thematic evaluation of the integration of gender in ec development
Transcription
thematic evaluation of the integration of gender in ec development
(XURSHDQ&RPPLVVLRQ 7+(0$7,&(9$/8$7,212)7+(,17(*5$7,212)*(1'(5,1 (&'(9(/230(17&223(5$7,21:,7+7+,5'&28175,(6 0DUFK 92/80(±$QQH[HVWR)LQDO5HSRUW 3UHSDUHGE\ Dr Mary Braithwaite (GB, Team Leader) (XURSHDQ&RQVXOWDQWV Dr. Jane Hailé (GB) Claudy Vouhe (F) Julian Walker (GB) Dirk Van Esbroeck (B) &RQVXOWDQWVRI(&3DUWQHU&RXQWULHV Wasan Hijazi (Jordan) Adama Moussa (Mali) Dr. Carolyn Sobritchea (Philippines) Dr. Diana Urioste (Bolivia) %DFNVWRSSHU Martín Steinmeyer (D, PARTICIP GmbH) Consortium composed by PARTICIP GmbH CIDEAL ECDPM IDC SEPIA )RUWKH Lead Company: PARTICIP GmbH Consultants for environment Hildastr. 66 D - 79102 Freiburg Germany www.particip.de development & This report has been prepared by PARTICIP GmbH for the Commission of the European Communities. The authors accept sole responsibility for this report. The report does not necessarily reflect the opinion of the Commission. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Annexes to Final Report; PARTICIP GmbH - March 2003 92/80($QQH[HVRI)LQDO5HSRUW 1. Terms of Reference of the evaluation 2. Members of the evaluation team 3. Glossary of terms and concepts 4. EC policy commitments on the integration of gender in development co-operation 5. List of people participating in the interviews and focus group discussions 6. Questionnaire to EC Delegations on the integration of Gender in EC Development cooperation Note: This is Volume 3 of three volumes on the thematic evaluation of the integration of gender in EC development co-operation. The other volumes are: Volume 1: Final Report Volume 2: Field Phase Report (report of the four country missions) Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Annexes to Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 1 EUROPEAN COMMISSION EuropeAid Co-operation Office General affairs (YDOXDWLRQ H:\charpls\GENRE\CAHIER DES CHARGES\GENDERToR-7.doc 7+(0$7,&(9$/8$7,212) 7+(,17(*5$7,212)*(1'(5,1 (&&223(5$7,21:,7+7+,5'&28175,(6 7(5062)5()(5(1&()LQDO Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 2 Table of contents ,1752'8&7,21 1.1. 1.2. 1.3. Mandate ................................................................................................................ 3 Evaluation Users ................................................................................................... 3 Objectives of the evaluation .................................................................................. 3 &29(5$*(2)7+((9$/8$7,21 2.1. 2.2. 2.3. Past and Existing programmes and Projects ......................................................... 4 The New Country Strategy Programming Framework ........................................... 4 Geographical coverage ......................................................................................... 4 6758&785($1')2//2:7+528*+2)7+((9$/8$7,21 3.1. 3.2. Steering Group...................................................................................................... 4 The Evaluation’s Basic Elements .......................................................................... 4 (9$/8$7,9(48(67,216 4.1. 4.2. 4.3. 4.4. Gender within Country Programming and Political Dialogue................................. 5 Gender Mainstreaming and Specific Measures for Women .................................. 5 Factors Influencing Gender in EC Co-operation .................................................... 6 Implementation...................................................................................................... 6 (9$/8$7,213+$6(6$1'5(3257,1* 5.1. 5.2. Starting Phase....................................................................................................... 6 Structuring Phase.................................................................................................. 6 ,QWHUPHGLDU\1RWH 6WUXFWXULQJWKHHYDOXDWLRQ 5HSRUWVRQWKH)LUVW3KDVH 5.3. 5.4. Field Phase ........................................................................................................... 7 Report-Writing Phase ............................................................................................ 8 )LQDO5HSRUWV 'LVVHPLQDWLRQ (9$/8$7,217($0 7,0,1*$1'%8'*(7 7.1. 7.2. Calendar ............................................................................................................... 9 Cost of the Evaluation and Payment Procedure .................................................... 9 $11(;(&'2&80(1765(*8/$7,216$1',167580(17621*(1'(5127 (;+$867,9( $11(;287/,1(6758&785(2)7+(),(/'3+$6(5(3257 Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 3 $11(;287/,1(6758&785(2)7+(),1$/5(3257 7(5062)5()(5(1&()25$7+(0$7,&(9$/8$7,212) 7+(,17(*5$7,212)*(1'(5,1(&&223(5$7,21 :,7+7+,5'&28175,(6 ,QWURGXFWLRQ 0DQGDWH During its meeting of 29 November 2001, the Board of the EuropeAid Co-operation Office, requested the Evaluation Unit to undertake an evaluation of gender equality in order to ³YHULI\WHVW WKH ORJLF DQG FRQVLVWHQF\ RI LQGLYLGXDO DFWLRQV ZLWK WKH VWDWHG REMHFWLYHVDQGH[SHFWHGLPSDFWV´.1 The request for such an evaluation is also based on EC Regulation of 22 December 1998 on LQWHJUDWLQJ JHQGHU LVVXHV LQ GHYHORSPHQW FR RSHUDWLRQ (art.11).2 (YDOXDWLRQ8VHUV This evaluation aims at addressing the principal concerns of the Board of Commissioners of the Relex family, as well as answering questions concerning the External Relations Directorate Generals (AidCo, Dev, Relex) of the European Commission. Given the crosscutting nature of “Gender”, some degree of “openness” – in terms of potential beneficiaries of the evaluation – can be expected. 2EMHFWLYHVRIWKHHYDOXDWLRQ As already mentioned, this thematic evaluation comes primarily as an answer to the legal obligation laid in art.11 of EC Regulation of 1998, in view of the adoption of some future regulation,3 and it should also provide some valuable input as how gender should be better integrated in Country and Regional Strategy Papers. The objective of the present evaluation (elaborated in relation to the five key evaluation criteria as described below in § 3.2) is to provide the Commission with an independent source of expertise in order to draw out key findings and lessons from the integration of gender within EC co-operation programmes. The evaluation will present findings and conclusions along with a set of detailed recommendations. This evaluation report is designed primarily to provide the Commission’s policy-makers with an indispensable aid in view of improving strategies for integration of gender across sectors and policies (in particular in the framework of Country and Regional Strategy papers). The study should provide a valuable input for a deeper understanding of the concrete meaning of key concepts (such as mainstreaming), and of the strategic and/or practical changes induced by, and required for the integration of gender in EC development cooperation. It should also aim at enhancing coherence between promoting gender equality and the Commission’s other objectives, as well as a more rational strategic decisionmaking (including within Country Strategy Papers). 1 See (YDOXDWLRQ 6WUDWHJ\ IRU WKH 5HOH[ )DPLO\ (p.3) as in annex to Commissioner Nielson’s note of December 14, 2001, on www.europa.eu.int/comm/europeaid/evaluation/index.htm 2 OJ L-354/5 3 Nota Bene: The present evaluation comes before the assessment (scheduled for 2003) of the 3URJUDPPH RI DFWLRQ IRU WKH PDLQVWUHDPLQJ RI JHQGHU HTXDOLW\ LQ &RPPXQLW\ GHYHORSPHQW FRRSHUDWLRQ, COM (2001) 295 final of 21.6.2001, and should be approached as a different exercise. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 4 &RYHUDJHRIWKH(YDOXDWLRQ The study will cover: 3DVW DQG ([LVWLQJ SURJUDPPHV DQG 3URMHFWV an overall evaluation of EC’s actions to integrate gender issues in EC external co-operation programmes and policies IURP WR and what have been their impacts in the beneficiaries countries;4 7KH1HZ&RXQWU\ 6WUDWHJ\ 3URJUDPPLQJ )UDPHZRUNan assessment of the relevance of: displayed objectives, activities undertaken, as well as intended impacts (and foreseen indicators) of WKH FXUUHQW VWUDWHJ\ of the EC to integrate gender issues in co-operation with third countries (in particular through an analysis of Country Strategy Papers which have been SUHVHQWHGVLQFHWKHHQGRIXQWLO0DUFK). 2.3 *HRJUDSKLFDO FRYHUDJH: An evaluation of a cross-cutting issue such as gender is meant to be global. However, for the field phase, countries and/or projects will be selected at the end of the structuring phase (see below §5.2) on the basis of a proposal made by the consultants. During the structuring phase they will identify the projects that could constitute appropriate case studies. The field phase of the report should however present a certain (cultural, regional) diversity. 6WUXFWXUHDQGIROORZWKURXJKRIWKH(YDOXDWLRQ 6WHHULQJ*URXS The progress of the evaluation will be followed closely by a Commission Steering Group consisting of members of the Relex family services as well as other relevant Directorate Generals under the chairmanship of the Evaluation Unit. This Steering Group will act as an interface between the evaluation team and Commission’s services. The members of the Steering Group will provide information and documentation on activities undertaken in the field of gender, and they will advise on the quality of work done by the consultants. Finally, the Steering Group will assist in feedback of the findings and recommendations from the evaluation into future programme design and delivery. 7KH(YDOXDWLRQ¶V%DVLF(OHPHQWV There will be four distinct phases to the evaluation: (a) setting up its structure; (b) collection of data; (c) analysis; (d) judgement. The evaluation must lead to a set of conclusions (based on findings) and to related recommendations. The assessment will be based on five key evaluation criteria: impact, relevance, effectiveness, efficiency and sustainability, and the approach should include the following basic elements: 4 If necessary, the consultants will take into consideration actions that were undertaken prior to 1995 and the results of which are still relevant for the period under study. Nota Bene: The first major EC policy statements on gender equality in development cooperation were adopted in 1995 in the wake of the 4th Beijing World Conference on Women: Communication to the Council and the European Parliament on integrating gender issues in development co-operation, 18 September 1995 - COM(1995)423; Council Resolution of 20 December 1995, Integrating Gender Issues in Development Co-operation. (for further key official documentation, see Annex 1). Since the ratification of the Treaty of Amsterdam, gender mainstreaming has a legal basis in Art.3 of the Treaty establishing the European Community which provides that “the Community shall aim to eliminate inequalities, and to promote equality, between men and women in all Community policies.” Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 5 i.identify, explain and hierarchise the EC’s objectives in terms of gender equality, their logic and coherence, their UHOHYDQFH both to EC objectives and to the needs of recipient countries, the intended LPSDFW5 corresponding to each objective, and finally how these intended impacts fit within broader and changing contexts (sociological, cultural, economic, political). ii. identify all recorded impacts including unintended impacts or deadweight/ substitution effects (and compare them to intended impacts); iii. assess HIIHFWLYHQHVV in terms of how far the intended results were achieved and also - to the extent that the interventions were effective - their HIILFLHQF\ in terms of how far funding, personnel, regulatory, administrative, time and other resource considerations contributed to, or hindered the achievement of results; iv. consider the VXVWDLQDELOLW\ of gender as a crosscutting issues in EC programmes, that is an assessment of whether the results of the mainstreaming strategy can be maintained over time. v. assess how far the integration of gender in development co-operation programmes has taken account of other FURVVFXWWLQJ LVVXHV (environment, human rights, capacity building, etc.), on the one hand, and of co-ordination, complementarity and coherence aspects on the other; (YDOXDWLYH4XHVWLRQV The following questions, which reflect the Commission’s principal fields of interest, must be addressed: *HQGHUZLWKLQ&RXQWU\3URJUDPPLQJDQG3ROLWLFDO'LDORJXH ❶ How strongly have synergies between gender issues and other goals of EC development co-operation been created? 7KH HYDOXDWRUV ZLOO SD\ SDUWLFXODU DWWHQWLRQ WR WKH OLQNV WKDW KDYH EHHQ LGHQWLILHG RU QRWEHWZHHQJHQGHUDQGRWKHUFURVVFXWWLQJLVVXHVVXFKDVKXPDQULJKWVDQGJRRG JRYHUQDQFHLQVWLWXWLRQDOEXLOGLQJHQYLURQPHQWHWF ❷ To what extent has gender been taken up as a WUXO\ crosscutting issue within Country Strategy Papers (which represent a crucial instrument in EC co-operation with third countries)? 7KHDQDO\VLVVKDOOFRQFHQWUDWHRQERWKDV\VWHPDWLFSUHVHQFHRIJHQGHUDQDO\VLVLQ DOOUHOHYDQWVHFWLRQVRI&63VDQGVXEVWDQWLYHDVRSSRVHGWRDIRUPDOLVWLFWUHDWPHQW DSSURDFKWRJHQGHULVVXHV ❸ To what extent has gender been taken into consideration into political dialogue with third countries? *HQGHU0DLQVWUHDPLQJDQG6SHFLILF0HDVXUHVIRU:RPHQ ❹ How far have WKH PHWKRGV used to mainstream gender (notably: review of existing policies and guidelines, use of statistics and indicators, active consultation of stakeholders, training courses for stakeholders, etc.) contributed to make gender issues visible in EC data and analysis? 5 Please note the ordering of the five criteria. In the context of the programmes of the External Relations Directorates-General, the increased focus on LPSDFW is of particular importance given the current emphasis on results-based management as well as on partner Governments to focus their policies more on poverty alleviation, good governance, democracy, and sound macroeconomic management. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 6 7KH FRQVXOWDQWV VKDOO FRQFHQWUDWH WKHLU DQDO\VLV RQ WKH GLIIHUHQW VWHSV RI (& LQWHUYHQWLRQ IURP SURJUDPPH GHVLJQ WR LPSOHPHQWDWLRQ DQG IROORZXS ZKLOH WDNLQJ LQWRFRQVLGHUDWLRQDVSHFWVVXFKDVFRRUGLQDWLRQFRPSOHPHQWDULW\DQGFRKHUHQFH 7KHLU DQDO\VLV VKRXOG DOVR WDNH LQWR FRQVLGHUDWLRQ PHWKRGV WKDW DUH FXUUHQWO\ EHLQJ XVHGE\RWKHUGRQRUV ❺ How far have Specific Measures for women influenced positively the promotion of gender equality in EC development co-operation programmes? )DFWRUV,QIOXHQFLQJ*HQGHULQ(&&RRSHUDWLRQ ❻ How far has the EC focus on gender issues (including specific programmes for which women are target beneficiaries) increased potential for women to benefit from, participate in, and influence development processes in different sectors of EC intervention ? ❼ To what extent have specific (whether sociological, cultural, political, legal, etc.) factors have been important for promoting or impeding the promotion of gender equality in particular sectors of co-operation? 7KH FRQVXOWDQWV VKDOO LGHQWLI\ VRPH VHFWRUV RI H[WHUQDO DQG GHYHORSPHQW FR RSHUDWLRQDQGDQDO\VHWRZKDWH[WHQWWKH\KDYHSURYHGWREHJHQGHUFRQVFLRXVRUWR UHPDLQUDWKHUJHQGHUEOLQG ,PSOHPHQWDWLRQ ❽ How far has the implementation and delivery of EU-supported activities (especially EC’s administrative arrangements, resource allocation, training courses, etc.) facilitated the effective integration of gender issues within EC co-operation goals and processes and has made possible the achievement of specific objectives? ❾ How far have actions or measures financed by the EC contributed to redress inequalities and improve the gender balance? * ,Q VRPH VHFWRUV VXFK DV HGXFDWLRQ WKH FRQVXOWDQWV VKRXOG FKHFN KRZ IDU DFWLRQV ILQDQFHG E\ WKH (& KDYH FRQWULEXWHG WR WKH HOLPLQDWLRQ RI VWHUHRW\SHV UHSUHVHQWDWLRQVRIZRPHQDQGPHQ¶VUROHVLQERRNVHWF ❿ To what extent has the promotion of gender been a potent force for accelerating development and poverty reduction in third countries? 1RWD%HQH2QWKHEDVLVRIWKHVWUXFWXULQJSKDVHVHHEHORZWKHFRQVXOWDQWVPD\ SURSRVH FKDQJHV WR WKH HYDOXDWLYH TXHVWLRQV FDQFHO VRPH RU DGG QHZ TXHVWLRQV LI VRPH DSSHDUHG QHFHVVDU\ LQ RUGHU WR HYDOXDWH DOO WKH LPSDFWV LPSOLHG ZLWKLQ WKH REMHFWLYHV VHW RXW E\ WKH (XURSHDQ &RPPLVVLRQ +RZHYHU DIWHU YDOLGDWLRQ E\ WKH 6WHHULQJ *URXS QR PRUH WKDQ twelve (YDOXDWLYH 4XHVWLRQV LQ WRWDO VKRXOG EH UHWDLQHG (YDOXDWLRQ3KDVHVDQG5HSRUWLQJ 6WDUWLQJ3KDVH Prior to embarking in the structuring phase of this study, the evaluation team will deliver to the Evaluation Unit an ,QFHSWLRQ 1RWH setting out in full their XQGHUVWDQGLQJ of these Terms of Reference as well as their SURSRVHGDSSURDFK to the work. 6WUXFWXULQJ3KDVH During the Structuring Phase of the evaluation, the evaluation team will examine all relevant key documentation on the past and current Commission’s actions to integrate gender issues in Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 7 its co-operation with third countries. This shall include data on the pertinent Regulations and Instruments, and analysis based on extensive discussions with Commission officials. During this documentary work, the consultants shall also take into consideration the methods that are currently being used by other donors. ,QWHUPHGLDU\1RWH With the information obtained the consultants shall produce an ,QWHUPHGLDU\ 1RWH to be delivered to the Evaluation Unit 15 days after the start of the Structuring phase). In this document, the consultants will: i. examine the Objectives purported by the EC in integrating gender issues to its external programmes and policies and set them in order of priority. They shall assess (a) their relation to the needs of beneficiaries; (b) their intended impacts; (c) their logic, context and overall coherence, including the assumptions, conditionality and risks attached to each; ii. analyse the Key Evaluative Questions proposed within the Terms of Reference. 6WUXFWXULQJWKHHYDOXDWLRQ After acceptance of the Intermediary Note by the Evaluation Unit, the consultants will proceed with the Structuring Phase. For each Evaluative Question, the evaluators should identify an appropriate Judgement Criterion (or criteria), and subsequently select relevant quantitative and qualitative Indicators for each Judgement Criterion identified (this in turn will determine the scope and methods of data collection). On the basis of the Evaluative Questions (their correspondent Judgement Criteria and associated Indicators), the team will then identify and set out proposals for the following: i.suitable methods of Data and Information Collection -- literature, interviews, questionnaires, case studies, etc. -- indicating any limitations and describing how the data should be cross-checked to validate the analysis; ii. appropriate Methods of Analysis, again indicating any limitations. 5HSRUWVRQWKH)LUVW3KDVH At the end of this structuring period, the evaluators will present a first draft Report on the First Phase6 setting out their results and detailing their proposed approach and methodology for the field phase of the evaluation (eg. analytical grid for case studies, model of interview, example of questionnaires, etc.). The field phase will not start before the proposed approach and methodology have been approved by the Evaluation Unit. In this report the consultants will also propose a list of countries and/or projects that could be retained for the field phase (reflecting regional diversity), and include a final budget and timeplanning for the complete study. After the Steering Group has discussed this Draft Report, a delay (about 10 days) will be given to the consultants in order to produce the Final Report on the First Phase. )LHOG3KDVH Following satisfactory completion of the first phase, field visits will be undertaken on the basis of a common analytical grid (as presented within the First Phase Report) at country and/or project level. The duration and panel of countries retained for the field base will be discussed 6 It should be drafted following the structure set out in Annex 2. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 8 with the steering group. The field Phase shall be undertaken on the basis set out in the Structuring Phase. The purpose of field visits is to provide information about how gender issues have been integrated in subsequent phases of EC development co-operation: implementation of programmes, follow-up, as well as dialogue with third countries. At the conclusion of the field study, the team will: (i) give a detailed debriefing to the Delegations on their provisional findings, and (ii) proceed to prepare the )LHOG0LVVLRQ5HSRUW. This report will be submitted to, and discussed within the Steering Group. 