Bioinspired nanomaterials
Transcription
Bioinspired nanomaterials
Bioinspired nanomaterials Johannes Raff nanoSeminar Institute of Materials Sciences 11.11.2010 Institute of Radiochemistry y www.fzd.de y Member of the Leibniz Association Outline • Forschungszentrum Dresden-Rossendorf • Institute of Radiochemistry • Microbe radionuclide interaction • Bacterial S-layers • Metall binding by bacterial S-layers • Application potential of bacterial S-layers • S-layer based materials • Biomass productions • Summary • Future cooperation IRC-FZD with IfWW-TUD Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Forschungszentrum Dresden-Rossendorf e.V. (FZD) As of 01.01.2011 Ion-Beam Center Ion-Beam Physics and Materials Research Advanced Materials Radiation Physics Radiochemistry Cancer Research Radiopharmacy Nuclear Safety Research Safety Research High Magnetic Field Laboratory Radiation Source ELBE Rossendorf Beamline (ESRF, Grenoble) PET-Center TOPFLOW-Facility Dresden High Magnetic Field Laboratory Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association I FZD: Facts and figures • Member of the Leibniz-Association Change to the Helmholtz Association as of 01.01.2011, as HZDR (Result of the evaluation 2007) • Foundation: 01.01.1992 (e.V.) • Employees: ~ 800 total (incl. PhD, Annex, projects, trainees) ~ 400 basic funding ~ 370 scientists • Budget 2009: ~ 60 Mio € basic funding ~ 20 Mio € third party funding Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Institute of Radiochemistry Dresden Radiochemical lab building 8b Office and lab building 8a Micobiological and radiochemical labs, Divisions Biogeochemistry, Surface Processes, Biophysics Leipzig Radiochemical laborytories FZD research site Leipzig, Division Reactive Transport Grenoble ESRF Beamline ROBL, France Division Molecular Structures Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association I Research at the Institute of Radiochemistry Radio-ecological research on the behaviour of actinides in nature Long term disposal of radioactive waste Fungi Humans Meat Milk Fruits Animals Bacteria Fungi Water Bread Grain Plants Soil Air Soil Water Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Algae/plants II Sources of radioactive heavy metals (uranium) Natural and anthropogen sources of actinides and radionuclides Reprocessing plants Uranium deposits and minerals Nuclear power plants Storage tanks Nuclear warhead, USA Uranium mining waste piles Nuclear explosions Phosphate fertilizer Uranium ammunition Storage Cement production Our aim: protect people and environment from being affected by actinides Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Fundamental research Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Microbe radionuclide interaction Uranium mining waste pile “Haberland” nearby Johanngeorgenstadt, Saxony Biosorption Uptake Complexation Biotransformation - Determination of the microbial diversity via gen analysis - Isolation of bacteria Research on the interaction of actinides with microorganisms Biomineralization Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Bacterial S-layers Interesting properties of S-layer Heavy metals Paracrystalline protein envelope (S-layer) ☺ ☺ ☺ - Self assembling proteins - Multifunctional - Intelligent interface to the bacterial environment - Metall binding - Some with high stability ☺ ☺ ☺ Trace elements Cell wall Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association I Identified isolates with S-layer proteins (16S rRNA gene analyses) JG-B7 Lysinibacillus fusiformis