GSLUHVROXWLRQ
Xerox 21 Page/Minute Laser Printer N2125
;(5/$6(51
+LJKSULQWVSHHGSDJHPLQ5HVROXWLRQ[GSLVWDQGDUGPHPRU\0E
XSWR0EVWDQGDUG,QWHUIDFHVDUH(WKHUQHW,(((ELGLUHFWLRQDO
SDUDOOHODQG86%HPXODWHV3&/DQG3&/H$GREH3RVWVFULSW
Plotters
HP Designjet 450C A1 Colour Plotter
HP Designjet 500 A0 Graphics Printer
+3'-(7&$
+3'-(7$
$LQNMHWFRORUSULQWHUZLWK0E5$00D[5HVROXWLRQLQPRQRFKURPHGSL
UHVROXWLRQLQFRORXUGSLOLQHSULQWLQJIURPDV¿QHDVPPaPP,QWHUIDFHV
&HQWURQLFVSDUDOOHODQG56&VHULDO
$LQNMHWFRORXUSULQWHUZLWK0E5$00D[0EUHVROXWLRQXSWR[
GSL /LQHV DV ¿QH DV PP UROO IHHG DQG DXWR FXWWHU +33&/*8,
FRPSDWLEOH&HQWURQLFVSDUDOOHO,(((FRPSDWLEOH(&386%
Did you know?
TECHRENTALS offers a Damage Waiver option. For a small additional fee you can avoid
extra charges if our equipment is damaged whilst in your care.
Protect yourself against unexpected occurences - Talk to our friendly staff today
Some conditions may apply , not available on all equipment.
138
Call now!
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
www.trtelecom.com
BEARCOM
A division of TR Corporation
Communications solutions for every
business situation
from Motorola’s
Australasian Radio Dealer of the Year
Melbourne
Sydney
Newcastle
Gold Coast
Brisbane
Townsville
Darwin
Adelaide
Perth
New Zealand
freecall
1800 22 2327 (Australia)
0800 832 473 (New Zealand)
www.bearcom.net.au
www.bearcom.co.nz
sales
maintenance
engineering & design
rental
Communications
Table of contents
Radio solutions
CB & licence-free
Conventional
Conventional 5-tone
MPT
Digital radio networks
LTR
SMARTnet
Accessories
Service & maintenance
Engineering & system design
Rental solutions
Glossary of radio terms
About us
TR Coporation’s communication division provides innovative solutions across a spectrum of industries and business sizes. Our solutions
encompass two-way radio, satellite and GPS technology. Our customers including major government departments, blue chip organisations
DQGVPDOO±PHGLXPHQWHUSULVHV:KHWKHULW¶VRQHSRUWDEOHUDGLRPRELOHFRPPXQLFDWLRQVIRUDÀHHWRIYHKLFOHVRUDFRPSOH[)0V\VWHPIRUD
new gas plant; we can assist.
$ZDUGHGD0RWRUROD3UHPLHU5DGLR'HDOHUVKLSLQ%HDUFRPKDVVLQFHJURZQWREHFRPHWKH
FRXQWU\¶VODUJHVWDQGPRVWH[SHULHQFHGUDGLRFRPPXQLFDWLRQVVXSSOLHU
Hirecom are our specialised Adelaide-based team serving national and international industrial
customers in the heavy construction, petrochemical, manufacturing and mining sectors. Providing
rental of radio communications to this demanding sector has made them a valuable member of
the group.
%DVHGRQWKH*ROG&RDVW6N\FRPPSURYLGHORFDOVXSSRUWWRWKHPDQ\EXVLQHVVHVLQWKHUHJLRQ
LQFOXGLQJPDMRUWRXULVPIDFLOLWLHV7ZRZD\UDGLRVDWHOOLWHDQGWKHLURZQSXEOLFUDGLRQHWZRUNVDUH
just some of the solutions they offer.
6XSSRUWLQJ:HVW$XVWUDOLDQWZRZD\UDGLRFXVWRPHUVVLQFH0HPR&RPPXQLFDWLRQVLVWKHPRVW
recent addition to the TR group. Their own unique mobile data solutions compliment the traditional
)RUPRUHGHWDLOVRQDOORXUFRPPXQLFDWLRQVVSHFLDOLVWVJRWRZZZWUFRUSRUDWLRQFRPDX
142
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
Our solutions
Communications
Communication solutions
Whatever your business requirements, we’ll listen and offer an individual solution that is competitively priced, using leading radio communications
technology. The solutions we’ll offer use products that are renowned worldwide for their superior quality and cutting edge design - meaning you’ll
buy the best, from the best in the business.
Portable radios
&RPSDFW DQG UXJJHG 0RWRUROD SRUWDEOH UDGLRV
RIIHU UHOLDEOH FRPPXQLFDWLRQV IRU PRVW ZRUN
environments.
Specialised environments are also catered for with
ZDWHUSURRI)0RSWLRQVDQGDLUEDQGDYDLODEOH
0RELOHUDGLRV
Renowned for their durability and user-friendly
RSHUDWLRQ0RWRURODRIIHUDUDQJHRIPRELOHUDGLRV
IRULQYHKLFOHRUEDVHVWDWLRQDSSOLFDWLRQV7DONWRXV
DERXWÀH[LEOHPRELOHÀHHWFRPPXQLFDWLRQV
No.1 in communications
‡$XVWUDOLD¶VPRVWH[SHULHQFHG0RWRURODGHDOHUV
‡.QRZOHGJHDEOHVWDIIRIIHULQJH[SHUWDGYLFH
• Solutions suited to your business and budget
• Wide range of superior quality products
‡)XOOWHFKQLFDOVXSSRUWIRUWKHSURGXFWVZHVHOO
‡)OH[LEOHSXUFKDVHUHQWDORSWLRQV
• Locations across Australia
• One source for all your communications needs
sales • service • rental
*HQXLQH0RWRURODDFFHVVRULHV
Can dramatically improve the usability
and features of your radio. Whether it is
IRU D ³KDQGVIUHH´ ³)0´ RU D ³KLJK QRLVH´
HQYLURQPHQW WKHUH¶V D JHQXLQH 0RWRUROD
accessory designed to assist.
Service & maintenance
Whether it’s warranty repairs, spare parts, annual maintenance or even a
WDLORUHG FDOORXW FRQWUDFW ± RXU
service division will provide effective
and responsive support for your radio
equipment and system.
:LGHDUHDQHWZRUNV
If you need communications across town or
WKH VWDWH WKHQ D ³ZLGH DUHD QHWZRUN¶ PLJKW
be appropriate. The TR group has access
WR PDMRU QHWZRUNV$XVWUDOLDZLGH LQFOXGLQJ
RXU RZQ ³%($5QHW´ V\VWHP 0RWRUROD¶V 60$57QHW DQG 7HOVWUD¶V 605 WR
name a few.
)OH[LEOHSXUFKDVHRSWLRQV
Outright purchase, rental-purchase
or lease; whatever your budget
and business size we can assist
with tailored purchase options from
reputable vendors to suit needs.
Radio systems
)RU ODUJHU SURMHFWV DQG VSHFLDOLVHG
applications we will design an individual
radio system that provides reliable onsite
communications with a desired set of
features.
2XUHQJLQHHULQJWHDPZLOOZRUNZLWK\RXWR
GHVLJQDVROXWLRQVSHFL¿FWR\RXUQHHGVXVLQJ
WUXQNHGRUFRQYHQWLRQDO5)SURWRFROV
Visit our website
www.bearcom.net.au
Convenient rental
:KHWKHU\RXUQHHGVDUHVKRUWRUORQJWHUPDSURMHFWRUHYHQWRXUH[SHULHQFHG
rental team can provide well maintained equipment to cater
IRU\RXUH[SHFWHGRUXQH[SHFWHGGHPDQGV
• Two-way radio
• Satellite phones
• GPS
‡(3,5%¶V
BEARCOM
143
Communications
Products
Our radio products
(YHU\SURGXFWZHRIIHUKDVEHHQFDUHIXOO\FKRVHQIRUWKHFRPELQDWLRQRITXDOLW\GXUDELOLW\DQGEHQH¿WVLWRIIHUV$QGEHFDXVHZHVHOHFWVRFDUHIXOO\
ZHVWDQGEHKLQGHYHU\VROXWLRQZHGHOLYHU
Benefits of two-way radio
7KDW¶V DOVR ZK\ ZH GRQ¶W LPPHGLDWHO\ UXVK WR RIIHU HYHU\ FRPPXQLFDWLRQV VROXWLRQ WKDW KLWV WKH PDUNHW
We prefer to be selective and only those offering long term value to our customers will make our product
SRUWIROLR
Some of the other factors we consider when selecting products are the availability of spare parts, warranWLHVUHSDLUFRVWVDQGRIFRXUVHWKHUHSXWDWLRQRIWKHPDQXDIDFWXUHUWKHPVHOI
7KHEUDQGV\RX¶OO¿QGZLWKLQWKLVFDWDORJXHDUHDOOLQGXVWU\OHDGHUVDQGLQFOXGH0RWRUROD,FRP*0(5),
DQG0)%WRQDPHMXVWDIHZ
‡,QVWDQWDFFHVVWR\RXUVWDII
‡&RPSOLDQFHZLWK2+6UHTXLUHPHQWV
‡,PSURYHFXVWRPHUVHUYLFH
‡,QFUHDVHEXVLQHVVHI¿FLHQF\
‡5HGXFHRWKHUFRPPXQLFDWLRQVFRVWV
Locations around Australia & New Zealand
CB and licence-free products
*HWWLQJVWDUWHGZLWK0RWRURODLVDEUHH]HZLWKWKHVHFRPPHUFLDOTXDOLW\&%DQG
OLFHQFHIUHHUDGLRSURGXFWV
6XLWDEOH IRU DJULFXOWXUH FRQVWUXFWLRQ VFKRROV ORZOHYHO VHFXULW\ DQG MXVW DERXW
and any small business wanting affordable but easy-to-use communications tools,
ZLWKRXWVDFUL¿FLQJTXDOLW\
7KHUDQJHIHDWXUHGKHUHDUHEXLOWWRWKHVDPH0LOLWDU\VSHFL¿FDWLRQVDVWKHUHVWRI
WKH0RWRURODUDQJH
Economical and rugged, with no licenses, contracts or fees - communicate to one or
WRPDQ\ZLWKWKHSXVKRIDEXWWRQDQG0RWRUROD¶V&%RU:DOND7DONDUDQJH
Portable radios
Mobile radios
0RGHO
:DOND7DOND,,
%DQG
0RWRURODH[FOXVLYHEDQG
1R&KDQQHOV
16
3RZHURXWSXW
1-5 w
Key features
• 8 char display
• Scanning
‡1XLVDQFHFKGHOHWH
• Keypad lock
‡%DFNOLJKW
Standard pack
144
&%352
8+)&LWL]HQEDQG
&%
Model
GM CBPRO
%DQG
8+)&LWL]HQEDQG
1R&KDQQHOV
&%
3RZHURXWSXW
Key features
1-5 w
• 8 char display
‡EXWWRQVSUHSURJ
‡3ULPHFKDQQHO
• Scanning
‡1XLVDQFHFKGHOHWH
• Keypad lock
5DGLRDQWHQQDEDWWHU\EHOWFOLS
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
Standard pack
1-5 w
• 14 char display
• Scanning
• Nuisance channel delete