5HSRUW:ULWLQJ3KDVH )LQDO5HSRUWV The evaluators will proceed with drafting the Final Report. This draft shall be structured as set out in Annex 3 and should take due account as appropriate of comments received during previous steering group meetings. It should be noted that after having answered the evaluative questions – and on the basis of these answers – the consultants shall provide an overall assessment of the EC strategy in the field of gender (see below Annex 3; § 7.4). This 'UDIW)LQDO5HSRUWwill be delivered to the steering group through the Evaluation Unit by email no later than 15 November 2002. Then, three weeks will be allocated to the steering group in order to consider this draft. On the basis of comments received, the team of evaluators shall bring the appropriate final amendments before submitting their )LQDO5HSRUW to the Evaluation Unit. The evaluators may either accept or reject the comments made by the Steering Group, but, in case of rejection, they shall motivate (in writing) their refusal. 'LVVHPLQDWLRQ After approval of the final report, the Evaluation Unit will proceed with 'LVVHPLQDWLRQ$FWLYLWLHV. The Unit will (i) make a formal MXGJHPHQWRQWKHTXDOLW\ of the evaluation; (ii) prepare a 2-page (YDOXDWLRQ6XPPDU\ (EvInfo) to the standard DAC format, (iii) prepare a )LFKH&RQWUDGLFWRLUH for discussion with the relevant Services. The Judgement, EvInfo and )LFKH&RQWUDGLFWRLUH will all be published on the Web alongside the final report. Finally, the evaluation team will, at the conclusion of the study, take part in a VHPLQDU organised by the evaluation Unit to discuss the evaluation findings with the EC relevant services. (YDOXDWLRQ7HDP This evaluation is to be carried out by a team with advanced knowledge of, and experience in gender analysis and gender equality issues in development co-operation. Consultants should also possess an appropriate training and document experience in the management of evaluations, as well as evaluation methods in field situations. The Evaluation Unit recommends strongly that consultants from beneficiaries countries be employed (particularly, but not only, during the Field Phase). The reports shall be drafted in English, and depending on the countries selected for the field phase, other language skills (such as French and/or Spanish) may be required. The quality of the redaction of the reports must be outstanding. The ILQGLQJV DQDO\VLV, FRQFOXVLRQV and UHFRPPHQGDWLRQV should be thorough. They should reflect a methodical and thoughtful approach to the evaluative questions, and finally the link or sequence between them should be clear. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 9 7LPLQJDQG%XGJHW &DOHQGDU The evaluation will start in April 2002 with completion of the final report on the main study scheduled for November 2002. The following is the planned meeting schedule: – Launch Meeting (Evaluation Unit + consultants) Early April 2002 – Intermediate Steering Group Meeting (Phase 1 3 weeks after reception Draft Report) of the Draft report (May) – Steering Group Meeting (Field Phase Report) 3 weeks after reception of Report (July) – Steering Group Meeting (Draft Final Report) 3 weeks after reception of Draft report (November) – Final Report Seminar January 2003 The dates mentioned in the foregoing sections may only be changed with the agreement of all concerned. &RVWRIWKH(YDOXDWLRQDQG3D\PHQW3URFHGXUH The cost of the Structuring Phase is expected to fall in the range of ¼ The cost of the next phases, and particularly the Field Phase, will be decided upon the desk phase report and particularly on the basis of the Steering group’s decision regarding which (and how many) countries shall be visited. Payment will take place according to the terms of the framework contract as revised by the note of Mr Chomel to Dr.Walter (14 March 2002). The first payment of lump sum costs for the evaluation (30% of the RYHUDOO budget) will be drawn down on acceptance by the Commission services of the structuring phase report. This report will include the proposal for the costs and human resource allocation for the following phases of the evaluation. Other payments shall be drawn down as before; ie. 50% at the presentation and acceptance of the draft final report and 20% at approval of the final report. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 10 $QQH[ (&GRFXPHQWVUHJXODWLRQVDQGLQVWUXPHQWVRQJHQGHUQRW H[KDXVWLYH Communication to the Council and the European Parliament on integrating Gender issues in development co-operation, 18 September 1995 - COM (95) 423 final Council Resolution of 20 Dec ember 1995, Integrating Gender Issues in Development cooperation Communication from the Commission on incorporating equal opportunities for women and men into all Community policies and activities (1996) – COM(1996)67 final of 21 February 1996 European Commission progress report 1997, Integrating Gender Issues in Development Cooperation Council Regulation (EC) No 2836/98 of 22 December 1998 on Integrating Gender Issues in Development Co-operation The European Community's Development Policy, April 26 2000 - COM (2000) 212 final The Cotonou EU-ACP Agreement, 2000 Joint Declaration of the Commission and the Council of November 10, 2000 on the Development Co-operation Policy of the Community Communication from the Commission to the Council, the European Parliament, the Economic and Social Committee and the Committee of the Regions, Towards a Community Framework Programme on Gender Equality (2001-2005), COM (2000) 335 final Communication from the Commission to the Council and the European Parliament on a Programme of Action for the Mainstreaming of Gender Equality in Development Co-operation, COM(2001) 295 final Proposition de décision du Conseil relative au programme concernant la stratégie communautaire en matière d’égalité entre les hommes et les femmes (2001-2005) JO C 337 E/196. • Instruments to mainstream Gender within the Commission under elaboration of revision An amendment to the Project Cycle Management manual and format for presenting financial proposals ("Engendered" PCM Manual) Guide to gender impact assessment (DG EMPL) http://europa.eu.int/comm/employment_social/equ_opp/gender_en.pdf The project identification sheets Intranet site in the Commission on Gender and Development Training materials adapted to various situations Programming Guidelines for the 9th EDF (European Development Fund) Gender country profiles Gender impact assessment form and guidelines The general Terms of Reference for evaluations and feasibility studies Commission Staff Working Paper, Work programme for 2002 of each Commission service for the implementation of the framework strategy on gender equality. Evaluation du Fonds Social européen sur l’égalité des chances (1998) Gender Impact Assessment, DG RTD (2001) • Other Documents Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 11 The Beijing Declaration and Pltaform of Action (1995) and the Beijing + 5 documents (QJHQGHULQJ'HYHORSPHQW7KURXJK*HQGHUHTXDOLW\LQULJKWVUHVRXUFHVDQGYRLFH World Bank Policy research report, 2001. *HQGHUDQG*URZWK$IULFD¶VPLVVHGSRWHQWLDOFindings n.197, World Bank, December 2001. ,QWHJUDWLQJ*HQGHULQ:RUOGEDQN$VVLVWDQFHWorld Bank, Operations Evaluation Department, Report No.23035, October 25, 2001. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 12 $QQH[ 2XWOLQH6WUXFWXUHRIWKH)LHOG3KDVH5HSRUW 3DUW: Reconstruction of the Hierarchy, Logic, related Assumptions, and Intended Impacts of (&¶V2EMHFWLYHV to integrate gender equality in its co-operation with third countries. 3DUW: Presentation of the understanding and interpretation of the .H\ (YDOXDWLYH 4XHVWLRQV, -XGJHPHQW&ULWHULD and associated ,QGLFDWRUV. 3DUW : Analysis of the ,QIRUPDWLRQ DQG 'DWD available at the end of the first phase and indications of any missing data, so as to inform the work plan for the field phase. 3DUW: Proposed )LHOG 3KDVH 0HWKRGRORJ\ (methods of enquiry, data collection and sampling, etc.). 3DUW: Proposed $QDO\VLV0HWKRGRORJ\ based on sound and recognised methods used for evaluation. 1RWD%HQH7KHFDVHVWXGLHVWKDWZLOOEHSUHVHQWHGLQWKLV)LHOG3KDVH5HSRUWVKRXOGEHVHOI VWDQGLQJ7KH\VKRXOGEHEDVHGXSRQDFRPPRQVWUXFWXUHDQGRUJDQLVHGDFFRUGLQJWRWKH VDPHDQDO\WLFDOJULG Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 13 $QQH[ 2XWOLQH6WUXFWXUHRIWKH)LQDO5HSRUW /HQJWK: The overall length of the final country report should not be greater than SDJHV (including the executive summary). Additional information on overall context, programme or aspects of methodology and analysis should be confined to annexes (which however should be restricted to the essential information). ([HFXWLYH6XPPDU\ /HQJWKSDJHVPD[LPXP This executive summary must produce the following information: 1.1 – Purpose of the evaluation; 1.2 – Background to the evaluation 1.3 – Methodology; 1.4 – Analysis and main findings for each Evaluative Question; short overall assessment; 1.5 – Main conclusions; 1.6 – Main recommendations. &RQFOXVLRQV DQG UHFRPPHQGDWLRQV PXVW EH UDQNHG DQG SULRULWLVHG DFFRUGLQJ WR WKHLU UHOHYDQFH WR WKH HYDOXDWLRQ DQG WKHLU LPSRUWDQFH DQG WKH\ VKRXOG DOVR EH FURVV UHIHUHQFHGEDFNWRWKHNH\ILQGLQJV/HQJWKZLVHWKHSDUWVGHGLFDWHGWRWKHFRQFOXVLRQV DQGUHFRPPHQGDWLRQVVKRXOGUHSUHVHQWDERXWRIWKHH[HFXWLYHVXPPDU\ ,QWURGXFWLRQ /HQJWK: SDJHV 2.1. Synthesis of the Commission’s Strategy: its objectives, how they are prioritised and ordered, their logic both LQWHUQDOO\ (ie. the existence – or not – of a logical link between the EC policies and instruments and expected impacts) and H[WHUQDOO\ (ie. within the context of the needs of the country, government policies, and the programmes of other donors); the implicit assumptions and risk factors; the intended impacts of the Commission’s interventions. 2.2. Context: brief analysis of the political, economic, social and cultural dimensions of gender issues in co-operation with third countries, as well as the needs, potential for development (of the population as a whole) and main constraints. 2.3. Purpose of the Evaluation: presentation of the evaluative questions 2QO\ WKH PDLQ SRLQWV RI WKHVH VHFWLRQV VKRXOG EH GHYHORSHG ZLWKLQ WKH UHSRUW 0RUH GHWDLOHGWUHDWPHQWVKRXOGEHFRQILQHGWRDQQH[HV 0HWKRGRORJ\ /HQJWKSDJHV In order to answer the evaluative questions a number of methodological instruments must be presented by the consultants: 3.1. Judgement Criteria: which should have been selected (for each Evaluation Question) and agreed upon by the steering group; 3.2. Indicators: attached to each judgement criterion. This in turn will determine the scope and methods of data collection; Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 1 – Terms of Reference for the Evaluation Page 14 3.3. Data and Information Collection: can consist of literature review, interviews, questionnaires, case studies, etc. The consultants will indicate any limitations and will describe how the data should be cross-checked to validate the analysis. 3.4. Methods of Analysis: of the data and information obtained for each Evaluation Question (again indicating any eventual limitations); 3.5. Methods of Judgement 0DLQ)LQGLQJVDQG$QDO\VLV /HQJWKWRSDJHV 4.1. Answers to each Evaluative Question, indicating findings and conclusions for each; 4.2. Overall assessment of the EC Strategy in the field of gender. This assessment should cover: – Relevance to needs and overall context, including development priorities of third countries and co-ordination with other donors; – Actual Impacts: established, compared to intended impacts, as well as unforeseen impacts or deadweight/substitution effects; – Effectiveness in terms of how far the intended results were achieved: – Efficiency: in terms of how far funding, personnel, regulatory, administrative, time and other resource considerations contributed or hindered the achievement of results; – - Sustainability: whether the results can be maintained over time. $)XOO6HWRI&RQFOXVLRQVDQG5HFRPPHQGDWLRQV /HQJWKSDJHV A Full set of Conclusions* and Recommendations* (i) for each evaluative question; (ii) as an overall judgement. *$OO FRQFOXVLRQV VKRXOG EH FURVVUHIHUHQFHG EDFN E\ SDUDJUDSK WR WKH DSSURSULDWH ILQGLQJV 5HFRPPHQGDWLRQVPXVW EH UDQNHG DQG SULRULWLVHG DFFRUGLQJ WR WKHLU UHOHYDQFH DQGLPSRUWDQFHWRWKHSXUSRVHRIWKHHYDOXDWLRQDOVRWKH\VKDOOEHFURVVUHIHUHQFHGEDFN E\SDUDJUDSKWRWKHDSSURSULDWHFRQFOXVLRQV Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 15 CURRICULUM VITAE - DR. MARY BRAITHWAITE Date of birth: 27.3.1955 Legal status: Director of Tacitus sprl; Administrator of Engender asbl. Nationality: British Working languages: English, French .(<$5($62)(;3(57,6( &RQVXOWDQW DQG UHVHDUFKHU LQ JHQGHU PDLQVWUHDPLQJ ORFDO DQG UHJLRQDO GHYHORSPHQW HPSOR\PHQW DQG ODERXU PDUNHW LQWHJUDWLRQ 0RGHUDWRU RI SDUWLFLSDWRU\ ZRUNVKRSV 7UDLQHU LQ SURMHFW DQG SURJUDPPH F\FOH PDQDJHPHQWDQGSDUWLFLSDWRU\ORJLFDOIUDPHZRUNSODQQLQJ ('8&$7,21$1'75$,1,1* 1978-83 Faculty of Archaeology and Anthropology, University of Cambridge, UK. Subject of doctoral thesis: Gender, material culture and communication among the Azande of southern Sudan. PhD awarded in 1985. 1975-78 Departments of Geography and Archaeology, University of Leeds, UK. Joint BA Honours degree (2.1) awarded in 1978. 1986-7 Courses in Marketing and Business Management, North London Polytechnic, UK 1987 Course in Equal Opportunities in Employment, Greater London Enterprise Board, UK 1993 10-day moderator’s training course for Objective-Oriented Project Planning (OOPP), Management for Development Foundation, Netherlands 1995 Course in OOPP Project and Programme Evaluation, Management for Development Foundation, Netherlands 1995 Course in Gender Policy and Planning, Brussels, DPU for DG VIII (Development), EC 2001 5-day training course in mediation for conflict resolution. CDR Associates, Boulder, Colorado. 352)(66,21$/(;3(5,(1&( GOPP FACILITATION AND PCM TRAINING : 2001 Facilitator of a two-day workshop on “Rural infrastructure, poverty alleviation and employment creation” in Jakarta, Indonesia, for the ILO/ASIST-AP programme. 2001 Lead facilitator at the seven-day Annual Co-ordinating Meeting of the RMI and RTTP programs, part of the multi-donor Sub-Saharan Africa Transport Program. Client: World Bank. 2000 Organiser and trainer of five-day residential training course in participatory project planning (GOPP) and workshop facilitation, integrating gender and diversity issues, held at Eurovillage in Ardennes. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts 2000 Page 16 Facilitation of four-day participatory workshop to elaborate a common methodology for a series of evaluations of Belgian development co-operation projects from the perspective of poverty reduction and gender. Included technical inputs on conceptual frameworks and evaluation criteria. Client: Evaluation Department for International Co-operation, Belgian Ministry of Foreign Affairs. 2000 Design, delivery, evaluation and reporting, with co-trainer, of five-day training seminar on Project Cycle Management integrating a gender perspective, for managers of EUsupported development programmes and projects in Madagascar. Client: FORMFED. 1999 Facilitation and reporting of five-day review and planning workshop for ILO/ASIST programme (labour-based methods in infrastructure works) in eastern and southern Africa, Harare, Zimbabwe. Client: ILO. 1999 Training of facilitators and facilitation of two-day seminar on women’s continuing education in Northern Ireland. Client: Workers’ Educational Association. 1999 Facilitation and reporting of two-day review workshop for ILO/ASIST programme (labour-based methods in infrastructure works) in Asia and the Pacific region in Bangkok, Thailand. Client: ILO. 1999 Trainer of five-day training seminar in objective-oriented participatory planning (logical framework) for WWF project and programme staff from southern and eastern Africa. Client: PCM Group for World Wide Fund for Nature. 1998 Moderation of a seven-day participatory process to reformulate and identify indicators for a programme proposal of the Roads Department Botswana. Client: NORAD 1998 Moderation of three-day participatory workshop in Bangkok to finalise project proposal for ASIST project (labour-based methods in infrastructure investment and maintenance) in Asia and Pacific. Client: ILO 1998 Organisation and co-moderation of ex-ante assessment workshops for EU programmes in fields of education and training. Client: PCM Group, for DG XXII, European Commission. 1995-7 Training and on-going technical support for the development and implementation of the Project Cycle Management methodology in the EC's development cooperation with ACP states. Member of the Help-Desk technical assistance team working with the EC, Evaluation Unit, DG VIII. Client: PCM Consortium for DG VIII, European Commission. 1997 Moderator of two-day participatory workshop on institutional reform in roads sector in Tanzania. Client: Swiss Agency for Cooperation and Development. 1997 Moderator, and co-ordinator of team of seven moderators, for participatory workshops at World Bank Roads Management Initiative policy seminar for ECOWAS countries, Abidjan, Côte d'Ivoire. Client: ASIAFCO / European Commission (DG VIII). 1997 Trainer of two five-day training courses in Project Cycle Management for NGOs in South Africa. Client: PCM Consortium / EU Delegation in South Africa. 1997 Moderation of five-day pre-feasibility planning workshop for Francistown Vocational Teacher Training Centre and Vocational Training Centre project, Botswana. Client: Ministry of Education, Government of Botswana / European Commission. 1996 Moderation of workshops at five-day feedback seminar on the evaluation of EDF SME support programmes, Nairobi, Kenya. Client: European Commission, DG VIII. 1996 Moderation of participatory planning workshop for ASIST project concerning employment-intensive methods for infrastructure programmes, Harare, Zimbabwe. Client: International Labour Organisation. 1996 Moderation of participatory planning workshop for vocational training centre, Gaborone, Botswana. Client: EC (DG VIII). Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 17 1996 Moderation of policy consultative workshop in Malawi for the Sub-Saharan Africa Rural Travel and Transport Program. Client: World Bank. 1995 Moderation of review and replanning workshop for roads sector programme, Ministry of Public Works, Kenya. Client: Swiss Development Cooperation. 1995 Moderation of participatory planning workshop for European transnational project on women and rural economic development, Limousin, France. Client: the project partners. 1995 Organisation and moderation of participatory planning workshop for transnational European project concerning the labour market integration of unemployed rural women, Brussels. Supported by the EC (DG V). 1994 Organisation and moderation of participatory strategy workshop in the framework of the Fourth Equal Opportunities Action Programme. Client: EC (DG V). 1994 Moderation of participatory workshop on rural development and long-term unemployment, Enniskillen, Northern Ireland. Client: Rural Development Council of Northern Ireland. 1994 Organisation and moderation of European expert seminar on women in the rural economy and gender in rural development, Château-Thierry, France. Supported by the EC (DG V). 1994 Moderation of review and replanning workshop for roads sector programme, Ministry of Public Works, Kenya. Client: Swiss Development Cooperation. 1993 Co-moderation of review and replanning workshop for Minor Roads Programme, Ministry of Public Works, Kenya. Client: DANIDA. GENDER MAINSTREAMING : 2001-2 Co-ordinator of gender assessment study of Objective 1 and 2 Structural Fund programmes for the 15 Member States, assessing the treatment of gender issues in programming documents and identifying examples of good practice. Client: DG REGIO, European Commission. 2000-1 Advisor to the French Agency for Development on gender mainstreaming. Coordinator of international consultancy team, assessing treatment of gender issues in AFD projects, undertaking country missions and elaborating recommendations for the integration of gender in the management of co-operation projects. Client: Agence française de développement. 