SW-B9 (AY907676) Lysinibacillus sphaericus DSM28T (AJ310084) Fundamental research Application oriented research Lysinibacillus sphaericus JG-A12 JG-B53 JG-B62 JG-B58 Bacillus psychroviridis 433-D9 (AY266991) JG-B5T Bacillus pumilus Tbl (AB195283) JG-B12 JG-B35 JG-B37 JG-B41 Bacillus cereus AH 521 (AF290554) Bacillus mycoides ATCC6462 (AB021192) Bacillus weihenstephanensis DSM118221 (AB021199) 0.01 Total 144 Bacillus/Lysinibacillus isolates Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Metal binding by bacterial S-layers Molecular biology Spectroscopy XAS Elements ICP-MS N/R ATR-FTIR Microscopy TRLFS Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association χ(k)k 3 I EXAFS investigations of formed uranium protein complexes at pH 4,5 L. sphaericus JG-A12 S-layer L. sphaericus JG-A12 spores 2 4 6 8 -1 k[Å] 10 12 Fourier Transform Magnitude L. sphaericusJG-A12 cells Oax: 1.77 Å Oeq1: 2.31 Å Oeq2: 2.45 ÅC: 2.88 Å P: 3.61 Å P C Oeq1 0 U Data Fit C 0 2 4 R + Δ [Å] 6 8 U Oeq2 P Used model for the fit of the uranium spectra (parts of two molecules, meta-autunite and uranyltriacetate). Merroun, M.et al.(2005) Appl. Environ. Microbiol. 71(9): 5532-5543 Raff, J. et al. (2004) In Water-Rock Interaction, Richard B. Wanty und Robert R. Seal II, A.A. Balkema Publishers, New York, p 97-701 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 1544 PO4 ? 924 1165 1238 1398 νas(UO22+) bidentate binding by COOH 1456 1636 II ATR-FT-IR investigations of formed uranium protein complexes at pH 4 JG -A12 N C T C 9602 Absorption Absorption D S M 2898 A12 1078 JG -B 7 1033 B62 JG -7B JG -B62 JG -B 58 1800 1600 1400 1200 W avenum ber / cm 1000 -1 800 B58 1140 1120 1100 1080 1060 1040 1020 -1 Wavenumber / cm Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 1000 980 960 III Supporting EXAFS/IR investigations using poly-Glu and Phosvitin, pH 4 10 Denatured phosvitin with PbCl 0 FT -5 2 ax 2 S-layer B62 + 0,1 mM U 4 6 S-layer B62 + 1 mM U 1.0 0.5 Phosvitin + 0,1 mM U 0.0 Phosvitin + 1 mM U 8 10 12 14 16 -1 k [Å ] 0 1 2 3 4 5 6 R + Δ [Å] Polyglutamate alpha carboxyl 1083 Absorption Wavenumber / cm Feldman-Complex 2.41Å -4 10 M -3 10 M 1800 1600 1400 1200 1000 800 -1 wavenumber / cm Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 2.34Å Denatured phosvitin with 800 10-3 M U(VI) Li, B. et al.(2010) J Inorg Biochem 104(7), 718-725 ax -U 1 -O UO Uranyltriacetate 3.76Å 1000 -1 5 Denatured phosvitin with 10-4 M U(VI) dis 1.5 1456 2+ U-C dis U-C-C dis U-C-C -C 923 1200 Poly-Glu 1 mM U Oeq1 Oeq2 C 1016 1400 2.5 2.0 1096 1600 15 1022 1800 Poly-Glu 0,1 mM U 1410 9.8:1 3.0 1539 f 925 1019 1:1.02 20 Denatured phosvitin from saturation UO2 U:P 25 4.0 3.5 1716 -COOH 918 1027 d ax 4.5 1531 b O 30 1652 Phosvitin Solution 5.0 χ(k)*k 3 1001 1085 930 1078 1180 1228 1400 1465 Absorption a e exp. fit 35 1540 1655 Phosvitin IV P/S-K edge XANES measurements P K-edge XANES S K-edge XANES S-layer S-layer S-layer + U(VI) S-layer + U(VI) S-layer S-layer S-layer + U(VI) S-layer + U(VI) No evidence, that Phosphate groups are not involved in the U(VI) binding, but sulfur-species interact also. Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Sulfoxide at 2474.9 eV and sulfate at 2483.8 eV JG-B58 JG-B12 JG-B5T JG-B62 JG-B7 JG-A12 Glycoproteins V Posttranslational modifications of the S-layer proteins: glycosylation Detection of glycosylated proteins by means of the “DIG glycan detection kit”. Dark bands indicate glycosylation. Absorption maxima Sugar residue (nm) (mol/mol) JG-A12 - 0,03 JG-B5T 477 2,46 JG-B7 482 1,93 JG-B12 482 4,74 JG-B58 477 2,33 JG-B62 482-485 3,79 S-layer Modified colorimetric determination of sugars after Dubois. Weinert, U. et al.