‡5HSHDWHUWDONDURXQG
‡5HPRWHPRXQWLQJRSWLRQ
5DGLR¿VWPLFPRXQWLQJEUDFNHWV
Products
Communications
Conventional radio products
6WD\DKHDGLQWRGD\¶VIDVWPRYLQJZRUOGZLWK0RWRUROD¶V3URIHVVLRQDO6HULHVWZRZD\UDGLRVEXLOWIRU\RXUEXVLQHVV1RPDWWHUZKDWSURIHVVLRQ\RX¶UH
LQ0RWRUROD¶VUDQJHRIFRQYHQWLRQDOUDGLRVJLYH\RXLQVWDQWDFFHVVWRWKHULJKWSHRSOHDQGLQIRUPDWLRQIRUHIIHFWLYHGHFLVLRQPDNLQJ
6XLWDEOHIRUPRVWVPDOOWRPHGLXPEXVLQHVVHVZKRQHHGVLPSOHFRPPXQLFDWLRQV7DONUDGLRWRUDGLRRUYLDDUHSHDWHUIRUH[WHQGHGUHDFK
Case study
Story Bridge Adventures
7KRVHZKRNQRZ%ULVEDQHZLOOEHIDPLOLDUZLWKWKHLFRQLF6WRU\%ULGJH
VSDQQLQJ WKH %ULVEDQH 5LYHU ,WV GUDPDWLF VKDSH LV WKH VHWWLQJ IRU
WKH QHZO\ RSHQHG 6WRU\ %ULGJH $GYHQWXUH &OLPE RQH RI RQO\ WKUHH
bridge climbs in the world and cleverly designed to give climbers an
uninterrupted 360º view of
WKH%ULVEDQHVN\OLQH
7KHUHVXOW±0RWRUROD*3SOXVSRUWDEOHV
and the ingenious Temple Transducer
KHDGVHWDQH[FHSWLRQDODXGLRWRROWKDWXVHV
advanced technology to transmit sound by
YLEUDWLRQWKURXJKWKHWHPSOHWRWKHHDU7KH
crisp, clear audio it produces truly needs to
be heard to be believed and climbers are
When the climb operators
thrilled with the added safety the system
DSSURDFKHG %HDU&RP IRU
SURYLGHV
a communications solution,
ruggedness and reliability With demand high from both locals and
ZHUHNH\GHVLUDEOHV
tourists alike, the number of climbs per day
has already increased in the few months
The solution also needed
VLQFHWKHFOLPERSHQHG
to be compact so it could
EHFDUULHGHDVLO\DQGSURYLGHKDQGVIUHHFRPPXQLFDWLRQV7KHUDGLRV Needless to say, the climb operators are very happy with both their
were to provide a link between climbers for safety reasons and to allow 0RWRURODFRPPXQLFDWLRQVVROXWLRQDQGWKHVXFFHVVRIWKH6WRU\%ULGJH
FRPPHQWDU\WKURXJKRXWWKHFOLPE
$GYHQWXUHV
Portable radios
0RGHO
*3
*3
%DQG
1RFKDQQHOV
*3SOXV
*3SOXV
9+)8+)0+=
4 or 16
%DVLFIHDWXUHV
$GGLWLRQDOIHDWXUHV
Standard pack
Visit our website
www.bearcom.net.au
4 or 16
FK
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡/('EDWWHU\JDXJH‡3/'3/
‡(PHUJHQF\VLUHQ‡0'&VLJQDOOLQJ
‡&KDQQHOVFDQ
‡2SWLRQV6WXEE\DQWHQQD9RLFHVWRUDJHERDUG
'70)GHFRGH0DQGRZQERDUG)0
• 14 char display
‡1DPHWRQHWDJJLQJ
‡7RQHWDJJLQJFKRQO\
• Lithium battery
• 14 char display
‡0HQXNH\V
‡1DPHWRQHWDJJLQJ
• Status messages
5DGLRDQWHQQDEDWWHU\EHOWRUKROVWHUFOLS
BEARCOM
145
Products
Communications
Mobile radios
*0
*0
%DQG
4
1RFKDQQHOV
*0
160
8
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡0'&VLJQDOOLQJ‡5HSHDWHUWDONDURXQG
‡([WHUQDODODUP‡&KDQQHOVFDQ
‡2SWLRQV5HPRWHPRXQW92;9RLFHVWRUDJHIRRWVZLWFK
‡SURJUDPPDEOHEXWWRQV
•
•
•
•
14 char display
4 programmable buttons
Dual priority scan
Status call
64
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
• LED status indicator
• Nuisance channel delete
‡5HSHDWHUWDONDURXQG‡([WHUQDODODUP
‡2SWLRQV5HPRWHPRXQW92;9RLFHVWRUDJHIRRWVZLWFK
• 14 char display
• 7 programmable buttons
‡)XOONH\SDG
‡%XLOWLQYRLFHVWRUDJH
Standard pack
GM3688
9+)8+)0+]
Key features
([WUDIHDWXUHV
*0
9+)0+]8+)0+]
‡SURJUDPPDEOHEXWWRQV
‡&KDQQHOVFDQ
• 8 char display
• 4 programmable buttons
‡%XV\FKDQQHOORFNRXW
• Dual priority scan
• Nuisance channel delete
5DGLREDVHWUD\¿VWPLFPRXQWLQJEUDFNHWV
Conventional “5-tone” radio products
Portable radios
0RGHO
*3
*3
%DQG
1RFKDQQHOV
Key features
*3SOXV
*3SOXV
9+)0+]
8+)0+]
16
16
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡/RQHZRUNHU‡6WXQXQVWXQ
‡&KDQQHOVFDQ‡6LJQDOOLQJ±3ULYDWHOLQHWRQH
‡5HSHDWHUWDONDURXQG‡9RWLQJ
‡2SWLRQV0DQGRZQERDUG9RLFHVWRUDJH92;
6WXEE\DQWHQQD/LWKLXP,RQEDWWHU\)0
• 14 char display
‡)XOO'70)NH\SDGZLWKORFN
• Name tagging
• 100 number contact list
([WUDIHDWXUHV
Standard pack
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡/LWKLXP,RQEDWWHU\‡/RQHZRUNHU
‡&KDQQHOVFDQ‡6LJQDOOLQJ±3ULYDWHOLQHWRQH
‡5HSHDWHUWDONDURXQG
‡2SWLRQV0DQGRZQERDUG9RLFHVWRUDJH92;)0
• 14 char display
‡)XOO'70)NH\SDGZLWKORFN
• Name tagging
• 100 number contact list
5DGLRDQWHQQDEDWWHU\EHOWKROVWHUFOLS
Mobile radios
0RGHO
*0
%DQG
1RFKDQQHOV
Key features
([WUDIHDWXUHV
Standard pack
146
*0
*0
9+)0+]
8+)0+]
10
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
• 14 char display
• Lone worker
• Voting
• Signalling – 5 tone
‡6WDWXVFDOO‡6WXQ8QVWXQ
‡2SWLRQV5HPRWHPRXQW92;9RLFHVWRUDJHIRRWVZLWFK
• 4 programmable buttons
*0
9+)0+]
8+)0+]
100
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡5HSHDWHUWDONDURXQG‡/RQHZRUNHU
‡6LJQDOOLQJ±WRQH‡SLQDFFHVVRU\SRUWIRUGDWD*36
‡6WDWXVFDOO‡6WXQ8QVWXQ
‡2SWLRQV5HPRWHPRXQW92;9RLFHVWRUDJHIRRWVZLWFK
‡)XOONH\SDG
‡%XLOWLQYRLFHVWRUDJH
• 7 programmable buttons
‡SURJUDPPDEOHEXWWRQV
• 1 char channel display
5DGLREDVHWUD\¿VWPLFPRXQWLQJEUDFNHWV
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
• 3 programmable buttons
• 8 char display
‡QXPEHUFRQWDFWOLVW
Communications
Products
MPT radio products
$QLQWHUQDWLRQDOO\UHFRJQLVHGWUXQNLQJSURWFRO037RIIHUVFRQVXPPDWHV\VWHPFRQWURODQGVXEVFULEHUPDQDJHPHQW1RRWKHUSURWRFRO
PDWFKHVWKHYHUVDWLOLW\LQWKHHFRQRPLHVRIVFDOHDSSDUHQWLQ037:LWK0RWRUROD¶VZLGHUDQJHRIPRELOHDQGSRUWDEOH037FDSDEOHUDGLRV
ERWKVPDOODQGODUJHXVHUJURXSVFDQQRZWDSLQWRWKLVSRZHUIXOQHWZRUN
&KRVHQIRU7HOVWUD¶V605QHWZRUNVEHFDXVHRILW¶VLQWHUQDWLRQDOVWDQGDUG037LVDOVRWKHFKRLFHRIVHYHUDO%HDUFRPFXVWRPHUVLQFOXGLQJ
PDMRUSXEOLFYHQXHVLQ0HOERXUQH
Portable radios
Model
PTX700
%DQG
1RSRVLWLRQV
PTX760
PTX780
PTX700plus
PTX760plus
9+)0+]
8+)0+]
4
Key features
60
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡&KDQQHOVFDQ‡6LJQDOOLQJ±3ULYDWHOL
‡5HSHDWHUWDONDURXQG
‡2SWLRQV0DQGRZQERDUG9RLFHVWRUDJH92;
6WXEE\DQWHQQD/LWKLXP,RQEDWWHU\)0
• 14 char display
• Keypad
([WUDIHDWXUHV
Standard pack
‡ZSRZHURXWSXW‡.+]FKDQQHOVSDFLQJ
‡/LWKLXP,RQEDWWHU\‡&KDQQHOVFDQ
• Signalling –
‡5HSHDWHUWDONDURXQG‡9RWLQJ
‡2SWLRQV0DQGRZQERDUG9RLFHVWRUDJH92;)0
• 4 line display
• Keypad
• Voice storage
‡&KDUGLVSOD\
• Keypad
5DGLRDQWHQQDEDWWHU\EHOWKROVWHUFOLS
Mobile radios
Model
MCX700
%DQG
‡0$3GDWDER[
4
60
‡Z
‡.+]FKDQQHOVSDFLQJ
‡%XLOWLQYRLFHVWRUDJH
• Display
• Dynamic regrouping
• Short data message
‡5HPRWHPRXQWFRQWUROKHDGRSWLRQ
• 4 programmable buttons
‡0LVVHGFDOO
• 100 number contact list
([WUDIHDWXUHV
Standard pack
MCX780
9+)0+]
8+)0+]
1RSRVLWLRQV
Key features
MCX760
Data head only
Visit our website
www.bearcom.net.au
• 7 programmable buttons
‡)XOONH\SDG
‡2SWLRQDO0$3FRQWUROKHDG
5DGLREDVHWUD\¿VWPLFPRXQWLQJEUDFNHWV
BEARCOM
147
Products
Communications
LTR radio products
7DNH\RXUFRPPXQLFDWLRQV\VWHPWRDZKROHQHZOHYHOZLWK/75WUXQNLQJFDSDELOLWLHV(I¿FLHQWDQGFRVWHIIHFWLYH/75RU/RJLF7UXQNHG5DGLR
1RJLYHV\RXDZLGHUFDOOLQJUDQJHIDVWHUFKDQQHODFFHVVJUHDWHUSULYDF\SOXVKLJKHUXVHUDQGWDONJURXSFDSDFLW\
6XLWDEOHIRULQKRXVHV\VWHPDSSOLFDWLRQVRUSXEOLFDFFHVVQHWZRUNVLQGHHG%HDU&RP¶VYHU\RZQ%($5QHWSXEOLFQHWZRUNXWOLVHVWKH/75WUXQNLQJ
SURWRFRO
CASE STUDY:
Melbourne Exhibition and Convention Centre
,QWKH¿UVWVWDJH0RWRUROD*3/6SRUWDEOHVZHUHLQWURGXFHGWRWKH
ÀHHW WKHLU GXDO FDSDELOLW\ PHDQLQJ WKH\ FRXOG EH XVHG RQ ERWK WKH
H[LVWLQJFRQYHQWLRQDORUIXWXUH/75V\VWHP
7KHQH[WVWHSVDZDWDLORUHGFKDQQHO/75V\VWHPGHVLJQHGDQGEXLOW
IRUWKHYHQXHKDQGOLQJZLWKHI¿FLHQF\WKHODUJHQXPEHURIWDONJURXSV
WKH\UHTXLUHGIRUWKHYDULRXVGHSDUWPHQWVZLWKLQWKHIDFLOLW\
$VWKH¿QDOVWHSWKHXOWUDVPDOO*3;/6KDVEHHQLQWURGXFHGWRWKH
ÀHHWSURYLGLQJDFRPSDFWVROXWLRQWKDWOLJKWHQVWKHORDGIRUWKHPDQ\
VWDIIUXQQLQJHDFKHYHQW
/RQJ WLPH XVHUV RI 0RWRUROD UDGLR HTXLSPHQW 0(&& KDG DOZD\V
intended to implement a system that better catered for their growing
QHHGV:LWKWZRVLWHVRQHLWKHUEDQNRIWKH<DUUD5LYHULQWKH0HOERXUQH
&%'DQGQXPHURXVVWDIIJURXSVWKHH[LVWLQJFRQYHQWLRQDOV\VWHPKDG
EHHQRXWJURZQ
%HDU&RPKHOSHGWKH0(&&PDQDJHPHQWWHDPGHYHORSDVWDJHGSODQ
WRPRYHJUDGXDOO\WRDQLQKRXVH/75V\VWHPRYHUDIHZ\HDUV7KH
SODQDOVRFDWHUHGIRUDJUDGXDOLQYHVWPHQWWKDW¿WLQZLWKWKHLUEXGJHW
7KH0(&&DUHYHU\VDWLV¿HGZLWKERWKWKHVROXWLRQDQGWKHUHVSRQVLYH
FXVWRPHUVHUYLFHWKH\UHFHLYHIURP%HDU&RP