2000-1 Leader of gender impact assessment study of specific programme “Improving th Human Potential and Socio-Economic Knowledge), 5 STD Framework Programme. Research on gender issues in the fields covered, evaluation of the integration of gender in the programme and elaboration of recommendations. Client: DG Research, EC. 2000 Advice and training to the COPEC Committee, European Parliament, on equal opportunities issues and strategies in the context of organisation change. Client: European Parliament. 2000 Co-trainer of two one-day training seminars in English and French for gender mainstreaming officials in the European Commission. Client: DG Personnel, EC. 1999 Writing of technical document for the European Commission on the mainstreaming of gender equality in Structural Fund programming for the period 2000-2006. Client: DG Regional Policy, EC. 1997-9 Project co-ordinator of programme of studies and technical assistance on the integration of gender in EC development co-operation in ACP countries. Responsible for coordinating the work of several teams of international consultants and for facilitating the decision-making with the EC on the programme strategy and activities. Specific involvement in Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 18 work on the monitoring of gender in the programme and project cycle and the integration of gender in PCM, including delivery of training workshops in Guinea, Brussels and Ethiopia. Client: Royal Tropical Institute, Amsterdam, for the European Commission, DG VIII. 1999 Numerous workshop presentations in Germany, France, Belgium and Ireland on gender mainstreaming in the European Structural Funds. Various clients: EC (DG V, DG VI, DG XVI), national and regional authorities. 1998-1999 Coordinator of survey and seminar on good practice on mainstreaming gender in Structural Fund programming in Germany, UK and France. Author of guidelines on gender mainstreaming in the new regulations of the European Structural Funds. Client: European Commission, DG XVI. 1998 Organiser of workshop on “implementation and evaluation” at European seminar on mainstreaming equality in the Structural Funds, Viana do Castelo, Portugual, Sept 1998. Client: European Commission, DG XVI. 1997-8 Consultant to European Social Fund on integration of gender in regulations of new Structural Fund interventions; elaboration of guidelines and instrument for ex-ante assessment of ESF programme proposals. Client: DG V, European Commission. 1996 Training seminar and guidelines on integrating gender equality into Objective 2 programming for urban and industrial regions, for European Commission Desk Officers in DG V and DG XVI. Client: EC (DG XVI). 1995-6 Co-ordinator of European study on methods and tools for integrating gender equality into the identification, planning and evaluation of local and regional development projects and programmes. Supported financially by the EC (DG V). &RRUGLQDWRURIVWXG\RQWKHSRVLWLRQRIZRPHQLQGHFLVLRQPDNLQJ LQ WUDGH XQLRQV LQ (XURSH &OLHQW (XURSHDQ 7UDGH 8QLRQ &RQIHGHUDWLRQ (03/2<0(17$1'/2&$/'(9(/230(17 2001-2002 Co-ordinator of external evaluation of “Preparatory Measures for a Local Commitment to Employment”, in framework of European Employment Strategy. Client: INBAS for DG EMPL, EC. 2000-2001 Peer review manager for EC “Peer Review Programme of Active Labour Market Policies”. Responsible for facilitating exchanges of experience on labour market policy initiatives between EU Member States, in framework of European Employment Strategy. Client: ÖSB/INBAS for DG EMPL, EC. 2000 Ex-ante assessment of European Structural Fund programme documents for Objective 1 and 2 regions in the south-west of England from a perspective of equal opportunities and gender equality. Client: Prosper Development Agency. 1999-2000 Review and final reporting of EU demonstration programme “Information Society and Social Exclusion”: production of discussion document and final synthesis report, co-ordination of one-day review meeting with the EC and the pilot projects. Client: DG Regional Policy, EC. 1997 Evaluator of two regional employment creation strategies in "new sources of jobs" for long-term unemployed people in Norrbotten Sweden and West Ireland. Presentation at closing European conference of programme on "the potential of new activities and the corresponding territorial conditions". Client: Europe Innovation 2000 / European Commission DG XVI. 1996 Co-ordinator of expert group and author of discussion paper for European conference on employment creation strategies in the context of regional development. Client: EC (DG XVI). Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 19 1996 Evaluation of project proposals in the framework of the European Regional Development Fund Article 10 "new sources of employment" programme. Client: EC (DG XVI). 1995-6 Co-ordinator of study on the economic roles and situation of rural women in Finland, Austria and Sweden. Supported by the EC (DG X). 1994-1995 Joint co-ordinator of study to identify good practice employment creation initiatives for unemployed women in rural areas in the European Union. Project supported by the EC (DG V). 1994 Member of evaluation team undertaking project progress review of National Printing Training Centre, Bangkok, Thailand. Client: GTZ. 1994 Equal opportunities evaluation of EC-funded youth training projects (desk study), for PETRA Youth Bureau. 1993-1995 Co-ordination and moderation of planning, monitoring and evaluation workshops for ERGOFORM, a transnational project on continuous training for staff of projects for the long-term unemployed. Client: INBAS. 1993 Assessment of project proposals for the EC’s PHARE Democracy Programme. Client: EC (DG I). 1992 Analysis of project proposals in the framework of the EC LEADER programme on rural development. Client: AEIDL. 1990-June 1992 Editor/Manager of Edition-Communication department of (Association Européenne pour l'Information sur le Développement Local), Brussels. AEIDL Responsible for the management of multi-lingual publications contracts and for research and information on local economic and employment development, in the framework of EC employment and social policy programmes (ELISE, Poverty 3, ERGO). 1988 - 90 Glasgow. Project Manager, Economic Development Department, The Planning Exchange, Editor of LEDIS, the Local Economic Development Information Service, and manager of research and evaluation projects, specialising in employment, enterprise and training initiatives. &RRUGLQDWRU7KH0DUNHWLQJ5HVRXUFH&HQWUH/RQGRQ Manager of training and consultancy organisation for small enterprises and nonprofit organisations. 1978 - 85 Post-graduate research, in UK and Sudan. Additional work during this period included: member of ethnographic research team in Nuba Mountains, Sudan, in 1979; tutoring and lecturing in Cambridge and Cardiff, UK; writing and editing. 1975 - 78 Full-time undergraduate, University of Leeds. Holiday work included participation in ethnographic field research in Baringo region, Kenya. 1973 - 75 Administrative Assistant, Limuru Boys (Agricultural Training) School, Kenya. General administrative support and teaching of English and Maths. Also taught domestic science on voluntary basis at local YWCA girl’s school. 35,1&,3$/5(&(1738%/,&$7,216 2001 Braithwaite, M. Gender in Research: Gender impact assessment of the FP5 specific programmes – Improving human research potential and the socioeconomic knowledge base. A study for the European Commission, DG Research. 2000 Braithwaite, M. Final conclusions and lessons of the EC Demonstration Programme “Promotion of the Information Society as a way of tackling social exclusion”, EC DG Regional Policy. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 20 1999 Braithwaite, M. and Wuiame, N. Technical Document 3: Mainstreaming equal opportunities for women and men in Structural Fund programmes and projects, EC DG Regio. 1999 Braithwaite, M., Mainstreaming equal opportunities in the European Structural Funds: how regions of Germany, France and UK are putting into practice the new approach, EC DG XVI (Regional Policy). 1998 Braithwaite, M. and Wuiame, N., Guidelines for the integration and ex-ante assessment of gender equality in ESF programme proposals, EC DG V European Social Fund 1998 Braithwaite, M. (editor), The economic role and situation of women in rural areas of Austria, Finland and Sweden, European Commission (DG X), Agricultural Information Service, Brussels 1997 Braithwaite, M., Manual for integrating gender equality into local and regional development, Engender, Brussels 1996 Braithwaite, M., The promotion of equal opportunities between women and men in urban and industrial regions within the framework of Objective 2, 1997-1999, EC Directorate-General for Regional Policy, Brussels 1995 Braithwaite, M. and Byrne, C., The position of women in decision-making in European trade unions, European Trade Union Confederation, Brussels 1994 Braithwaite, M., The economic role and situation of women in rural areas of the European Union, Commission of the European Communities (DG X), Agricultural Information Service, Brussels Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 21 &855,&8/809,7$(B'LUN9DQ(VEURHFN 6XPPDU\RI([SHULHQFH 'LUN 9DQ (VEURHFN LV D VRFLRHFRQRPLVW KDYLQJ QHDUO\ \HDUV RI H[SHULHQFH LQ GHYHORSPHQWFRRSHUDWLRQ$IWHUKLVVWXGLHVKHZRUNHGIRUVL[\HDUVLQ,QGRQHVLDLQDQ LQWHJUDWHGUXUDOGHYHORSPHQWSURMHFWDQGDVFRXQWU\UHSUHVHQWDWLYHIRUDPDMRU%HOJLDQ 1*2 +H UHWXUQHG IURP ,QGRQHVLD LQ DQG ZDV RQH RI WKH IRXQGHUV RI 6RXWK 5HVHDUFKRQH\HDUODWHUDQGLVSUHVHQWO\LWV'LUHFWRU6LQFHKHKDVFRQGXFWHGILHOG PLVVLRQV WR DERXW FRXQWULHV LQ $IULFD $VLD DQG (DVWHUQ (XURSH IRU (XURSHDQ DQG LQWHUQDWLRQDO1*2VELODWHUDODQGPXOWLODWHUDOGRQRUV+LVPDMRULQWHUHVWVDQGH[SHUWLVH DUHUHODWHGWRHYDOXDWLRQRISURMHFWVSURJUDPPHVDQGSROLFLHVSDUWLFLSDWRU\DSSURDFKHV RISURMHFWF\FOHPDQDJHPHQWEDVHGDPRQJRWKHUVRQWKHORJLFDOIUDPHZRUNDSSURDFK LQVWLWXWLRQDO VWUHQJWKHQLQJ RI 1*2V DQG JUDVVURRWV RUJDQLVDWLRQV WKH VHW XS LPSOHPHQWDWLRQ DQG PDQDJHPHQW RI SURJUDP RU WKHPDWLF HYDOXDWLRQ H[HUFLVHV DQG PLFURFUHGLW +LV DVVLJQPHQWV LQFOXGH WUDLQLQJ H[SHUW DGYLFH DFWLRQ RULHQWHG UHVHDUFK DQGHYDOXDWLRQ 3HUVRQDOGDWD 9DQ(VEURHFN'LUN/HRSROG3LHWHU %RUQLQ%UXVVHOV%HOJLXPRQ-XQHWK 0DUULHGWR+H\OHQ/XWJDUGLV )LYHFKLOGUHQ $FDGHPLFHGXFDWLRQ %DFKHORU RI $SSOLHG (FRQRPLFV ZLWK GLVWLQFWLRQ DW 8)6,$ 8QLYHUVLW\ RI $QWZHUS3ULQVVWUDDW$QWZHUS%HOJLXP 0DVWHURI$SSOLHG(FRQRPLFVZLWKGLVWLQFWLRQDW8)6,$ &HUWLILFDWHRIWZR\HDUVRIVWXG\RI6SDQLVKODQJXDJH8)6,$ 7HDFKLQJ&HUWLILFDWHLQ(FRQRPLF6FLHQFHV8)6,$ &HUWLILFDWHRISUHSDUDWRU\H[DPLQDWLRQJLYLQJDFFHVVWRWKHVWXG\RI0DVWHULQ6RFLDO DQG3ROLWLFDO6FLHQFHV8)6,$ Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 22 &RXUVHVRIWKHSRVWJUDGXDWHSURJUDPRI6RFLDODQG&XOWXUDO$QWKURSRORJ\ DW.8/&DWKROLF8QLYHUVLW\RI/RXYDLQWHUPLQDWLRQRIWKHVHVWXGLHVLQ0DUFK EHFDXVHRIGHSDUWXUHWR,QGRQHVLDVHHEHORZ 6KRUWFRXUVHV 7UDLQLQJFRXUVHIRUGHYHORSPHQWZRUNHUVRUJDQLVHGE\&RRSLER)HEUXDU\0DUFK ZHHNV • Moderators Course for Objective Oriented Project Planning, organised by the Management for Development Foundation, Ede, The Netherlands (8 days) • Participant of the CIGO (Consultancy in Groups and Organisations) training programme (on-going) .QRZOHGJHRIODQJXDJHV /DQJXDJH 5HDG 6SHDN :ULWH 'XWFK )UHQFK (QJOLVK ,QGRQHVLDQ 6SDQLVK 'HWDLOHGHPSOR\PHQWUHFRUGLQUHYHUVHGRUGHU )URP0D\WR WKH SUHVHQW ([HFXWLYH 'LUHFWRU RI 6RXWK 5HVHDUFK D IRXQGDWLRQ IRU WKH VWXG\ DQG HYDOXDWLRQ RI GHYHORSPHQW DFWLRQV $V VXFK UHVSRQVLEOH IRU WKH JOREDO PDQDJHPHQW DQG GHYHORSPHQW RI WKH DVVRFLDWLRQ DOVR LQYROYHG LQ WKH LPSOHPHQWDWLRQRIDQLPSRUWDQWQXPEHURIFRQVXOWDQFLHVDQGDGYLVRU\DFWLYLWLHVVHH SRLQW 6HSWHPEHU$SULOLQGHSHQGHQWFRQVXOWDQWLQGHYHORSPHQW Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 23 0DUFK$XJXVWHPSOR\HGE\&RRSLER D PDMRU %HOJLDQ 1*2 ZLWK WKH IROORZLQJGXWLHV ½ RYHUDOO UHVSRQVLELOLW\ IRU WKH LGHQWLILFDWLRQ DQG SUHSDUDWLRQ RI D SURMHFWDLPLQJDWWKHFUHDWLRQRIDUHJLRQDOFHQWHUIRUGHYHORSPHQWWUDLQLQJDQG VHUYLFHVLQFRRSHUDWLRQZLWK<,6,QGRQHVLDQGHYHORSPHQW1*2 ½ FRQVXOWDQW RI D SURMHFW IRU FRPPXQLW\ GHYHORSPHQW DQG FR RSHUDWLYH DFWLRQ LQ WKH GLVWULFW RI 7DQD 7RUDMD 6XODZHVL ,QGRQHVLD VHW XS RI FROODERUDWLRQ ZLWK D ORFDO IRXQGDWLRQ GHYHORSPHQW RI DFWLYLWLHV LQ YDULRXV ILHOGV FRRSHUDWLYH PDUNHWLQJ RI YHJHWDEOHV FRQVXPHUV FRRSHUDWLYHV DJULFXOWXUDOH[WHQVLRQOLYHVWRFNDQGSUHYHQWLYHKHDOWKFDUH ½ &RRSLERUHSUHVHQWDWLYHIRU,QGRQHVLD ½ FRRUGLQDWRU RI WKH DERYH PHQWLRQHG SURMHFW LQ 7DQD 7RUDMD 6XODZHVL,QGRQHVLD ½ KHDG RI WKH HFRQRPLF DFWLYLWLHV GHSDUWPHQW RI WKH DERYH PHQWLRQHG SURMHFW &RQVXOWDQFLHVDQGDGYLVRU\DFWLYLWLHV 6XPPDU\RIPDMRUDVVLJQPHQWVXQGHUWDNHQGXULQJWKHODVW\HDUV 2QJRLQJ $VVLVWDQFH WR WKH 6RXWKHDVW (XURSH 'HSDUWPHQW RI WKH .LQJ %DXGRXLQ )RXQGDWLRQLQDVWUDWHJLFSODQQLQJH[HUFLVHDQGLQFDSDFLW\EXLOGLQJDWWKH OHYHORIWKHGHSDUWPHQWVXSSRUWWRWKHIRXQGDWLRQ·VSURJUDPPHLQ6RXWK (DVW (XURSH LQWHUYHQWLRQV LQ WKH ILHOG RI VWUDWHJLF SODQQLQJ SDUWLFLSDWRU\ SURMHFW PDQDJHPHQW DQG RUJDQLVDWLRQDO VWUHQJWKHQLQJ RQ UHTXHVW RI WKH .LQJ%DXGRXLQ)RXQGDWLRQDQGWKH:RUOG%DQN,QVWLWXWH 2QJRLQJ 0HPEHU RI WKH FRUH WHDP RI WKH 3DUWLFLS *HUPDQ FRQVXOWDQF\ ILUP OHG FRQVRUWLXPSURYLGLQJVHUYLFHVWRWKH(XURSHDQ&RPPLVVLRQLQWKHILHOGRI 3URMHFW &\FOH 0DQDJHPHQW DVVLVWDQFH LQ WKH UHYLHZ RI H[LVWLQJ WUDLQLQJ PDWHULDOGHYHORSPHQWRIQHZWUDLQLQJPRGXOHVWUDLQLQJRI(&VWDII 2QJRLQJ .H\ H[SHUW LQ WKH IUDPHZRUN RI WKH VHUYLFH FRQWUDFW ´(YDOXDWLRQV LQ WKH $UHDV RI +XPDQ 'HYHORSPHQW DQG *RRG *RYHUQDQFH DV PHPEHU RI D FRQVRUWLXP ZLWK 3DUWLFLS DV OHDG DJHQF\ UHVSRQVLEOH IRU RYHUDOO TXDOLW\ PDQDJHPHQWRIWKHFRQWUDFWDQGWKHHYDOXDWLRQVLPSOHPHQWHG 2QJRLQJ &RRUGLQDWRURIDPDMRUSDUWRIWKHSURJUDPPHHYDOXDWLRQRIWKH:$$: FRQVRUWLXP FRQVRUWLXP RI %HOJLDQ 1*2V FRIXQGHG E\ WKH %HOJLDQ JRYHUQPHQW FRYHULQJ FRXQWULHV LQ $IULFD /DWLQ $PHULFD DQG $VLD UHVSRQVLEOHIRUWKHGHILQLWLRQRIWKHHYDOXDWLRQPHWKRGRORJ\TXDOLW\RIWKH ILHOGHYDOXDWLRQVDQGGUDIWLQJRIWKHILQDOUHSRUW 7HDP OHDGHU RI WKH HYDOXDWLRQ RI FRILQDQFLQJ RSHUDWLRQV ZLWK (XURSHDQ 1*2V EXGJHW OLQH % JOREDO FRRUGLQDWLRQ RI WKH HYDOXDWLRQ GHVN SKDVHDQGILHOGPLVVLRQVGUDIWLQJRIWKHGHVNSKDVHDQGILQDOUHSRUW Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 24 $VVLVWDQFH WR WKH 9/,5 WKH )OHPLVK ,QWHU8QLYHUVLW\ &RXQFLO WR VXSSRUW WKHPLQWKHGHILQLWLRQDQGHODERUDWLRQRIDFRPSUHKHQVLYHV\VWHPRISURMHFW F\FOH PDQDJHPHQW IRU WKH WKUHH PDMRU IRUPV RI XQLYHUVLW\ FRRSHUDWLRQ 3ROLF\$GYLFH:RUN2ZQ,QLWLDWLYHVRI%HOJLDQ3URPRWHUVDQG,QVWLWXWLRQDO 8QLYHUVLW\ &RRSHUDWLRQ FROODERUDWLRQ ZLWK ,'30 WKH ,QVWLWXWH RI 'HYHORSPHQW3ROLF\0DQDJHPHQW8QLYHUVLW\RI$QWZHUS 3DUWLFLSDWLRQ LQ DQ HYDOXDWLRQ RI 1*2 :DWHU DQG 6DQLWDWLRQ 3URMHFWV FR IXQGHGE\WKH(&WHDPOHDGHUIRUWKHILHOGHYDOXDWLRQRIQLQH1*2ZDWHU DQG VDQLWDWLRQ SURMHFWV FRIXQGHG E\ WKH (& LQ 8JDQGD DVVLVWDQFH LQ WKH GUDIWLQJRIWKHILQDOUHSRUW $VVLVWDQFH WR )$'2 %HOJLDQ 1*2 ZLWK WKH VHWXS LPSOHPHQWDWLRQ DQG IROORZ XS RI D SDUWLFLSDWRU\ SURJUDPPH HYDOXDWLRQ RI VXVWDLQDEOH DJULFXOWXUHGHYHORSPHQWSURMHFWVLQFOXGLQJWKHGHILQLWLRQRIWKHGHVLJQRI WKH HYDOXDWLRQ PHWKRGRORJ\ GHILQLWLRQ RI WKH HYDOXDWLRQ IUDPHZRUN PRGHUDWLRQRIDSUHSDUDWRU\VHPLQDULPSOHPHQWDWLRQRIDWHVWHYDOXDWLRQ SDUWLFLSDWLRQ LQ WKH GLVFXVVLRQ RI WKH HYDOXDWLRQ UHVXOWV GUDIWLQJ D SDSHU GHVFULELQJWKHPHWKRGRORJ\RIWKHHYDOXDWLRQ 5HVSRQVLEOHIRUDPDMRUUHYLHZRIWKHDSSOLFDWLRQRIWKH2EMHFWLYH2ULHQWHG ,QWHUYHQWLRQ 3ODQQLQJ PHWKRG ZLWKLQ %$'& %HOJLDQ $GPLQLVWUDWLRQ IRU 'HYHORSPHQW &RRSHUDWLRQ DVVHVVPHQW RI WKH DFWXDO DSSOLFDWLRQ RI WKH PHWKRGVLGHQWLILFDWLRQRIPDMRUERWWOHQHFNVDQGSRWHQWLDOVIRUPXODWLRQRI D SURSRVDO IRU LPSURYHG DSSOLFDWLRQ LQ D IUDPHZRUN RI LQWHJUDWHG SURMHFW F\FOHPDQDJHPHQW 3DUWLFLSDWLQJ LQ WKH HYDOXDWLRQ RI WKH SURJUDPPH RI 619 1HWKHUODQGV 'HYHORSPHQW2UJDQLVDWLRQLQ%HQLQFRPPLVVLRQHGE\,29WKHHYDOXDWLRQ XQLW RI WKH 'LUHFWRUDWH *HQHUDO IRU ,QWHUQDWLRQDO &RRSHUDWLRQ 7KH 1HWKHUODQGV UHVSRQVLEOH IRU WKH HYDOXDWLRQ RI WZR SURMHFWV DQG WKH GUDIWLQJRIDSDUWRIWKHSURMHFWVXPPDU\UHSRUW 'HWDLOHGOLVWRIFRQVXOWDQFLHV VXSSRUW WR WKH VWUDWHJLF SODQQLQJ SURFHVV RI WKH 3DSXD &RQVHUYDWLRQ )XQG 3DSXD,QGRQHVLDFRPPLVVLRQHGE\WKH3&)XQGDQG86$,' RUJDQLVDWLRQDO VXSSRUW WR .3$ DQ ,QGRQHVLDQ &RQVRUWLXP IRU $JUDULDQ 5HIRUPFRPPLVVLRQHGE\.3$DQGVHYHUDO(XURSHDQ1*2V DVVLVWDQFH RI WKH 6RXWKHDVW (XURSH GHSDUWPHQW RI WKH .LQJ %DXGRXLQ )RXQGDWLRQLQDVWUDWHJLFSODQQLQJH[HUFLVHDQGLQFDSDFLW\EXLOGLQJDW WKH OHYHO RI WKHGHSDUWPHQWDGYLFHDQGEDFNVWRSSLQJIRUWKHGHYHORSPHQWRIWKHRUJDQLVDWLRQ·V SURJUDPPH LQ 5RPDQLD 0DFHGRQLD DQG %XOJDULD RQ UHTXHVW RI WKH .LQJ %DXGRXLQ)RXQGDWLRQDQGWKH:RUOG%DQN,QVWLWXWH Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 25 HYDOXDWLRQRIWKHSURJUDPPHRIWKH:$$:FRQVRUWLXPLQFRXQWULHVLQWKH 6RXWKJOREDOFRRUGLQDWLRQDQGPDQDJHPHQWGHILQLWLRQRIHYDOXDWLRQPHWKRGRORJ\ DQGILHOGHYDOXDWLRQLQ7RJRDQG%HQLQFRPPLVVLRQHGE\WKH:$$:FRQVRUWLXP EDFNVWRSSLQJIRUWKHHYDOXDWLRQRQ´PRELOLW\JUDQWVµLQWKHIUDPHZRUNRIWKH VHUYLFH FRQWUDFW RI (YDOXDWLRQV LQ WKH $UHDV RI +XPDQ 'HYHORSPHQW DQG *RRG *RYHUQDQFHFRPPLVVLRQHGE\WKH(& WHDP OHDGHU IRU WKH HYDOXDWLRQ RI IRXU SURJUDPPHV IRU WKH HPSRZHUPHQW RI LQGLJHQRXV SHRSOH LQ 0LQGDQDR 3KLOLSSLQHV LQ WKH IUDPHZRUN RI WKH %URHGHUOLMN 'HOHQSURJUDPPHHYDOXDWLRQFRPPLVVLRQHGE\%URHGHUOLMN'HOHQD%HOJLDQ1*2 WHDP OHDGHU IRU WKH HYDOXDWLRQ RI WZR SURMHFWV LPSOHPHQWHG E\ 'DWD 3HUWLZL )RXQGDWLRQ UHODWHG WR VPDOOVFDOH HQWHUSULVH SURPRWLRQ DQG VRFLRHFRQRPLF GHYHORSPHQWFRPPLVVLRQHGE\'D\D3HUWLZL)RXQGDWLRQ UHVSRQVLEOH IRU WKUHH WUDLQLQJ FRXUVHV LQ SURMHFW F\FOH PDQDJHPHQW RQH LQ %UXVVHOVRQHLQ)LMLRQHLQ&DPERGLDIRU(&VWDIIDQGUHSUHVHQWDWLYHVIURPORFDO(& SDUWQHULQVWLWXWLRQVFRPPLVVLRQHGE\WKH(& VHYHUDOVKRUWWUDLQLQJFRXUVHVLQSURMHFWF\FOHPDQDJHPHQWDQGUHODWHGVXEMHFWV IRU YDULRXV FOLHQWV 8)6,$ 8QLYHUVLW\ RI $QWZHUS LQ WKH IUDPHZRUN RI D WKUHH PRQWKWUDLQLQJFRXUVHWKH5HG&URVVRI%HOJLDQ)UHQFKVSHDNLQJFRPPXQLW\WKH ,QVWLWXWHIRU7URSLFDO0HGLFLQH • 2001: responsible for two training courses in project cycle management (one in Brussels, one in Fiji) for EC staff and representatives from 11 Pacific countries (commissioned by the EC); • 2001: key-expert in the framework of the Service Contract for the evaluation in the field of humen development and good governance. • 2001: evaluation of the programme of the WAAW consortium in 11 countries in the South; global co-ordination and management, definition of evaluation methodology and field evaluation in Togo and Benin (commissioned by the WAAW consortium); VHYHUDOWUDLQLQJFRXUVHVLQSURMHFWF\FOHPDQDJHPHQWLQ%UXVVHOVDQG0RURFFR IRU (& VWDII LQ %UXVVHOV (& GHOHJDWLRQ VWDII LQ 0RURFFR DQG UHSUHVHQWDWLYHV IURP ORFDOSDUWQHURUJDQLVDWLRQVFRPPLVVLRQHGE\WKH(& VXSSRUW PLVVLRQ WR WKH 'D\D 3HUWLZL )RXQGDWLRQ IRU WZR RI WKHLU SURMHFWV D SURMHFW RI DJULFXOWXUDO GHYHORSPHQW LQ 1XVD 3HQLGD ,VODQG %DOL 3URYLQFH DQG D SURMHFW RI VPDOO VFDOH HQWHUSULVH SURPRWLRQ LQ %DOL DQG (DVW -DYD SURYLQFHV 'D\D 3HUWLZL)RXQGDWLRQ DVVLVWDQFH WR /X[ 'HYHORSPHQW 6$ WR UHILQH DQG XSGDWH WKH SURMHFW F\FOH SUHVHQWO\ XVHG E\ WKH RUJDQLVDWLRQ LQ WKH LPSOHPHQWDWLRQ RI GHYHORSPHQW SURMHFWV IXQGHG E\ WKH *RYHUQPHQW RI /X[HPERXUJ FRPPLVVLRQHG E\ /X[ 'HYHORSPHQW 6$ VXSSRUWPLVVLRQWRWKH.RQVRUVLXP3HPEDUXDQ$JUDULD.3$&RQVRUWLXPIRU $JUDULDQ 5HIRUP WR UHYLHZ WKHLU JOREDO VWUDWHJ\ DQG SODQV IRU WKH IXWXUH FRPPLVVLRQHGE\.3$DQG)UqUHVGHV+RPPHVD)UHQFK1*2 DVVLVWDQFH RI WKH &DELQHW RI WKH 6HFUHWDU\ RI 6WDWH IRU 'HYHORSPHQW &R RSHUDWLRQLQDVWUDWHJLFSODQQLQJH[HUFLVHFRPPLVVLRQHGE\WKH6HFUHWDU\RI6WDWHIRU 'HYOHRSPHQW&RRSHUDWLRQ HYDOXDWLRQ RI FRILQDQFLQJ RSHUDWLRQV ZLWK (XURSHDQ 1*2V EXGJHW OLQH % JOREDO FRRUGLQDWLRQ RI WKH HYDOXDWLRQ GHVN SKDVH DQG ILHOG PLVVLRQV Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 26 GUDIWLQJ RI WKH GHVN SKDVH DQG ILQDO UHSRUWV DQG ILHOG HYDOXDWLRQ RI HLJKW PXOWL VHFWRUDOSURMHFWVLQ6RXWK,QGLDFRPPLVLRQHGE\WKH(& WUDLQLQJDQGDGYLFHRISURMHFWVWDIIRIWKUHHIOHPLVKXQLYHUVLW\GHYHORSPHQWFR RSHUDWLRQSURJUDPPHVLQ(FXDGRUDQG%ROLYLD HYDOXDWLRQ RI WKH SURJUDPPH RI WKH 'HGHELW 6DYLQJV DQG &UHGLW ,QVWLWXWLRQ '(&6,7LJUD\(WKLRSLD'(&6,DQG626)DLP%HOJLXP VHYHUDOEDVLFDQGDGYDQFHGWUDLQLQJFRXUVHVLQSURMHFWF\FOHPDQDJHPHQWWKH (&WKH(XURSHDQ&RPPLVVLRQ VXSSRUWWRWKH(&UHODWHGWRWKHIXUWKHURSHUDWLRQDOLVDWLRQRIWKHFRQFHSWDQG RI WKH DSSURDFK RI 'HFHQWUDOLVHG &RRSHUDWLRQ DV PHPEHU RI D FRQVRUWLXP LPSOHPHQWLQJDIUDPHZRUNFRQWUDFWFRPPLVVLRQHGE\WKH(& VXSSRUW PLVVLRQ WR WKH 'D\D 3HUWLZL )RXQGDWLRQ IRU WZR RI WKHLU SURMHFWV D SURMHFW RI DJULFXOWXUDO GHYHORSPHQW LQ 1XVD 3HQLGD ,VODQG %DOL 3URYLQFH DQG D SURMHFW RI VPDOO VFDOH HQWHUSULVH SURPRWLRQ LQ %DOL DQG (DVW -DYD SURYLQFHV 'D\D 3HUWLZL)RXQGDWLRQ VXSSRUW PLVVLRQ WR $5('6 WKH $VVRFLDWLRQ IRU 5XUDO (GXFDWLRQ DQG 'HYHORSPHQW6HUYLFHWRDVVLVWWKHPDQGUHODWHGFRPPXQLW\EDVHGRUJDQLVDWLRQVLQ WKH IXUWKHU GHYHORSPHQW RI WKHLU HFRQRPLF SURJUDPPHV DQG WKH IRUPXODWLRQ RI D ILYH\HDUVWUDWHJLFSODQ$5('6DQG1&26D%HOJLDQ1*2 HYDOXDWLRQRIDPLFURFUHGLWSURMHFWLPSOHPHQWHG E\352',$ %XUNLQD )DVR ZLWK WKH VXSSRUW RI WKH (& DQG 626)DLP 626)DLP D %HOJLDQ DQG /X[HPERXUJ EDVHG1*2 