(2010) Anal Biochem (in preparation) Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VI Limited proteolysis for the localisation of the posttranslational modifications Proteolytic digestion of native S-layers from L. sphaericus JG-A12 and NCTC 9602 using the endoproteinase Glu-C (–Glu-P1´– and –Asp-P1 – in Phosphate buffer) JG-A12 JG-A12 9602 MANQPKKYKKFVATAATATLVASAIVPVASAAGFSDVAGNDHEVAINALADAGIINGYADGSFKPNQTIN RGQVVKLLGRYLEAQGQEIPADWNSKQRFNDLPVTAEEELVKYAALAKDAGVFNGSNGNLNASQTMQRQQ MAVVLVRAIKEIAGVDLVAEYKKANFVTEIGDLDKAYSAEQRTAIVALEYAGITNVAHFNPGNSVTRGQF ASFLYRTIENVVNNPEAGVAAVKAINNTTVEVTFDEEVDNVQALNFLISDLEVKNAAVKLTNKKVVVLTT AAQTADKEYTVSLGEEKIGTFKGIAAVVPTKVDLVEKSVQGKLGQQVTLKAQVTVAEGQTKAGIPVTFFI PGSANGVKTPVTVEAVTNEEGIATYSYTRYAATNDTVTVYANGDRSKFSTGYVFWAVDQTLEITEVTTGA TINNGANKTYKVTYKHPETGKPVSGKVLNVSVKENIDVTVDKLQNVTVNGIAVVQTSDNNTRAAQITTDS KGEATFTVSGSNAEVTPVVFEATPVQVTNTNGAVTTTSYTQKYTADILQASAAKVTFGAVQAAYTLEVTR DGGEVAATGVENGRKYNLVVKDKDGKLAANETVNVAFNEDIDGVISTVTSAEFVKVENDKQVRYEGKKIT VKTNSKGEASFVISSEAVNTYATPIAWIDINNQSAKDANLDKGEPSAVAPISYFQAEYLDGSKLVSYKDT TETDKFTGSETATFKVQLTNQSGKVVKNSGYTTPNVSYTVYNTGANNVKVDGVEIAPNRVHTVVAKDGVI NVTTVDNKSSSVKVLATGVAKQTNGNKEFAFTSKEATATFTATNEVSNPYTGAVKHYNTDKKTITFDNKD AIKYAGVKGKTYKYFGLGSTPIANADAFIATLSGQGAGNQVTVTYKEEDDVVSFYIISVVNGGIGNPTTD PALANGVTGTIAFTNTSFNASANQTITVKDADLNVNATVADTTTVTITDSAKTTFNITLTETGVNTGEFT GTLTSAQLALLKDGVITATYNDAKNANNVAATATATATLNTTVGAVNFAAKATTEYSEGVGTAAKVEGST VLTSKVDTGDLVLVVDGVQFTTVVTAIDPGTSATASLTAVVAEINAAAKKVGFTADVATVDADKIVLTSP TKGTSSSVEVKDLGTTTGLGLTKAPEVKGTAGAAVATQWKFTVTTTPAVGETITVKVGTKEASHKVVAGN DLAAIATALNTAIGADYNIALVTGSNVITVTQATPAKTTDELSVTVTK 9602 MANQPKKYKKFVATAATATLVASAIVPVASAAGFSDVAGNDHEVAINALADAGIINGYADGSFKPNQTIN RGQVVKLLGRYLEAQGQEIPADWNSKQRFNDLPVTAEEELVKYAALAKDAGVFNGSNGNLNASQTMPRQQ MAVVLVRAIKEIAGVDLVAEYKKANFVTEIGDLDKAYSAEQRTAIVALEYAGITNVAHFNPGNSVTRGQF ASFLYRTIENVVNAPEAGAAAVKAVNNTTVEVTFDEEVDNVQALNFLISDLEVKNAAVKQTNKKVVVLTT APQTADKEYTVSLGEEKIGTFKGIAAVVPTKVDLVEKSVQGKLGQQVTLKAQVTVAEGQTKAGIPVTFFI PGSANGVKSPVTVEAVTDENGVASYTYTRYAATNDTVTVYANGDRSKFSTGYVFWAVDTTLEITEVTTGD IINNGANKTYKVAYKDPETGKPVSGKVLNVSVKENIDVTVDKLQNVTINGIKVAQTSTSNTTAAQVTTDS KGEATFTITGANAEVTPVVFAGEAVTGQTLPSQKYNADALQTTAKKVKFGALQADYILEVTRDGGETAAT GYDNGRKYKLVVKDKNGKLAANETVNVAFNEDIDGVISTTTDAKFVKLDNEDNQVGWDTTVDKDAKKITV KTDSKGEASFIIGNTKENTYYTPIAWIDVNYQSGKVGTLDQGEPSATAPISYFQSPTIDGSKLVAENKDG KKPSDFEDKDAIFKVVLVNQSGKEMKNHNYKTEKVSYTVNNTGSNEAVVEYTYNGKVESETLAPNRATSV VADNGTITVKPNGKTTSVKVLATGVAKEDKTNGKEYAFTAKEATAKFTATKEISNPYTGAIKYYDTDKKT ITFDGKDAIKYAGESGKKYKYYSGNIEVATEKAFIDLLANASGKVTVTYKVEDDTKSFHIINVGTDVANK PVEKKDDTKPTNNAPVAKQVADQVIASNGSKLTFTANDVASDADKDTLKIVTAYTTNSTVATATTDANQL GFSVEPKGEGSTTVTVVVTDGKDNINVSFKVNVSTASYTSVVNSGNPVKDFAPAVPTAATAKLPEFTSVA KAGTIKVQGFDIPLTLGSTQAQVLETLNNFITDYKINASAKLVDKAIVISSTETGNAATLTVEGDSTLEL VAGTVLGTVSTTPGSVGTATPAKYAVKVLNGVSNGTKVDFKFTIGAKTVTVTVDATAGAKAVSDVVDTLA AATLDGYSITKNGDVIELTQTTPATTTDKLVVETKKAN Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VII Posttranslational modifications of S-layer proteins: phosphorylation Proteolytic digestions of native S-layer endoproteinase Glu-C M 1 2 3 4 5 * * * * * * * * Samples M: Marker 1: S-layer JG-A12 2: S-layer NCTC 9602 3: Glu-C digested JG-A12 SL 4: Glu-C digested 9602 SL 5: Phosvitin P-positive references in lane… M: Ovalbumine 1,73 P:1 (0.12 %) 5: Phosvitin 100 P:1 (10 %) P-positive bands are indicated by an asterix Stains-all staining N-terminal sequencing of the fragments Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VIII