%HLQJDWRWDOVROXWLRQVSURYLGHUPHDQV%HDU&RPLVDEOHWRSURYLGHWKH
venue with not only equipment, but also maintenance and latest model
0RWRURODUHQWDOUDGLRVWRVXSSOHPHQWWKHLUÀHHWIRUPDMRUHYHQWV
0RWRUROD/75DQGWKH0(&&WKHSHUIHFWHYHQWSDUWQHUVKLS
Mobile radios
Portable radios
0RGHO
*3/6
1RSRVLWLRQV
1RFKDQQHOV
8+)0+]
WUXQNHG]RQHZLWKWDONJURXSV
16 conventional ch
Key features
([WUDIHDWXUHV
*3/6
WUXQNHG]RQHVZLWKWDONJURXSV
HDFRQYHQWLRQDOFK
*3;/6
9+)
8+)0+]
WUXQNHG]RQHVZLWKWDONJURXSV
HDFRQYHQWLRQDOFK
• 1-4 w power output
‡.+]FKDQQHOVSDFLQJ
‡/75FRQYHQWLRQDOPRGH
‡0'&VLJQDOOLQJ
• Emergency button
• Nuisance channel delete
‡5HSHDWHUWDONDURXQG
‡2SWLRQV6WXEE\DQWHQQD'70)GHFRGH9RLFHVWRUDJH.H\SDGUHWUR¿W)0
• 3 programmable buttons
• Single priority scan
Standard pack
Visit our website
www.bearcom.net.au
• 6 programmable buttons
• Home channel revert
‡)XOONH\SDGZLWKORFN
• Dual priority scan
0RGHO
*0/6
%DQG
8+)0+]
1RFKDQQHOV
WUXQNHG]RQHVWDONJURXSVHDFK
16 conventional ch
Key features
‡ZSRZHURXWSXW
‡.+]FKDQQHOVSDFLQJ
• 14 char display
• 4 programmable buttons
‡5HSHDWHUWDONDURXQG
‡%XLOWLQYRLFHVWRUDJH
‡$GYDQFHG0'&VLJQDOOLQJ
‡&DOODOHUW
‡&DOOHU,'
• 14 char display
• 6 programmable buttons
‡)XOONH\SDGZLWKORFN
• Dual priority scan
‡4XLFN&DOO,,VLJQDOOLQJ
‡/LWKLXP,RQEDWWHU\
5DGLRDQWHQQDEDWWHU\EHOWKROVWHUFOLS
BEARCOM
149
Products
Communications
SMARTnet radio products
0RWRUROD¶VRZQWUXQNLQJSURWRFRO60$57QHWLVXVHGH[WHQVLYHO\E\ODUJHFXVWRPHUVZLWKVRSKLVWLFDWHGV\VWHPUHTXLUHPHQWVDQGE\WKRVHRQ
0RWRUROD¶VSXEOLFQHWZRUNVDURXQG$XVWUDOLD
Portable radios
Mobile radios
0RGHO
0RGHO
07;
07;
%DQG
9+)0+]
8+)0+]
1RWDONJURXSV
V\VWHPVWDONJURXSV
10 conventional channels
Key features
• 1-5 w power output
‡.+]FKDQQHOVSDFLQJ
‡$XWRPDWLF0XOWLSOH6LWH6HOHFWLRQ$066
• Emergency alarm
‡7DONJURXSFRQYHQWLRQDOVFDQ
‡)DLOVRIWRSHUDWLRQ
• Selective radio inhibit
‡2SWLRQV6WXEE\DQWHQQD/LWKLXP,RQEDWWHU\
([WUDIHDWXUHV
• 16 modes
• 4 programmable buttons
‡3ULYDWHFDOOGHFRGH
‡&DOODOHUWGHFRGH
• Telephone interconnect decode
Standard pack
0$;SOXV
%DQG
8+)0+]
1RWDONJURXSV
WUXQNHGV\VWHPVWUXQNHGWDONJURXSV
10 conventional channels
Key features
Standard pack
• 15 w power output
• 3 char display
• Wide area roaming
‡3ULYDWHFRQYHUVDWLRQ
‡+RUQOLJKWDFWLYDWLRQ
‡7DONJURXSFRQYHQWLRQDOVFDQ
‡)DLOVRIWRSHUDWLRQ
‡&DOODOHUW
• Telephone interconnect
5DGLREDVHWUD\¿VWPLFPRXQWLQJEUDFNHWV
• 14 char display
• Keypad
‡PRGHV
• Umlimited private call
• Unlimited call alert
• Telephone interconnect
5DGLRDQWHQQDEDWWHU\EHOWFOLS
CASE STUDY:
Security industry leader ADVENT chooses Motorola, for contact and control
$GYHQW6HFXULW\6HUYLFHVDUHD$XVWUDOLDQRZQHGFRPSDQ\SURYLGLQJ SURGXFWVZDVVHOHFWHGWRSURYLGHÀH[LELOLW\DQGUHOLDELOLW\
VHFXULW\ VHUYLFHV WR ERWK WKH SXEOLF DQG SULYDWH VHFWRU ZLWK RI¿FHV LQ
0HOERXUQH6\GQH\$GHODLGHDQG1HZ=HDODQG
7KH0RWRUROD07;
portable was selected
With numerous industry awards under their belt the organisation is highly IRU LWV VPDOO VL]H DQG
focused on their customers and delivering superior quality service, a durability, combined
FRPPLWPHQWWKDWLVUHÀHFWHGLQWKHLUPRWWR³([FHOOHQFHLQ6HFXULW\´
ZLWK 0$; PRELOH
radios for both vehicle
$GYHQW¶V 16: VWDWH PDQDJHU 0DUN ,]]DUG LV KRQHVW DERXW WKH IDFW WKH\ DQG EDVH VWDWLRQ XVH
actively seek out the best in order to deliver the best service to their Depending on the
YDOXHGFOLHQWV,WLVWKLVIRFXVWKDWOHGWKHPWR%HDU&RPWRXSJUDGHWKHLU site, communications
is either by onsite
FRPPXQLFDWLRQVV\VWHPV
0RWRUROD
&'5
)RUDQXPEHURI\HDUV$GYHQWKDGXVHGPRELOHSKRQHVIRUWKHPDMRULW\RI repeater or SmartNet
their business communications, with the use of radios limited to selected QHWZRUN
VLWHVDQGMREV:LWK2+6LVVXHVDQGQDWLRQDOVDIHW\EHFRPLQJKLJKHU
SULRULWLHV $GYHQW LQ 16: ZHUH ORRNLQJ DW ZD\V WR LPSOHPHQW D PRUH 7KH FKRVHQ 0RWRUROD
HIIHFWLYH FRPPXQLFDWLRQV V\VWHP WKDW ZDV ÀH[LEOH DQG FRVW HIIHFWLYH solution works very
providing communications for permanent sites but also allowing for the ZHOOSURYLGLQJ$GYHQW6HFXULW\LQ6\GQH\ZLWKWKHULJKWWRROVIRUHIIHFWLYH
FRQWDFWDQGFRQWURORIWKHLUVWDII
FDVXDOMREVWKDWDUHDQRQJRLQJSDUWRIVHFXULW\
Searching for the best solution entailed a trial, conducted on selected sites
LQ 6\GQH\ XVLQJ ROGHU PRGHO 0RWRUROD SRUWDEOH UDGLRV RQ WKH 6PDUW1HW
V\VWHPWKHEHQH¿WVZHUHLPPHGLDWHO\IHOWDQGWKHQH[WVWHSZDVWDNHQ
$IWHU DVVHVVLQJ WKHLU QHHGV FDUHIXOO\ D FRPELQDWLRQ RI 0RWRUROD UDGLR
150
$IWHUDOOZKHQ\RX¶UHFRPPLWWHGWRH[FHHGLQJFXVWRPHUH[SHFWDWLRQVOLNH
$GYHQWDUH\RXFDQ¶WDIIRUGWRFKRRVHDFRPPXQLFDWLRQVWRROWKDWGRHVQ¶W
GHOLYHUWKHJRRGVHYHU\WLPH
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
Products
Communications
Product focus:
Motorola Impress battery system - “Smart’ batteries help you manage your assets
)HDWXUHVRIWKH,PSUHVVV\VWHP
‡3OXJSOD\VLQJOHDQGPXOWLXQLWFKDUJHUV
‡$XWRPDWHVEDWWHU\PDLQWHQDQFH
‡2SWLPLVHVEDWWHU\F\FOHOLIH
‡5HFRQGLWLRQV\RXUEDWWHU\WRVXLWLWVLQGLYLGXDOUHTXLUHPHQWV
‡/&'GLVSOD\RSWLRQIRUPRUHGHWDLOHGFRPPXQLFDWLRQ
‡5HPRYHVWKHJXHVVZRUNIURPEDWWHU\PDLQWHQDQFH
‡&KDUJHUFDQVWLOOEHXVHGZLWK³QRUPDO´EDWWHULHV
‡8OWLPDWHO\LWPD[LPLVHV\RXUUDGLRWDONWLPH
0RWRUROD¶V,PSUHVV6PDUW(QHUJ\6\VWHPŒLVDUHYROXWLRQDU\EDWWHU\FKDUJLQJDQGUHFRQGLWLRQLQJVROXWLRQ,WDXWRPDWHV
EDWWHU\PDLQWHQDQFHRSWLPLVHVF\FOHOLIHDQGPD[LPLVHVUDGLRWDONWLPH±\RXUUDGLRV\VWHPZLOOEHFKDUJHGDQGUHDG\WR
JRWKHQ\RXQHHGWRFRPPXQLFDWH
:KHQ SODFHG LQ WKH ³6PDUW´ FKDUJHU WKH EDWWHU\ LV DQDO\VHG DQG GLVFKDUJHG EHIRUH EHLQJ FRPSOHWHO\ UHFKDUJHG $Q\
LVVXHVZLWKWKHEDWWHU\ZLOOEHLGHQWL¿HGDQGGHDOWZLWKGXULQJWKHDGDSWLYHUHFRQGLWLRQLQJSURFHVV$GLJLWDOGLVSOD\ZLOO
FRPPXQLFDWHWKURXJKRXWWKHSURFHVVDQGDGYLVHZKHQWKHEDWWHU\LVQRORQJHUVXLWDEOHIRUXVHPXOWLXQLWPRGHOV
,QVKRUWWKH,PSUHVVV\VWHPWDNHVWKHJXHVVZRUNRXWRIPDQDJLQJUDGLREDWWHULHVZLWKÀH[LEOHFKDUJHURSWLRQVDOORZLQJ
EDWWHU\PDLQWHQDQFHWREHPDQDJHGE\LQGLYLGXDOUDGLRXVHUVWRRZLWKRXWWKHQHHGIRUWUDLQLQJRUVSHFLDOLVHGNQRZOHGJH
:H¶UHH[FLWHGWRDQQRXQFHWKDWWKH,PSUHVVV\VWHPLVQRZDYDLODEOHIRUWKHPRVWSRSXODUPRGHORIUDGLR0RWRUROD¶V:DULV
VHULHV*3VHULHV07;VHULHV37;VHULHV
&DOOXVIRUDEURFKXUHDQGSULFLQJRQWKH0RWRUROD,PSUHVVV\VWHP
6XLWDEOHIRU
‡$Q\FXVWRPHUZLWKODUJHQXPEHUVRIEDWWHULHVWRPDQDJH
‡$Q\RQHZKRZDQWVWRPD[LPLVHWKHLUEDWWHU\OLIH
DID YOU KNOW?
7KDW0RWRUROD¶V$FFHOHUDWHG/LIH7HVWLQJVLPXODWHV¿YH\HDUVRI
hard use in real conditions?
(TXLSPHQWLVVXEMHFWHGWRVKRFNYLEUDWLRQGXVWDQGKXPLGLW\
7KLVHQVXUHVDOO0RWRURODSURGXFWGHVLJQVVWDQGWKHWHVWLQD
FRPPHUFLDOHQYLURQPHQW
No wonder it’s tough gear!
Visit our website
www.bearcom.net.au
BEARCOM
151
Products
Communications
Radio accessories
The right accessory can dramatically improve the usability of your two-way
UDGLRDQG0RWRURODOHDGWKHZD\ZLWKUREXVWDQGXVHUIULHQGO\DFFHVVRULHV
IRUWKHLUUDQJHRISURIHVVLRQDOUDGLRV
:KDWHYHU \RXU QHHG ± KDQGVIUHH DXGLR ³6PDUW´ EDWWHU\ PDQDJHPHQW
VXUYHLOODQFHRU)0±WKHUH¶VD0RWRURODDFFHVVRU\ULJKWIRU\RX
%HORZ LV MXVW D VPDOO VDPSOH RI WKH H[WHQVLYH UDQJH RI 0RWRUROD *HQXLQH
DFFHVVRULHV6KRXOG\RXKDYHVRPHWKLQJVSHFLDOLVHGLQPLQGWKDW\RXGRQ¶W
VHHEHORZSOHDVHWDONWRXV
DID YOU KNOW?
7KH0RWRUROD2ULJLQDOLFRQLV\RXUJXDUDQWHHRITXDOLW\
,W JXDUDQWHHV WKDW WKH 0RWRUROD DFFHVVRU\ \RX DUH
XVLQJKDVEHHQGHVLJQHGWRZRUNVSHFL¿FDOO\ZLWK\RXU
0RWRURODUDGLRDQGWKDWLWKDVEHHQWHVWHGWRHQVXUHLW
LVXSWRWKHMRE
6R ZKHQ XVLQJ 0RWRUROD UDGLRV DOZD\V FKRRVH
DFFHVVRULHV WKDW KDYH WKH 0RWRUROD 2ULJLQDO WDJ \RX¶OO
DSSUHFLDWHWKHGLIIHUHQFH
Batteries
3011
P$K1L0++LJK&DSZLWKEHOWFOLS
+11
P$K8OWUD+LJK&DS
-011
P$K/L,RQVOLP3OXVPRGHOV
-011
P$K/L,RQ+L&DS3OXVPRGHOV
HNN9013
1200 mAh Lithium Ion
HNN9011
1260 mAh FM NiCad
Chargers
HTN3006
6LQJOH8QLW&KDUJHU
3071
0XOWL8QLW&KDUJHU
:3/1
,PSUHV0XOWL8QLW&KDUJHUZLWK'LVSOD\
-0=1
+ROVWHUZLWK&OLS3OXVPRGHOV
+/1
1\ORQ%HOW/RRS&DUU\&DVH
Carrying accessories
+/1
%HOW&OLS
152
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
+/1
/HDWKHU%HOW/RRS&DUU\&DVH
Products
Communications
Antenna
Get mobile!