VXSSRUWRIWKHGHYHORSPHQWFRRSHUDWLRQGHSDUWPHQWRIWKH9/,5WKH)OHPLVK ,QWHUXQLYHUVLW\ &RXQFLO IRU WKH GHYHORSPHQW RI D QHZ DSSURDFK LQ SURMHFW F\FOH PDQDJHPHQW9/,5 WUDLQLQJLQWKHPRGHUDWLRQRIWKH22,32EMHFWLYH2ULHQWHG3URMHFW3ODQQLQJ PHWKRGDQGVXEVHTXHQWILHOGDSSOLFDWLRQIRUVWDIIDQGSDUWQHUVRI)$'2DQG)26LQ 9LHWQDP)$'2DQG)26WZR%HOJLDQ1*2V VHFRQG DVVLVWDQFH WR WKH <33:, WKH )RXQGDWLRQ IRU (QWUHSUHQHXUVKLS 'HYHORSPHQWLQ,ULDQ-D\D,QGRQHVLDLQWKHIRUPXODWLRQRIDVWUDWHJLFSODQIRUWKH IRXQGDWLRQ<33:,DQG129,%D'XWFK1*2 HYDOXDWLRQ RI 5(0'(& 5HVRXUFH DQG 0DQDJHPHQW 'HYHORSPHQW &RQVXOWDQWVDQ,QGRQHVLDEDVHGFRQVXOWDQF\ILUPIXQGHGE\1RYLE1RYLE VXSSRUW RI WKH 6RXWK 'HSDUWPHQW RI WKH 1&26 XPEUHOOD RI WKH )OHPLVK1*2VWRUHGHILQHWKHLUVWUDWHJLFRSWLRQVIRUWKHIXWXUH1&26 HYDOXDWLRQRIWKHSURMHFW'HYHORSPHQWRIVDYLQJVDQGFUHGLWFRRSHUDWLYHVLQ %DPEDQJ LPSOHPHQWHG E\ '&'&, DQG ,9$ 3KLOLSSLQHV %$'& WKH %HOJLDQ $GPLQLVWUDWLRQIRU'HYHORSPHQW&RRSHUDWLRQ EDFN VWRSSLQJ PLVVLRQZLWK UHSUHVHQWDWLYHV RI IRXU DJULFXOWXUDO GHYHORSPHQW SURMHFWV LQ )ORUHV (DVW 1XVD 7HQJJDUD 3URYLQFH ,QGRQHVLD FRPPLVVLRQHG E\ )$'2D%HOJLDQ1*2 DVVLVWDQFHWRWKH<33:,WKH)RXQGDWLRQIRU(QWUHSUHQHXUVKLS'HYHORSPHQWLQ ,ULDQ -D\D ,QGRQHVLD LQ WKH IRUPXODWLRQ RI D VWUDWHJLF SODQ IRU WKH IRXQGDWLRQ <33:,DQG129,% Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 27 DVVLVWDQFH WR WKH VWDUWXS RI D UXUDO GHYHORSPHQW SURMHFW RQ 1XVD 3HQLGD ,VODQG%DOL3URYLQFH,QGRQHVLD'D\D3HUWLZL)RXQGDWLRQ PHWKRGRORJLFDODVVLVWDQFHLQWKHIRUPXODWLRQRIDSURMHFWDLPLQJDWLPSURYLQJ WKH SHUIRUPDQFH RI WKH VHHG SURGXFWLRQ DQG GLVWULEXWLRQ VHFWRU LQ WKH 1RUWK RI &DPHURRQ*RYHUQPHQWRI&DPHURRQDQGWKH%$'& WHDPOHDGHU IRU DQ HYDOXDWLRQ RIQLQH 1*2 ZDWHU DQG VDQLWDWLRQ SURMHFWV FR IXQGHGE\WKH(&LQ8JDQGD(&DQG3DUWLFLSD*HUPDQFRQVXOWDQF\ILUP LQVWLWXWLRQDOVXSSRUWWRWKH)$'2SURJUDPPHLQ,QGRQHVLD VXSSRUW WR <D\DVDQ 'D\D 3HUWLZL DQ ,QGRQHVLDQ 1*2 IRU WKH VWDUW XS RI D SURJUDPPH RI VPDOO VFDOH HQWHUSULVH SURPRWLRQ LQ (DVW -DYD DQG %DOL ,QGRQHVLD <'3DQG1&26 SDUWLFLSDWLRQ LQ WKH HYDOXDWLRQ RI DQ DJURIRUHVWU\ SURMHFW FRQGXFWHG E\ :$/'$DQ,QGRQHVLDQ1*2LQ6RXWK6XODZHVL,QGRQHVLD)$'2 VXSSRUW PLVVLRQ WR *KDQD LQ WKH IUDPHZRUN RI 'HFHQWUDOLVHG &RRSHUDWLRQ 3URJUDPPH 'HOHJDWLRQ RI WKH (XURSHDQ &RPPLVVLRQ LQ *KDQD DQG WKH 1DWLRQDO $XWKRULVLQJ2IILFHU VXSSRUWIRUWKHSURPRWLRQRIGHFHQWUDOLVHGFRRSHUDWLRQLQWKHIUDPHZRUN RIWKHGHYHORSPHQWFRRSHUDWLRQEHWZHHQWKH(&DQGWKH$&3FRXQWULHV(&8QLWRI 'HFHQWUDOLVHG&RRSHUDWLRQ HYDOXDWLRQ RI WKH 'HGHELW 6DYLQJV DQG &UHGLW ,QVWLWXWLRQ 7LJUD\ (WKLRSLD %$'& PHWKRGRORJLFDO DVVLVWDQFH LQ WKH IRUPXODWLRQ RI D SURMHFW DLPLQJ DW WKH UHKDELOLWDWLRQRIWKH%DQFRXPDQDSODLQ0DOL%$'&DQGWKH*RYHUQPHQWRI0DOL HYDOXDWLRQ RI WKH DFWLYLWLHV RI WKH FRRUGLQDWLQJ RIILFH RI )$'2 DQG )26 )$'2DQG)26 VWXG\ RQ WKH GLUHFW IXQGLQJ RI VRXWKHUQ 1*2V E\ RIILFLDO GRQRUV DQG LWV FRQVHTXHQFHVIRUQRUWKHUQ1*2V%LODQFHDPDMRU'XWFK1*2 VXSSRUWIRUWKHVHWXSRIDQHYDOXDWLRQRIWKHSURJUDPRI)$'2LQ,QGRQHVLD GHVLJQ RI WKH HYDOXDWLRQ PHWKRGRORJ\ GHILQLWLRQ RI WKH HYDOXDWLRQ IUDPHZRUN PRGHUDWLRQRIDSUHSDUDWRU\VHPLQDULPSOHPHQWDWLRQRIDWHVWHYDOXDWLRQ)$'2 VXSSRUWPLVVLRQWR$5('6$VVRFLDWLRQRI5XUDO(GXFDWLRQDQG'HYHORSPHQW 6HUYLFH7DPLO1DGX,QGLDIRUWKHIRUPXODWLRQRIDVWUDWHJLFILYH\HDUSODQ1&26 DQG$5('6 HYDOXDWLRQRIWKH6XSSRUW3URMHFWWRWKHDJULFXOWXUDODFWLYLWLHVRIORFDOVHOIKHOS JURXSV LQ WKH $WODQWLTXH SURYLQFH %HQLQ 352726 D %HOJLDQ 1*2 DQG WKH (XURSHDQ&RPPLVVLRQ VXSSRUWPLVVLRQWR<D\DVDQ'D\D3HUWLZL'D\D3HUWLZL)RXQGDWLRQ0DODQJ (DVW-DYD ,QGRQHVLD WR DVVLVW LQ WKH IRUPXODWLRQ RI D SURJUDPPH IRU VPDOO VFDOH HQWHUSULVHGHYHORSPHQW'D\D3HUWLZL)RXQGDWLRQDQGWKH1&26 UHVSRQVLEOHIRUWKHUHYLHZRIWKHDSSOLFDWLRQRIWKH22,3PHWKRGZLWKLQ%$'& DQG WKH IRUPXODWLRQ RI D SURSRVDO IRU DQ LPSURYHG DSSOLFDWLRQ LQ D IUDPHZRUN RI LQWHJUDWHGSURMHFWF\FOHPDQDJHPHQW%$'& Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 28 HYDOXDWLRQ RI WKH UXUDO GHYHORSPHQW SURJUDPPH RI 9UHGHVHLODQGHQ.ROGD 6HQHJDO9UHGHVHLODQGHQD%HOJLDQ1*2 PLG WHUP HYDOXDWLRQ RI WKH ,QWHJUDWHG 5XUDO 'HYHORSPHQW 3URMHFW LQ .ULVKQDJLUL'LVWULFW7DPLO1DGX,QGLD1&26 SDUWLFLSDWLQJ LQ WKH HYDOXDWLRQ RI WKH SURJUDPPH RI 619 1HWKHUODQGV 'HYHORSPHQW2UJDQLVDWLRQLQ%HQLQUHVSRQVLEOHIRUWKHHYDOXDWLRQRIWZRSURMHFWV DQG WKH GUDIWLQJ RI D SDUW RI WKH VXPPDU\ UHSRUW ,29 WKH HYDOXDWLRQ XQLW RI WKH 'LUHFWRUDWH*HQHUDOIRU,QWHUQDWLRQDO&RRSHUDWLRQ7KH1HWKHUODQGV VXSSRUW PLVVLRQ WR <D\DVDQ 'D\D 3HUWLZL 0DODQJ (DVW-DYD ,QGRQHVLD WR GHILQHDVWUDWHJ\IRULQVWLWXWLRQDOVXVWDLQDELOLW\1&26 VXSSRUW PLVVLRQ WR <:70 DQ ,QGRQHVLDQ 1*2 EDVHG LQ )ORUHV WR GHILQH D SROLF\RQFUHGLWGHOLYHU\IRUVPDOOKXVEDQGU\DQGWRH[HFXWHVHYHUDOEDFNVWRSSLQJ DFWLYLWLHV)$'2 VXSSRUW WR 0$65, DQ ,QGRQHVLDQ 1*2 EDVHG LQ 6RXWK6XODZHVL ,QGRQHVLD IRUWKHSODQQLQJRIDZRPHQGHYHORSPHQWSURMHFW)$'2 FRRUGLQDWRURIDQHYDOXDWLRQRQ&UHGLWV\VWHPVIRUHFRQRPLFDFWLYLWLHVLQ WKHUXUDOVHFWRULQZKLFKSURMHFWVIXQGHGE\WKH%HOJLDQJRYHUQPHQWDQG%HOJLDQ 1*2 V DUH HYDOXDWHG %$'& DQG $'2&RSURJUDP WKH XPEUHOOD RUJDQLVDWLRQV RI WKH%HOJLDQ1*2 V LQVWLWXWLRQDOVXSSRUWPLVVLRQWR,9'3DQ,QGLDQ1*21&26 HYDOXDWLRQRIWKHHFRQRPLFSURJUDPPHVRI$5('6DQ,QGLDQ1*21&26 HYDOXDWLRQ RI D SURJUDPPH RI HPSOR\PHQW FUHDWLRQ LQ WKH VPDOO VFDOH HQWHUSULVHVHFWRULQ7XQLVLD(XURSHDQ&RPPLVVLRQ WUDLQLQJRIRIILFLDOVRIWKH%$'&WKH%HOJLDQ$GPLQLVWUDWLRQIRU'HYHORSPHQW &RRSHUDWLRQLQWKH2EMHFWLYH2ULHQWHG,QWHUYHQWLRQ3ODQQLQJPHWKRG%$'& WUDLQLQJ RI 7XQLVLDQ JRYHUQPHQW RIILFLDOV LQ WKH 22,3 PHWKRG 2EMHFWLYH 2ULHQWHG,QWHUYHQWLRQ3ODQQLQJWKH*RYHUQPHQWRI7XQLVLDDQGWKH%$'& VXSSRUWPLVVLRQWRDQDJULFXOWXUDOGHYHORSPHQWSURMHFWLQ)ORUHV,QGRQHVLDWR GHILQHWKHLQVWLWXWLRQDOVHWWLQJRIWKHSURMHFW)$'2 WHDP OHDGHU RI DQ DSSUDLVDO PLVVLRQ IRU D SURMHFW RQ UXUDO HOHFWULILFDWLRQ DQG ZDWHU SURYLVLRQ XVLQJ QHZ DQG UHQHZDEOH HQHUJLHV UHVSRQVLEOH IRU WKH HFRQRPLF DQG PHWKRGRORJLFDO DVSHFWV RI WKH PLVVLRQ LQFOXGLQJ SODQQLQJ ZLWK WKH 22,3 PHWKRG%$'& HYDOXDWLRQ RI IRXU FUHGLW SURMHFWV LQ WKH 3KLOLSSLQHV LQ WKH IUDPHZRUN RI WKH HYDOXDWLRQRI&UHGLWV\VWHPVIRUHFRQRPLFDFWLYLWLHVLQWKHUXUDOVHFWRU%$'&VHH DERYH DSSUDLVDOIROORZLQJWKH22,3DSSURDFKRIDSURMHFWWRLPSURYHWKHXVHRIWKH SRWHQWLDORIWKH7XQLVLDQGLDU\FDWWOHWKH7XQLVLDQ/LYHVWRFN2IILFHDQGWKH%$'& HYDOXDWLRQ RI WKH 38*$SURMHFW 3URMHFW IRU WKH 8WLOLVDWLRQ RI *HRWKHUPLF 5HVRXUFHVLQ$JULFXOWXUHLQ7XQLVLDFRPPLVVLRQHGE\WKH%$'& DVVLVWDQFHRIWKH9LOODJH:DWHU5HVHUYRLU3URMHFWLQ7DPDOHUHJLRQ*KDQDDQG GHVLJQRIDWKUHH\HDUDFWLRQSODQ&(%(02D'XWFKIXQGLQJDJHQF\ Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 29 DVVLVWDQFH RI WKH )XQG IRU 'HYHORSPHQW &RRSHUDWLRQLQ WKH SUHSDUDWLRQ DQG LPSOHPHQWDWLRQ RI LWV WULHQQLDO SODQQLQJ DQG HYDOXDWLRQ VHVVLRQ )26 D %HOJLDQ 1*2 FRUHVSRQVLEOHIRUWKHRUJDQLVDWLRQRIDQLQWHUQDWLRQDOZRUNVKRSRQWKHXVHRI WKH/RJLFDO)UDPHZRUN$SSURDFKDQGWKH2EMHFWLYH2ULHQWHG,QWHUYHQWLRQ3ODQQLQJ IRUSDUWLFLSDWRU\GHYHORSPHQW UHVSRQVLEOH IRU WKH LGHQWLILFDWLRQ RI GHYHORSPHQW LQWHUYHQWLRQV LQ WKH VPDOO OLYHVWRFNVHFWRULQ&DPHURRQLQWKHIUDPHZRUNRIWKHELODWHUDOFRRSHUDWLRQEHWZHHQ &DPHURRQ DQG %HOJLXP %$'& LQ FRRSHUDWLRQ ZLWK %,() D %HOJLDQ FRQVXOWDQF\ ILUP UHVSRQVLEOHIRUDWUDLQLQJFRXUVHIRU0DOLQHVHGHYHORSPHQWRIILFLDOVRQWKHXVH RI WKH 22,3 PHWKRG WKH 'HSDUWPHQW RI ,QWHUQDWLRQDO &RRSHUDWLRQ RI 0DOL DQG %$'& UHVSRQVLEOHIRUWKHSODQQLQJSURFHVVRIDQDJULFXOWXUDOGHYHORSPHQWSURMHFWRQ WKHLVODQGRI)ORUHV,QGRQHVLD)$'2 FRUHVSRQVLEOH IRU D SODQQLQJ VHPLQDU LQ WKH IUDPHZRUN RI D :RUOG %DQN FRPPLVVLRQHGVWXG\RQWKH(YDOXDWLRQRIWKHH[DPLQDWLRQV\VWHPLQWKHVHFRQGDU\ VFKRROVLQ7XQLVLDPHPEHURIDWHDPRI%,()D%HOJLDQFRQVXOWDQWVJURXS UHVSRQVLEOHIRUDWUDLQLQJFRXUVHIRUPRGHUDWRUVRI22,32EMHFWLYH2ULHQWHG ,QWHUYHQWLRQ3ODQQLQJZRUNVKRSVLQ5ZDQGD%$'& UHVSRQVLEOH IRU WUDLQLQJ FRXUVHV RQ 22,3 IRU WKH ILHOG VWDII RI WKH %$'& LQ %XUXQGLDQG5ZDQGD%$'& UHVSRQVLEOH IRU D WUDLQLQJ FRXUVH IRU PRGHUDWRUV RI 22,3 ZRUNVKRSV IRU 2&&=,0 2UJDQLVDWLRQ RI &ROOHFWLYH &RRSHUDWLYHV RI =LPEDEZH )26 D %HOJLDQ 1*2 UHVSRQVLEOH RI D VXSSRUW PLVVLRQ WR WKH 9LOODJH :DWHU 5HVHUYRLUV 3URMHFW LQ 7DPDOH1RUWKHUQ3URYLQFH*KDQD&(%(02 VXSSRUWPLVVLRQWRWKH,QWHJUDWHG9LOODJH'HYHORSPHQW3URJUDPPH,9'3LQ 7DPLO1DGX,QGLDIRUWKHH[WHQVLRQRILWV1&26 UHVSRQVLEOHIRUDVXSSRUWPLVVLRQIRUWKH$VVRFLDWLRQRI5XUDO(GXFDWLRQDQG 'HYHORSPHQW6HUYLFHVLQ7DPLO1DGX,QGLD1&26 UHVSRQVLEOH RI DQ 22,3 2EMHFWLYH 2ULHQWHG ,QWHUYHQWLRQ 3ODQQLQJ VHPLQDU DQDO\VLQJWKHLQVWLWXWLRQDOVWUHQJWKVDQGZHDNQHVVRI2&&=,0)26 FRUHVSRQVLEOH IRU D VWXG\ RQ WKH FRQVWUDLQWV DQG SRVVLELOLWLHV RI LQVWLWXWLRQDO GHYHORSPHQW DQG RUJDQLVDWLRQDO VWUHQJWKHQLQJ RI $IULFDQ 1*2 V LQFOXGLQJILHOGZRUNLQ6HQHJDO1&26DQGHLJKWRWKHU%HOJLDQ1*2 V FRUHVSRQVLEOH IRU DQ DQDO\VLV RI WKH SRVVLELOLWLHV RI HVWDEOLVKLQJ PRUH VWUXFWXUDO UHODWLRQVKLSV RI FRRSHUDWLRQ DPRQJ WKH %HOJLDQ LQGHSHQGHQW 1*2 V FRPPLVVLRQHG E\ 21*2 WKH XPEUHOOD RUJDQLVDWLRQ RI WKH LQGHSHQGHQW %HOJLDQ 1*2 V PRGHUDWLRQ RI DQ 22,3 VHPLQDU FRQFHUQLQJ D GHYHORSPHQW SURJUDPPH WR HVWDEOLVK D VWUXFWXUDO OLQN EHWZHHQ DJULFXOWXUDO UHVHDUFK DQG H[WHQVLRQ LQ 7XQLVLD %$'& Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 30 PRGHUDWLRQRIDQ22,3VHPLQDUFRQFHUQLQJDGHYHORSPHQWSURMHFWWRVXSSRUW WKHGLDU\VHFWRULQ7XQLVLD%$'& PHPEHU RI D WHDP RI 0') 0DQDJHPHQW IRU 'HYHORSPHQW )RXQGDWLRQ (GH 7KH 1HWKHUODQGV UHVSRQVLEOH IRU WKH VHW XS DQG LPSOHPHQWDWLRQ RI D WUDLQLQJ SURJUDPPH FRQFHUQLQJ WKH ,QWHJUDWHG $SSURDFK WR 3URMHFW3URJUDPPH F\FOH 0DQDJHPHQWFRUHVSRQVLEOHIRUWUDLQLQJVHVVLRQVLQ%UXVVHOVDQG'DNDU'*9,,, RIWKH(& PRGHUDWLRQ RI DQ 22,3 SODQQLQJ VHPLQDU FRQFHUQLQJ WKH SURPRWLRQ RI DJULFXOWXUDOLQYHVWPHQWVLQ7XQLVLD%$'& PRGHUDWLRQ RI DQ 22,3 SODQQLQJ VHVVLRQ FRQFHUQLQJ WKH HVWDEOLVKPHQW RI D GDWDEDQNRIWKH7XQLVLDQ,QGXVWULHV%$'& UHVSRQVLEOHIRUWKHHYDOXDWLRQRIWKH,QWHJUDWHG9LOODJH'HYHORSPHQW3URMHFW LQ'KDUPDSXUL'LVWULFW7DPLO1DGX,QGLD1&26 PHPEHURIDWHDPFRPSRVHGE\0DWUL[FRQVXOWDQWV7KH1HWKHUODQGVWR HYDOXDWHWKH'XWFKGHYHORSPHQWSURJUDPPHDQGSROLF\LQ0DOLUHVSRQVLEOHIRUWKH HYDOXDWLRQRIILYHSURMHFWVLQWKH6RXWK0DOLDUHD'*,6WKH'XWFK*RYHUQPHQW UHVSRQVLEOH IRU WKH HYDOXDWLRQ RI WZR DJULFXOWXUDO GHYHORSPHQW SURMHFWV ILQDQFHGWKURXJKWKH%HOJLDQ6XUYLYDO)XQGLQ0EH\D5HJLRQ7DQ]DQLD&RRSLER D%HOJLDQ1*2 UHVSRQVLEOH IRU D WUDLQLQJ FRXUVH RQ 22,3 2EMHFWLYH 2ULHQWHG 3URMHFW 3ODQQLQJDQGVXEVHTXHQWSODQQLQJH[HUFLVHLQ WKH ILHOGIRU UHSUHVHQWDWLYHV RI ILYH 5ZDQGHVHDQGWKUHH=DLULDQ1*2 V&RRSLER FRUHVSRQVLEOH IRU D WUDLQLQJ FRXUVH WR IRUP PRGHUDWRUV IRU 22,3 SODQQLQJ H[HUFLVHVLQFROODERUDWLRQZLWKWKH0DQDJHPHQWIRU'HYHORSPHQW)RXQGDWLRQ(GH 7KH1HWKHUODQGV%$'& FRUHVSRQVLEOHIRUWZRSODQQLQJVHPLQDUVIROORZLQJWKH22,3PHWKRGIRUWZR SURMHFWVLQ7HWHDQG0DQLFDSURYLQFHV0R]DPELTXH)26 FRUHVSRQVLEOHIRUDWUDLQLQJFRXUVHRQ22,3LQ %XUXQGL IRU PHPEHUV RI WKH %HOJLDQ &RRSHUDWLRQ 6HFWLRQ LQ %XUXQGL %$'& SURMHFW OHDGHUV DQG ORFDO RIILFLDOV %$'& FRUHVSRQVLEOHIRUDVLPLODUFRXUVHLQ5ZDQGD%$'& FRUHVSRQVLEOHIRUWKHHYDOXDWLRQRIWKHVXVWDLQDELOLW\RI1*2SURMHFWV LQ$IULFDLQFRRSHUDWLRQZLWKWKH&HQWUHIRU'HYHORSPHQW6WXGLHVRIWKH8QLYHUVLW\ RI$QWZHUSFRRUGLQDWRURIWKHHYDOXDWLRQRISURMHFWVLQ5ZDQGD FRUHVSRQVLEOH IRU D FRXUVH RQ 2EMHFWLYH 2ULHQWHG 3URMHFW 3ODQQLQJ IRU RIILFLDOVRIWKH*HQHUDO$GPLQLVWUDWLRQRI'HYHORSPHQW&RRSHUDWLRQ%$'& UHVSRQVLEOH IRU D SODQQLQJ VHPLQDU IRU WKH 0ZDQ]D 5XUDO +RXVLQJ 'HYHORSPHQW3URMHFW0ZDQ]D5HJLRQ7DQ]DQLD&RRSLER UHVSRQVLEOHIRUDWUDLQLQJFRXUVHRQ2EMHFWLYH2ULHQWHG3URMHFW3ODQQLQJIRU UHSUHVHQWDWLYHV RI VL[ =LPEDEZHDQ 1*2 V DQG RI $JULWH[ $JULFXOWXUDO ([WHQVLRQ 2IILFH=LPEDEZH)26 UHVSRQVLEOHIRUDWUDLQLQJFRXUVHRQ22,3IRUPHPEHUVRIVL[=DLULDQ1*2 VLQ %DV=DLUHSURYLQFH=DLUH$352'(&D=DLULDQ1*2 Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 31 FRUHVSRQVLEOHIRUWKHHYDOXDWLRQRIWKHKXVEDQGU\SURJUDPPHLQ=DLUHRIWKH %$'&*RYHUQPHQWRI%HOJLXP%$'& PLVVLRQWR(DVWDQG:HVW.DVDwSURYLQFHV=DLUHWRHYDOXDWHWKHLQYROYHPHQW RI&RRSLERLQDUHJLRQDOFHQWUHIRUWKHSURPRWLRQRIDQLPDOWUDFWLRQ&RRSLER PLVVLRQ WR ,ULDQ -D\D 3URYLQFH ,QGRQHVLD WR HYDOXDWH WKH GHYHORSPHQW SURJUDPPHV RI WKH ORFDO 3URWHVWDQW DQG &DWKROLF FKXUFKHV ILQDQFHG WKURXJK WKH 5XUDO 'HYHORSPHQW 3URJUDP RI '*,6 *RYHUQPHQW RI WKH 1HWKHUODQGV DV PHPEHURIDWHDPHQJDJHGE\0DWUL['*,6 FRUHVSRQVLEOHIRUFRXUVHRQSURMHFWSODQQLQJDQGPDQDJHPHQWDFFRUGLQJWKH 2EMHFWLYH2ULHQWHG3URMHFW 3ODQQLQJ DSSURDFK ,7(&2D %HOJLDQ RUJDQLVDWLRQ IRU WUDLQLQJRIGHYHORSPHQWZRUNHUV PLVVLRQWR.ROGDUHJLRQ6HQHJDOWRLGHQWLI\DQLQWHJUDWHGUXUDOGHYHORSPHQW SURMHFW UHVSRQVLEOH IRU D SODQQLQJ VHPLQDU RQ WKH GLVWULFW OHYHO DQG D VXEVHTXHQW VHVVLRQ ZLWK WKH WHDP UHVSRQVLEOH IRU WKH SURMHFW LGHQWLILFDWLRQ 9UHGHVHLODQGHQ D %HOJLDQ1*2 PLVVLRQ WR ,QGRQHVLD WR UHIRUPXODWH D SURMHFW RI LQVWLWXWLRQDO DQG KXPDQ UHVRXUFH GHYHORSPHQW PHPEHU RI D WHDP HQJDJHG E\ :(6 :HVWYODDPV (FRQRPLVFK 6WXGLHEXUHDX LQ FRRSHUDWLRQ ZLWK '7.7' 'LUHFWRUDWH IRU 5HJLRQDO DQG&LW\3ODQQLQJ PLVVLRQWR0EH\DUHJLRQ7DQ]DQLDWRDVVLVWORFDOUXUDOGHYHORSPHQWSURMHFWLQ WKH VHWWLQJ XS RI D FRPSUHKHQVLYH SODQQLQJ DQG HYDOXDWLRQ V\VWHP WKH 1*2 6XUYLYDO)XQG&RQVRUWLXP DVVLVWDQFH WR )$'2 )OHPLVK $LG DQG 'HYHORSPHQW 2UJDQLVDWLRQ LQ WKH HYDOXDWLRQDQGUHIRUPXODWLRQRIDUXUDOGHYHORSPHQWSURMHFWLQ)ORUHV,QGRQHVLD UHVSRQVLEOHIRUDSDUWRIDWUDLQLQJSURJUDPIRU,QGRQHVLDQSODQQLQJRIILFHUVLQ RUGHUWRHQKDQFHORFDOSODQQLQJFDSDFLWLHVFRPPLVVLRQHGE\:(6LQWKHIUDPHZRUN RIWKHGHYHORSPHQWFRRSHUDWLRQSURJUDPPHEHWZHHQ,QGRQHVLDDQG%HOJLXP LQYROYHGLQDSURMHFWDSSUDLVDOVWXG\IRUVXSSRUWWRVHFRQGDU\FRRSHUDWLYHVLQ 1RUWK.LYX=DLUH&RRSLER PLVVLRQWRSUHSDUHDQHYDOXDWLRQWR1HJRPER6UL/DQND1&26 PLVVLRQ WR IRUPXODWH D SURMHFW RI LQVWLWXWLRQDO DQG KXPDQ UHVRXUFH GHYHORSPHQWLQ,QGRQHVLDPHPEHURIDWHDPHQJDJHGE\:(6 SUHSDUDWLRQRIDSURMHFWDSSUDLVDOVWXG\LQ=DLUHSURYLQFH+DXW=DLUH:LWKXLV D%HOJLDQQRQJRYHUQPHQWDORUJDQLVDWLRQ FRRUGLQDWRURIDWUDLQLQJSURJUDPPHIRUWKHGHYHORSPHQWRIDPDQXDORQUXUDO VPDOOVFDOHLQGXVWU\GHYHORSPHQWIRUORFDOSODQQLQJDJHQFLHVLQ,QGRQHVLDSUREOHP LGHQWLILFDWLRQ H[WHQVLRQ WUDLQLQJ FUHGLW PDUNHWLQJ FRPPLVVLRQHG E\ :(6 LQ WKHIUDPHZRUNRIWKHGHYHORSPHQWFRRSHUDWLRQSURJUDPPHEHWZHHQ,QGRQHVLDDQG %HOJLXP DSSUDLVDO RI DQ DJULFXOWXUDO FUHGLW SURJUDP LQ (DVW DQG :HVW.DVDL SURYLQFHV=DLUH&RRSLER VWXG\ RQ DJULFXOWXUDO FUHGLW LQ &KDG LQ WKH IUDPHZRUN RI WKH DJULFXOWXUDOVHFWRUUHKDELOLWDWLRQSURMHFWILQDQFHGE\WKH:RUOG%DQNPHPEHURID WHDPRI$JUHUD%HOJLDQFRQVXOWDQF\JURXS Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 32 UHVSRQVLEOH IRU WKH HODERUDWLRQ RI D SURMHFW FDVH VWXG\ ZLWKLQ WKH IUDPHZRUNRIWKH7.2WUDLQLQJFRXUVH7.2D'XWFKRUJDQLVDWLRQIRUGHYHORSPHQW WUDLQLQJDQGHGXFDWLRQ UHVSRQVLEOH IRU WKH HODERUDWLRQ RI D VLPLODU FDVH VWXG\ IRU ,7(&2 %HOJLDQ RUJDQLVDWLRQIRU WUDLQLQJ RI GHYHORSPHQW ZRUNHUVIRXQGHGE\ D JURXS RI %HOJLDQ1*2 V FRUHVSRQVLEOH IRU D VWXG\ RQ WKH LPSDFW RI WKH LQWURGXFWLRQ RI R[ WUDFWLRQLQWKH(DVW.DVDLUHJLRQ=DLUHILQDQFHGDRE\2[IDP SDUWLFLSDWLRQLQDQHYDOXDWLRQRQWKHFRQVHTXHQFHVRIWKHLQWURGXFWLRQRI QHZIRRGFURSVWKLVHYDOXDWLRQKDV EHHQ H[HFXWHG E\ VL[ %HOJLDQ 1*2 V ILQDQFHG E\DIRXQGDWLRQOLQNHGZLWKWKH8QLYHUVLW\RI$QWZHUS PHPEHURIWKH$VLD(YDOXDWLRQ&RPPLVVLRQRI-9&ODWHU362-9&ZDV DQ XPEUHOOD RUJDQLVDWLRQ RI 'XWFK 1*2 V WKDW MRLQHG ZLWK 23,7 D VLPLODU RUJDQLVDWLRQ WR EHFRPH 362 WKDW HYDOXDWHG WKH LPSDFW RI 'XWFK GHYHORSPHQW ZRUNHUV LQ $VLD DV VXFK FRDXWKRU RI WKH LQWHUPHGLDWH UHSRUW FRPPLVVLRQHG E\ -9&362DQGWKH'XWFKJRYHUQPHQW FRUHVSRQVLEOH IRU WKH HYDOXDWLRQ RI WKH &RRSLER LQWHUYHQWLRQ LQ =DLUH ILQDQFHGE\%URHGHUOLMN'HOHQWKH%HOJLDQ/HQWHQ&DPSDLJQDQG0LVHUHRU UHVSRQVLEOHIRUWKHHYDOXDWLRQRIWKH&RRSLERLQWHUYHQWLRQLQ,QGRQHVLD ILQDQFHG E\ %URHGHUOLMN 'HOHQ DXWKRU RI WKH PDLQ UHSRUW DQG HYDOXDWRU RI WKH 0RZDQJX 2OLSX SURMHFW LQWURGXFWLRQ RI DQLPDO WUDFWLRQ LPSURYHPHQW RI DJULFXOWXUDOSUDFWLFHVDJULFXOWXUDOFUHGLW HODERUDWLRQRIDPRQLWRULQJV\VWHPIRUDSURMHFWLQ 1LFDUDJXD FRPPLVVLRQHG E\DFRQVRUWLXPRI%HOJLDQ1*2 V VWXG\ RI WKH SRVVLELOLWLHV IRU %HOJLDQ 1*2 V WR SDUWLFLSDWH LQ WKH %HOJLDQ 6XUYLYDO)XQG1&26 IHDVLELOLW\ VWXG\ FRQFHUQLQJ WKH FUHDWLRQ RI D VWXG\ DQG HYDOXDWLRQ XQLW &RRSLER Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 33 &855,&8/809,7$( 6XUQDPH: HAILE 1DPH: Jane Elisabeth 'DWHDQGSODFHRIELUWK: 1DWLRQDOLW\: British &LYLO6WDWXV: Married (GXFDWLRQ: 9 October 1944, York, U.K. ,QVWLWXWLRQV*LUWRQ&ROOHJH8QLYHUVLW\RI&DPEULGJH8. 'DWH2FW-XQH 'DWH2FW-XQH 'HJUHH%$+RQV6RFLDO$QWKURSRORJ\ 'HJUHH 0$ $QWKURSRORJ\ +RQV 6RFLDO ,QVWLWXWLRQV6FKRRORI2ULHQWDO$IULFDQ6WXGLHV8QLYHUVLW\ RI/RQGRQ8. 'DWH2FW-XQH 'HJUHH 3K ' LQ 6RFLDO $QWKURSRORJ\ ZLWK VSHFLDO UHIHUHQFHWR6RXWK(DVW$VLD /DQJXDJHVNLOOV /DQJXDJH English /HYHO 3DVVLYH 6SRNHQ :ULWWHQ 5 5 5 0RWKHU7RQJXH French 3 4 3 3 Thai 3 3 3 2 0HPEHUVKLSRI3URIHVVLRQDO%RGLHV • Faculty Member , New School On-line University, New York • Member of Advisory Board, Machreq/Maghreb Gender Linking and Information Project, Beirut, Lebanon • Member of the Scientific Committee for a series of workshops and conferences on women’s entrepreneurship • culminating in the Conference on Women’s Entrepreneurship in Malta 2004 (FP5-IHP Human Potential);presenter of workshop papers on gender-based occupational segregation. • Member of a number of gender–related and social development associations and networks in Europe, the USA and the Middle East 2WKHUVNLOOVHJFRPSXWHUOLWHUDF\HWF • Experience in planning/formulating/implementing/monitoring and evaluating development programmes in many sectors Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 34 • Experience in developing and presenting practical and participatory orientation, briefing and training for a variety of institutions , and agencies (governmental and non-governmental) at many levels, from beneficiaries to decision-makers • Trained in Project Cycle Management, and experience in using the methodology for appraisal and monitoring. • Excellent writing & conceptual skills • Computer literate. Experience in facilitating On-line discussion groups (UNIFEM/WARO) and in developing and teaching On-line courses (New School On-line University , New York) 3UHVHQW3RVLWLRQ: ( January 2002 onwards) Independent international consultant in gender, human rights, and development issues providing consultancy services in the following areas *HQGHU$QDO\VLVDQG(YDOXDWLRQRI*HQGHU0DLQVWUHDPLQJ • analysis of policies, strategies and programmes for integration /mainstreaming of gender issues and concerns across economic and social sectors( e.g. poverty alleviation, trade liberalisation, public sector reform, social protection, infrastructure development, education and vocational training, small and medium enterprises(SMEs), micro-credit, health and population , rural development, environment, emergency response/humanitarian assistance, etc). (YDOXDWLRQRIJHQGHUPDLQVWUHDPLQJDWDOO OHYHOVSROLF\ SURJUDPPH SURMHFW FXUUHQWO\ LQYROYHG LQ HYDOXDWLRQ RI 81 VXSSRUWWRJHQGHUPDLQVWUHDPLQJLQWKH%DOWLF6WDWHV *HQGHU7UDLQLQJ: • development of comprehensive training strategies for agencies and institutions to address all dimensions of gender equality issue(e.g. in programmes, in recruitment and placement, in finance and budgeting ,in information/external relations, in research priorities etc) • development of training packages; organisation and facilitation of briefing, and training sessions tailored to audience, institutional, sectoral, and cultural context covering various dimensions of gender debate (e.g. gender and development, human rights (e.g. CEDAW), gender equality issues in institutions and organisations) • development of training and briefing sessions On-line • on-the-job training on particular programmes or projects where prior evaluation has shown remedial action or mid-course adjustment is necessary :RUNLQJ7RROV • development RI ³HQJHQGHUHG´ WRROV IRU SURMHFW IRUPXODWLRQ PRQLWRULQJ DQG HYDOXDWLRQ; development of country and sectoral gender profiles and check-lists of key issues and questions for programme officers and others +XPDQ5LJKWV: • briefing and training on the Convention on the Rights of the Child (CRC) and the Convention on the Elimination of All forms of Discrimination Against Women (CEDAW);their articles and provisions, the process of ratification, and their implications at country and programme level. Training on and technical assistance to the reporting and monitoring process. Development of programmes of public information, advocacy and legal literacy; programmes to address problems of violence against women and children, human rights issues in emergency situations. 