Sequence analyses and localisation of the modified amino acids 0 Signal sequence L. sphaericus JG-A12 820 aa 210 aa 1207 aa Phosphorylation N-terminal domain Central domain C-terminal domain 1197 aa L. sphaericus 9602 Phosphorylation Glu-C cleaving sites in the native protein; theoretical 125 (JG-A12) and 141 (9602) Possible sites. C-terminus S-layer P N-terminaler anchor Cell wall Pollmann, K. et al. (2005) Microbiology, 151(9): 2961-2973 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association IX Hypothesis: phosphorylated amiono acids mediate the release of S-layers Uranium COOHgroups bind uranium Uranium mining waste pile isolate Signal transduction ??? Expression of new S-layer proteins S-layer gene Formation of a new S-layer Secretion of the protein monomers Release of the uranium saturated S-layers - phosphate group(s) as a switch? - role of sulfurspecies? Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association X Investigation of the hierarchic organisation of S-layer proteins pH Monomers (%) Hypothesis: 9 8 7 6 5 4 3 25 9 9 16 17 60 100 - Me2+ - Me2+ Me2+ Me2+ (5 mg/ml S-layer JG-A12, 0.1 M NaCl) - Me2+ Me2+ Me2+ Me2+ 2+ Me2+ Me2+ Me Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Application oriented research Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Application potential of bacterial S-layers Some natural functions Applications Extreme environments Functional diversity of the S-layer Diversity of possible technical materials Biosensoren Pollmann, K. et al. (2006) Biotechnology Advances 24 (1), 58-68 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association S-layer based materials Bacterial waste pile isolates S-layer isolation Intact polymers Monomer solution Sol-gel embedding (particles or coatings) Production of S-layer covered Controlled recrystallization direct on hollow carriers or after activation spheres Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association I S-layer coatings with polyelectrolyte support • • • To improve the surface properties for S-layer recrystallization a polyelectrolyte interface can be introduced Simple LbL-coating Layer composition influences the stability of the protein coating Modified after Decher, G. SCIENCE 277(5330), 1232-1237 Without polyelectrolyte support - Recrystallization on SiO2 - 57 % coverage - 12 h incubation with polyelectrolyte support - Recrystallization on PEcoated Si - >90 % coverage - < 30 min incubation - Monolayer Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association II S-layer coated polyelectrolyte hollow sheres • Coating of spheric templates (CaCO3, CaP) with multiple layers (410-…) of polyelectrolytes (PSS, PAH) • Dissolution of the core material by HCl • Coating of the spheres with S-layer(s) via recrystallisation and LbL-techniques • Mono- or multifunctional transparent speres • Magnetic “beads” • Combination of binding molecules and catalysts • … Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association III Functionalization of S-layer coatings Multifunctional multi layer systems Metal binding Production of nano-particles Dyes Enzymes Aptamers Antibodies PEL PEL Possible carrier materials: Glas Ceramics Metal Plastics Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association IV Metal/metalloid filters Water Dissol ved me tal ions Selective binding Advantages compared to previous approaches: - Binding properties - Environmental-friendly disposal - Selectivity ? http://www.periodictable.com Raff, J. et al. (2003) Chem Mater 15(1): 240-244 