Did you know there is a range of
accessories which increase usability
RI \RXU 0RWRUROD UDGLR RQ WKH URDG
and add to driver safety?
30$(
6WXEE\8+)DQWHQQD
0+]
1$(
6WDQGDUG8+):KLS$QWHQQD
0+]
In-vehicle accessories
EN1008
0RELOH9HKLFOH$GDSWHU
+HUH¶V MXVW D IHZ RI WKH XQLTXH
VROXWLRQV DYDLDEOH IRU 0RWRUROD PRELOH
UDGLRVDQGEDVHVWDWLRQV
‡)RRWVZLWFKHVIRUKDQGVIUHHDFWLYDWLRQ
‡5HPRWHVSHDNHUPLFURSKRQHV
‡0RXQWLQJVROXWLRQVIRUGLIIHUHQWYHKLFOHDSSOLFDWLRQV
‡([WHUQDOVSHDNHUVDQGKRUQV
‡$QWHQQDFDEOHRSWLRQV
5/1
7UDYHO&KDUJHU
Audio accessories
+/1
$XGLRDFFHVVRU\DGDSWRU
30/1
0DJ2QHHDUEXGZLWKLQOLQH
PLFURSKRQHDQG377
30/1
0DJ2QHUHFHLYHUZLWKLQOLQH
PLFURSKRQHDQG377
30/1
0DJ2QHRYHUWKHHDUHDUSLHFH
30/1
0DJ2QHLQWKHHDUHDUSLHFH
$$+01
5HPRWHVSHDNHUPLFURSKRQH
$$+01
Noise-canceling remote speaker microphone
ZLWKPPMDFN
(DUSLHFHWRVXLWQRLVHFDQFHOLQJ560
-011
5HPRWHVSHDNHUPLFURSKRQH
3OXVPRGHOV
$=501
:LUH6XUYHLOODQFHNLW
30/1
Surveillance kit with acoustic tube
30/1
ZLUHVXUYHLOODQFHNLW
3OXVPRGHOV
501
Temple transducer
(101
1RLVH&RPP
$=501
0HGLXPZHLJKWKHDGVHWZLWKLQOLQH377
%'1
Heavy duty headset
Visit our website
www.bearcom.net.au
BEARCOM
153
BEARCOM
A division of TR Corporation
Service and maintenance solutions
for every business situation
from Motorola’s
Australasian Radio Dealer of the Year
Melbourne
Sydney
Newcastle
Gold Coast
Brisbane
Townsville
Darwin
Adelaide
Perth
New Zealand
freecall
1800 22 2327 (Australia)
0800 832 473 (New Zealand)
www.bearcom.net.au
www.bearcom.co.nz
warranty repairs
fixed price repairs
fm repairs
installation
field service
maintenance agreements
research & design
Service & Maintenance
Communications
Service & Maintenance Solutions
7KH75JURXS¶VFRPPXQLFDWLRQVHUYLFHGLYLVLRQRIIHUVFRPSOHWHDIWHUVDOHVVXSSRUW
IRU\RXUUDGLRFRPPXQLFDWLRQVHTXLSPHQWDQGV\VWHPV
Whether it’s the simple installation of a single radio into a vehicle, warranty repairs,
VSDUHSDUWVRUDFRPSUHKHQVLYHPDLQWHQDQFHFRQWUDFWZKDWHYHU\RXUVHUYLFH
QHHGVDUHZHFDQDVVLVW
1DWLRQDO5HSDLU&HQWUH
2XU1DWLRQDO6HUYLFH&HQWUHLVORFDWHGLQ%ODFNEXUQ1RUWK9LFWRULD0DQDJHGE\DQ
H[SHULHQFHG6HUYLFH0DQDJHUWKHWHDPLQFOXGHV0RWRURODWUDLQHGUHSDLUWHFKQLFLDQV
H[SHULHQFHGLQVWDOOHUV¿HOGWHFKQLFLDQVDQGDGHGLFDWHGVHUYLFHFRRUGLQDWRU&ORVH
SUR[LPLW\ WR 0RWRUROD¶V RZQ QDWLRQDO KHDGTXDUWHUV DOORZV IDVW DFFHVV WR SDUWV DQG
DGGLWLRQDOWHFKQLFDOVXSSRUWZKHQUHTXLUHG
Local technical support
5DGLRUHSDLUVFDQEHORGJHGDWORFDWLRQVDFURVV$XVWUDOLDZLWKIXOOUDGLRZRUNVKRSVLQ0HOERXUQH6\GQH\%ULVEDQHDQG3HUWKDWWKLVWLPHDQGPRUH
RQWKHZD\0DQDJHGE\DQH[SHULHQFHGORFDO6HUYLFH0DQDJHUHDFKZRUNVKRSSURYLGHVRQVLWHLQVWDOODWLRQDQGGULYHZD\VHUYLFHSOXV¿HOGWHFKQLFDO
VXSSRUW$GHGLFDWHGVHUYLFHFRRUGLQDWRULQHDFKFHQWUHHQVXUHVSURPSWFXVWRPHUVHUYLFH
0RWRUROD$SSURYHG
:HDUHDFFUHGLWHGDVD/HYHO0RWRURODZDUUDQW\UHSDLUHUZLWKH[WHQVLYHH[SHULHQFHRQPRVWPRGHOVZLWKLQWKH0RWRURODIDPLO\ERWKQHZDQGROG
Service solutions
Warranty repairs
We are accredited to undertake warranty repairs
WR0RWRURODUDGLRHTXLSPHQW
)L[HGSULFHUHSDLUV
$UH DYDLODEOH IRU WKH PRVW SRSXODU PRGHOV RI
0RWRURODUDGLRSURYLGLQJDFRVWHIIHFWLYHRSWLRQ
)05HSDLUV
We are currently undergoing approval for
DFFUHGLWDWLRQ WR UHSDLU )0 UDGLR HTXLSHPW D
VHUYLFHZHKRSHWRRIIHULQWKHQHDUIXWXUH
Spare parts
:HRIIHUFRPSHWLWLYHSULFLQJRQ*HQXLQH0RWRUROD
SDUWVDQGDFFHVVRULHV
0DLQWHQDQFH$JUHHPHQWV
)RU RUJDQLVDWLRQV ZKHUH UHOLDEOH FRPPV DUH
RSHUDWLRQFULWLFDO ZH¶OO WDLORU D 0DLQWHQDQFH
$JUHHPHQW WKDW SURYLGHV GHGLFDWHG DQG
responsive technical support as needed, even
LIGHVLUHG
3UHYHQWDWLYHPDLQWHQDQFH
3UHYHQWDWLYHPDLQWHQDQFHDOORZVDQRUJDQLVDWLRQ
to better predict the reliability of their equipment,
DQG RIWHQ DYRLG FRVWO\ HPHUJHQF\ UHSDLUV
Let us tailor a maintenance schedule that
PDLQWDLQV WKH UHOLDELOLW\ RI \RXU UDGLR ÀHHW DQG
SUHYHQWVXQH[SHFWHGGRZQWLPHFDXVHGE\IDXOW\
HTXLSPHQW
,QVWDOODWLRQ
2IPRELOHUDGLRVPRELOHSKRQHVGDWDWHUPLQDOV
base stations, antenna systems, power
VXSSOLHV
)OHHWPDQDJHPHQW
:H FDQ DVVLVW ZLWK UDGLR ÀHHW PDQDJHPHQW
providing reporting on equipment and repairs,
DXGLWVRI\RXUÀHHWDQGDGYLFHRQKRZWREHWWHU
PDLQWDLQ\RXUHTXLSPHQW
6LWHWHVWVVXUYH\V
([SHULHQFHG¿HOGWHFKQLFLDQVFDQXQGHUWDNHVLWH
tests for system designs, upgrades and other
FRPPXQLFDWLRQVQHHGV
5HVHDUFK'HVLJQ
2XUH[SHULHQFHGWHFKQLFDOVWDIIORYHDFKDOOHQJH
and should an off-the-shelf solution not be
available, we’ll work with you to design a unique
VROXWLRQIRU\RXUFRPPXQLFDWLRQVQHHGV
•
•
•
•
•
Why we are the service leaders
Responsive customer service
Experienced, knowledgable tehnical staff
Modern, well equipped workshops
Flexible maintenance options, tailored to your business
24/7/ support if required
• One-stop for all your radio communications needs
Visit our website
www.bearcom.net.au
BEARCOM
155
BEARCOM
A division of TR Corporation
Engineered solutions for every
business situation
from Motorola’s
Australasian Radio Dealer of the Year
Melbourne
Sydney
Newcastle
Gold Coast
Brisbane
Townsville
Darwin
Adelaide
Perth
New Zealand
freecall
1800 22 2327 (Australia)
0800 832 473 (New Zealand)
www.bearcom.net.au
www.bearcom.co.nz
consultation
system design
building & testing
installation
commissioning
integration
training & documentation
Engineered Solutions
Communications
Engineering & Design
:HSURYLGHHQJLQHHUHGFRPPXQLFDWLRQVVROXWLRQVEDVHGRQ5)WHFKQRORJ\:LWKVROXWLRQVIRUVPDOOWRODUJH
organisations, the services we provide include consultancy, system design, equipment installation and system
WHVWLQJFRPPLVVLRQLQJDQGLQWHJUDWLRQVHUYLFHVWUDLQLQJDQGV\VWHPGRFXPHQWDWLRQ
2XUH[SHULHQFHGWHDPFRPSULVHVHQJLQHHUVDQGWHFKQLFLDQVZKRDUHH[SHUWVLQWKHLUUHVSHFWLYH¿HOGVDQGDUH
IXOO\FRQYHUVDQWZLWKWRGD\¶VHPHUJLQJFRPPXQLFDWLRQVWHFKQRORJLHV2XUV\VWHPUHVXPHLQFOXGHVSURMHFWVIRU
OHDGLQJRUJDQLVDWLRQVDFURVVDPXOWLWXGHRILQGXVWULHVPDQ\ZKRDUHLQWHUQDWLRQDOO\UHFRJQLVHGQDPHV
Our engineering expertise
‡4XDOL¿HGHQJLQHHUVZLWKLQWHUQDWLRQDOH[SHULHQFH
‡,62TXDOLW\DVVXUDQFH
• Superior quality workmanship
‡&RQVXOWDWLYHFRPSUHKHQVLYHGHVLJQSURFHVV
‡&RPSUHKHQVLYHDIWHUVDOHVVXSSRUW
The design process
&RQVXOWDWLRQ
7KH¿UVWVWDJHRIDQ\VXFFHVVIXOSURMHFWLVGLVFXVVLRQ7KXVWKHEHJLQQLQJ
RI DQ\ GHVLJQ LQYROYHV WKH FXVWRPHU PHHWLQJ ZLWK RXU H[SHULHQFHG
WHFKQLFDOWHDPDQGWKHLUDFFRXQWPDQDJHUWRFOHDUO\GH¿QHWKHLUQHHGV
&RPPLVVLRQLQJ
2QFHLQVWDOOHGWKHV\VWHPXQGHUJRHVDVHFRQGURXQGRIWHVWLQJRQVLWH
WRHQVXUHLWLVSHUIRUPLQJWRWKHLQLWLDOGHVLJQ)LQDOWZHDNLQJFDQGRQH
EHIRUHWKHFXVWRPHU³DFFHSWV´WKHV\VWHPRQVLWH
During this stage we will be looking at things that impact on the system
LQFOXGLQJ
• Site limitations
• Desired system features
• Number of radio users
‡8VHUV\VWHPRSHUDWLRQDOHQYLURQPHQW
‡$QGFULWLFDOO\EXGJHW
,QWHJUDWLRQ
,QVRPHFDVHVWKHV\VWHPPD\DOVRQHHGWREHLQWHJUDWHGLQWRH[LVWLQJ
LQIUDVWUXFWXUHDQGRUDGGLWLRQDOHTXLSPHQWVXFKDVDODUPVDQGPRQLWRULQJ
V\VWHPV
'HVLJQ
$IWHUDWKRURXJKDVVHVVPHQWRI\RXUQHHGVDQGGH¿QLQJWKHERXQGDULHV
RIWKHSURMHFWRXUHQJLQHHULQJWHDPZLOOGHVLJQDV\VWHPVROXWLRQWKDW
PHHWVWKHVHWFULWHULD
8VLQJ LQWHUQDWLRQDOO\ UHFRJQLVHG 5) SURWRFROV WKH VROXWLRQ PD\
HQFRPSDVV
• Smartnet
‡/75
‡037
‡&RQYHQWLRQDO
‡0'&
%XLOGLQJ
$OOV\VWHPVDUHEXLOWDWRXUHQJLQHHULQJZRUNVKRSLQ0HOERXUQHXQGHUWKH
ZDWFKIXOH\HRIRXU1DWLRQDO(QJLQHHULQJ0DQDJHU$OOZRUNLVXQGHUWDNHQ
WRKLJKVWDQGDUGVJXLGHGE\RXU,624XDOLW\$VVXUHGV\VWHP
7UDLQLQJ
To ensure you fully understand and use the system correctly, training is
FRQGXFWHGE\RXUHQJLQHHULQJWHDPRUWKH$FFRXQW0DQDJHU7UDLQLQJLV
tailored to the customers budget and organisational needs, ranging from
informal demonstration to comprehensive training tools and multiple user