'HYHORSPHQW 3URJUDPPH ,GHQWLILFDWLRQ )RUPXODWLRQ 0RQLWRULQJ DQG (YDOXDWLRQ technical assistance to the development programme formulationPRQLWRULQJDQGHYDOXDWLRQSURFHVV 'UDIWLQJ DQG 5HSRUWLQJ: assistance to drafting of policy and strategy documents, preparation of background papers and reports for conferences and seminars <HDUVRISURIHVVLRQDOH[SHULHQFH Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts • Page 35 Graduate tutoring in Social Anthropology in Cambridge and London Universities (1968/9) followed by over30 years of professional experience in development, commencing in 1970 on recruitment to the UN Economic & Social Commission for Asia and the Pacific (ESCAP), Bangkok , Thailand .H\TXDOLILFDWLRQV • Experience in programme planning/management/ and evaluation across a wide range of development issues, Structural Adjustment(Adjustment with a Human Face),Debt Relief, Primary Health Care, Population & Reproductive Health(including HIV/AIDS),Poverty Reduction/Social Protection, Small and medium Enterprises, Education and Training, Children’s & Women’s Rights(CRC and CEDAW), Gender & Development, Violence Against Women, Emergency Response, Communication and Information. • Experience in both senior managerial & technical positions in a number of multi-lateral agencies (UN Economic & Social Commission for Asia & the Pacific; UNDP, UNFPA, UNICEF), and senior expert at the EC. • Experience in developing and managing and evaluating programmes of the United Nations • Experience in leading multi-disciplinary, multi-cultural, multi-national teams of experts • Extensive long-term work experience in Asia, the Caribbean, West & Central Africa, the Middle East & North Africa with government, NGOs and civil society. Regional and Sub-Regional development 6SHFLILFH[SHULHQFHLQQRQLQGXVWULDOLVHGFRXQWULHV &RXQWU\ 'DWH PRQWK\HDU PRQWK\HDU Thailand Jan-June 1970 (for ESCAP Region) Thailand project) Research Officer, Social Development Division, ESCAP Bangkok. Desk research and report writing on social development issues in Asia & the Pacific (regional June 1970 - July Head of Research Monitoring/(YDOXDWLRQ 8QLW IRU the 1976 UNDP Regional Development Support Communication Service (DSCS) Bangkok Thailand. - Burma - Bangladesh - Cambodia - Indonesia - Iran - Pakistan - Philippines - Turkey - Vietnam Indonesia (base) South Korea India IURP 1DPHDQGEULHIGHVFULSWLRQRIWKHSURMHFW WR 'HYHORSHG PRQLWRUHG DQG HYDOXDWHG Communication Support Component for UNDP-assisted projects in agriculture, health, population, water/sanitation, infrastructure development, capacity-building. July 1976 - March Independent consultant working primarily for UNFPA as 1979 - Advisor in Communication/Social Marketing to the Indonesian Family Planning Board (BKKBN). - Thailand ( Regional Jan 1982 Office for East Asia 1987 and Pakistan Also worked on identification and monitoring of projects for UNFPA in S. Korea & India. Sept Regional Advisor for Training Communication, UNICEF/EAPRO. & Programme Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Region) Barbados (Area covering countries) Page 36 Advising 13 UNICEF country offices, government counterparts, and NGOs on communication, social marketing and training, techniques & methodologies & their application to UNICEF-assisted programmes (water/sanitation oral rehydration ,immunisation, breastfeeding, MCH/PHC, etc) Sept. 1987 - Dec. UNICEF Area Representative to English-speaking 1991 Caribbean & Suriname with sub-offices in Jamaica and Office Guyana. Developed and managed programmes in 14 14 countries in early childhood development, HIV/AIDS, children’s/women’s rights w/govt, NGO, parliamentary groups, media etc. Fundraising & advocacy activities through management of Greeting Card Operation. Initiated work on Debt Swap and Debt Relief for Child Survival in Jamaica. Organised emergency relief for hurricane affected countries. Feb. 1992 - August Deputy Regional Director, 1994 UNICEF West & Central Africa Regional Office. (UNICEF Regional Office for West & Management of team of regional advisors providing support Central Africa) in GHYHORSPHQW SODQQLQJ DQG HYDOXDWLRQ of economic issues/ health / nutrition/ education/ human rights/ emergency/information and fundraising. Special responsibility for women & child rights, “complex” emergency response, and VRFLDO GHYHORSPHQW UHVHDUFK DQG HYDOXDWLRQ Organised regional preparatory conferences for Beijing Conference. Ivory Coast Sept. 1994 - June Deputy Regional Director for UNICEF Middle East & North 1998 Africa : managed team of regional advisors providing (M.E & North Africa, technical assistance to UNICEF country offices & govt. and including Gulf NGO counterparts in SODQQLQJPRQLWRULQJHYDOXDWLRQ, Countries, Iran, human rights, info/communication, health/education. Libya, and Sudan) Responsible for Inter-Agency collaboration e.g. with WHO on Reproductive Health, with UNIFEM on gender training and CEDAW monitoring ,with ESCWA on genderdisaggregated data and Integrated Follow-up to Global Conferences. Managed special regional and sub-regional programmes for integration of CRC and CEDAW into the curriculum of law schools; and for producing training resource book for MENA region. Organised regional conference and drafted UNICEF position paper for Beijing Conference. Responsible for staff training and publications programme. O-I-C for UNICEF Lebanon during the Emergency of 1996, assisted in Co-ordination of Joint UN Appeal for Emergency Funding and subsequent programme of relief and rehabilitation. O-I-C for UNICEF Libya Jordan Palestine July - August 1998 Member of evaluation mission on EC assistance to Palestine 5HVSRQVLEOH IRU HYDOXDWLRQ RI (& DVVLVWDQFH WRWKHWHUWLDU\HGXFDWLRQVHFWRU Mediterranean Partner countries September 1998 – Team Leader and Gender Expert, MEDATEAM 8 (Gender, December 2001 Population and Poverty Alleviation). Work on mainstreaming gender issues at all levels(policy ,programme, project) and ( based in Brussels) across sectors of priority concern to the EU; participated in drafting Communications and in reviewing, and analysing strategy papers and programmes for integration of gender issues. Participated in EC preparations for Beijing + 5 Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 37 conference June,2000 Developed and presented participatory training and briefing courses for Commission staff in Brussels, and for EC staff and government and NGO counterparts in delegations reflecting particular country context, achievements and needs. (Algeria, Egypt, Jordan, Lebanon, Palestine, Syria, Tunisia).Participated in the organising committee and presented a paper at the Euro Med Forum on Economy and Sustainable Development: enhancing participation of women in economic life(workshops on training, legal framework,entrepreneurship etc)under auspices of Belgian Presidency. Backstopped poverty alleviation experts by analysing ongoing and new poverty alleviation programmes for integration of gender issues, by providing current information on gender/poverty issues, EULHILQJFRQVXOWDQWV IRUHYDOXDWLRQPLVVLRQVetc. 3URIHVVLRQDOH[SHULHQFHQRWDOUHDG\FRYHUHGXQGHUSDUDJUDSK 'DWHIURPPRQWK\HDUWRPRQWK\HDU May 1980 - Dec. 1981 Location New York Company / Organisation UNDP Position Interagency Consultant for the International Drinking Water Supply & Sanitation Decade (IDWSSD) Job Description Developed guidelines for the incorporation of communication/health education component in UN programmes of water/sanitation and HYDOXDWLRQ RI LPSOHPHQWDWLRQRIWKLVFRPSRQHQW 'DWHIURPPRQWK\HDUWRPRQWK\HDU Sept. 1998 – Dec 2001 Location (of employer) Rome Company / Organisation PARSEC Position Team Leader MEDATEAM 8: Population & Poverty Alleviation Job Description Provide advice & technical assistance to EC projects in Mediterranean partner countries. Activities include preparing and conducting gender training and briefing at field and headquarters levels ; GHYHORSLQJ 725 EULHILQJ FRQVXOWDQWV SULRU WR HYDOXDWLRQ PLVVLRQV; policy and programme advice on gender mainstreaming; preparation of country gender profiles(See para 13 above) 2WKHUV D 3XEOLFDWLRQVDQG6HPLQDUV Gender Management, • Handbooks on Communication and Training, UNICEF/EAPRO, Bangkok 1986 • “Ending Gender Disparities in the Arab World” prepared for the Beijing Conference with Ra’ida al Zubi 1995(English, Arabic) Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts • Page 38 "Gender and Development Training Sourcebook for the Middle East and North Africa", prepared for UNICEF/MENARO, and accompanying multimedia presentation 1998. "Safe Motherhood: a Human Right", prepared for and published by WHO, 1998. • "Safe Motherhood: A Radical Alternative", prepared for and published by WHO/EMRO, 1996. • “ Women’s Health as a Human Right” Fourth International Conference of Women in Palestine, Gaza 1999 • Training Packages on Gender & Development (Algeria, Egypt, Jordan, Lebanon, Syria, Tunisia ) 1999-200 • Training packages on: Gender and Development ; Gender Audit, Gender and Communication; International Conferences (ICPD ,Beijing etc) and Human Rights (CRC,CEDAW);genderdisaggregated data; key gender issues in Budgeting, Emergency and Humanitarian Assistance; Health/Nutrition; Population/Family Planning/HIV/AIDS; Poverty Alleviation; Education/Vocational Training; Information Technology/Telecommunications; Integrated Rural Development; Trade Liberalisation; Transport; Small and Medium Enterprises; Structural Adjustment; Social Funds; Gender and Emergency; Violence Against Women; Gender and Environmental issues. • Compilation of Key Gender Terms and Concepts (English , French and Arabic) • Gender Questions in Project Design: key questions to ask during programme formulation across economic and social sectors (English, French) • Presentation on structural issues to be addressed in order to enhance Women’s Participation in Economic Life (gender-disaggregated data, “engendered” budgets, revision of legal system/legal literacy, establishment of appropriate credit systems, vocational training not based on conventional gender stereotypes, public information etc) at the” Euro Med Forum On Economy and Sustainable Development : the enhanced participation of women in economic life” Brussels, July 2001(under auspices of the Belgian Presidency) • Various papers on teenage pregnancy, domestic violence and revision of family law (Caribbean); and on female household heads, gender implications of structural adjustment policies, and gender aspects of the AIDS epidemic (West and Central Africa), socio-economic trends & developments (Middle East/North Africa). Academic publications • Buddhist Monk: Buddhist Layman; a study of urban monastic organisation in Central Thailand (C.U.P. Cambridge 1974). • Buddhism in Thailand, Laos & Cambodia in the World of Buddhism, ed. Richard Gombrich, Thames & Hudson, London 1983 • Who's Afraid of Social Marketing, June 1995.(prepared as visiting lecturer ,Department of Anthropology, Cambridge University) • Anthropology & Social Development: Go Between or Coy Bed-Fellow, May 1995.(prepared as a visiting lecturer ,Department of Anthropology, Cambridge University) Seminars Attended and organised numerous seminars, meetings and conferences in areas of expertise indicated under paras. 13 & 14. particularly in relation to Beijing + 5 process, CEDAW & women's rights issues; economic and social situation of women in the Middle East and North Africa; women’s entrepreneurship and enhancing women’s participation in economic life, gender budgeting, safe motherhood/reproductive health, domestic violence and violence against women, and social marketing and social mobilization and communication/information strategy development . Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts E Page 39 5HIHUHQFHV On request Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 40 &/$8'<928+( 6SHFLDOLVDWLRQ *HQGHU SODQQLQJ 6PDOO VFDOH HQWHUSULVH DQG FRPPXQLW\ GHYHORSPHQW 7UDLQLQJWUDLQLQJ RI WUDLQHUV0DWHULDOVGHYHORSPHQW (GXFDWLRQ 0DVWHUV%XVLQHVVDQG6RXWK$PHULFDQ6WXGLHV3RLWLHUV8QLYHUVLW\)UDQFH 3RVWJUDGXDWH'LS,QWHUQDWLRQDO0DUNHWLQJ1DSLHU8QLYHUVLW\(GLQEXUJK /DQJXDJHV )OXHQW(QJOLVK6SDQLVKDQG)UHQFKPRWKHUWRQJXHLQWHUPHGLDWHOHYHORI3RUWXJXHVH 2FWREHU,QGHSHQGHQW*HQGHUDQG'HYHORSPHQW&RQVXOWDQW 2Q±JRLQJ&RRUGLQDWRURIDIUDQFRSKRQH³*HQGHUDQG$FWLRQ´QHWZRUNVXSSRUWHGE\WKH)UHQFK0LQLVWU\IRU)RUHLJQ $IIDLUV6RFLDO'HYHORSYLDWKH&HQWUHGHV(WXGHVG¶$IULTXH1RLUH&($1%RUGHDX[8QLYHUVLW\ 2QJRLQJ $VDQDVVRFLDWHRIWKH'HYHORSPHQW3ODQQLQJ8QLW8.EDFNVWRSSLQJIRUWKH6ZLVV'HYHORSPHQW &RRSHUDWLRQ 1RY (80DGDJDVFDU(QGRISURMHFWHYDOXDWLRQRI,*('³*HQGHUDQG'HYHORSPHQW,QLWLDWLYH´SURMHFW 2FWREHU 6ZLVV 'HYHORSPHQW &RRSHUDWLRQ 7DQ]DQLD 7RROV GHYHORSPHQW ZRUNVKRS DQG ILHOG WHVWLQJ RI PRQLWRULQJWRROVDQGV\VWHPVLQWKHKHDOWKDQGUXUDOURDGVVHFWRUV $SULO6HSW*HQGHU3ROLF\DQG3ODQQLQJ3URJUDPPH'HYHORSPHQW3ODQQLQJ8QLW/RQGRQ8. &RGLUHFWRURIWKHC*HQGHU3ROLF\DQG3ODQQLQJ¶SURJUDPPHOHFWXUHULQ8UEDQ'HYHORSPHQW3ODQQLQJ 0VF 6RFLDO 'HYHORSPHQW DQG 3ODQQLQJ 'LSORPD DQG *HQGHU 3ROLF\ DQG 3ODQQLQJ WUDLQLQJ SURJUDPPHV &RQVXOWDWLRQV :DWHU$LG8.&DSDFLW\EXLOGLQJDQGDGYLFHIRUPDLQVWUHDPLQJJHQGHULQZDWHUSURMHFWV Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 41 3URMHFWPDQDJHU ³0DNLQJ HYDOXDWLRQ UHDO DQG XVHIXO IRU QHWZRUNV´ (6&25'I,' IXQGHG UHVHDUFKRQHYDOXDWLRQPHWKRGRORJLHVXVHGE\GHYHORSPHQWQHWZRUNV 0R]DPELTXH3DULV$JHQFH)UDQoDLVHGH'pYHORSSHPHQW5HVHDUFKDQGFRQVXOWDQF\OHDGLQJWRWKH GHYHORSPHQW RI SULQFLSOHV DQG JXLGHOLQHV WR PDLQVWUHDP JHQGHU LQ $)' 'LDJQRVLV RI DQ XUEDQ GHYHORSPHQWSURMHFWLQ0DSXWR 5ZDQGD5HYLHZHURI³*HQGHU7UDLQLQJ3URMHFW´5ZDQGDQ0LQLVWU\IRU*HQGHU'I,' 8.1DWLRQDO/RWWHU\&KDULWLHV%RDUGPDLQVWUHDPLQJJHQGHULQ,QWHUQDWLRQDO*UDQWVSURFHGXUHV 6RXWK $IULFD &RPPLVVLRQRQ*HQGHU(TXDOLW\ ,QSXWV LQWR WKH IRUPXODWLRQ RI &*( JHQGHU WUDLQLQJ SURJUDPPHIXQGHGE\'I,' 1DPLELD,ELV)RUPXODWLRQRID&RPPXQLW\6XSSRUW3URJUDPPHLQ1RUWKHUQ1DPLELDDQGLQSXWVIRU PDLQVWUHDPLQJJHQGHULQDQ8UEDQ(QYLURQPHQW3URJUDPPH 6ZLVV'HYHORSPHQW&RRSHUDWLRQ6ZLW]HUODQG7UDLQHUDQGFRQVXOWDQWIRUJHQGHUPDLQVWUHDPLQJ &KLOH'HYHORSPHQWRIDQRSHUDWLRQDOPDQXDOIRUJHQGHUSROLF\DQGSODQQLQJWDUJHWLQJSUDFWLWLRQHUVDW PXQLFLSDOOHYHOZLWKDORFDO1*2&RELMR'HVDUUROOR\+DELWDWIXQGHGE\WKH%ULWLVK&RXQFLO 7XQLVLD7UDLQHUDQG&RQVXOWDQWIRU³*HQGHU3ROLF\DQG3ODQQLQJ6WUHQJKWHQLQJLQVWLWXWLRQDOFDSDFLW\ LQ 7XQLVLD´ D \HDU SURJUDPPH LQFOXGLQJ WUDLQLQJ QHHGV DVVHVVPHQW GHYHORSPHQW RI D WUDLQLQJ VWUDWHJ\JHQGHUFRQVXOWDWLRQZLWKOLQHPLQLVWULHVUHVHDUFKHUVDQG1*2VWUDLQLQJRIWUDLQHUVLQWKH 8. DQG WUDLQLQJ ZRUNVKRSV LQFRXQWU\ PRQLWRULQJ DQG LPSDFW HYDOXDWLRQ LQ %ULWLVK &RXQFLO'ILG '*9,,,(XURSHDQ&RPPLVVLRQ,QWHJUDWLRQRI*HQGHU,VVXHVLQ'HYHORSPHQW&RRSHUDWLRQ DUHVHDUFKRQJHQGHUDQGPRQLWRULQJLQELODWHUDODLGRUJDQLVDWLRQVZLWK.,71/ 7UDLQLQJ ,VUDHO3DOHVWLQH%LPNRQ3ODQQHUVIRU3ODQQLQJ5LJKWVWUDLQHURQZRUNVKRSRQVRFLDOGLYHUVLW\DQG JHQGHULQSDUWLFLSDWRU\XUEDQSODQQLQJ ³0DLQVWUHDPLQJJHQGHULQHGXFDWLRQLQ%DQJODGHVK´GHVLJQHGIRUFLYLOVHUYDQWVIURPWKH 0LQLVWU\RI(GXFDWLRQLQ%DQJODGHVKVL[ZHHNZRUNVKRSLQ/RQGRQ ,QWHUQDWLRQDO/DERXU2UJDQLVDWLRQ*HQHYD,QSXWVLQWKHFDSDFLW\EXLOGLQJSURJUDPPHDQG IRUPXODWLRQRIWKHPDLQVWUHDPLQJVWUDWHJ\ Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 42 'HYHORSHURUJDQLVHUDQGIDFLOLWDWRURIQHZZHHNFRXUVH³7UDLQLQJRI7UDLQHUVLQ *HQGHU3ROLF\DQG3ODQQLQJ´IRUIUDQFRSKRQHSUDFWLWLRQHUV/RQGRQ 6SDLQ ³*HQGHU DQG 'HYHORSPHQW´ VHPLQDUV LQ 6SDQLVK IRU ,QVWLWXWR &RPSOXWHQVH GH (VWXGLRV ,QWHUQDFLRQDOHV8QLY&RPSOXWHQVHGH0DGULGDQGIRU6SDQLVKDLGRIILFLDOVLQ&RRSHUDWLRQ0LQLVWU\ ³7UDQVODWLQJ %HLMLQJ &RPPLWPHQWV LQWR DFWLRQ LQ 3DNLVWDQ´ WUDLQLQJ SURJUDPPH IRU KLJK OHYHO JRYHUQPHQWRIILFHUVDQG1*2VLPSOHPHQWRUVRIWKH3ODWIRUPRI$FWLRQLQ3DNLVWDQIXQGHGE\'I,' &RIDFLOLWDWRURIWUDLQLQJZRUNVKRSVLQ)UHQFKDQG(QJOLVKRQ*HQGHU3ODQQLQJDQG3ROLF\IRUWKH WKHQ'*9,,,RIWKH(&GHYHORSPHQWFRRSHUDWLRQLQ$&3FRXQWULHV <HDUO\ 7UDLQHURQWZHOYHZHHN'LSORPD&RXUVH³:RUNLQJZLWKZRPHQDQGPHQ0DLQVWUHDPLQJJHQGHULQ SROLF\ DQG SODQQLQJ´ LQFOXGLQJ DQ H[DPLQDWLRQ RI WKHRU\ DQG SUDFWLFH DGYRFDF\ DQG WUDLQLQJ RI 7UDLQHUV &RQVXOWDQW,QFRPH*HQHUDWLQJ$FWLYLWLHVIRU:RPHQ81,&()1DPLELD 7KLV ILYH \HDU SURMHFW DLPHG WR GHYHORS FDSDFLW\ DPRQJVW ORFDO SDUWQHUV WR SURPRWH DQG VXSSRUW LQFRPHJHQHUDWLQJLQLWLDWLYHVDVDVWUDWHJ\WRDOOHYLDWHSRYHUW\DQGLQFUHDVHIRRGVHFXULW\LQUXUDODQG XUEDQDUHDVSDUWLFXODUO\IRUZRPHQ7DVNVLQFOXGHG 3URMHFW0DQDJHPHQWDQGPRQLWRULQJ$FWLRQUHVHDUFK35$RQLQFRPHJHQHUDWLRQDQGFRPPXQLW\ GHYHORSPHQW 7UDLQLQJ 0LQLVWULHV DQG 1*2V RQ FRPPXQLW\ DVVHVVPHQW DQG JHQGHUDZDUH SODQQLQJ XVLQJ SDUWLFLSDWRU\ PHWKRGRORJLHV 'HYHORSPHQW RI WUDLQLQJ PDWHULDOV SURFHGXUHV DQG JXLGHOLQHV IRU LQFRPHJHQHUDWLQJ SURMHFWV $GYRFDF\ DQG LQIRUPDWLRQ GLVVHPLQDWLRQ IRU LQFRPH JHQHUDWLQJDFWLYLWLHV6XSSRUWWRJHQGHUPDLQVWUHDPLQJLQSROLFLHVDQGSURJUDPPHVZLWK0LQLVWU\RI :RPHQ$IIDLUV 7HFKQLFDO$GYLVHU0LQLVWU\RI(GXFDWLRQDQG&XOWXUH1DPLELD1DWLRQDO/LWHUDF\3URJUDPPH 1DPLELD &RPPXQLW\EDVHG UHVHDUFK RQ IXQFWLRQDOOLWHUDF\QHHGV OLQNHG WR LQFRPHJHQHUDWLRQ7UDLQLQJ RI DGXOWHGXFDWRUVLQSDUWLFLSDWRU\FRPPXQLW\GHYHORSPHQWPHWKRGVDQGIDFLOLWDWLRQRIJHQGHUWUDLQLQJWR OLWHUDF\ PDQDJHUV DQG SURPRWHUV ZLWK '38 0DWHULDOV GHYHORSPHQW IRU OLWHUDF\ OHDUQHUV DQG WUDLQHUV (FRQRPLF &RQVXOWDQW &(, &RQVXOWDQWV /WG &HQWUH IRU (PSOR\PHQW ,QLWLDWLYHV (GLQEXUJK 8. 5HVHDUFK DQG FRQVXOWDQFLHV RQ VRFLRHFRQRPLF LVVXHV LQFOXGLQJ FRXQVHOOLQJ DQG WUDLQLQJ IRU WKH ORQJWHUPXQHPSOR\HG ORFDO HPSOR\PHQW LQLWLDWLYHV FRPPXQLW\ UHJHQHUDWLRQ DQG FRUSRUDWH VRFLDO Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 43 LQYHVWPHQW&OLHQWVLQFOXGHG*RYHUQPHQW'HSDUWPHQWVWKH(8DQGORFDODQGQDWLRQDOGHYHORSPHQW DJHQFLHV:RUNPDLQO\LQWKH8.)UDQFH6SDLQDQG3RUWXJDO *HQGHUFRQVXOWDQWWR8.ORFDODXWKRULWLHV1*2DQG&%2WKURXJK:RPHQ V(FRQRPLF)XWXUHD &(,LQLWLDWLYHIRFXVLQJRQJHQGHULVVXHVLQWKHODERXUPDUNHW &RPPXQLFDWLRQV&RRUGLQDWRURIWZR(8SURJUDPPHV'*9GHDOLQJZLWKORQJWHUPXQHPSOR\PHQW DQGFRXQVHOOLQJLQFOXGLQJSURGXFWLRQRIERRNOHWVSRVWHUVFDVHVWXGLHVGLUHFWRULHVYLGHRVVOLGHV SUHVVUHOHDVHVHWF (GLQEXUJK8QLYHUVLW\,QVWLWXWHIRU$SSOLHG/DQJXDJH6WXGLHV &RXUVH'LUHFWRUUXQQLQJ³EXVLQHVV)UHQFK´ZRUNVKRSVDQGWDLORUPDGHWXLWLRQVIRUWKHSULYDWHVHFWRU 38%/,&$7,216$1'8138%/,6+('5(32576 ³3ODQLILFDWLRQ VHORQ OH JHQUH 9UDLV SRXYRLUV HW IDXVVHV H[FXVHV´ &DKLHUV *HQUH HW 'pYHORSSHPHQW1R-DQXDU\ $GGUHVVLQJPHQDQGPDVFXOLQLW\LQ*$'FRDXWKRUZLWK&DUHQ/HY\DQG1DGLD7DKHU ,'6%XOOHWLQ1R$SULO *XtDSDUDODSODQLILFDFLyQORFDOFRQODVPXMHUHV\ ORV KRPEUHV FRDXWKRU ZLWK 0DULVRO 6DERULGR &RELMR+DELWDW\'HVDUUROOR&KLOH 0RQLWRULQJDQG*HQGHULQ)RXUELODWHUDO$LG2UJDQLVDWLRQV5HSRUWSUHVHQWHGWR.,75R\DO7URSLFDO ,QVWLWXWHIRU'*9,,,(8 'RFXPHQWVRIWKH\HDUSURJUDPPH&DSDFLW\%XLOGLQJIRU*HQGHU3ODQQLQJLQ7XQLVLD SUHVHQWHGWRWKH%ULWLVK&RXQFLODQGWKH0LQLVWU\IRU:RPHQDQG)DPLO\$IIDLUVC*HQGHU3ODQQLQJ 7UDLQLQJ 1HHGV LQ 7XQLVLDC C6HQVLWL]DWLRQ DQG ,QIRUPDWLRQ 6HVVLRQVC C7UDLQLQJ RI 7UDLQHUVC DQG C7UDLQLQJ:RUNVKRSV¶SURFHHGLQJVLQ)UHQFKDQG(QJOLVK (GLWRURI'381(:6'38¶VELDQQXDOQHZVOHWWHU 0HWKRGRORJ\ WR DVVHVV FDSDFLW\ EXLOGLQJ RI LQFRPHJHQHUDWLQJ SURMHFWV ZLWK $ Y 'LHVHQ DQG *XLGHOLQHVWRDVVLVWLQFRPHJHQHUDWLQJSURMHFWVDQG%XVLQHVVVNLOOVIRULQFRPHJHQHUDWLQJSURMHFWV 81,&()1DPLELD %H\RXURZQ%RVVZLWK3URI'0DFKDULD1DPLELD/LWHUDF\3URJUDPPH81,&() )DFWRUVFRQWULEXWLQJWRWKHVXFFHVVRIVPDOOEXVLQHVVHVLQ1DPLELD81,&()1DPLELD Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 44 &RPSDQ\JLYLQJLQ(XURSHZLWK&(,IRUWKH'LUHFWRU\RI6RFLDO&KDQJH/RQGRQ &RHGLWRU RI (5*21(:6 TXDUWHUO\ QHZVOHWWHU LQ IRXU ODQJXDJHV SXEOLVKHG E\ WKH (5*2 SURJUDPPHIRUORQJWHUPXQHPSOR\PHQW'*9 Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 45 -XOLDQ:DONHU $VRFLDODQWKURSRORJLVWZRUNLQJLQWKHILHOGRIVRFLDOGHYHORSPHQW,KDYHXQGHUWDNHQWUDLQLQJ UHVHDUFK DQG FRQVXOWDQF\ LQ WKH ILHOGV RI LQYROXQWDU\ UHVHWWOHPHQW FRPPXQLW\ SDUWLFLSDWLRQ DQWLSRYHUW\SROLFLHVJHQGHUSROLF\DQGSODQQLQJDQGVRFLDOGHYHORSPHQWWRROVLQFOXGLQJUDSLG DSSUDLVDOVWDNHKROGHUDQDO\VLVDQGVRFLDOLPSDFWDQDO\VLV 'DWHRI%LUWK 7.7.70 1DWLRQDOLW\ British 'LVFLSOLQH Social anthropologist /DQJXDJHV English, basic Spanish and French (GXFDWLRQDQGTXDOLILFDWLRQV 1995 MSc in Urban Development Planning, Pass (with Distinction) Development Planning Unit, University College London 1993 RSA/UCLES Certificate in TEFLA (Teaching English as a Foreign Language to Adults), Pass. International Language Institute, Sahafeyeen, Cairo 1992 BA (Hons) in Social Anthropology, Overall class 2.1 King’s College, Cambridge University $SSRLQWPHQWV 2000- present Freelance Consultant and Development Planning Unit Associate 1995-2000 Lecturer, Development Planning Unit, University College London 1994 Teacher, Chelsea School of English 1993 Teacher of English as a foreign language to adults, the British Council in Cairo, and the American University in Cairo. &RQVXOWDQF\5HVHDUFKDQG7UDLQLQJ([SHULHQFH 2001-2 $XVWULD DQG 7KDLODQG: Work at the United Nations Office in Vienna (UNOV) and the United Nations Economic and Social Council for Asia Pacific (UNESCAP). Reviewed Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 46 efforts of staff to promote gender equality in their work in order to design and carry out training for professional staff on ‘Gender Mainstreaming’. 2001-2 5XVVLD: Evaluation of social impact assessment and proposed social impact mitigation measures (on behalf of potential lenders) for a proposed offshore oil and gas extraction project based on Sakhalin Island. 2001 Production of policy paper on ‘Urban Sustainable Livelihoods in India’ for Swedish SIDA on behalf of ODI (Overseas Development Institute). 2001 Joint authorship, with a team at the Development Planning Unit of University College London, of a DFID funded sourcebook (“Implementing the Habitat Agenda”) presented at the Habitat + 5 meeting, New York 2001. 