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz AssociationPatent DE 101 46 375 V Uranium binding by cells and S-layer proteins 19,5 S-layer 64,0 92,5 JG-B62 Cells 76,6 411,7 JG-B58 Isolates JG-B53 JG-B41 JG-B37 99,9 31,6 33,3 JG-B35 JG-B5T 49,1 11,6 350 150,0 149,2 144,2 143,3 JG-B12 JG-B7 157,4 42,5 291,5 182,5 168,3 229,1 Bound uranium (in mg U/g dw) Uranium binding (in µg U/mg dry weight) JG-A12 JG-B7 DSM 2898 JG-A12 NCTC 9602 Cells S-layer 300 250 200 150 100 50 0 4 5 6 7 8 pH Raff, J., Selenska-Pobell, S. (2006) NEI 51 (619) 34-36 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VI Arsenic binding by cells and S-layer proteins 580 Project: 600 BIO MATUM living dead 2000 100 Bound As(V) (in µg/g) 171 117 179 332 182 140 133 117 200 266 289 300 328 400 269 1500 1000 500 rp Fe rr o so -B 62 53 JG -B JG -A 12 7 JG -B 02 N C JG 96 TC 13 24 0 0 98 Z TC SM D ce A en er C 12 98 1 Z 28 EM rs ls ef SM ye el As(V) bindung by living and dead biomass, using a As(V) solution with [As] = 10 mg/l R ae ica nis cus um cus orp g in uth mu eni teri eri ros r a ha er sy lym om ars g . F p e s P .p . c B. M . m L. S B C 0 la S- 0 D Bound As(V) [µg/g dry biomass] 500 As(V) bindung by cells and S-layers of reference strains and uranium mining waste pile isolates, using a As(V) solution with [As] = 10 mg/l Reference material: Ferrosorp (granulated ferric hydroxide) Matys, S. et al. (2010) FZD-Report 530 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VII Pt and Pd binding by S-layer 1900 JG-B35 924 1800 JG-B41 825 Isolate 490 JG-B7 710 JG-A12 1147 815 JG-B53 JG-B62 820 1023 235 760 Bound metal (in mg Me/g dry weight) Pt Pd Fahmy, K. et al. (2006) Biophysical Journal 91 (3), 996-1007 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association VIII Removal of contaminants or recovery of resources Rain Dissolved metals/ metalloids Former mining sites Metal removal or recovery River, lakes, sea Geogenic deposits Industry Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association IX Metal/metal oxide catalysts Incubation with a metal salt soultion + Addition of reducing / precipitation agents Defined catalytic active nanoparticles e.g. Pt, Pd, Fe/Pd, Fe/Pt ZnO, TiO2 with sizes of 1-26 nm Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association X S-layer based synthesis of defined and regular arranged nanoparticles Adding metal salt solution Adding reducing reagents Protein removal via UV Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association XI Synthesis of Pt nanoparticles on different coatings Protein removed by UV Nanoparticles produced on PE without S-layer Protein removed by UV Nanoparticles produced on PE + S-layer Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association XII Precious metal catalysts for the synthesis of defined CNT´s Possibly migration and agglomeration of the particles Further improvement necessary Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association XIII Photocatalytic active coatings for the degradation of pharmaceuticals Projects: t gh Li Inorganic degradation products NanoAqua Water Pharm aceutic als ZnO or TiO2 nano-particles Advantages compared to previous approaches: - Environmental-friendly (disposal, immobilization of nano-particles) - Higher efficency (required energy, day light sensitivity) ? Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Patent pending XIV ZnO based photocatalysts for the elimination of pharmazeutica A 100 Intensity (cps) cDiclofenac [µM] (0 0 4) (2 0 0) (2 -1 2) (2 0 1) 100 (1 0 3) (2 -1 0) (1 0 2) (0 0 2) (1 0 1) (1 0 0) 80 60 40 20 0 80 0 5 10 15 20 25 t [h] 60 40 Z pH 7,3 + JG-B53 Z pH 8,3 + JG-B53 Z pH 9,0 + JG-B53 Z pH 7,3 + JG-A12 Z pH 8,4 + JG-A12 Blindwert B 20 100 0 40 50 60 70 Scattering angle (deg) Top: XRD-pattern of S-layer supported ZnO (red graph) and equally prepared ZnO without protein (green graph). S-layer prepared ZnO-particles have a size of about 14 nm. Right: Diclofenac elimination by S-layer supported ZnO in suspension (A) and immobilized on a carrier (B). c Diclofenac [µM] 90 30 80 70 60 50 0 5 10 t [h] T + PEM + Z pH 8 T + PEM + JG-A12 + Z pH 8 Blindwert Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 15 20 T + PEM + Z pH 9 T + PEM + JG-B53 + Z pH 8 25 XV Photocatalytic elimination of pharamceuticals in water Manufacturer Hospitals Product path Private households Animal husbandry Photocatalytic treatment Water path River, lakes, sea Dumps Wastewater treatment plants Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association XVI Sensory coatings for the detection of pharmaceuticals Project: AptaSens FRET Acceptor Donor Aptamer Organic compound e.g pharmaceutical Advantages compared to previous approaches: - Transferability - Chip-based quantification of several analytes ? - lower unspecific binding ? Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Patent pending XVII S-layer bound fluorescence dyes and aptamers FRET-pair a) c) b) S-layer aptamer composite d) f) e) Thrombin binding by the S-layer bound aptamers (IAsys) 100 µg Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Biomass production Process Yield in g/l (z.B. JG A12) Biomass S-layer Manpower requirements Conventional 3 0,03 6,9 19000 Pilot plant 6 0,16 1,4 730 Optimisation 12 0,85 1,4 100 Aim Possible strategies: €/g S-layer - High density cultivation - Heterologous expression Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association <10 Summary • S-layers are essential for many bacteria to survive in extreme environments. • S-layer proteins are highly complex proteins with many different functional groups and modifications, directly affecting their molecular behavior (conformation, hierarchic organization, metal binding). • Their metal binding and self-assembly properties make S-layers very worthwhile for the development of new materials for • environmental techniques • biotechnology • nanotechnology, but for their application we need to know more about them. Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Future cooperation IRC-FZD with IfWW-TUD • Submitted EU-project “ActiveBrane” Development of reactive nanomembranes with low biofouling for decomposition of organic pollutants in water streams by applying a novel sandwich technology • Arsenic binding by S-layers Planned DFG project Arsenic binding aptamers • Aptamer based sensors for different pollutants Planned project Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association Acknowledgement Research: Co-operation partners: Ulrike Weinert Franziska Lederer Tobias Günther Anne Heller Bo Li Manja Vogel 5 Institutes André Marquard Falk Lehmann Tobias Hauptmann Dr. Sabine Kutschke Dr. Katrin Pollmann Dr. Harald Foerstendorf Dr. Henry Moll Dr. André Rossberg Presented work was funded by: Dr. Sabine Matys (IfWW) Dr. Ulrich Soltmann (GMBU) Dr. Mohamed Merroun (Universität Granada, Spanien) Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 350 JG-B7 DSM 2898 JG-A12 NCTC 9602 Cells S-layer 300 250 200 150 100 50 0 4 Institute of Radiochemistry y Dr. Johannes Raff y www.fzd.de y Member of the Leibniz Association 5 6 7 8