WUDLQLQJVHVVLRQV7KHFXVWRPHUPD\FKRRVHWRKDYHERWK³XVHU´WUDLQLQJ
DQG³WHFKQLFDO´WUDLQLQJIRUWKRVHUHVSRQVLEOHIRUPDQDJLQJWKHV\VWHP
'RFXPHQWDWLRQ
$Q LPSRUWDQW SDUW RI WKH SURMHFW LV DFFXUDWH GRFXPHQWDWLRQ RI DOO WKH
component of the system, providing user and maintenance information
WRDOORZWKHFXVWRPHUWREHWWHUPDQDJHUWKHLUYDOXDEOHLQYHVWPHQW:H
DUHSURXGRIWKHKLJKTXDOLW\RIWKHLUV\VWHPGRFXPHQWDWLRQ
$IWHUVDOHVVXSSRUWPDLQWHQDQFH
$IWHUVDOHV VXSSRUW LV SURYLGHG IRU DOO V\VWHPV VROG :H ZLOO DOVR
recommend a more comprehensive annual maintenance contract for
organisations where their radio communications is critical to their ongoing
RSHUDWLRQV
$OO FRPSRQHQWV VHOHFWHG IRU XVH LQ RXU V\VWHPV DUH FKRVHQ IRU WKHLU
TXDOLW\DQGUHOLDELOLW\:HDUHSDUWLFXODUO\SURXGRIWKHKLJKTXDOLW\RIRXU
FUDIWVPDQVKLSDQGWKHUHOLDELOLW\RIWKHZRUNZHXQGHUWDNH
7HVWLQJ
$FULWLFDOVWHSLQWKHSURFHVVLVIDFWRU\DFFHSWDQFHWHVWLQJRIWKH¿QLVKHG
V\VWHP'XULQJWKLVSKDVHZHDOZD\VHQFRXUDJHWKHFXVWRPHUWRDWWHQG
RXU ZRUNVKRS DQG ³DFFHSW´ WKH V\VWHP $OO V\VWHPV DUH VXEMHFWHG WR
ULJRURXVWHVWLQJWRHQVXUHWKHLUUHOLDELOLW\XQGHURSHUDWLRQDOFRQGLWLRQV
,QVWDOODWLRQ
The installation phase can be simple or complicated, depending on the
SK\VLFDOVLWHDQGV\VWHPUHTXLUHPHQWV,WXVXDOO\LQFOXGHVLQVWDOODWLRQRI
cabling, power and antenna systems, prior to the installation of a rack or
FDELQHWPRXQWHGV\VWHP
:HKDYHH[WHQVLYHH[SHULHQFHDWHQVXLQJWKHLQVWDOODWLRQSKDVHLVDVD
VHDPOHVVDQGOHDVWGLVUXSWLYHWRWKHFXVWRPHUVRUJDQLVDWLRQ
Solutions for any environment
Visit our website
www.bearcom.net.au
BEARCOM
157
BEARCOM
A division of TR Corporation
Rental communication solutions
for every situation
from Motorola’s
Australasian Radio Dealer of the Year
Melbourne
Sydney
Newcastle
Gold Coast
Brisbane
Townsville
Darwin
Adelaide
Perth
New Zealand
freecall
1800 22 2327 (Australia)
0800 832 473 (New Zealand)
www.bearcom.net.au
www.bearcom.co.nz
two-way radio
mobile phones
satellite phones
EPIRB’s
GPS
Rental Solutions
Communications
Communications for any project or event
:KDWHYHU\RXUSURMHFWRUHYHQWHIIHFWLYHFRPPXQLFDWLRQVFDQPDNHWKHGLIIHUHQFHEHWZHHQLWEHLQJD
VXFFHVVRUQRW
Talking between work teams, around a site, across town or even across the world is easy with a comPXQLFDWLRQVVROXWLRQIURPWKH75JURXS¶VH[SHULHQFHGUHQWDOWHDP
We’ll provide a solution that meets both your needs and budget, and whilst two-way radio is our specialty
RXUVROXWLRQVDOVRLQFOXGHVDWHOOLWHSKRQHV*36XQLWV(3,5%¶VDQGPRELOHSKRQHV
)URPGD\WRDZHHNRUORQJHUUHQWLQJFRPPXQLFDWLRQVHTXLSPHQWIURPXVLVJRRGIRU\RXUEXVLQHVV
:H¶YHKHOSHGWKRXVDQGVRIRUJDQLVDWLRQVDFURVV$XVWUDOLDUXQVXFFHVVIXOSURMHFWVDQGHYHQWV:KHWKHU
LW¶VDVFKRROFDPSRXWEDFNFDUUDOO\FRQVWUXFWLRQSURMHFWJDVSODQWVKXWGRZQRUPRWRUUDFLQJVSHFWDFXODUZHFDQDVVLVW
6RWDONWRXVUHFHLYHH[SHUWDGYLFHDFFHVVWKHODWHVWHTXLSPHQWDQGUHFHLYH\RXUJHDUZKHQ\RXQHHG
LWZLWKIULHQGO\DQGHI¿FLHQWFXVWRPHUVXSSRUW
Specialised rental solutions
2XUHTXLSPHQW
,QGXVWU\VROXWLRQV
:KDWHYHU\RXUQHHGZLWKRQHRIWKHODUJHVWUHQWDOÀHHWVLQWKHFRXQWU\ZH¶OOKDYHWKHULJKW ,WPD\VXUSULVH\RXWROHDUQWKHYDULHW\RISHRSOHDQGRUJDQLVDWLRQVZKREHQH¿WIURPRXU
SURGXFWIRU\RX
VROXWLRQV
)URPVLPSOHSRUWDEOHUDGLRVWRFRPSOH[WUXQNHGUDGLRVZLWKDGYDQFHGVHFXULW\IHDWXUHV :KLOVWZHKDYHSURGXFWVWRVXLWDQ\LQGXVWU\KHUHDUHDIHZZH¶YHKHOSHGLQWKHSDVW
WR ,ULGLXP VDWHOOLWH SKRQHV RXU SURGXFW SRUWIROLR FRQVLVWV RI ZHOOPDLQWDLQHG PRGHUQ
‡(YHQWVVSRUWLQJFRQFHUWVIHVWLYDOV
HTXLSPHQWPDQXIDFWXUHGE\OHDGLQJQDPHVVXFKDV0RWRUROD,ULGLXP*0(DQG,FRP
• Disaster management teams
‡)LOP79SURGXFWLRQXQLWV
2XUVROXWLRQVLQFOXGH
‡5HWDLOORVVSUHYHQWLRQ
‡3RUWDEOHPRELOHUDGLRV
‡6FKRROVFDPSVFURVVFRXQWU\IHWHV
• Quality audio accessories
‡0LQLQJJDVSHWURFKHPLFDOFRPSDQLHV
‡%DVHVWDWLRQVDQGUHSHDWHUV
‡&RQVWUXFWLRQSURMHFWV
‡0RELOHWUXQNLQJV\VWHPV
• Security companies
‡0RELOHSKRQHV
‡&KDULWLHVIXQUXQVFDUUDOOLHVEDOOV
• Satellite phone
‡0DQXIDFWXULQJ
‡*36
‡+RWHOVSXEVFOXEV
‡(3,5%¶V
• Travel tour groups
(YHQW0DQDJHPHQW
Event management is something we know a lot about because we’ve been involved in
&XVWRPHUVZRUNLQJLQHQYLURQPHQWVZKHUHKD]DUGRXVJDVRUFKHPLFDOVQHFHVVLWDWHWKH PDMRUHYHQWVDFURVV$XVWUDOLDIRUWKHSDVW\HDUV
XVHRI)0UDGLRHTXLSPHQWFDQEHUHDVVXUHGWKDWZHFDQDVVLVWZLWKWKLV
:H¶YHSURYLGHGVROXWLRQVIRUHYHQWVLQFOXGLQJWKH6\GQH\2O\PSLFV$XVWUDOLDQ0RWRU
&\FOH*UDQG3UL[&+2*0WKH6\GQH\0DUGL*UDV%DWKXUVWDQGHYHQ$PZD\¶V
2XUZHOOPDLQWDLQHGÀHHWRI0RWRUROD)0SRUWDEOHUDGLRVDUHWKHLGHDOWRROIRUFRPPHUFLDO
QDWLRQDOFRQIHUHQFH
FXVWRPHUVZLWKVSHFLDOLVHGQHHGVLQFOXGLQJ
We appreciate that all events have different needs, so whether yours is large or small we’ll
‡3ODQWVKXWGRZQV
HQVXUHWKHFRPPXQLFDWLRQVDGGVWRWKHVXFFHVVRI\RXUHYHQW
‡0LQHVLWHV
2XUVHUYLFHVFRXOGLQFOXGH
‡*DVSODQWV
‡&RQVXOWDWLRQWRKHOS\RXSODQ\RXUHYHQW
‡&KHPLFDOPDQXIDFWXULQJ
‡5DGLRIUHTXHQF\PDQDJHPHQW
‡3HWUROHXPIDFLOLWLHV
‡,QVWDOODWLRQRIHTXLSPHQW
‡*UDLQKDQGOLQJ
‡$PRELOHWUXQNLQJV\VWHP
• User training for your event staff
‡2QVLWHFRPPXQLFDWLRQVPDQDJHPHQW
)0)DFWRU\0XWXDO
Visit our website
www.bearcom.net.au
BEARCOM
159
Communications
Rental Solutions
Portable radios
0RWRURODSRUWDEOHUDGLRVDUHFRPSDFWHDV\WRXVHDQGUXJJHGWKHLGHDOWRROIRUPRVWSURMHFWVRUHYHQWV:LWKDYDULHW\RIPRGHOVWRVXLWGLIIHUHQW
DSSOLFDWLRQV DQG )0 RSWLRQV DYDLOEOH WKHUH LV D SRUWDEOH UDGLR WR VXLW \RX 7DON WR XV DQG ZH¶OO EH KDSS\ WR VXJJHVW WKH ULJKW PRGHO IRU \RXU
DSSOLFDWLRQ
*3
*3SOXV
*3/6
*3/6
*3
37;
37;
07;
07;
Equipment delivered ready to use, whenever you need it.........
A company who understands that your business needs
flexibilty and reliability in a supplier.......
Combine this with quality equipment and great service,
what more could you ask for !
Mobile radios & repeaters
:KHQEHWWHUFRYHUDJHRUDPRUHFRPSOH[VROXWLRQLVUHTXLUHGRXUUDQJHRIPRELOHUDGLRVEDVHVWDWLRQVDQGUHSHDWHUVFDQKHOS:KDWHYHUWKHVL]HRI
\RXUHYHQWEHLWDVPDOOFDUFOXEPHHWRUWKH*UDQG3UL[ZHFDQRIIHUDVROXWLRQWKDWFDWHUVIRUGLYHUVHVLWXDWLRQVDQGPXOWLSOHXVHUJURXSV
$QGIRUYHU\FRPSOH[RUODUJHHYHQWVRXUHQJLQHHULQJWHDPZLOOWDLORUDPRELOHWUXQNLQJVROXWLRQWKDWFDQEHZKHHOHGLQIRUWKHGXUDWLRQRI\RXUHYHQW
7KHIROORZLQJDUHWKHPRELOHUDGLRVEDVHVWDWLRQVDQGUHSHDWHUVZHRIIHUVVXEMHFWRIFRXUVHWRVWRFNDYDLOELOLW\DWWKHWLPHRIUHQWDO
*0
%DVHVWDWLRQRULQYHKLFOH
*0/6
%DVHVWDWLRQRULQYHKLFOH
,FRP,&352
%DVHVWDWLRQRULQYHKLFOH
*5
5HSHDWHUIRUVPDOOHYHQWV
0RELOHWUXQNLQJV\VWHP
5HSHDWHUIRUODUJHHYHQWV
We stock radios in both UHF and VHF frequencies, so talk to us if you do not see what you require.
160
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
Rental Solutions
Communications
Portable Radio Accessories
7KHULJKWDFFHVVRU\FDQWXUQ\RXUUDGLRLQWRPRUHWKDQDFRPPXQLFDWLRQVWRROLQWRDXVHIXODLGZKLFKKHOSVPHHW2+6REOLJDWLRQVFUHDWHVDVDIHU
ZRUNHQYLURQPHQWDQGMXVWPDNHVLWHDVLHUWRJHWRQZLWKWKHMREDWKDQG
:HVWRFNDP\ULDGRIDFFHVVRU\RSWLRQVIURPOHDGLQJEUDQGVLQFOXGLQJ0RWRUROD:KHWKHULW¶VDFDUU\FDVHHDUSLHFHZDWHUSURRIEDJXQLWFKDUJHU
RUKHDY\GXW\KHDGVHW\RXUDFFRXQWPDQDJHUFDQVXJJHVWWKHULJKWDFFHVVRU\IRU\RXUHYHQWRUSURMHFW
%HORZDUHDVDPSOHRIWKHW\SHVRIDFFHVVRULHVZHRIIHUEXWLIWKHUH¶VVRPHWKLQJ\RX¶YHVHHQWKDWZHGRQ¶WVWRFNOHWXVNQRZ
Ex-rental equipment
5HPRWHVSHDNHUPLFURSKRQH
Eearpiece
Lightweight headset
%HDU&RP DUH FRQVWDQWO\
updating inventory to
ensure you can rent the
latest technology, so we
often have good quality
H[UHQWDO HTXLSPHQW IRU
SXUFKDVH
&DOO IRU GHWDLOV RI RXU
FXUUHQWH[UHQWDOVWRFN
Noise cancelling headset
Single unit chargers
Iridium satellite phones
6-unit chanrgers
EPIRB’s and GPS
For safety on the water, the mountains or in any out of the way place
we stock a number of EPIRB’s and GPS products, to suit a variety of
uses.