2000-2001 &KLQD: Social development consultant on DFID funded ‘China State-Owned Enterprise Reform’ Project. Undertook social impact assessment on 6 pilot enterprises in Sichuan province. Involved in ongoing development of pilot activities to offset the impact of retrenchment and the restructuring of social welfare systems. 2000 Joint trainer on a (DFID funded) 10 week course for Bangladeshi education officials on “Mainstreaming Gender Policy and Planning in Primary Education in Bangladesh” 2000 ,VUDHO: Co-trainer on a workshop on ‘Incorporating Gender and Social Diversity Issues in Planning’ held in Jerusalem for BIMKOM, an Israeli NGO promoting planning rights for Palestinians 2000 6ZLW]HUODQG: Co-trainer on a workshop on ‘Mainstreaming Gender in Policy and Planning’ held for Swiss Development Cooperation staff. 1999 Desk research and co-production of DFID funded policy paper on “Sustainable Urban Livelihoods”. 1999 &KLQDUndertook a social benefit study for the World Bank and DFID funded Sichuan Urban Environment Project. (Four month field survey of primary and secondary stakeholders in nine water, waste water and solid waste projects and a provincial industrial action plan). 1998 Design and coordination of DFID funded study visit for senior officials from the Vietnamese Ministry of Construction. 1998 $UJHQWLQD Design and execution of workshop on ‘Integrated development’ and lectures in regional universities. Part of a World Bank/ British Council supported regional programme in ‘Management of human resources for science, technology and regional development’. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 47 1998 Assistant trainer on a course for senior Vietnamese officials on ‘Mainstreaming Gender in Public Policy’, funded by the UNDP. 1997 &KLQD DQG WKH 3KLOLSSLQHV: Undertook and coordinated four months of field research for ODA/ ESCOR funded study of resettlement policy and practice in China and the Philippines (literature review, semi-structured interviews and focus group discussions). 1997 &KLQD: Assistant trainer for Resettlement Monitoring and Evaluation Workshop at Changsha Provincial Resettlement Office, funded by the ODA. 1996 1HZ <RUN Research and training assistant, prototype training workshop for UN staff on: ‘The social perspective on development: Policy formulation and implementation for gender responsive poverty eradication’. 1995 -1996 Part time action research with young people for the Industrial Society’s ‘2020 Vision Program’, researching young people’s aspirations for the future of work and learning in the UK. 1995 1HZ <RUN Research and training assistant, prototype training workshop for United Nations staff on: ‘The social perspective: policy formulation and evaluation’. $FDGHPLFH[SHULHQFH 1998-2000 1995-1998 Lecturer at the Development Planning Unit of University College London, undertaking the following: • Joint Course Director and Lecturer for Postgraduate Diploma course in ‘Planning and development studies’ • Joint lecturer on Certificate Course in ‘Social development: policy, planning and practice’ • Joint lecturer on modules on ‘Participatory Decision-Making’ and “Antipoverty Policy and Practice” for the MSc in Urban Development Planning. Assistant lecturer and research assistant at the Development Planning Unit of University College London 3XEOLFDWLRQV 2001 “Implementing the Habitat Agenda: In Search of Urban Sustainability”, a DFID funded sourcebook presented at the Habitat + 5 meeting, New York 2001, with a team from the Development Planning Unit of University College London 2000 “Sustainable Urban Livelihoods”, Development Planning Unit Working Paper, with Sheilah Meikle and Tamsin Ramasut Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 48 1999 “The changing face of the Chinese city”, in 2G: International Architecture Review (No.10/ 1999/ II), with Dr. Sheilah Meikle. 1998 Glossary of social development terms in English and Chinese. Produced for the Department for International Development, with Dr. Sheilah Meikle, University College London. 1997 Resettlement Policy and Practice in China and the Philippines (ESCOR/ DFID) Research scheme number R6802 - Final report with Dr. Sheilah Meikle. 1996 “Exploring the cultural dimensions of urban planning”, with V.Cruzate and M. Tovar-Restrepo, Development Planning Unit Working Paper no. 76. 1995-1996 Book reports for ‘Environment and Urbanisation’, the periodical of the International Institute for Environment and Development (IIED). Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 49 1DWLRQDO([SHUWV%ROLYLD-RUGDQ0DOLWKH3KLOLSSLQHV Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 50 &855,&8/809,7$( '$7263(5621$/(6 Nombre: Diana Urioste Fernández de Córdova Lugar y fecha de 6XFUH– Bolivia nacimiento: 13 de Marzo de 1952 Nacionalidad: Boliviana, CI: 195482 Dirección: Los Pinos, Torre 2, Piso 7, dpto. 4 Teléfono domicilio 795312/Tel-Fax Of. 335471 Casilla Postal 9136 La Paz, Bolivia $5($6'((;3(5,(1&,$ • Conducción y Gestión Institucional. • Elaboración, Planificación, Seguimiento y Evaluación de proyectos de desarrollo con perspectiva de género. Especialidad área urbana. • Gestión Financiera. • Acompañamiento a grupos de mujeres y formación/capacitación con estrategias participativas. organizaciones mixtas en • Diseño , planificación e implementación de campañas de Presión Política. • Relacionamiento Institucional. • Implementación y seguimiento de Guarderías Infantiles. (678',265($/,=$'26 1981 Licenciatura en Psicología con especialidad en Psicopedagogía. Los estudios empezaron en la Universidad Católica Boliviana, La Paz, Bolivia y concluyeron en la Universidad de Lodz, en Lodz, Polonia. 7HVLV Cambios en las actitudes de estudiantes extranjeros. 1969 Bachiller en Humanidades Colegio Sagrados Corazones, La Paz, Bolivia 27526(678',26 1999 Taller dictado por Irma Arriagada: Género y Políticas Sociales Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 51 1998 Curso dictado por Mcs Jennifer Cooper: Género y Trabajo 1995 Curso dictado por la Dra. Marcela Lagarde: Género y Cultura, Una Visión Antropológica. CIDES-UMSA. 1989 Planificación Estratégica y Análisis Financiero. Montevideo, Uruguay. 1986 Programa Sistemático de Capacitación en Educación Popular. PROCEP-AIPE, La Paz, Bolivia. 1971 Estudios de Francés Alianza Francesa. Paris, Francia. 1970-1 971 Curso de Inglés para Extranjeros Oxford College of Further Education; Oxford, Inglaterra. (;3(5,(1&,$352)(6,21$/ 1998-1999 Secretaria Ejecutiva de la Coordinadora de la Mujer 1998-1997 Directora proyecto Formación Política y Ciudadana, Coordinadora de la Mujer 1996 Responsable Proyecto de Coordinación Subsecretaría de Asuntos de GéneroComité de Enlace Nacional de ONGs Post Beijing. 1995-7 Unidad de Desarrollo Institucional. Centro de Promoción de la Mujer Gregoria Apaza. 1995-1992 Directora Ejecutiva Centro de Promoción de la Mujer Gregoria Apaza. 1991-1985 Responsable Programa de Guarderías. Centro de Promoción de la Mujer Gregoria Apaza. 1989-1987 Responsable Area de Producción y Servicios. Centro de Promoción de la Mujer Gregoria Apaza. 1985-1984 Responsable Programa Comedores Infantiles. Fundación San Gabriel. 1983 Psicóloga Colegio Los Pinos. La Paz. 3$57,&,3$&,21(1',5(&725,26 1998-1999 Fundación La Paz. 1998-1999 Instituto de Formación Femenina Integral (IFFI). 1998-1997 Coordinadora de la Mujer 1998-1995 Plataforma de Derechos Humanos, Democracia y Desarrollo (primero por el Centro Gregoria Apaza y posteriormente por la Coordinadora de la Mujer). 1998-1987 Centro de Promoción de la Mujer Gregoria Apaza. 1997-1996 Comité Nacional de Enlace del Foro de Organizaciones No Gubernamentales de Mujeres Post Beijing. 1997 Comité de Programas, UNITAS-PROCADE Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 52 1995-1994 Punto Focal para la Subregión Andina y Bolivia del Foro de ONGs para la IV Conferencia Mundial de la Mujer. 1995-1992 Secretaría Ejecutiva del Comité Directivo de la Plataforma de de NOVIB en Bolivia. 1994-1992 Secretaria General Directorio Coordinadora de la Mujer. Contrapartes 1994-1992.1 UNI-La Paz. 1993 Miembro Fundadora de la Fundación Yatiyawi. 1993 Miembro del Comité Nacional Provisional de Mujeres de Bolivia. 1993 Enlace del Comité Nacional de la Red Entre Mujeres. 1993-1 991 Asociación de Instituciones de Promoción y Educación. 321(1&,$6<&2168/725,$6 1999 Supervisión de la elaboración del informe sobre Indicadores de acceso de las mujeres a Espacios de Decisiones, Embajada de Holanda. 1998 Supervisión y organización dela elaboración del Informe Nacional sobre Violencia de Género en Bolivia, PNUD - ACDI 1997 Informe sobre “Equidad de Género en Bolivia” elaborado junto a Natasha Loayza para el proyecto Social Watch. 1996 Prioridad para la intervención sobre los Derechos Humanos y el Desarrollo en Bolivia. Novib, Sistema Boliviano de Apoyo. 1995 Incorporación de la Perspectiva de Género en proyectos del Programa Nacional de Atención a Menores. Subsecretaría de Asuntos de Genero. 1995 El Desafío de la Ley de Participación Popular para las ONG’s La experiencia del Centro de Promoción de la Mujer Gregoria Apaza. Ponencia elaborada junto a Juan Carlos Balderas. Oxfam U.K, Diakonia. 1994 Evaluación Externa del Centro de Apoyo Integral a la Mujer Juana Azurduy. 1994 Apoyo en la planificación del Centro de Apoyo Integral de la Mujer Juana Azurduy. 1993 Acompañamiento y Asesoría Externa al Instituto de Formación Femenina lntegrat.(IFFI) 1992 Propuesta de Políticas para la Mujer en Bolivia. Novib. 1991 Dimensión de la Problemática de la Mujer y la Reproducción en Bolivia. Red de Salud, Brasil. 1991 El Cuidado de los Niños Trabajadores. OIT Red de Salud, Brasil. 1991 El Cuidado de los Niños Trabajadores. OIT Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 53 CURRICULUM VITAE WASAN MOHAMMED ADEEB HIJAZI BUSINESS DEVELOPMENT TRAINER AND CONSULTANT DATE OF BIRTH: 14TH DECEMBER 1966 GENDER: FEMALE PLACE OF BIRTH: IRBID NATIONALITY: JORDANIAN SOCIAL STATUS: MARRIED\ One Child EDUCATION: 1991 MASTER IN SOCIAL& ECONOMIC ANTHROPOLOGY, INSTITUTE OF ARCHAEOLOGY AND ANTHROPOLOGY, YARMOUK UNIVERSITY. 1988 B.A. IN FINE ARTS, INDUSTRIAL DESIGN, DEPARTMENT OF FINE ARTS, YARMOUK UNIVERSITY. M.A. THESIS TITLE: “FAMILY AND MARRIAGE IN A JORDANIAN VILLAGE, IN THE JERASH REGION: A DESCRIPTIVE STUDY”. CURRENT JOB: Special Advisor Assistant for His Excellency Minister of labor on women in the workforce Youth start-ups, poverty and employment the task contains high policy and planning skills, networking and coordinating . the establishment of the Programmes Management Unit. 1999 - Business Training Specialist. 24 months Contract to conduct training Needs Assessment for Small and Micro Entrepreneurs In Jordan. Design and Develop Training Manuals with the Project team. Maintaining and Building Capacity of Partner and Training Institutions to promote and Market Improve and Expand Your Business Programmes. Especially in developing Gender sensitive Material with in the Business Culture Frame in Jordan. Follow-up and Monitoring all activities conducted by the project and coaching , supervising and evaluating the SYB -IYB-EYB Trainers in Field. The contract expired by 30th January 2002 Since 1996 - 1999 General Manager/ Business Owner Small And Micro Enterprise Training, Counseling and Developing Training Packages and Educational Materials. HAND IN HAND CONSULTANCY . TASKS AND FUNCTIONS Were: n Daily management responsibilities n Writing job descriptions, interviewing, recruiting and contracting Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 54 n Proposal writing and fund raising n Capacity building internally and externally (Building capacity for governmental and private and NGO) n Follow up and monitoring of clients different sectors CAREER HISTORY: 2002 “ Being Your Own Boss Training” – Dubai, U.A.E. 4 Females Participants and 12 males (from 27th April. – 5th May.), with Dubai Economic Department. 2000 “Promoting Sustainability for Small Businesses for Arab Countries” Six Day Training Course for Project Staff of Small and Micro Credit Project in Syria. Sustainability, Marketing and Promotion Campaigns for Small and Micro Businesses Schemes (12 participant) CARDNE , Amman from 22- 27th December 2001. “Gender Training” for Jordan American Partnership Project Interns TWO training Courses. (22 Participant), Awareness on Gender Concept, Needs, Gender Roles, and Gender Planning. “Start Your Own Business Training” – Dubai, U.A.E. 18 Females Participants (from 29th Sep. – 4th Oct.), with Dubai Economic Department. “Marketing and Sales Basics for Small Businesses”. Dubai, U.A.E. 13 Females Participants (from 29th Sep. – 4th Oct.), with Dubai Economic Department. “Gender Training” for Jordan American Partnership Project Interns. One training Courses. (18 Participant), Awareness on Gender Concept, Needs, Gender Roles, and Gender Planning. 1999 “Project Management Cycle Training and Proposal re-writing for 15 NGO’s in West Bank to obtain funds from European Commission” West Bank-Ramallah, Six months assignment. Addressing Mission, Vision, Goals and Objectives, scope of work, budgeting, Implementation and action planning for each association’s proposals. Results: 11 associations were qualified and got the funding approval based on the proposals submitted “Human and Women Rights Training” For Ministry of Youth Staff and Centers’ Officers. 3-day course / Twice a month. January, February, March and April. Amman, Jordanian International Schools 1998 Palestinian Women in Business Sector- A study conducted for OXFAM/ Quebec - OCSD in Collaboration with Al-Mashreq for research and Studies MRS, Ramallah And MMIS, Amman. “Communication Skills (media and public speeches) for Associations and Municipalities female Members that want to participate in the elections in Palestine”, Hebron, Nablus and Gaza. September. “The Socio-Impact Assessment of Industrial Development Bank Grants” Coordination of the project (one month Task), to co-ordinate on behalf of Management and Development Group MDG. (1st October- 1st November) “Raising awareness in Income Generating Activities Course” for youth (at AlHussein voluntary work camps) one week. July Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 55 Raising awareness in Gender” Course for youth (at Al-Hussein voluntary work camps) one week. August “Team Building Workshop” (enhancing interpersonal skills: Communication, Convincing, Problem analysis, and problem solving) for Child Health & Development Institution and Population Programs, Noor Al-Hussein Foundation .One week. June “Gender and Income generation workshop” In corporation of Ministry of Agriculture and UNDP/WFP, for agricultural extortionists, in Mafrak, Salt, and Karak. For Noor Al Hussein Foundation a program to evaluate a current situation in Mafrak and Rsayfa preparing research plan, needs assessment, action plan, training, monitoring and evaluation, April 1997 Business Awareness course, funded by European committee for Social Development Program in Development and Employment Fund. From 16-24Jan/ 1997. Six training Hours daily for 25 participant, in Karak. “How to start your own business” course and Business Plan for each idea, funded by European Committee, for Social Development Program in DEF. From 28/110/2/1997, 28 participants, in Karak, Rabba and That Rass. Twenty-five Business Plans had Prepared, agricultural, and services sector. “Business Awareness Course”, funded by European committee for the same program in Irbid, 28 participants. Mainly concentrated on agriculture and services types. “Business Awareness Course” 22 participants, in Rafeed, 9/ March/ 1997. All these training programs included, questionnaires, interviews, preparations, documentation, Stationary, logistics and one to one counseling for each idea. Gender issues and small business regional course for trainers, in Amman, Syria, Lebanon, Palestine, Egypt, Qatar, Bahrain, and Mauritania. June funded by (CAWTAR). In addition to training, testing, modifying and follow-up for training material. Alternative materials were prepared for some parts of the program, which related to small enterprise management. Planning For Women Small Firms Workshop”. A six regional workshop conducted in Amman dealt with the field practitionist conducting a Participatory Rapid Appraisal to screen women attitudes, skills, opportunities and obstacles with in the sector of small firms and women entrepreneurs in two different area (Madaba/ Rural) and (Al-Nadeef Camp/Sub-Urban). Funded by CAWTAR and conducted at Queen Zein Al-Sharaf Complex, June. Course Design Plan for the second stage for DEF program in income generation; Activities for the poorest and UN-employed people. Goal Oriented Project Planning GOPP Workshop In corporation with GTZ in Dair Alla for directors and employees in Jordan Valley Authority 1996 Training Supervisor for Entrepreneurial Projects Unit, Full Time Job- Queen Zein Al-Sharaf Complex. Developing the Unit, Preparing the Annual Plan of the Training Program, Writing and Developing the Training Packages for Business awareness and Business Startups as well as Business Development. Conduct Training courses For Women Grassroots, Trainers of the Grassroots and other women and youth Leaders and trainers. To Evaluate and do follow up Sessions and Visits included Coaching for trained trainers. Enhance Counseling Techniques implemented by the trained Women In business councilors. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts 1994 Page 56 Consultant, Full-time at Noor al Hussein Foundation. Population Program For the Grassroots. To assist in the preparatory Stage of the Data Collecting, Researchers Training and Supervision and Phase I analysis related to Population Education. Consultant, Anthropologist and Co-Trainer. Development Services Office, Private Sector. Since 1991 1993 Consultant, UNICEF. Collecting and Analyzing Literature, Studies and Field Notes on Rural Women Health Project (2 months contract) Anthropologist, League of Arab States, ”Immigration of the Head of the Households and The Influence of Their Absence on their Families” (to prepare 30 case studies on women And children within those households” female headed households” (Sep.-Dec). Anthropologist, Save the Children Foundation. “Early Child Development and Pre-school Child Education”. Jul. - Oct. Consultant, UNICEF. “Co-ordination for the Regional Arab Family Seminar “Arab Family Project (Mar.-Jun.) 1992 Anthropologist, ESCWA. “Gulf Returnees Project”, To prepare 10 case studies on the Gulf Returnees Conditions (Economic, Social, Health and their Residential Units...etc. (Oct. - Jan.) Consultant, UNICEF. Preparing Arabic Bibliography for Arabic Resources Materials Available in Jordanian Libraries, Universities and Institutions. (Mar. May.) Responsible for Family and Kinship Project, Institute of Archaeology and Anthropology, Yarmouk University 1991 Consultant, Researcher and Co-trainer. Development Services Office. Private Sector (Full Time) 1989 Museum Guide. Museum of Jordanian Heritage, Institute Of Archaeology and Anthropology, Yarmouk University. ADDITIONAL WORK: 1991 Design Teacher, GRANADA COLLEGE, Irbid. MEMBERSHIP AND HONORS: • Member of Amman Business and Professional Women Club (since 1995) • Member of the National Committee For Child Education (1992-1995) CONFERENCES, SEMINARS AND WORKSHOPS: 2000 Micro finance Training 2000 in Boulder Colorado USA. 3 weeks training Course Since 1999-2000 Accredited Microfinance Trainer By AMIR Program In Jordan of trainers in Sustainable Microfinance, August ,and the Refresher TOT Course LQ$SULO 1998 “Professional and Business Women Club Seventh Conference on Tourism Environment and Investments in Jordan “ (28 - 30th October) “Technical Resource Unit Workshop”, Amman, UNIFEM (24-25 July) Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 57 1997 “Business Women Workshop”, Nicosia- Cyprus. Business AIM. Sep. Moderation Techniques Training”, Amman. INTERACTION & GTZ (29th Mar. 1st April) 1996 “First Research Seminar In fundraising”, Amman, QZSCD (23rd -25th Nov.) “Enterprenuership and Small Enterprises: Recent Development in Education And Training”. Edinburgh-Scotland Conducted By Sterling University and the British council. (13th Jan. - 8th Feb.) 1995 “Gender in Development Training of Trainers”. (First week of May) Conducted By Near East Foundation, Amman “ Training of Trainers Competency Based Program”, Conducted By College De Bois - De Boulogne (7th -19th Oct.) at QZSCD Training Center, Amman “Empowering Grassroots Women Of Entrepreneurial Skills Needed For Starting-up their Projects” (24th Aug. - 13th Sep). At QZSCD, Amman “Financing for Small and Micro Enterprises” Cairo, Egypt. Conducted at Safeer Hotel, By AFED and Granfield University (9th - 14th Jul.) 1994 “Philosophy of the pre-school Child Education Conference” Royal and cultural Center, Amman, 21-23 Nov.) “Data Collectors’ Training on Population Concepts, Communication Skills, Interviewing and Questioning Skills” (29th Oct.