Suitable for schools, scouting groups, hikers, sailing,
exploration or leisure use.
EPIRB’s
Designed to activate in times of emergency, EPIRB’s
come in a range of shapes and sizes. Whether you need
a small personal EPIRB or larger version, we’re bound
to have the right solution for you - ask for details on
our current stock.
7KH,ULGLXPV\VWHPLVDVDWHOOLWHEDVHGZLUHOHVVFRPPXQLFDWLRQVQHWZRUN
designed to permit telephone transmission to reach its destination
DQ\ZKHUHRQHDUWK
6XLWDEOH IRU FRPPHUFLDO H[SORUDWLRQ LQGHSHQGDQW WUDYHOOHUV UHPRWH
SURMHFWV FRPPXQLWLHV VFKRROV FDPSV ¿VKLQJ RU HYHQ OHLVXUH XVH
,QGHHGDQ\DFWLYLW\ZKHUH\RXQHHGFRPPXQLFDWLRQVRXWVLGHODQGOLQHRU
PRELOHSKRQHQHWZRUNFRYHUDJH
,ULGLXP$6DWHOOLWH3KRQH
:HLJKLQJ OHVV WKDQ KDOI D NLORJUDP WKH ,ULGLXP $ KDV D URWDWLQJ
antenna and protective keypad, which make it easy to carry in a briefcase
RUNQDSVDFN3URYLGLQJXSWRKRIWDONWLPHZLWKDVWDQGDUGEDWWHU\DQG
XSWRKRIVWDQGE\WLPH
,ULGLXP'DWD.LW
6XLWDEOHIRUWKHWUDYHOOHUZKRQHHGVHPDLORUID[DFFHVVRQWKHPRYHWKH
,ULGLXPGDWDNLWLVXVHGLQFRQMXQFWLRQZLWKWKH0RWRUROD,ULGLXP6DWHOOLWH
SKRQH,WDOORZVWUDQVPLVVLRQRIGDWDDWHLWKHUNEVIRU'LDOXS'DWD
6HUYLFH RU NEV ZKHQ XVLQJ WKH 'LUHFW ,QWHUQHW 'DWD
6HUYLFH
6DWHOOLWHID[PDFKLQH
:KHQFRPELQHGZLWKWKHGDWDNLWWKHVDWHOOLWHID[PDFKLQH
DOORZVID[WUDQVPLVVLRQYLD\RXU,ULGLXPVDWHOOLWHSKRQH
GPS
GPS or Global Positioning Systems
provide satellite navigation for both
commercial and leisure users. BearCom
stock the reliable Garmin brand of GPS units in both
personal handheld versions and more sophisticated
vehicle or marine models.
Mobile phones
Whether you require GSM or CDMA, we have a range of mobile phones
to suit your requirements including Tri-band units for use with a current
Telstra SIM card should you be travelling overseas.
Our mobile phone inventory includes models from leading brands
including:
• Nokia
• Motorola
• Ericsson
&DOOSODQV
75 7HOHFRP RIIHU D YDULHW\ RI FDOO SODQV IRU \RXU ,ULGLXP
SKRQHFDWHULQJIRUERWKVKRUWDQGORQJWHUPXVH
Visit our website
www.bearcom.net.au
BEARCOM
161
Glossary of radio terms
Communications
%HORZ\RXZLOO¿QGDQH[SODQDWLRQRIVRPHRIWKHWHUPVXVHGZLWKLQWKHFDWDORJXH3OHDVHWDONWRXVLI\RXKDYHDQ\RWKHUTXHVWLRQVRUUHTXLUH
IXUWKHUH[SODQDWLRQ
$&$
7KH$XVWUDOLDQ&RPPXQLFDWLRQV$XWKRULW\LVWKHJRYHUQLQJERG\ZKRPDQDJHVWKH
XVHRIUDGLRVSHFWUXPLQ$XDWUDOLD0XFKRIWKHVSHFWUXPUHTXLUHVDOLFHQFHWRXVHLW
DQGWKH$&$IDFLOLWDWHWKLVYLD\RXUUDGLRGHDOHU
$FFHVVRU\&RQQHFWRU
$WWDFKHVWRWKHVLGHRIDWZRZD\UDGLRWRDOORZWKHXVHRIH[WHUQDODFFHVVRULHVVXFK
DVKHDGVHWVDQGHDUSLHFHV
$XGLEOH&DOO$OHUW
$OORZVWKHFDOOHUWRVHQGDQDXGLEOHWRQHWKDWDOHUWVRWKHUVLQWKHJURXSRIDQLQFRPLQJ
WUDQVPLVVLRQ7KHWRQHLVKHDUGE\RWKHUXVHUVRQWKHVDPHFKDQQHO
$XGLEOH/RZ%DWWHU\$OHUW
When batteries are low the two-way radio will chirp 1 to 4 seconds after turning power
RQ0RVWPRGHOVZLOOGRXEOHFKLUSDIWHUDWWHPSWLQJWRWUDQVPLWZKHQDWORZSRZHU
%DVH6WDWLRQ
$¿[HGRUVWDWLRQDU\WUDQVPLWWHUUHFHLYHUXVXDOO\DPRELOHUDGLR
%DWWHU\0HWHU,QGLFDWRU
/RFDWHGRQWKH/&'WKHEDWWHU\PHWHULQGLFDWRULVGLYLGHGLQWRWKUHHEDUV(DFKEDU
UHSUHVHQWVRQHWKLUGRIWKHEDWWHU\OLIH$VSRZHULVXVHGWKHEDUVZLOOGLVDSSHDU
&%&LWL]HQVEDQG
The frequency range used by amateur radio enthusiastics because it does not require
DOLFHQFHXVHVWKH8+)UDQJH0+]WR0+]
&KDQQHO
$ XVHUGH¿QHG VHWWLQJ WKDW KDV D VSHFL¿F IUHTXHQF\ IRU FRPPXQLFDWLQJ ZLWK RWKHU
UDGLRVXVLQJWKHVDPHVHWWLQJ
&KDQQHO%XV\,QGLFDWRU
Visual indicator of channel activity, which can be used instead of the monitor button
WRLQGLFDWHWKDW\RXUFXUUHQWFKDQQHOLVLQXVH
&KDQQHO/RFN
$OORZV\RXWRGLVDEOHWKHSURJUDPPLQJPRGHVRLWFDQQRWEHFKDQJHGDFFLGHQWDOO\
:KHQORFNLVDFWLYDWHGWKHUDGLRLVIXOO\IXQFWLRQDOH[FHSWIRUSURJUDPPLQJPRGH
&KDQQHO6FDQ
$OORZV\RXWRPRQLWRUDWZRZD\UDGLR¶VFKDQQHOVDQGFRGHV:KHQWKHUDGLRGHWHFWV
VRPHRQH WDONLQJ LW VWRSV VFDQQLQJ DQG ORFNV LQ RQ WKH DFWLYH FKDQQHO <RX FDQ
listen and talk back automatically to the person transmitting without having to switch
FKDQQHOV
&KDUJLQJ/LJKW
2Q D VLQJOH FRORXU /(' FKDUJHU WKH /(' ÀDVKHV FRQWLQXRXVO\ ZKLOH WKH EDWWHU\
FKDUJHV/('JORZVFRQWLQXRXVO\ZKHQEDWWHU\LVIXOO\FKDUJHG2QDWULFRORU/('
FKDUJHUGLIIHUHQW/('FRORXUVÀDVKWRLQGLFDWHFKDUJLQJVWDWXV$VROLGJUHHQ/('
LQGLFDWHVFKDUJLQJFRPSOHWLRQ
&7&66
&RQWLQXRXV 7RQH &RGHG 6TXHOFK 6\VWHP RU D W\SH RI VXEDXGLEOH WRQH WKDW LV
WUDQVPLWWHGZLWKDYRLFHVLJQDO
'XSOH[
$PHWKRGRIWUDQVPLWWLQJDQGUHFHLYLQJYLDWZRGLIIHUHQW³FKDQQHOV´RUSDWKV)XOO
GXSOH[PHDQVWUDQVPLWDQGUHFHLYHFDQRFFXUVLPXOWDQHRXVO\DQGKDOIGXSOH[PHDQV
RQHIXQFWLRQQHHGVWRZDLWIRUWKHRWKHUWREHFRPSOHWHG
'XW\&\FOH
Length of time that a battery will last under normal use, which is roughly considered
WREHDSSUR[VHQGLQJUHFHLYLQJDQGLQVWDQGE\RUPRQLWRULQJPRGH
7KHGXW\F\FOHGHSHQGVRQDQXPEHURIIDFWRUVLQFOXGLQJWKHVL]HDQGFKHPLVWU\RI
WKHEDWWHU\SOXVLWVDJH
Keypad Lock
3UHVVLQJ DQG KROGLQJ WKH .H\SDG /RFN EXWWRQ DOVR GLVDEOHV WKH 6FUROO 0HQX DQG
6FDQ EXWWRQV VR \RX GRQ¶W DFFLGHQWDOO\ VZLWFK WKH FKDQQHO RU RWKHU VHWWLQJV$OVR
FDOOHG.H\SDG/RFN
0+]0HJDKHUW]
2QHPLOOLRQF\FOHVSHUVHFRQG8VHGWRPHDVXUHUDGLRIUHTXHQF\
0RQLWRU%XWWRQ
8VHG WR FKHFN DFWLYLW\ RQ D FXUUHQW FKDQQHO EHIRUH WUDQVPLWWLQJ &KHFN FKDQQHO
DFWLYLW\E\SUHVVLQJWKH0RQLWRUEXWWRQ,IWKHFKDQQHOLVFOHDU\RXZLOOKHDUVWDWLF
,IWKHFKDQQHOLVLQXVH\RXZLOOKHDUFRQYHUVDWLRQ,WDOVRVHUYHVDVDZD\WRFKHFN
WKHYROXPHOHYHORIWKHUDGLRDVWKHUDGLRZLOO³VTXHOFK´ZKHQSUHVVLQJWKHPRQLWRU
EXWWRQ
3URJUDPPDEOH6FDQ
6HOHFWLYHO\PRQLWRUFKDQQHOVDQGFRGHVRIRWKHUWUDQVPLWWLQJWZRZD\UDGLRV:KHQ
WKHUDGLRGHWHFWVDFWLYLW\RQRQHRIWKHFKDQQHOVFRGHV\RXVHOHFWHGLWVWRSVVFDQQLQJ
DQGORFNVLQRQWKHFKDQQHORUFRGH7KLVIHDWXUHDOORZV\RXWROLVWHQDQGWDONEDFNWR
WKHSHUVRQVWUDQVPLWWLQJZLWKRXWKDYLQJWRVZLWFKWKHFKDQQHO
377%XWWRQ
3XVK7R7DONEXWWRQRQDSRUWDEOHRUPLFURSKRQHXVHGWRFDXVHWKHWUDQVPLWWHUWR
WUDQVPLWDQGDOORZDXGLRWRSDVV
6FDQ%XWWRQ
6FDQVIUHTXHQFLHVIRUDFWLYLW\
6LPSOH[
Transmitting and receiving on the same frequency
5DQJH
The distance the radio can transmit, which depends on the power output and the
WHUUDLQ5DQJHLVDIIHFWHGE\WHUUDLQZLWKFRQFUHWHVWUXFWXUHVRUKHDY\IROLDJHDQG
DOVRE\RSHUDWLQJUDGLRVLQGRRUVDQGYHKLFOHV
5HSHDWHU
$ UDGLR UHFHLYHUWUDQVPLWWHU WKDW UHFHLYHV RQ RQH IUHTXHQF\ DQG UHEURDGFDVWV WKH
VLJQDORQDGLIIHUHQWIUHTXHQF\5HSHDWHUVQRUPDOO\RSHUDWHLQIXOOGXSOH[PRGH
Talkgroup
$VSHFL¿FVHWRIUDGLRXVHUVZLWKDFRPPRQ,'WKDWDUHDOORZHGWRWDONWRHDFKRWKHU
DQGDUHDVVLJQHGDSDUWLFXODUIUHTXHQF\
7LPH2XW7LPHU
+HOSV H[WHQG EDWWHU\ OLIH E\ HPLWWLQJ D ZDUQLQJ WRQH LI WKH 3XVK7R7DON EXWWRQ LV
SUHVVHGIRUDSUHGHWHUPLQHGDPRXQWRIWLPH7KHUDGLRZLOODOVRVWRSWUDQVPLWWLQJ
Trunking
$PHWKRGRIJURXSLQJRIIUHTXHQFLHVVRVHYHUDOXVHUVFDQXVHWKHJURXSHGUHVRXUFHV
WKXVLQFUHDVLQJFDSDFLW\WRFDUU\FRQYHUVDWLRQV
8+)
8+) RU 8OWUD+LJK )UHTXHQFLHV DUH WKRVH PRVW FRPPRQO\ XVHG LQ $XVWUDLOD IRU
FRPPHUFLDOWZRZD\UDGLRRSHUDWLQJEHWZHHQ0+]
9+)
9+)RU9HU\+LJK)UHTXHQFLHVIRUWZRZD\UDGLRXVHLQ$XVWUDOLDDUHEHWZHHQ
0+]
92;9RLFH2SHUDWHG7UDQVPLVVLRQ
7KH 92; IHDWXUH DOORZV KDQGVIUHH RSHUDWLRQ RI \RXU WZRZD\ UDGLR 7KH VRXQG
RI \RXU YRLFH DFWLYDWHV WUDQVPLVVLRQ ZKHQ WKH UDGLR LV XVHG ZLWK FRPSDWLEOH 92;
DFFHVVRULHV
)UHTXHQF\
$IUHTXHQF\LVWKHUDQJHZLWKLQZKLFKUDGLRZDYHVFDQEHWUDQVPLWWHG
Hands-free
:LWKD92;FDSDEOHDFFHVVRU\\RXFDQFRQGXFWDFRQYHUVDWLRQZLWKRXWKROGLQJWKH
UDGLRDQGSUHVVLQJWKH3XVK7R7DONEXWWRQWRFRPPXQLFDWH
162
Call now
Australia 1800 222 327 - New Zealand 0800 832 473
Got a unique requirement and
need some advice?
With a range of technologies
and brands at our disposal,
and staff who are experts in
their field, TR Corporation has
solutions for all your specific
situations.
test & measurement
business &
audio visual
radio & satellite
communications
Call today, and talk to us.
In the event we don’t have an
immediate solution, we’ll soon
find it for you.
wireless
networking
& broadband
TR Corporation - technology innovations for you
www.trcorporation.com.au
General Index
A
AC
See Electrical
Accelerometer
83-84
Acoustic Spectrum Analysis
111
Adhesion Tester
86
Air
Compressor Output
104
Flow
104-109
Quality
106-109
Air Conditioning
Coolant Flow
102-104
Measurement
106
Valve Balancing
109
Air Quality
Monitoring
106-109, 116
Particles
106, 109
Temp & Humidity
106, 109
Air Velocity Meter
105, 108
Alcohol Breath Analyser
114
Alignment
83-84
Ammeter
58, 59
$PSOL¿HU,QVWUXPHQWDWLRQ
Anemometer
106, 108, 109
Angle Measurement
60
Antenna & Cable Test
20, 22
Antennas
23, 40
Appliance Tester
47
Area Heat Stress
106, 109
ATM
31, 34
Audio Analyser
29
Audio Visual
121-123
Autoclave Logger
65, 68
Automotive Testing
85
B
Balances
80-82
Balancing Machinery
109
Balancing Machinery Analyser 83
Balometer
106, 108
Barcode Scanner
135
Barometric
97
Barometric Recorder
97
Batch Barcode Scanner
135
Bath
Constant Temperature 90, 91, 93
Ultrasonic
95
Battery Tester
60
Bit Error Rate (BERT)
31
Blast Logger
85
Body Vibration Measure
83-84
Bore Hole Depth
119
Bore Hole Water Quality
118
Borescope
77-78
Brake Tester
85
Bridge
39
Bridge LCR
14
Business Equipment
122
Butt Set
32
C
Cable
Fault Locator
LAN Test
164
39-40
34-36
Locator
34-35, 39-40
Tester
34-35, 39
Tracer
39-40
Cable TV
30
Calibrator
Current
90-93
Current Loop
90-92, 94
Dry Block Temp
90-91, 93-94
Electrical
15
Hydraulic
90, 91, 95
,QGXVWULDO
Loop
90-91
3QHXPDWLF,QVWUXPHQW Pressure
90-91, 94-95
Process
90-92
Resistance
90-92
Temperature
90-91, 93
Voltage
90-92, 94-95
Caliper
76
Camera
Digital
100, 125-126
Endoscope
77-78
High Speed
73
Lens
126
Mobile Digital Recorder
126
3LSH,QVSHFWLRQ
Still
126
Surveillance
100
7KHUPDO,PDJLQJ
Video
73, 79, 125
Carbon Dioxide (CO2)
106, 109,
115-117
Carbon Monoxide (CO)106, 109, 116
Cash Drawer
135
Cat 3, 4, 5, 5E, 7
34-35
CCTV Surveillance
100
&KDUJH$PSOL¿HU
Chart Recorder
71, 73
Circuit Tracer
39
Clean Room Monitor
109
Cleaver - Fibre Optic
37
Coating Thickness
85-86
Cobra Scanner
136
Coil & Winding Test
42, 46
Colour Laser Printer
138
Combustion Gas Analysis 115-116
Communications Test Set
24-25
Compressed Air Flow
104
Compressor Output
Flow
99
Quality
99
Computer & Peripherals
121
Computer Monitors
130, 132
Concrete Testing
Adhesion
86
Cover Meter
87
Moisture Meter
87-88
Reo Depth
87-88
Test Hammer
87-88
Ultrasonic Tester
85, 87
Conductivity & Salinity
118
&RQ¿QHG6SDFH(QWU\
Copier, Laser Printer & Fax
137
Counting Scales
81
Crane Scales
80
CRT Monitors
130
Current Clamp 47, 53, 56, 58-60, 71
DC Source
13
,QMHFWLRQ
,QSXW/RJJHU
Loop
90-94
Meter 48-49, 54, 58-60, 102-103
3ULPDU\,QMHFWLRQ
Probe
10
6HFRQGDU\,QMHFWLRQ
Sensor
71
Shunt
58-59
Transducer
53, 58-59, 71
Transformer (CT) 48-49, 52-54,
58-59
D
'DWD9LGHR3URMHFWRU
Data Communications
Cable Test
34-35
Etherscope
32
Fibre Optics
36
LAN Analyser
32
Protocol analyser
34
Protocol Analyser
31, 33, 34
WAN Analyser
32, 34
Data Logger
65-68, 73
DC High Voltage
10, 57
DC Power Supplies
13
Decade Resistance Box
15
Demand Analyser
48-49, 52, 55
Depth Logger
119
Desktop Computers
129
Graphics Card
129
Dewpoint
99, 106, 109
Digital Camera
100, 126
Digital Storage Oscilloscope
8
Digital Video Cameras
125
Dimension Measurement
76
Dissolved Oxygen
118
Distance Measurement
76
Distortion Analyser/Generator
29
Dose Meter (Noise)
112
Dot Matrix Printer
137
Dust Measurement
106, 109
DVD Burner
127
DVD Player/Recorder
123
E
E1/E3 Tester
31, 33-34
Earth Leakage 40-45, 48-49, 57-58,
60
Earth Leakage (RCD) 40, 42-43, 45,
47, 48-49, 58, 60
Earth Tester
46, 47
Electric Motor Test
46
Eletrical
Cable Test
42-45, 57
High Voltage
57, 60
Surge Generator
39
TDR
39
VLF
57
(OHFWULFDO,QVWDOODWLRQ7HVW
Appliance Tester
47
High Voltage Test (Hi-Pot) 46, 57
,QVXODWLRQ7HVW Phase Rotation
60
Resistance Test
42-47
Soil/Ground Resistance
42, 46
Electrical Power Generation &
Transmission
&XUUHQW,QMHFWLRQ
High Voltage Test (Hi-Pot)
57
Power Quality
48-55
Protection Relay Test
56
VLF Test
57
Electrical Power Quality
Demand Analyser
52, 53, 55
Harmonics
48-49, 52, 55
Power Factor
48-49, 52-53, 60
Power Quality Analyser
48-55
Voltage Current Recorder
71
Electrical Power Sources
&XUUHQW,QMHFWRUV
Generator
64
Line Conditioners
61
UPS
61, 63
Electrical Testers
60
Electrical Transducers
58
Electrochemistry
118
Electrometer
12
Electrostatic Charge Measurement 13
(0&(0,7HVW(TXLSPHQW
Endoscopes
77-78
Environmental Chambers/Oven
95-96
Environmental Noise
112-113
Ethernet Analyser
32-33
Exchange Simulator
31
F
Facsimile
133
Fibre Optic Microscope
36-37
Fibre Optics
36-37
LAN Cable Test
34-36
OTDR
36, 37
PMD
37
Power Meter/Light Source 36, 37
Field Strength Meter
Gauss
41
RF
23
Field Strength Meters & Antennas 23
Filters
28
Flash Card
71
Floor Slip Tester
114
Flow Meters
102-104
Compressed Air
102, 104
Doppler
102-104
Gas
102, 104, 105
Liquid
102-104
1RQ,QWUXVLYH
Open Channel
102-104
Transit Time
102, 104
Ultrasonic
102-104
Flue Gas Analysis
115-116
)OXH,QVSHFWLRQ
Fluorimeter
119
Force Gauge
79
Formaldehyde Meter
115-116
Frequency Counter
16
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
General Index
Frequency Response Analysers 15
Frequency Transducer
58-59
Function Generator
14
Fusion Splicer
38
G
G.703, G.821
32
Gamma Radiation
23
Gas
Alcohol
114
Carbon Dioxide (CO2) 109,115-116
Carbon Monoxide (CO)109,
115-116
Flammable (LEL)
116
Formaldehyde
115-116
Hydrogen Sulphide (H2S)
116
Methane (CH4)
115-117
Nitric Oxide (NO) 109, 115-116
Nitrogen Dioxide (NO2) 115-116
Oxygen (O2)
115-117
Ozone (O3)
117
Refrigerant
110
Sulphur Dioxide (SO2)
115
VOC
115-117
Gas Analysis & Monitoring 115-117
Gauss/Tesla Meter
41
Generator (AC)
64
Glossmeter
85
*3,%,QWHUIDFH
Ground Vibration
85
Groundwater
119
H
Hardness Tester
88
Harmonics (Power)
48-50, 54-55
Heat Stress
106, 109
Hi-Pot Tester
46, 57
Holiday Detector
86
Hot Wire Anemometer
106, 108
Humidity
Chamber
96
Concrete
87
High Temp Probe
74-75
,QGRRU$LU
Logging
65, 67, 68
Natural Gas
99
Recorders
97
Thermohygrograph
97
Transducer
74, 75
Weather
97, 110
+9$&,$4
Hybrid Recorders
71
Hydraulic Pressure 86, 90, 91, 95
I
,'&DUG3ULQWHU
,OOXPLQDQFH0HWHU
,QFOLQRPHWHU
,QGRRU$LU4XDOLW\
,QIUDUHG&DPHUD
,QIUDUHG7KHUPRPHWHU
,QMHFWLRQ7HVW6HW
,QNMHW3ULQWHU
,QVWUXPHQWDWLRQ$PSOL¿HU
,QVXODWLRQ7HVWHU
,QWULQVLFDOO\6DIH
Current Loop Calibrator 90, 91, 94
Digital Multimeter
12
Gas Monitor
116
Moisture Analyser
99
Noise Dose Meter
112
3KRWR,RQLVDWLRQ'HWHFWRU3,' 115, 117
,QYHUWHU
,RQLVDWLRQ7HVWHU
,6'1
L
Laboratory Oven
96
LAN
Analyser
32-34
&DEOH&HUWL¿FDWLRQ
Cable Tester
34-36
Laser
Distance & Speed
76
Level
76
Laser Barcode Scanner
135
Laser Printer
137-138
Laser Printer & Copier
138
LCD Monitors
132
LCR Meter
14
Leak Detector
Gas Pipe
40, 110, 116
Microwave Oven
23-24
Refrigerant
110
Water
40
Light Measurement
111
Light Meter
111
Linear Position Transducer
75
Load Cell
79-80
Logger
See also Recorders
Accessories
66
Autoclave
65, 68
Data
65-68, 73
Environmental Noise
112-113
Explosion
85
Flow
102-103
Ground Vibration
85
Humidity
65-68
Oven
65-66
Pressure
97
Shipping & Transport
84
Temperature
65-68
Logic Analyser
15
Logic Programmer
15
Low Frequency
Frequency Response Analysers
15
Phase Meter
29
Signal Generator
29
Luminance Meter
111
Lux Meter
111
M
Machinery
Balancing
Vibration
Magnetic Field Meter
Manometer
83
83-84
41
107
Materials Testing
80, 120
Memory Recorder
68, 70
Metal Detector
100-101
Methane Monitor
115, 117
Micro-Ohm Meter
42-45
Microphone
122
Microscope
79
Microwave Leakage Detector 23-24
Microwave Oven Survey Meter
23-24
0RGL¿HG$WPRVSKHUH
Packaging Test
115, 117
Modulation Meter
24
Moisture
Concrete
87-88
Timber
87
Moisture Balance
81
Monitor
LCD
132
Speakers
132
SVGA Colour
130
Touchscreen
130
Multimeter
12-13
N
Natural Gas
99
Network Analyser
Antenna & Cable Test
20-22
LAN/WAN
32
Power
48-49
RF
17, 20, 28
Telecommunications
31
Network Products
133
Noise & Sound
112
Noise Dose Meter
112
Noise Logger
112, 113