- &6th Nov.) (Trainer)- NHF “Up-grading Entrepreneurial Skills of Managers Under Rapid Changes”, (14th20th Sep.), Trainee. Conducted by ESCWA& Friedrich Ebert Stiftung “GOPP Methodology Workshop to Up-grade Production of Seeds Cultivation” (1st -8th Aug.). Co-moderator, Conducted by GTZ, Ministry of Agriculture and Development Services Office. “ Strategic Needs For Women Entrepreneurs”. (3rd- 8th Jul.) Trainee, Conducted by UNIFEM and DSO, Amman “Gender Training” (1st - 6th June), Conducted by UNIFEM & DSO. Observer 1993 ”Pre-school Child Education Conference” Royal Cultural Center, (6th-7th Oct.) 1992 “Promoting Income Generating Activities” Training of Trainers, Conducted by CDS. Egypt (13th May- 4th Jun.) “Social Security and Health in the Middle East”(26th -28th Feb.), Conducted by CERMOC, Amman 1991 “Short Courses In Medical Anthropology” (30th - 14th Jul.) Yarmouk University, Jordan. “Displacement and Refugees In the Middle East Seminar “ (21st - 26th Jul.) Yarmouk University, Jordan RESEARCH AND STUDIES: 2001 Start, Improve and Expand Your Business Training Manuals, in collaboration with the Training Support For Micro and Small Business in Jordan. ILO Copyrights Materials, Jordanian Edition. (28 manual with their workbooks) in Arabic and English. 1998 “Palestinian Women in Business Sector” Field Survey with Women in Business Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 58 Sector, and Institutions (Credit, Research and Training) in addition to conduct five focus group discussion- 3months project, west Bank and Gaza Strip. 1994 “Field Survey On Grassroots Education in Population and Family Planning Issues”(8th Nov.- 15th Dec.) Supported by UNFPA 1993 “Field Survey to screen parental attitudes toward pre-school education and to Evaluate income-generating activities related to ECD Project at Bani Hamida Mountain, Nadeef and Mahata Camps in Amman” (July - Sep.) “Field Survey Immigration of the Head of the Household And the Influence of Their Absence their Families” 1991 Work Study for Ford Foundation For Post Graduates at the Institute of Archaeology and Anthropology. (Jan.- May) Field Research For Master thesis “Study Purposes” in Northern Jordan (Mar.Jul.) 1989 Field Research for recording the traditional Instruments Used in Traditional Handicrafts in Northern Jordan (5 Villages) LANGUAGES: ARABIC: Mother Tongue ENGLISH: Fluent Read and Write and communicate easily FRENCH: Principles, Reading and Understanding COMPUTER SKILLS: Operating/ Typing Windows 95 Arabic + English • PowerPoint 7.0 + Running Data Show Presentations • Excel • Winword • Microsoft Office PUBLISHED MATERIAL: 1994 The Absence Of the Head Of the Household. Research Department, League of Arab States, Cairo- Egypt 1993 Arab Family Bibliography: Arabic resources. UNICEF Regional Office- Amman. UN- PUBLISHED MATERIAL (PAPERS AND RESEARCHES: • Improve and Expand Your Business Manuals adapted for Jordanian Entrepreneurs “Teach Your Child how To think” Training Package • Booklet on Gulf Returnees, Ten Cases, (Case Study). In Arabic, ESCWA Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 59 • MA. Thesis Entitled” Family and Marriage in a Village” In Jerash Region: A descriptive Study for the Socio-economic patterns. In Arabic with an English Abstract SITE VISITS: Greece, Turkey, Syria, United Arab Emirates, Egypt, Scotland, West Bank and Gaza. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 60 &855,&8/809,7$( (7$7&,9,/ 120(735(120$GDPD0RXVVD '$7((7/,(8'(1$,66$1&(9HUV*DR0DOL 6,78$7,210$75,021,$/(0DULp 1$7,21$/,7(0DOLHQQH $'5(66(6&21*$)(0%3(%DPDNR0DOL /$1*8(6)UDQoDLVHWDQJODLVPDvWULVHSDUIDLWH%DPDQDQ6RQUKDwSDUOp (PDLOPRXVVDDGDPD#KRWPDLOFRP 7pO ('8&$7,21(7)250$7,215(d8(6 &HUWLILFDWG¶(WXGHV3ULPDLUHV&(3(FROH)RQGDPHQWDOHGH*DGq\H*DR 'LSO{PHG¶(WXGHV)RQGDPHQWDOHV'()(FROH)RQGDPHQWDOHGHJDGq\H*DR (WXGHV6HFRQGDLUHVDX/\FpHUpJLRQDOGH*DR%DFFDODXUpDW0DOLHQ 0DLWULVHG¶$QJODLV(FROH1RUPDOH6XSpULHXUH(1683 )RUPDWLRQVXUOHVLQQRYDWLRQVSpGDJRJLTXHVDX0DOLGHjQRVMRXUV )RUPDWLRQVXUOHVGURLWVGHVIHPPHVjWUDYHUVOHVLQVWUXPHQWVLQWHUQDWLRQDX[SUpVHQWDWLRQG¶XQHpWXGHGH FDVVXUOH0DOLj.DPSDOD28*$1'$ )RUPDWLRQVHPDLQHV©3ODQLILHUDYHFOHJHQUHª'HYHORSPHQW3ODQQLQJ8QLW/RQGUHV$QJOHWHUUH $WHOLHUVXUOHVWHFKQLTXHVGHFRPPXQLFDWLRQSRXUOHFKDQJHPHQWGHFRPSRUWHPHQW )RUPDWLRQ HQ JHVWLRQ GH SURMHW HW DGPLQLVWUDWLRQ GH SURJUDPPH 0')0DQDJHPHQW 'HYHORSPHQW )RXQGDWLRQ(GH3D\VEDV 5(&+(5&+((7)250$7,215($/,6((6 3URIHVVHXUG¶$QJODLVDX&HQWUHG¶(QVHLJQHPHQW7HFKQLTXHHW&RPPHUFLDO Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 61 $VVLVWDQWGH3URMHWjOD'LYLVLRQ5pJLRQDOHGHV$IIDLUHV6RFLDOHVDXSUqVGXSURMHW$SSXLjO¶,QVHUWLRQ 6RFLR(FRQRPLTXHGHVILOOHVPLJUDQWHV 'LUHFWHXUGHV(WXGHVGX&HQWUHG¶(QVHLJQHPHQW7HFKQLTXHHW&RPPHUFLDO jQRVMRXUV3URIHVVHXUFRQWUDFWXHO8QLYHUVLWpGX0DOL)DFXOWpGHV6FLHQFHVHW7HFKQLTXHV)$67 &KDUJpGH3URJUDPPHV21*$)(0$VVRFLDWLRQGHV)HPPHV(GXFDWULFHVGX0DOL jQRVMRXUV&RRUGLQDWHXU1DWLRQDO$GMRLQWGHO¶21*$)(0 0LVVLRQGHFRQVXOWDWLRQSURJUDPPHpGXFDWLI&$5$5ZDQGDHQFROODERUDWLRQDYHF,&&2168/7 5pDOLVDWLRQ DYHF O¶DSSXL G¶XQ FRQVXOWDQW KRPRORJXH H[WHUQH GH OD SODQLILFDWLRQ VWUDWpJLTXH HW GX SODQ G¶DFWLRQWULHQQDOGHO¶21*$)(0 5pDOLVDWLRQG¶XQHpWXGHVXUO¶LPSDFWGHVDFWLYLWpVG¶,(&HWG¶DOSKDEpWLVDWLRQVXU OHV ILOOHV PLJUDQWHV SRXU *7= (ODERUDWLRQGHGRFXPHQWVVXUOHVILOOHVPLJUDQWHVSRXUO¶21*$3(/')$VVRFLDWLRQSRXUODSURWHFWLRQGH O HQYLURQQHPQHQWODOXWWHFRQWUHODSDXYUHWpHWODSURPRWLRQGHODIHPPH (ODERUDWLRQG¶XQPRGXOHGHIRUPDWLRQ©SDUWLFLSDWLRQGHVJURXSHPHQWVIpPLQLQVjODJHVWLRQFRPPXQDXWDLUH ªSRXUOH)RUXP0DOLHQSRXUODGpPRFUDWLHHWODGpIHQVHGHVGURLWVKXPDLQV 'RFXPHQW GH GLDJQRVWLF HW GH SODQLILFDWLRQ VWUDWpJLTXH GH %DDUD 0XVR 21* )pPLQLQH PDOLHQQH TXL V RFFXSHGHODSURWHFWLRQGHVGURLWVGHVILOOHVPLJUDQWHV (WXGHVXU©/DSHUVLVWDQFHGHODSUDWLTXHGHO¶([FLVLRQDX0DOL4XHOOHVQRXYHOOHVVWUDWpJLHV"ª&,)5$ &HQWUHLQWHUQDWLRQDOGHIRUPDWLRQHQUHFKHUFKHDFWLRQ%XUNLQD)DVR )RUPDWLRQGXSHUVRQQHOHWGHVDJHQWVGHWHUUDLQGHO¶21*$)(0HQ*HQUH 5DSSRUWHXU*pQpUDOGHO¶DWHOLHUGHV21*DIULFDLQHVSRXUODSUpSDUDWLRQGX©6RPPHW0RQGLDOGHV(QIDQWV ª $QLPDWLRQGHO¶DWHOLHUQDWLRQDOGHSODQLILFDWLRQSRXUOHSURJUDPPHQDWLRQDO©GpYHORSSHPHQWGHVDGROHVFHQWV ª $QLPDWLRQ GX 6WDQG © 'URLWV HW &LWR\HQQHWp GHV )HPPHV HQ $IULTXH IUDQFRSKRQH ª 3UpSDUDWLRQ GH OD MRXUQpH 1DWLRQDOH GHV &RPPXQHV (ODERUDWLRQ G¶LQVWUXPHQWV SRXU OD FRQIHFWLRQ G¶XQ DQQXDLUH GHV IHPPHV PDLUHV &RIDFLOLWDWHXU GH O¶DXWRpYDOXDWLRQ GH O¶LQWpJUDWLRQ GX JHQUH GDQV OHV SURMHWV HW SURJUDPPHV GH OD &RRSpUDWLRQ6XLVVHDX0DOL Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 62 )RUPDWLRQGHVUHVSRQVDEOHVJHQUHGHVSURJUDPPHVGHODFRRSpUDWLRQ6XLVVHVXUODPLVHHQ°XYUHGHV RXWLOVJHQUHHWpODERUDWLRQGHODVWUDWpJLHG¶LQWHUSUpWDWLRQGXJHQUHGDQVOHVSURMHWVSURJUDPPHVGHODFRRSpUDWLRQ 6XLVVHDX0DOL $QLPDWLRQG¶XQHpPLVVLRQWpOpYLVpH©0DJD]LQHGHOD)HPPHHWGHO¶(QIDQWªVXUODSUREOpPDWLTXHGXJHQUH HWODSURPRWLRQIpPLQLQHDX0DOL $WHOLHU VXU OH UHQIRUFHPHQW GX SRXYRLU GH QpJRFLDWLRQ HW GH GLDORJXH GHV 21* IpPLQLQHV HQ PDWLqUH GH SROLWLTXHVHWGHSURJUDPPHVGHGpYHORSSHPHQW&$)2&RRUGLQDWLRQGHVDVVRFLDWLRQVHW21*IpPLQLQHVDX0DOL (ODERUDWLRQGXSODQG¶DFWLRQGHODPLVHHQ°XYUHGHODVWUDWpJLHJHQUHGHOD&RRSpUDWLRQ6XLVVH (WXGHVXUOHVIHPPHVSDUOHPHQWDLUHVGX0DOLSRXUOHEXUHDXGHFRRUGLQDWLRQGHODFRRSpUDWLRQVXLVVHDX 0DOL )RUPDWLRQHQJHQUHGXSHUVRQQHORSpUDWLRQQHOGHVSURJUDPPHVGHO¶21*6XLVVH6ZLVVFRQWDFWSDUWHQDLUH GHODFRRSpUDWLRQ6XLVVHDX0DOL Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 63 38%/,&$7,216&20081,&$7,216)(00(6*(15( /HV0XWLODWLRQV*pQLWDOHV)pPLQLQHVDX0DOL*7=&,)5$%XUNLQD)DVR ©&RPPHQWOHQRQIRUPHOSHXWDLGHUDXPDLQWLHQGHVILOOHVjO¶pFROH 6WUDWpJLHVG¶LQWHUYHQWLRQGHO¶21*$)(0GDQVOHFDGUHGHO¶DOSKDEpWLVDWLRQVpPLQDLUHELODQSURJUDPPDWLRQ GHVDFWLYLWpVG¶DOSKDEpWLVDWLRQGDQVOH'LVWULFWGH%DPDNR ,PSOLFDWLRQGHVIHPPHVGDQVODUpVROXWLRQGHVFRQIOLWV3UHVVH/RFDOH 6LWXDWLRQGHVILOOHVPLJUDQWHVDX0DOL3UHVVH/RFDOH Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 64 &855,&8/809,7$( &$52/<1,65$(/62%5,7&+($3K' 1DWLRQDOLW\ )LOLSLQR %LUWKGDWH -DQXDU\ ('8&$7,21$/%$&.*5281' • 3K'$QWKURSRORJ\8QLYHUVLW\RIWKH3KLOLSSLQHV • )XOEULJKW 'RFWRUDO (QULFKPHQW 6WXGLHV LQ $QWKURSRORJ\ 6WDWH 8QLYHUVLW\ RI 1HZ <RUN681<FRPSOHWHGXQLWRIFRXUVHZRUN • 0$ $VLDQ 6WXGLHV 8QLYHUVLW\ RI WKH 3KLOLSSLQHV $UHD RI 6SHFLDOL]DWLRQ 6RXWKHDVW$VLD • $%$QWKURSRORJ\8QLYHUVLW\RIWKH3KLOLSSLQHV &855(17326,7,216 • 3URIHVVRURI3KLOLSSLQH6WXGLHV$VLDQ&HQWHU8QLYHUVLW\RIWKH3KLOLSSLQHV • 'LUHFWRU 8QLYHUVLW\ &HQWHU IRU :RPHQ¶V 6WXGLHV 8QLYHUVLW\ RI WKH 3KLOLSSLQHV 6\VWHP-DQXDU\±SUHVHQW • 3URMHFW /HDGHU (QKDQFLQJ 5HSURGXFWLYH +HDOWK $GYRFDF\ WKURXJK 3URGXFWLRQ RI ,(&0DWHULDOV$MRLQWSURMHFWRI83&:6ZLWKWKH)RUG)RXQGDWLRQ± ),(/'62)63(&,$/,=$7,21 • :RPHQ¶V 6WXGLHV JHQGHU LGHRORJ\ IHPLQLVW PHWKRGRORJLHV IHPLQLVW WKHRULHV ZRPHQDQGGHYHORSPHQW • 3KLOLSSLQHSHDVDQWU\DQGDJUDULDQLVVXHVIRRGVHFXULW\PLFURILQDQFHDQGVDYLQJV IRUUXUDOZRPHQHQWHUSULVHGHYHORSPHQWIRUZRPHQ • (YDOXDWLRQ UHVHDUFK VRFLDO VRXQGQHVV DQDO\VLV SURJUDP DVVHVVPHQW LPSDFW HYDOXDWLRQ • *HQGHU 7UDLQLQJ EDVLF RULHQWDWLRQ RQ *HQGHU DQG 'HYHORSPHQW >*$'@ *HQGHU 3ODQQLQJ0DLQVWUHDPLQJ*HQGHULQ2UJDQL]DWLRQDO3URJUDPVHWF *5$'8$7(0$DQG3K'&2856(6%(,1*7$8*+7 • :RPHQLQ$VLD • 5HVHDUFK0HWKRGVHYDOXDWLRQUHVHDUFK Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts • 6HPLQDULQ3KLOLSSLQH6RFLHW\DQG&XOWXUH • 3KLOLSSLQH3HDVDQWU\ • 3KLOLSSLQH(WKQLF5HODWLRQV • 3KLOLSSLQH6RFLDO2UJDQL]DWLRQ • 'HYHORSPHQWSURFHVVHV Page 65 5(/(9$17&2168/7$1&<:25. • 7HFKQLFDO(GLWRU&RQVXOWDQW)UDPHZRUN3ODQIRU:RPHQ1DWLRQDO&RPPLVVLRQRQ WKH5ROHRI)LOLSLQR:RPHQ1&5):)HEUXDU\ • &RQVXOWDQW %XVLQHVV 3ODQ 'HYHORSPHQW IRU &OLQLF DQG /DERUDWRU\ 6HUYLFHV 5HPHGLRV$,'6)RXQGDWLRQ$XJXVW±-DQXDU\ • (QGRI3URJUDP(YDOXDWRU&RPPLVVLRQHGE\7HUUHVGHV+RPPHV3KLOLSSLQHVIRU %DWKDOXPDQ&ULVLV&HQWHU'DYDR&LW\$XJXVW±6HSWHPEHU • (YDOXDWRU 5HSURGXFWLYH +HDOWK 3URJUDPV RI WKH :RPHQ¶V +HDOWK &DUH )RXQGDWLRQ$XJXVW6HSWHPEHU • &RQVXOWDQW 'HYHORSPHQW RI 0RQLWRULQJ DQG (YDOXDWLRQ ,QGLFDWRUV IRU 3URJUDPV DORQJWKH0HNRQJ5LYHU2[IDP$PHULFD-DQXDU\ • *HQGHU (YDOXDWRU IRU JHQGHU DQG FRPPXQLW\ SDUWLFLSDWLRQ &RPPXQLW\ )RUHVW 0DQDJHPHQW 3URMHFW LQ 4XLULQR 3URYLQFH D 'HSDUWPHQW RI (QYLURQPHQW DQG 1DWLRQDO5HVRXUFHVDQG*7=HGSURMHFW-XQH-XO\ • 0HPEHU RIWKH 5HVHDUFK7HDP $ 3URMHFW WR 0RQLWRU WKH 3URJUHVV DQG ,PSDFW RI ,QWHUYHQWLRQ 3URJUDPV WR 3UHYHQW DQG (OLPLQDWH 9LROHQFH $JDLQVW :RPHQ DQG &KLOGUHQ &RPPLVVLRQHG E\ WKH 'HSDUWPHQW RI +HDOWK LQ FRRSHUDWLRQ ZLWK :RUOG %DQN-DQXDU\±'HFHPEHU • (YDOXDWRU 3HUIRUPDQFH DQG ,PSDFW $VVHVVPHQW RI WKH &RXQWU\ )RUHLJQ 9ROXQWHHU 3URJUDPV LQ WKH 3KLOLSSLQHV &RPPLVVLRQHG E\ WKH 3KLOLSSLQH 1DWLRQDO 9ROXQWHHU 6HUYLFH DQG &RRSHUDWLRQ $JHQF\ 3196&$ 1DWLRQDO (FRQRPLF 'HYHORSPHQW$XWKRULW\1('$2FWREHU±$SULO • 3URMHFW/HDGHU%XLOGLQJ*HQGHUDQG'HYHORSPHQW*$'&DSDELOLWLHVRI5HJLRQDO :RPHQ¶V*HQGHU 5HVRXUFH &HQWHUV 8QLYHUVLW\ &HQWHU IRU :RPHQ 6WXGLHV 8&:6 1&5): :RPHQ¶V 6WXGLHV $VVRFLDWLRQ RI WKH 3KLOLSSLQHV :6$3 DQG &DQDGLDQ,QWHUQDWLRQDO'HYHORSPHQW$XWKRULW\&,'$± • 3URMHFW /HDGHU ³5HVRXUFH %RRN RQ (FRQRPLF (PSRZHUPHQW RI :RPHQ LQ WKH 3KLOLSSLQHV´&RPPLVVLRQHGE\WKH7HFKQRORJLFDO(GXFDWLRQ6NLOOV'HYHORSPHQW $XWKRULW\7(6'$:RPHQ¶V&HQWHU-DQXDU\±$SULO • 0HPEHU RI DQ 1*2 7HDP WR WKH 1HWKHUODQGV RQ 3ROLF\ 'LVFXVVLRQV IRU :RPHQ DQG&UHGLW • 0HPEHU RI WKH (YDOXDWLRQ 7HDP 8QLWHG 1DWLRQV 3RSXODWLRQ )XQG 81)3$ 7HG 7XUQHU 3URMHFW LQ WKH 3KLOLSSLQHV 3+, -XQH ± 2FWREHU 0D\ ± -XO\ • 0HPEHU RI WKH (YDOXDWLRQ 7HDP (QWHUSULVH LQ WKH &RPPXQLW\ 'HYHORSPHQW 3URMHFW86$,'3KLOLSSLQHV2FWREHU±'HFHPEHU Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 66 • ([WHUQDO(YDOXDWRU&RQVXHOR=REHO$OJHU)RXQGDWLRQ2SHUDWLRQ%OXH5RVH3URMHFW $SULO±0D\ • 3URMHFW/HDGHU³6XUYH\RI5HSURGXFWLYH+HDOWKDQG)DPLO\3ODQQLQJ 3URJUDPV LQ WKH 3KLOLSSLQHV´ &RPPLVVLRQHG E\ &RQVXHOR=REHO $OJHU )RXQGDWLRQ 'HFHPEHU • 0HPEHURIWKH-RLQW1HWKHUODQGV3KLOLSSLQH0LVVLRQ(YDOXDWLRQRIWKH3KDVH,,RI ,PSOHPHQWDWLRQRIWKH$QWLTXH,QWHJUDWHG$UHD'HYHORSPHQW$1,$' 3URJUDP$XJXVWVHUYHGDVJHQGHUHYDOXDWRU • ([WHUQDO (YDOXDWRU IRU 8KLWHG 1DWLRQV 'HYHORSPHQW 3URJUDP 81'3 3URJUDP $VVHVVPHQWRI9ROXQWHHU6HUYLFHLQWKH3KLOLSSLQHV'HFHPEHU$SULO • &RQVXOWDQW IRU WKH 3UHSDUDWLRQ RI D )UDPHZRUN IRU 0DLQVWUHDPLQJ *HQGHU LQ WKH 0RQLWRULQJDQG(YDOXDWLRQ6\VWHPRI*RYHUQPHQW$JHQFLHV1DWLRQDO&RPPLVVLRQ RQWKH5ROHRI)LOLSLQR:RPHQ • 0HPEHU RI WKH 5HVHDUFK 7HDP $ %DVHOLQH 6WXG\ RQ WKH )LOLSLQR $PHUDVLDQV &RPPLVVLRQHGE\&RDOLWLRQZRUNLQJLQEHKDOIRIWKH)LOLSLQR$PHUDVLDQV8QLYHUVLW\ &HQWHUIRU:RPHQ¶V6WXGLHV-DQXDU\0D\ • 0HPEHU RI WKH 3URMHFW 0DQDJHPHQW 7HDP 3KLOLSSLQHV $ 5HJLRQDO 6WXG\ 6RXWKHDVW $VLD RI +,9$,'6 DQG 0LJUDWLRQ .DWLSXQDQ QJ .DEDEDLKDQ 3DUD VD .DOD\DDQ.$/$<$$10DUFK • *HQGHU$GYLVRU%UHDGIRUWKH:RUOG&RQVXOWDQF\3URJUDP± • 7HFKQLFDO &RQVXOWDQW:ULWHU RI 3KLOLSSLQH 3ODQ IRU *HQGHU 5HVSRQVLYH 'HYHORSPHQW&RPPLVVLRQHGE\WKH1&5): • &R5HVHDUFK/HDGHU$6WXG\RI,QWUDIDPLO\9LROHQFHLQWKH3KLOLSSLQHV8QLYHUVLW\ &HQWHUIRU:RPHQ¶V 6WXGLHV ZLWKIXQGLQJ VXSSRUW IURP 8QLWHG 1DWLRQV &KLOGUHQ¶V )XQG81,&() • 3URMHFW /HDGHU 'HYHORSPHQW RI $GYRFDF\ 0DWHULDOV IRU WKH $GYDQFHPHQW RI WKH 5LJKWVRIWKH*LUO&KLOG8QLYHUVLW\&HQWHUIRU:RPHQ¶V6WXGLHVZLWKIXQGLQJVXSSRUW IURP81,&()1RYHPEHU0DUFK • &RQVXOWDQW³(QKDQFLQJ*HQGHU6HQVLWLYLW\DQG*HQGHU5HVSRQVLYHQHVVLQ)DPLO\ 3ODQQLQJ DQG 3RSXODWLRQ 3URJUDPV´ ,QVWLWXWH IRU 6RFLDO 6WXGLHV DQG $FWLRQ LQ &ROODERUDWLRQ ZLWK WKH ,QWHUQDWLRQDO &RXQFLO RQ 0DQDJHPHQW RI 3RSXODWLRQ ,&2030DUFK'HFHPEHU • 3URJUDP /HDGHU (QJHQGHULQJ WKH 1DWLRQDO 5HVHDUFK DQG 'HYHORSPHQW 51' 3URJUDPV RI WKH 3KLOLSSLQH &RXQFLO IRU $JULFXOWXUH )RUHVWU\ DQG 1DWLRQDO 5HVRXUFHV 5HVHDUFK DQG 'HYHORSPHQW 'HSDUWPHQW RI 6FLHQFH DQG 7HFKQRORJ\ '2673KLOLSSLQH&HQWHUIRU$JULFXOWXUDO5HVHDUFKDQG'HYHORSPHQW3&$55' 0DUFK0DUFK • &RQVXOWDQW$VVHVVPHQWRI*HQGHU1HHGVDQG([SHUWLVHRI129,%3DUWQHUVLQWKH 3KLOLSSLQHV • 0HPEHU RI WKH 5HVHDUFK 7HDP 83 7VXNXED 8QLYHUVLW\ -RLQW 5HVHDUFK LQ 0DULWLPH $QWKURSRORJ\ LQ WKH &HQWUDO 9LVD\DV ZLWK IXQGLQJ VXSSRUW IURP 021%86+2 • &RQVXOWDQWIRUWKHSUHSDUDWLRQRIWUDLQLQJPRGXOHVLQ*HQGHU6HQVLWLYLW\DQG*HQGHU 3ODQQLQJIRU6($5&$1RYHPEHUDQG3&$55''HFHPEHU • &RQVXOWDQW $VVHVVPHQW RI *HQGHU 1HHGV DQG *HQGHU ([SHUWLVH RI 129,% 3DUWQHUVLQWKH3KLOLSSLQHV&RPPLVVLRQHGE\129,%1HWKHUODQGV • &RQVXOWDQW IRU WKH *HQGHU DQG 'HYHORSPHQW RI ,&&2 'XWFK ,QWHU&KXUFK 2UJDQL]DWLRQIRU'HYHORSPHQW&RRSHUDWLRQ3ROLF\SDSHUIRUWKH3KLOLSSLQHV0DUFK Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 67 • 0HPEHURIWKH3URMHFW0DQDJHPHQW7HDP³$7UDLQLQJ3URJUDPLQ6XSSRUW*URXS 2UJDQL]LQJ DQG )HPLQLVW &RXQVHOLQJ IRU :RPHQ &RPPXQLW\ 2UJDQL]HUV DQG /HDGHUV´.$/$<$$1ZLWKIXQGLQJVXSSRUWIURP129,% • 0HPEHU RI WKH 5HVHDUFK $GYLVRU\ 7HDP 0RUDO 5HFRYHU\ 3URMHFW $ 1DWLRQDO 6XUYH\ RI )LOLSLQR 9DOXHV $WHQHR GH 0DQLOD DQG WKH 3KLOLSSLQH *RYHUQPHQW 'HFHPEHU • 0HPEHU RI WKH 5HVHDUFK $GYLVRU\ %RDUG ,QVWLWXWH RI 3KLOLSSLQH &XOWXUH ,3& $WHQHR*HQGHUDQG6H[XDOO\5HVHDUFK • 3URMHFW /HDGHU 'HYHORSLQJ DQG &RQGXFWLQJ *HQGHU 7UDLQLQJ IRU $JULFXOWXUDO ([WHQVLRQ :RUNHUV LQ $,'$%$VVLVWHG 3LORW 3URYLQFLDO $JULFXOWXUDO ([WHQVLRQ 3URMHFW 8QLYHUVLW\ &HQWHU IRU :RPHQ¶V 6WXGLHV ZLWK IXQGLQJ VXSSRUW IURP WKH $VLDQ3DFLILF'HYHORSPHQW&HQWHU.XDOD/XPSXU)HEUXDU\-XQH • 3URMHFW/HDGHU³'HYHORSLQJDQG3LORWLQJRI*HQGHU7UDLQLQJ&RXUVHVIRU3URJUDP 0DQDJHPHQW¶VDQG3URMHFW,PSOHPHQWRUVRI81,&()DVVLVWHGDJHQFLHV8QLYHUVLW\ &HQWHUIRU:RPHQ¶V6WXGLHVZLWKIXQGLQJVXSSRUWIURP81,&()1RYHPEHU 0D\ • 0HPEHURIWKH5HVHDUFK7HDP³)HPLQLVW9DOXHV´8QLYHUVLW\&HQWHUIRU:RPHQ¶V 6WXGLHVZLWKIXQGLQJVXSSRUWIURP25&83 • ([WHUQDO (YDOXDWRU RI WKH 0DQDJHPHQW DQG 2UJDQL]DWLRQ 'HYHORSPHQW IRU (PSRZHUPHQW ,QFRUSRUDWHG 02'( &RPPLVVLRQHG E\ ,&&2 6HSWHPEHU 'HFHPEHU • &RQVXOWDQW :RPHQ LQ 'HYHORSPHQW $GYLVRU\ 3URMHFW %DVHOLQH 'DWD *HQHUDWLRQ IRU WKH ,QWHJUDWLRQ RI :RPHQ LQ 7HFKQLFDO &RRSHUDWLRQ 3URMHFWV RI *7=3$6 'HXWVFKH *HVHOOVFKDIW 7HFKQLVFKH =XVDPPHQDUEHLW *PEK7HFKQLFDO &RRSHUDWLRQ)HGHUDO5HSXEOLFRI*HUPDQ\-DQXDU\-XO\ • 3URJUDP(YDOXDWRU&RQVXOWDQW³7KH3KLOLSSLQH*HUPDQ6SHFLDO(QHUJ\3URJUDP LQ ,VOD 9HUGH $ 6RFLDO ,PSDFW $VVHVVPHQW´ &RPPLVVLRQHG E\ WKH 3KLOLSSLQH *HUPDQ6SHFLDO(QHUJ\3URJUDP$XJXVW6HSWHPEHU • 0HPEHURIWKH(YDOXDWLRQ7HDPZLWK'U6\OYLD*XHUUHURDQG'U&OHPHQ$TXLQR ³(YDOXDWLRQRIWKH3XEOLF6HFWRU&RPSRQHQWRIWKH86$,'3KLOLSSLQH'HYHORSPHQW 3URMHFW´86$,'6HSWHPEHU'HFHPEHU • 0HPEHU RI WKH $VLDQ &HQWHU (YDOXDWLRQ 7HDP ³&RQWLQXLQJ $VVHVVPHQW RI .QRZOHGJH$WWLWXGHDQG9DOXH)RUPDWLRQLQ83(GXFDWLRQ5HVHDUFK 3URJUDP83 • 5HVHDUFK &RQVXOWDQW $Q $FWLRQ 5HVHDUFK 3URJUDP IRU :RPHQ¶V 3DUWLFLSDWLRQ &RDVWDO5HVRXUFH0DQDJHPHQW7$0%8<2*0DUFK-DQXDU\ • 5HVHDUFK &RQVXOWDQW $ 1DWLRQDO 6WXG\ RI WKH ,PSDFW RI 7HFKQRORJ\ &XOWXUH DQG 3ROLWLFRQ:RPHQ¶V3DUWLFLSDWLRQLQ'HYHORSPHQW´:'7 • 3URMHFW/HDGHU³$QDVVHVVPHQWRIWKHQHHGVDQGVWDWXVRI83ZRPHQ8QLYHUVLW\ &HQWHUIRU:RPHQ¶V6WXGLHV-DQXDU\2FWREHU • 0HPEHU RI WKH 5HVHDUFK 7HDP ³,PSDFW RI WKH 9DWLFDQ ,, RQ ZRPHQ 5HOLJLRXV´ ,QVWLWXWHRI:RPHQ¶V6WXGLHV1856,$-DQXDU\-DQXDU\ • 5HVHDUFK DQG JHQGHU LGHRORJ\ IRU 3K' GLVVHUWDWLRQ LQ D ILVKLQJ FRPPXQLW\ LQ /DJXQD • 5HVHDUFK RQ VRFLDOL]DWLRQ SUDFWLFHV IRU 0$ WKHVLV LQ D ILVKLQJ YLOODJH LQ /DJXQD • 3DUWLFLSDWHGLQPDQ\HWKQRJUDSKLFVWXGLHVLQ/DJXQD%DWDQJDV3DQJDVLQDQIURP Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts • Page 68 3DUWLFLSDWHGLQPDQ\HPSLULFDODQGWKHRUHWLFDOVWXGLHVRQWKH3KLOLSSLQH SHDVDQWU\ IURP ,192/9(0(17$65(6285&(3(562175$,1(5$1'/(&785(5 • 5HVRXUFH3HUVRQ5HJLRQDO:RUNVKRSRQ8QGHUVWDQGLQJ6H[XDOLWLHVLQ$VLD(ZKD :RPDQ¶V8QLYHUVLW\6HRXO.RUHD)HEUXDU\ • 5HVRXUFH 3HUVRQ 8QLWHG 1DWLRQV (FRQRPLF DQG 6RFLDO &RPPLVVLRQ IRU $VLD DQG WKH 3DFLILF 81(6&$3 ([SHUW *URXS 0HHWLQJ WR 6WDWHJL]H RQ WKH 5HJLRQDO ,PSOHPHQWDWLRQRIWKH2XWFRPH'RFXPHQWRIWKH*OREDO5HYLHZRIWKH%5$%HLMLQJ 3ODWIRUPIRU$FWLRQ1RYHPEHU • 0HPEHU RI WKH 3KLOLSSLQH 2IILFLDO 'HOHJDWLRQ WR WKH 81 3UHS&RP DQG *HQHUDO $VVHPEO\ WR 5HYLHZ WKH )LYH<HDU ,PSOHPHQWDWLRQ RI WKH %HLMLQJ 3ODWIRUP IRU $FWLRQ0DUFK-XQH • 6HUYHGDV5HVRXUFH3HUVRQDQG*HQGHU7UDLQHU*HQGHU$ZDUHQHVV:RUNVKRSV IRU 6HOHFWHG &RPPXQLW\ 2UJDQL]HUV DQG VHUYLFH ZRUNHUV LQ $VLDQ &RXQWULHV 'KDND&KDQJ0DL0D\&RORPER-XQH • 3DSHU 5HDGHU5HVRXUFH 3HUVRQ &RQIHUHQFHV RQ %XLOGLQJ :RPHQ¶V 6WXGLHV &XUULFXOXP LQ $VLD (ZKD 8QLYHUVLW\ 6RXWK .RUHD 0DUFK 8QLYHUVLW\ RI ,QGRQHVLD-DSDQ6RXWK.RUHD • 5HVRXUFH6SHDNHU7UDLQLQJLQ*HQGHUDQG'HYHORSPHQWIRU7RS/HYHO2IILFLDOVRI JRYHUQPHQWDQGSULYDWHVHFWRU6SRQVRUHGE\,/23KLOLSSLQHV6XOR+RWHO0DUFK • 5HVRXUFH6SHDNHUDQG0HPEHURIWKH2UJDQL]DWLRQ&RPPLWWHH*2*$'1DWLRQDO &RQIHUHQFHVSRQVRUHGE\WKH1DWLRQDO&RPPLVVLRQRQWKH5ROHRI)LOLSLQR:RPHQ &D\ODEQH5HVRUW0DUFK • /HFWXUH RQ *HQGHU ,VVXHV 6HPLQDU:RUNVKRS RQ WKH $QDO\VLV RI )RUHLJQ 3ROLF\ IRU$6($10LG&DUHHU/HYHO'LSORPDWV-DQXDU\-DQXDU\ • *HQGHU 7UDLQHU *HQGHU 5HVSRQVLYH 3ODQQLQJ IRU 5HJLRQDO 'LUHFWRUV 'LYLVLRQ &KLHIV DQG 7HFKQLFDO 6WDII RI WKH 'HSDUWPHQW RI /DERU DQG (PSOR\PHQW '2/( DQG LWV DWWDFKHG DJHQFLHV 3KLOLSSLQH 2YHUVHDV (PSOR\PHQW $JHQF\ 32($ 7(6'$2::$HWFSUHVHQW • *HQGHU 7UDLQHU *HQGHU $QDO\VLV DQG *HQGHU 5HVSRQVLYH 3ODQQLQJ IRU $,'$% DVVLVWHGH[WHQVLRQZRUNHUV • /HFWXUHU LQ )HPLQLVW 7KHRULHV DQG )HPLQLVW 0HWKRGRORJLHV .$/$<$$1 )HPLQLVW 6FKRRO • 6HUYHG DV UHVRXUFH VSHDNHU LQ VHYHUDO IRUD RQ WKH HVWDEOLVKPHQW RI :RPHQ V 6WXGLHV DQG RQ PDLQVWUHDPLQJ JHQGHU LQ WKH FXUULFXOXP 6LOLPDQ 8QLYHUVLW\ 8QLYHUVLW\ RI WKH (DVW 1RUWKHUQ /X]RQ 6WDWH 8QLYHUVLW\ 9LJDQ 8QLYHUVLW\ RI WKH (DVW 8( 6W 6FKRODVWLFD V &ROOHJH 3RO\WHFKQLF 8QLYHUVLW\ RI WKH 3KLOLSSLQHV 383 3KLOLSSLQH :RPHQ¶V 8QLYHUVLW\ 3:8 8QLYHUVLW\ RI WKH 3KLOLSSLQHV 83 FDPSXVHV FROOHJHV DQG RWKHU XQLYHUVLW\ LQ 0LQGDQDR HWF )URP WR SUHVHQW • 6HUYHG DV UHVRXUFH SHUVRQ RQ YDULRXV WRSLFV DERXW )LOLSLQR ZRPHQ LQ YDULRXV LQWHUQDWLRQDOPHHWLQJVZRUNVKRSDQGIRUD.XDOD/XPSXU*HUPDQ\1HWKHUODQGV (QJODQG &DQDGD 86 ,QGRQHVLD +RQJNRQJ $XVWUDOLD 6LQJDSRUH 6ZLW]HUODQG 7KDLODQGHWFSUHVHQW Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 69 • 6HUYHG DV UHVRXUFH SHUVRQ DQG *HQGHU DQG 'HYHORSPHQW WUDLQHU RI YDULRXV 81 DQG ,QWHUQDWLRQDO $JHQFLHV,/2 81,&() 86$,' 3ODQ ,QWHUQDWLRQDO $XV$LG 962(XURSHDQ8QLRQHWFSUHVHQW • 6HUYHGDVWUDLQHUDQGUHVRXUFHSHUVRQLQYDULRXVWUDLQLQJFRQGXFWHGE\1*2 VDQG SHRSOH V RUJDQL]DWLRQV SUHVHQW7$0%8<2* *URXS RI 7HQ * .