Non-Destructive Testing (NDT) 83-87
Non-Storage Oscilloscope
9
Notebook Computers
127-129
,QYHUWHU
O
Occupational Health & Safety
111-114
Air Quality
106, 109
Appliance Testing
47
&RQ¿QHG6SDFH(QWU\ Floor Slip Tester
114
Formaldehyde
115-116
Heat Stress
106, 109
Lighting
111
Noise & Sound
112
Ozone
115, 117
Radiation
23-24
Toxic Gas
115-116
UV Exposure
111
Vibration
83
2LO,QVXODWLRQ7HVWHU
Optical Networking
DWDM
37
Optical Spectrum Analysis
37
Oscilloscopes
Digital Storage
8-9
Non Storage
9
Portable
8-9
Visit our website
www.techrentals.com.au
www.techrentals.co.nz www.techrentals.com.my
Probes
OTDR
Oven
Oven Logger
Oxygen & CO2 Analyser
Oxygen (O2)
Ozone (O3)
10
36-37
96
65-66
115-117
115-117
115
P
Particle Counter
106, 109
PAT
47
PCM Test Equipment
31-32
PDA
130
PDH Analyser
32
People Counter
100
Petrol Generator
64
pH Measurement
118
Phase Angle
60
Phase Meter - LF
29
Phase Rotation Meter
60
Phase Sequence Meter
60
3KRWR,RQLVDWLRQ'HWHFWRU3,'
115, 117
Physical Measurement
73
Pinhole Detector
86
Pipe Locators
39
3LSHOLQH,QVSHFWLRQ
Pitot Tube
107-108
Plasma Screen
122
Plotter Printer
72
Plotters
138
Pocket PC
130
Point of Sale - POS
%DUFRGH9HUL¿HU
Batch Scanner
134-135
Cash Drawer
135
Cobra Scanner
136
Data Terminal
134
,'&DUG3ULQWHU
Label Printer
136
Laser Barcode Scanner
135
Omnidirectional Scanner
136
Paging System
136
Receipt Printer
134-135
Stocktake Scanner
136
Touch Terminal
135
Polarisation Mode Dispersion (PMD)
37
Portable Appliance Tester
47
Portable Data Appliance (PDA) 130
Position Transducer
75
POTS
31
Power
See Electrical
Power Analyser
48-53, 60
Power Analysis
48-64
Power Demand Analyser
48-49,
52-53, 55
Power Disturbance
48-54
Power Line Conditioner
61
Power Supplies - DC
13
Pressure
Calibrator
90, 91, 93, 94, 95
Circular Chart Recorder
73
,QGLFDWRU*DXJH
Transducer
74-75
TECHRENTALS 165
General Index
Printers
Colour Laser
138
Copier, Laser & Facsimile
137
Dot Matrix
137
,QNMHW
Laser
137-138
Laser & Copier
138
Probe
Current
10, 48-52, 56
Digital
70
Frame Relay
34
High Voltage
10
Line Logic
70
Near Field
24
Static Detector
13
Process Calibrator
92-94
Programmer
EPROM, EEPROM
15
3URMHFWLRQ6FUHHQ
3URMHFWRU
Protection Relay Test
56
Protocol Analyser
31, 33-34
Pulse Generator
14
Pump
90-91, 94-95
R
Radar Speed Gun
76
Radiation Monitor
23-24
Radiometer
111
Random Noise Generator
29
RCD Test
42, 46
Recorders
See Also Loggers
Barometric
97
Chart
71, 73
Hybrid
71
Memory
68, 70
Pressure
73
Tape
72
Temperature Humidity
67
5HFWL¿HU
Refrigerant Leak Detection
110
Relative Humidity
97
Also See Humidity
Relay Test
56, 60
Resistance
Calibration
90-91
Decade
15
Ground/Soil
46-47
Micro-Ohm
42-45
Static
42, 46
Tester
42-47
5HWDLO7UDI¿F)ORZ&RXQWHU
RF & Microwave
Accessories
28
$PSOL¿HU
Antenna/SWR
20-22
Antennas
20-23
Attenuator
27-28
Communications Test Set 24-25
(0&(0,7HVW
Field Strength Meters
23
Frequency Counter
16
Function Generator
14
Modulation Meter
24
Network Analyser
17, 20, 22
166
Power Meter
Radiation Monitor
Sampler
Signal Generator
Spectrum Analyser
Sweep Generator
Rogowski Coil
Rotating Balancing
Rotating Laser Level
Roughness
Router Test System
RTD Calibrator
S
25-27
23-24
28
17, 24
15, 18-19
17
48-49, 53
84
76
86
34
90-91
Salinity & Conductivity
118
Scales
80-82
Scanners
Film & Flatbed
125
Scopemeter
8-9
Security
Bug Detector
100
Metal Detector
100
Surveillance
100
Servers
130
Shaft Alignment
83-84
Shaker Table
83, 85
Signal Generator
Low Frequency
29
RF
17
Signalling Analyser
31-32
SLR Digital Camera
126
Smoke Generating Machine
107
Sniffer
33
Soil Resistivity
42, 46, 47
Sonde
40
Sound
112
Dose Meter
112
Logger
112-113
Measurement
112
Signal Analysis
111
Sound Level Meter 83-84, 112-113
Vibration
83-84
Spectrophotometer
119, 120
Spectroscopy
120
Spectrum Analyser
Acoustic
111
Optical
37
RF
15, 18-19
Speed Measurement
76
Splicer - Fibre Optic
38
SS7
31
Startup Current
48-49, 52-53
Static Detector Probe
13
Static Discharge Generator
24
STM1 ... STM64
31-32, 34
Stocktake Scanner
136
Strip Chart Recorder
71
Stroboscopes
76
Surface Roughness
86
Surge Generator
39
Surge Transient Generator
(0&(0,7HVW
Survey Equipment
76
Sweep Generator
17
T
Tachometers
76
Tape Recorders
72
TDR
39
Telecommunications
ATM
34
BERT
31
Cable Testers/Locator
31
CDMA
27
Communications Analyser
31-32
Fibre Optics
36
GSM
31
,6'1
Line/Exchange Emulators
31
PDH
32
POTS
31
SDH
31-32
Signalling Analyser
31-32
System Tools
31
WAN analyser
34
W-CDMA
26
Temperature
,57KHUPRPHWHU
Logging
67-68, 119
Recorders
97
Thermocouple
97-99
Thermometer
97
Tension
80
7KHUPDO,PDJLQJ&DPHUD
Thermocouple
97-99
Thermometer
97
Thermohygrograph
97
7LPH'RPDLQ5HÀHFWRU
TDR
39
Token Ring Analyser
33
Torque Wrench
79
Total Dissolved Solids (TDS)
118
Touchscreen Monitors
130
Toxic Gas Monitor
115-116
Training Equipment
122
Transducers
Current
53, 58-59
Electrical
58
Frequency
58-59
Humidity
74-75
,QVWUXPHQW7UDQVIRUPHU
Position
75
Pressure
73-75
Temperature
74, 75
Voltage
58-59
Transformer Oil Test
46
Transient Burst
24
Transmission Tester
25
Turbidity
118-119
TV Test Equipment
30
U
8OWUD¿QH3DUWLFOH&RXQWHU Ultrasonic Bath
95
Uninterruptable Power Supplies
(UPS)
61, 63
UV Exposure
111
V
V24, V35
32, 34
Valve Balancing
Air Conditioning
109
Vane Anemometer
106, 108
Variacs
63
VCR
73, 100
VHS Video Player
123
Vibration
Accelerometer
83-84
Analyser
83-84
Blast Logging
85
,PSDFW+DPPHU
Logging
84-85
Table
83, 85
Transport Testing
84
Whole Body
83
Video
Endoscope
78
High Speed
73
Microscope
79
3LSHOLQH,QVSHFWLRQ
Speakers
123
Surveillance
100
Video Camcorder
125
Video Camera
Digital
100,125
VHS
73, 100
Video Security
100
Viscometer
80, 120
VLF MV Cable Test
57
Volatile Organic Compounds (VOC)
115, 117
Voltage Calibrator
90-91
Voltage Transducer
58-59
Voltmeter
12
W
Walk Through Metal Detector 100
WAN Analysers
32-34
Water
Analysis
119
Conductivity
118
Depth
102-103, 118-119
Flow
102-103
Leakage Detection
40
pH
118-119
Quality
118-119
Sampling
119
Water/Oil Bath Temp Calibrator
90-91, 93
Waveform Generator
14
WBGT
106, 109
Weather
110
Wind Speed & Direction 109, 110
Workplace Safety See Occupational
Health & Safety
X
X.21, X.24
X-Ray Measurement
Call now
Australia 1800 632 652 - New Zealand 0800 832 473 - Malaysia 603 5632 1135
32-34
23
42#ORPORATIONHASTHEEQUIPMENT
TOCOVERAWIDERANGEOFINDUSTRIES
s!DVERTISING!RT
s#!$0RODUCTION
s&OOD-ANUFACTURING
s/FFICE%QUIPMENT
s3ECURITY#ROWD#ONTROL
0RODUCTION
s#HEMICAL!NALYSIS
s(EALTH3AFETY
s0ETROCHEMICAL
s3ECRETARIAL
s!GRICULTURE-AINTENANCE
s$ATA#OMMUNICATIONS
s'AS)NDUSTRY
s0HOTOGRAPHY6IDEO
s3IGNWRITING
s$EFENCE0OLICE&IRE
s'ENERAL%LECTRONICS4EST
s0LUMBING'ASFITTING
s4ELECOMMUNICATIONS
%QUIPMENT
s0OWER'ENERATION
s4RANSPORT
s'RAPHIC!RTS
$ISTRIBUTION
s4RAVEL,EISURE
s%DUCATION
s)4$EPARTMENTS
s0RESENTATION
s4RAINING
s%LECTRICAL)NDUSTRIAL
s,OCAL'OVERNMENT
s1UALITY#ONTROL
s7ATER7ASTE7ATER
$OMESTIC
s-ANUFACTURING
s2EFRIGERATION
0LUMBING
s%MERGENCY3ERVICES
0ROCESS)NDUSTRY
s2ETAIL
s6IDEO0RODUCTION
s%NTERTAINMENT
s-ARINE
s2&-ICROWAVE
s7ORKPLACE%NVIRONMENT
s%NVIRONMENTAL4ESTING
s-INING%XPLORATION
s2OAD2AIL#IVIL
s%VENT-ANAGEMENT
s.ON$ESTRUCTIVE4ESTING
#ONSTRUCTION
-ANAGEMENT
s!IR#ONDITIONING
2EFRIGERATION
-AINTENANCE
s!RCHITECTURE
s!RCHIVING%LECTRONIC
s!UDIOVISUAL0RESENTATION
s!UTOMOTIVE%NGINEERING
$ESIGN
s"UILDING#ONSTRUCTION
s!#0OWER&ILTERS
%MERGENCY
s$ESKTOP0UBLISHING
/
, /&REECALL!USTRALIA£nääÊÈÎÓÊÈxÓ
ÜÜÜ°ÌiV…Ài˜Ì>Ã°Vœ“°>Õ
&REECALL.EW:EALANDänääÊnÎÓÊ{ÇÎ
ÜÜÜ°ÌiV…Ài˜Ì>Ã°Vœ°˜â
,
"
&REECALL!USTRALIAÊ£nääÊÓÓÓÊÎÓÇ
ÜÜÜ°Li>ÀVœ“°˜iÌ°>Õ
#ALL-ALAYSIAÈäÎÊxÈÎÓÊ££Îx
ÜÜÜ°ÌiV…Ài˜Ì>Ã°Vœ“°“Þ
&REECALL.EW:EALANDänääÊnÎÓÊ{ÇÎ
ÜÜÜ°Li>ÀVœ“°Vœ°˜â
iLœÕÀ˜iÊÊÊ-Þ`˜iÞÊÊÊ
>˜LiÀÀ>ÊÊÊ iÜV>Ã̏iÊÊÊ`i>ˆ`iÊÊÊÀˆÃL>˜iÊÊʜ`Ê
œ>ÃÌÊÊÊ œÀ̅Ê+Õii˜Ã>˜`ÊÊÊ>À܈˜ÊÊÊ*iÀ̅ÊÊÊÕVŽ>˜`ÊÊÊ7iˆ˜}̜˜ÊÊÊ
…ÀˆÃÌV…ÕÀV…ÊÊÊÕ>>ÊՓ«ÕÀ

Similar documents

Program Book - IEEE Entity Web Hosting

Program Book - IEEE Entity Web Hosting IndustrialApplications;PhysicalAcoustics;Microacoustics(SAW,FBAR,MEMS);andTranducers&TransducerMaterialsǤ ‘–”‹„—–‹‘•…ƒ‡ˆ”‘ƒŽŽ‘˜‡”–Š‡™‘”Ž†ǡ”‡ˆŽ‡…–‹‰–Š‡‹–‡”ƒ–‹‘ƒŽ…Šƒ”ƒ...

More information

Global stratotype for the Ediacaran System and Period

Global stratotype for the Ediacaran System and Period ZDV D VWURQJ PRYHPHQW DZD\ IURP DOO WKHVH WUDGLWLRQDO PHWKRGV RI VXEGLYLVLRQ LQ IDYRXU RI D SUDJPDWLF DSSURDFK ² DUELWUDULO\GH¿QLQJEORFNVRIWLPH8VLQJ WKLVPHWKRG3OXPE ...

More information