$/$<$$1:RPHQ'HYHORSPHQW7HFKQRORJ\,QVWLWXWH:'7,'.0302'( HWF • 6HUYHG DV )XOOEULJKW+D\V $VLDQ 6FKRODU LQ 5HVLGHQFH 8QLYHUVLW\ RI 6RXWK $ODEDPD WDXJKW FRXUVHV LQ DQWKURSRORJ\ DQG ZRPHQ V VWXGLHV DQG KHOSHG GHYHORSPHQW WKH UHVRXUFH FROOHFWLRQ RQ ZRPHQ LQ $VLD JDYH OHFWXUHV LQ VHYHUDO XQLYHUVLW\ DFURVV WKH 86 DQG DWWHQGHG YDULRXV FRQIHUHQFHV LQ $VLDQ 6WXGLHVDQG$QWKURSRORJ\ 6(/(&7('38%/,&$7,216$1'&200,66,21('678',(6 • (GLWRU 6RFLR&XOWXUDO 'LPHQVLRQV RI *HQGHU 9LROHQFH 2& 8&:6 DQG )RUG )RXQGDWLRQ • ³7KH:RPHQ¶V0RYHPHQWLQWKH3KLOLSSLQHVDQGWKH3ROLWLFVRI&ULWLFDO&ROODERUDWLRQ ZLWKWKH6WDWH´SDSHU'HOLYHUHGDWWKH:RUNVKRSRQ&LYLO6RFLHW\LQ6RXWKHDVW$VLD KHOGDW,6($66LQJDSRUH1RYHPEHU • ³:RPHQ LQ 6RXWKHDVW $VLD +DYH WKH\ &RPH D /RQJ :D\"´ 3HUVSHFWLYH $SULO .RQUDG$GHQDXHU6WLIOXQJSDJHV • $)UDPHZRUNIRU,PSDFW(YDOXDWLRQRI9ROXQWHHU6HUYLFH LQWKH 3KLOLSSLQHV 81'3 DQG WKH 3KLOLSSLQH 1DWLRQDO 9ROXQWHHU 6HUYLFH &RRUGLQDWLRQ $JHQF\ 1('$ $SULO • 6RPH5HIOHFWLRQVRQWKH5ROHRI:RPHQLQ&UHGLWDQG6DYLQJ3DSHUSUHVHQWHG GXULQJWKH-RLQW:RUNVKRSRQ&UHGLWDQG6DYLQJV%UHDGIRUWKH:RUOG%IG:DQG 3URWHVWDQW$VVRFLDWLRQIRU&RRSHUDWLRQDQG'HYHORSPHQW(=($SULO • :LWK 6\OYLD *XHUUHUR DQG RWKHUV %UHDNLQJ WKH 6LOHQFH $ 6WXG\ RQ 'RPHVWLF 9LROHQFHLQWKH3KLOLSSLQHV81,&()DQG8QLYHUVLW\&HQWHUIRU:RPHQ¶V6WXGLHV 8&:6 • :LWK 3HDFK 0RQGLJXLQJ 5HVRXUFH %RRN RQ WKH )LOLSLQR *LUO &KLOG 81,&()DQG8&:6 • 6RPH5HIOHFWLRQRQ&XUUHQW'HYHORSPHQWLQWKH:RPHQ V0RYHPHQW5HDGLQJV LQ3KLOLSSLQH6WXGLHV(GLWHGE\&DURO\Q6REULWFKHDDQG'DQLOR*DODQJ • $ 6WXG\ RQ *HQGHU DQG 3RZHU &RQVWUXFWV LQ %LQLVD\D QJ .LQDEXKL 9LVD\DQ /LIH(GLWHGE\,ZDR8VKLMLPDDQG&\QWKLD1HUL=D\DV4XH]RQ&LW\4&&ROOHJH RI6RFLDO6FLHQFHVDQG3KLORVRSK\&6633XEOLFDWLRQV83 • :LWK-HDQQH,OORDQGRWKHUV+DQGERRNIRU'HYHORSLQJDQG&RQGXFWLQJ*HQGHU 7UDLQLQJ IRU $JULFXOWXUDO ([WHQVLRQ :RUNHUV 4& 8QLYHUVLW\ &HQWHU IRU :RPHQ V6WXGLHV • *HQGHU 5ROHV DQG (FRQRPLF &KDQJH LQ D )LVKLQJ9LOODJH LQ )LVKHUV RI WKH 9LVD\DV(GLWHGE\,ZDR8VKLMLPDDQG&\QWKLD1HUL=D\DV4&&6633XEOLFDWLRQV 83 Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts Page 70 • 3RVVLEOH 3ROLF\ GLUHFWLRQV IRU *HQGHU DQG 'HYHORSPHQW LQ WKH 3KLOLSSLQHV 3URFHHGLQJV RI WKH ,QWHU&KXUFK 2UJDQL]DWLRQ IRU 'HYHORSPHQW &RRSHUDWLRQ 0DQLOD02'( • ,VVXH (GLWRU :RPHQ 'HYHORSPHQW DQG (QYLURQPHQW /LOD $VLD 3DFLILF -RXUQDO 0DQLOD,QVWLWXWHRI:RPHQ V6WXGLHV1856,$ • $Q$QWKURSRORJLFDO6WXG\RI(FRQRPLF&KDQJH *HQGHU DQG 3RZHU LQ D 9LVD\DQ )LVKLQJ&RPPXQLW\5HYLHZRI:RPHQ V6WXGLHV9RO1R • 'RXEOH -HRSDUG\ 3ROLFH $EXVH RI :RPHQ LQ 3DNLVWDQ /LOD $VLD 3DFLILF :RPHQ V6WXGLHV-RXUQDO1R • :RPHQ V SURGXFWLRQ DQG 'RPHVWLF 5ROHV LQ D 6HDILVKLQJ &RPPXQLW\ LQ &HQWUDO 9LVD\DV3KLOLSSLQHV<$.$5$6WXGLHVLQ(WKQRORJ\7VKXNXED8QLYHUVLW\9RO • $Q (YDOXDWLRQ 6WXG\ RI WKH 9DULRXV 6HUYLFHV 2IIHUHG E\ 83 'LOLPDQ WR )HPDOH )DFXOW\ $FDGHPLF QRQ 7HDFKLQJ DQG $GPLQLVWUDWLYH 6WDII 5HYLHZ RI :RPHQ V 6WXGLHV9RO1RS • 7KH,GHRORJ\RI)HPDOH'RPHVWLFLW\,WV,PSDFWRQWKH6WDWXVRI)LOLSLQR:RPHQ 5HYLHZRI:RPHQ V6WXGLHV9RO1RSS • $PHULFDQ &RORQLDO (GXFDWLRQ DQG ,WV ,PSDFW RQ WKH 6WDWXV RI )LOLSLQR :RPHQ $VLDQ6WXGLHV9ROSSDQG • :RPHQDQG$VLD3XEOLVKHG3URFHHGLQJRIWKH5RXQGWDEOHRQ:RPHQDQG5XUDO 'HYHORSPHQW 6SRQVRUHG E\ WKH ,QWHUQDWLRQDO ,QVWLWXWH IRU 5XUDO 5HFRQVWUXFWLRQ • *HQGHU,QHTXDOLW\DQG6XSSRUWLQJ,GHRORJLHVLQ3KLOLSSLQH6RFLHW\$QG6KH6DLG 1R4XH]RQ&LW\3URJUDP8QLWRQ+XPDQ5LJKWV • ,PSOLFDWLRQV RQ 'HYHORSPHQW RI :RPHQ LQ WKH 3KLOLSSLQHV 3XEOLVKHG 3URFHHGLQJV RI WKH 6RXWKHDVW &RQIHUHQFH $VVRFLDWLRQ IRU $VLDQ 6WXGLHV 7XVFDORRVD$ODEDPD • 6RPH 1RWH RQ *HQGHU ,GHRORJ\ DQG WKH 6WDWXV RI :RPHQ LQ 3KLOLSSLQH 5XUDO &RPPXQLW\ (VVD\V RQ :RPHQ (GLWHG E\ 6U 0DU\ -RKQ 0DQDQ]DQ 26 % 0DQLOD:RPHQ V6WXGLHV&HQWHU6W6FKRODVWLFD V&ROOHJH 825*$1,=$7,21$/0(0%(56+,3 • 3UHVLGHQW:RPHQ V,QVWLWXWHIRU6XVWDLQDEOH(FRQRPLF$FWLRQ:,6($&7,QF • 3UHVLGHQW$FWLRQIRU+HDOWK,QLWLDWLYH,QFRUSRUDWHG$&+,(9( • %RDUG0HPEHU:RPHQ V5XUDO%DQN:5%RI5RVDULR%DWDQJDV3KLOLSSLQHV • 3DVW 3UHVLGHQW :RPHQ V 6WXGLHV $VVRFLDWLRQ RI WKH 3KLOLSSLQHV :6$3 • 3DVW 7UHDVXUHU :RPHQ V 6WXGLHV $VVRFLDWLRQ RI WKH 3KLOLSSLQHV:6$3 • 0HPEHU3L*DPPD0XKRQRU6RFLHW\ • 0HPEHU$VVRFLDWLRQRI)XOEULJKW6FKRODUV • 0HPEHU$VVRFLDWLRQRI)LOLSLQR$QWKURSRORJLVW8*$7³8JQD\DQQJ$JKDP7DR´ • $VVRFLDWH0HPEHU1DWLRQDO5HVHDUFK&RXQFLORIWKH3KLOLSSLQHV • 3DVW %RDUG 0HPEHU ,QVWLWXWH RI :RPHQ V 6WXGLHV 1856,$ 6W 6FKRODVWLFD V &ROOHJH Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 2 – CVs of Experts • &RXQFLO+HDG.$/$<$$1 • ([HFXWLYH%RDUG0HPEHU3KLOLSSLQH6RFLDO6FLHQFH&RXQFLO Page 71 6(/(&7('$:$5'6*5$176$1'6&+2/$56+,3 • :RPHQ RI 'LVWLQFWLRQ $ZDUGHH 6RURSWLPLVW ,QWHUQDWLRQDO &RPPRQZHDOWK 0DUFK • 9LVLWLQJ)HOORZ,QWHUQDWLRQDO&KULVWLDQ8QLYHUVLW\$SULO • 9LVLWLQJ)HOORZ8QLYHUVLW\RI6XVVH[%ULJKWRQ(QJODQG$SULO • 2XWVWDQGLQJ)DFXOW\([WHQVLRQ:RUNHU*DZDGQJ&KDQFHOORU • 6LPHRQ'DWXPDQRQJ3URIHVVRULDO&KDLU • 5HFLSLHQW RI )RUG )RXQGDWLRQ *UDQWV IRU 6WXG\ YLVLWV WR YDULRXV $VLDQ FRXQWULHV 0DOD\VLD6LQJDSRUH7KDLODQG-DSDQ&KLQDHWF • )XOEULJKW+D\V $VLDQ 6FKRODU LQ 5HVLGHQFH 8QLYHUVLW\ RI 6RXWK $ODEDPD • )XOEULJKW+D\V'RFWRUDO(QULFKPHQW6WXGLHV6XQQ\%XIDOR • 'LVVHUWDWLRQ)HOORZVKLS83 • 7UDYHO *UDQW WR WKH 3HRSOH V 5HSXEOLF RI &KLQD 6SRQVRUHG E\ WKH 3HRSOH V $VVRFLDWLRQIRU)ULHQGVKLSZLWK)RUHLJQ&RXQWULHV$SULO0D\ • )HOORZVKLS LQ $6($1 $UFKDHRORJ\ DQG 7UDYHO *UDQW WR ,QGRQHVLD 0DOD\VLD 6LQJDSRUH DQG 7KDLODQG 6SRQVRUHG E\ WKH $6($1 &RPPLWWHH RQ &XOWXUH DQG ,QIRUPDWLRQ DQG WKH 0LQLVWU\ RI )RUHLJQ $IIDLUV 5HSXEOLF RI WKH 3KLOLSSLQHV 6HSWHPEHU1RYHPEHU • 7UDYHO *UDQW WR ,QGRQHVLD 0DOD\VLD 7KDLODQG DQG 6LQJDSRUH 6SRQVRUHG E\ WKH 2IILFHRIWKH3UHVLGHQW5HSXEOLFRIWKH3KLOLSSLQHV-XO\ • &ROOHJH 6FKRODU 8QLYHUVLW\ RIWKH 3KLOLSSLQHV 7XLWLRQ 6FKRODUVKLS DV PHPEHURIWKH83FRQFHUW&KRUXV • (QWUDQFH6FKRODU8QLYHUVLW\RIWKH3KLOLSSLQHV Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 3 – Glossary of Concepts and Terms on Gender in Development Page 72 *ORVVDU\RIFRQFHSWVDQGWHUPVRQJHQGHULQGHYHORSPHQW The following definitions are based on those contained in EC documents and are coherent with accepted international definitions. Firstly, one important distinction that should be made is between “gender” as an objective and “gender” as a tool for planning and analysis. The global objective in all EC activities, including development co-operation, is as stated in the Treaty of Amsterdam: “to eliminate inequalities, and to promote equality, between men and women”. The strategy to achieve this objective is gender mainstreaming, which combines the systematic integration of a gender dimension with specific actions. Gender analysis is a tool to integrate a gender dimension into all projects and programmes through their cycle. The gender mainstreaming approach, which aims to reduce gender inequalities and promote gender equality, was adopted by the European Community in 1995. This replaced the former approach which focused primarily on women’s roles and opportunities and on overcoming the specific obstacles faced by women (the Women in Development or WID approach). The gender mainstreaming approach not only brings men into the picture (both as beneficiaries of development and as actors who can contribute to the promotion of gender equality), but also takes a more systematic and structural approach to tackling gender disparities. The following are definitions of some key terms that are used in the context of development co-operation. 7HUP 'HILQLWLRQ Equal opportunities for women The absence of barriers to economic, political and social and men participation on the grounds of sex. Equality between women and The principle of equal rights and equal treatment for women and men men (see gender equality). GAD The “GAD” – Gender and Development – approach takes into account the roles, needs and interests of both men and women in all areas of development policy and interventions. It is a transversal and multisectoral approach, and aims to tackle the structural causes of gender inequality. Gender The social differences, as opposed to the biological ones, and relations between women and men that have been acquired in life. They are changeable over time and have wide variations both within and between cultures and social groups. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 3 – Glossary of Concepts and Terms on Gender in Development Page 73 7HUP 'HILQLWLRQ Gender analysis The study of the differences and relations between women and men, girls and boys, particularly in terms of their roles, needs and interests in all spheres of life, their access to and control of resources and assets, and their decision-making powers at all levels. Since not all women or men are the same, variations according to ethnic group, caste, class, socio-economic group, etc. must be taken into account in such an analysis. Gender disparities Inequalities in the condition of women and men, girls and boys, particularly concerning their participation in social, economic and political life, their access to and control of resources and their decision-making powers. Gender equality The freedom of an individual to develop their personal abilities and make choices without the limitations set by gender roles; that the different behaviour, aspirations and needs of women and men are considered, valued and favoured equally. Gender mainstreaming The systematic integration of the respective situations, priorities and needs of women and men in all policies and programmes throughout their cycle, with a view to reducing gender disparities and promoting gender equality. Human rights of women The rights of women and girl children as an inalienable, integral and indivisible part of universal human rights and including sexual and reproductive rights. Specific (or positive) action A measure targeted at a particular group and intended to eliminate and prevent direct or indirect discrimination or to offset disadvantages arising from existing attitudes, behaviours and structures. Sex The biological characteristics which distinguish human beings as female or male. Sex-disaggregated statistics The collection and separation of data and statistical information by sex to enable comparative analysis (sometimes called genderdisaggregated statistics). Sex discrimination – direct Where a person is treated less favourable because of his or her sex. Sex discrimination – indirect Where a law, regulation, policy or practice, which is apparently neutral, has a disproportionate adverse impact on the members of one sex. WID The “WID” – Women in Development – approach focuses on the integration of women into development, through specific actions for women that tend to be limited and mono-sectoral in character. It does not take into account the role of men or the structural causes Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 3 – Glossary of Concepts and Terms on Gender in Development 7HUP Page 74 'HILQLWLRQ of inequality. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 4 – Policy commitments on gender in EC development co-operation Page 75 $QQH[3ROLF\FRPPLWPHQWVRQJHQGHULQ(&GHYHORSPHQWFRRSHUDWLRQ (OHPHQW $SSURDFK 3URSRVHG$FWLRQV 7DUJHWVDQGLQGLFDWRUV A. Policy formulation/ decisionmaking The general (gender) principles should be a constant feature in all policy dialogue and negotiation with partner countries (95). Build delegation level capacity for policy dialogue on gender/ women with gvmnt and civil society (01) Gender issues are an agenda item in policy dialogues with partners and manifest in dialogue outcome (01) B. Content of policy and interventions Women and men should both participate in and benefit from the development process on an equal basis (95). Actions addressing major gender disparities in resources/ decision-making (98) Analysis of disparities between women and men must be a key criterion for assessing the goals and results of development policies and interventions (95) By 2003 a substantially increased % of Community interventions satisfy OECD DAC criteria for gender integration or positive action (95). Commission will strengthen gender considerations for whole of project cycle (01) PRSPs/ CSPs/ annual work progs adapted to local gender needs (01) Take account of legal and actual status women and men, and contributions to family and society (98) Attention to emerging (gender) issues: emergency operations and crisis prevention, human rights and democratisation, macro economic analysis and interventions, sexual and reproductive health, rights (95, 98). Gender should be a cross cutting theme in 6 priority areas of EC Development Policy (01) C. Procedures In Progs/ Projs. and country strats. gender analysis will orient all interventions form planning to Review policy guidelines according to situation of women and men in each of the 6 priority policy areas ‘Gender friendly’ guidelines available (01) Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 4 – Policy commitments on gender in EC development co-operation (OHPHQW Page 76 $SSURDFK 3URSRVHG$FWLRQV evaluation phases. Both mainstreaming and positive/ special measures should be considered. (95, 01) (01) Strengthen the use of gender sensitive output indicators (01) 7DUJHWVDQGLQGLFDWRUV Engendered policy documents available 7 (01) Gender analysis at the macro-, meso- and microlevels (95, 98) Strengthen methods for quality assurance of gender sensitive sectoral policies (01) Make programming guidelines gender sensitive and issue to delegations/ partners (01) Disseminate and use revised (gender sensitive) Evaluation Guidelines (01) GS Publication available Gender Source Publication will be elaborated and regularly up-dated (01) Revised PCM Manual includes gender perspective Revised version of PCM Manual to provide guidance on integrating best gender practices into working procedures (01) Gender sensitive standard TOR to be used for prefeasibility and evaluations (01) Engendered pre-feasibility/ baseline studies, Eval TOR available (01) Disseminate and use revised (gender sensitive) Evaluation Guidelines (01) D. Capacity building 7 Expertise on gender issues to be ensured (policy level, technical divisions and operational and field level). ALL Education/ training (98) By 2006, all Commission staff working on development should be gender competent to NB some of the indicators outlined in Annex VI of the 2001 communication are not measurable and so useless. Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 4 – Policy commitments on gender in EC development co-operation (OHPHQW $SSURDFK (EC) development staff at HQ and field enabled to assume increasing responsibility for implementing and assessing gender aware policy (95) Page 77 3URSRVHG$FWLRQV 7DUJHWVDQGLQGLFDWRUV promote gender equality (01) Gender training for HQ and Delegation staff (01) IQSG reinforced with gender competence (01) On-call TA with gender expertise will be strengthened incountry, regional and HQ. ( &DSDFLW\ EXLOGLQJ SDUWQHUV Institutional capacity in partner countries should be built (training policy makers, supporting sex disagg. Data collection) (95) Education/ training (98) Build capacity of national gender experts (linked to activities for training Commission officials) Build public/ gender(98) private capacities for mainstreaming Increased national staff and policy maker awareness of gender concerns (01) Promotion of gender equality in national policy reforms (01) Support to civil society for gender sensitive approaches (inlc. Women’s organisations and networks) (95) F. Location of responsibility Institutional accountability measures should be established (95) Role of management committees in giving proper attention to gender issues in programming (95) I. Information J. M&E System for monitoring progress of gender policy and implementation should be established, integrated into management info. system and monitored at senior management level (95) G. Institutional culture Development cooperation must encourage and support changes in attitudes, structures and mechanisms at political, legal, community and household level in order to reduce gender 8 inequalities (95) H. Resources (95) Adequate financial, technical and human resources for: • Special interventions • Promoting catalytic role of gender experts Mainstream funds increasingly used for gender 8 NB – focus on institutional change with partners – but not within the EC itself…?? Should the be in the Community Framework strategy on Gender Equality (2001-2005) Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 4 – Policy commitments on gender in EC development co-operation (OHPHQW $SSURDFK Page 78 3URSRVHG$FWLRQV 7DUJHWVDQGLQGLFDWRUV sensitive interventions (95) Regular assessment (98) (98) Eligible activities for financing, are support to/ engendering: K. Coordination Gender issues should be systematically included in coordination of Community and Member States (95) Bring together groups of member states’ experts at least once a year to refine analyses of geographical areas or policy measures (95) With other funders (98) Take an active role in in country gender donor co-ordination groups (01) Partnerships with member states/ UN, civil soc. and others will improve information sharing on good practice (01) • TA • Procedures, methodologies • Capacity building (partners) • Data collection • Thematic M&E • Capacity building (commission) • National plans for Beijing plan of action • Coordination with member states Monthly reporting by commission to member states on projects approved (98) Recommendations of donor groups fed into country development dialogue (01) System for info sharing with member states in place (01) Documents used (95) - Council Resolution on Integrating Gender Issues in Development Cooperation, 20 December 1995 (98) - Council Regulation on Integration of Gender Issues in Development Cooperation, 22 December 1998 &RPPXQLFDWLRQ IURP WKH &RPPLVVLRQ WR WKH &RXQFLO DQG WKH (XURSHDQ 3DUOLDPHQW ± 3URJUDPPH RI $FWLRQ IRU WKH PDLQVWUHDPLQJ RI JHQGHU HTXDOLW\ LQ FRPPXQLW\ GHYHORSPHQWLQWHUYHQWLRQ Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 5 – Persons interviewed and discussions groups Page 79 3HUVRQVLQWHUYLHZHGDQGGLVFXVVLRQJURXSV o Corinne ANDRÉ – Aidco, B4 o Michel ARRION – ECHO, Ex DG Dev o Jan Ten BLOEMENDAL – Head of Unit, Aidco F4 o Hélène BOURGADE – Aidco, C4 o Anne CAUDRON – Aidco, F4 o Louis CHARPENTIER – Aidco, Evaluation Unit, H6 o Philippe DARMUZEY – DG Dev, C3 o Anna DIAMANTOPOULOU – EC Commissionner (Employment & Social Affairs) o Elisabeth DRORY – Consultant, SORCA framework contract o Elisabeth FOA – Aidco, C3 o Klaus HAUPT – Aidco, D2 o Irene HOREJS – Head of Niger Delegation o Eva JOELDOTTER-BERG – DG Dev, B3, Swedish END Gender Officer o Madeleine KIHLBERG – Aidco, C4 o Georg LADJ – former member of PCM Helpdesk o Paul MALIN – Head of Unit, DG Dev A3 o Claire MANDOUZE – DG Dev, C1 o France MARION – Aidco, F2 o Bela MATIAS – Aidco, MEDA Unit 3 o Irene MILLEIRO DIAZ – RELEX, B1 o Daniela NAPOLI – RELEX, B1 o Marie-Anne PARASKEVAS – DG Empl, Women's Unit o Horst PILGER – Aidco, D3 o Daniela ROFI – Aidco, F4 o True SCHEDVIN – Aidco, Evaluation Unit, H6, Swedish END o Dina-Pauline SINIGALLIA – RELEX, B1 (stagiaire) o SORCA TEAM (Anne Christine BLOUWERS and Maija SALA) o Dominique STEVERLYNCK – Aidco, A3 o Arne STROM – Ex Swedish END, DG VIII/DEV o John Bruce THOMPSON – DG Dev, B5 (Transport) o Cecilia THORFINN – Secretary of iQSG, DG Dev, Directorate B o Pieter VAN STEEKELENBURG – Aidco, Evaluation Unit Thematic Evaluation of the Integration of Gender in EC Development Co-operation with Third Countries Draft Final Report; PARTICIP GmbH - March 2003 Annex 6 – Questionnaire to EC Delegations on Integration of Gender in EC Development Co-operation Page 80 3/($6(5(78517+(&203/(7('48(67,211$,5(%<78(6'$<2&72%(5 (,7+(5%<(0$,/72IORUHQFHSDXO\#VN\QHWEH25%<)$;)$;1U QUESTIONNAIRE TO EC DELEGATIONS ON THE INTEGRATION OF GENDER IN EC DEVELOPMENT CO-OPERATION 'HOHJDWLRQLQFRXQWU\ 1DPHRIWKHSHUVRQFRPSOHWLQJ WKHTXHVWLRQQDLUH (PDLO 3RVLWLRQLQ'HOHJDWLRQ )HPDOH0DOH 4 <HV $UH \RX DZDUH RI WKH (&·V SROLF\ RQ JHQGHU LQ GHYHORSPHQW FRRSHUDWLRQ HJ WKH DQG&RXQFLO5HVROXWLRQVWKH&RPPXQLFDWLRQ" $UH GRFXPHQWV RQ WKH (&¶V SROLF\ RQ JHQGHU LQ GHYHORSPHQW FR RSHUDWLRQHYHUUHIHUUHGWRE\VWDIILQWKH'HOHJDWLRQ" 9HU\ UDUHO\ 'R'HOHJDWLRQVWDIIIROORZWKHJXLGHOLQHVRQJHQGHUDVLQGLFDWHG LQ WKH 3&0 PDQXDO WKH (& JXLGHOLQHV RQ HYDOXDWLRQ RU VHFWRUDO JXLGHOLQHV" 9HU\ UDUHO\ 'R 'HOHJDWLRQ VWDII PDNH XVH RI DQ\ VXSSRUW IURP %UXVVHOV HJ FRQWDFWWKH*HQGHU+HOS'HVNXVHWKH*HQGHU:HEVLWHRUUHTXHVW LQIRUPDWLRQRQJHQGHUIURP%UXVVHOVVWDII" 9HU\ UDUHO\ 4 ,I\HV 1R 6RPHWLPHV 5HJXODUO\ 6RPHWLPHV 5HJXODUO\ 6RPHWLPHV 5HJXODUO\ <HV ,VDPHPEHURIVWDIILQWKH'HOHJDWLRQUHVSRQVLEOHIRUJHQGHULVVXHV" :KDWLVWKLVSHUVRQ VSRVLWLRQLQWKH'HOHJDWLRQ" :KDW LVKLVKHU VWDWXVDQG JUDGH" (& FLYLO VHUYDQW JUDGH $ RU % \RXQJH[SHUWHWF )HPDOH0DOH :KDWSHUFHQWDJHRIKLVKHUWLPHLVVSHQWRQJHQGHULVVXHV" 'RHVKHKHUKDYH7HUPVRI5HIHUHQFHRUDMREGHVFULSWLRQIRUWKH ZRUNRQJHQGHU" <HV1R +DVKHVKHUHFHLYHGDQ\WUDLQLQJIRUWKHZRUNRQJHQGHU" <HV1R 1R Annex 6 – Questionnaire to EC Delegations on Integration of Gender in EC Development Co-operation 4 Page 81 <HV 1R <HV 1R +DVWKH'HOHJDWLRQWDNHQDQ\PHDVXUHVWRLPSURYHWKHFDSDFLW\DQGDELOLW\RIVWDIIWR DGGUHVV JHQGHU LVVXHV RU WR HQVXUH WKDW JHQGHU LVVXHV DUH DGGUHVVHG LQ (& VXSSRUWHGLQWHUYHQWLRQV" ,I\HV +DVDQ\WUDLQLQJEHHQRUJDQLVHGIRU'HOHJDWLRQVWDIIDQGRUFRXQWU\SDUWQHUVRQJHQGHU" 'RHVWKH'HOHJDWLRQKDYHJRRGGRFXPHQWDU\PDWHULDORQJHQGHULVVXHVLQWKHFRXQWU\ DQGUHODWLQJWRIRFDOVHFWRUVRIFRRSHUDWLRQ" +DYHWKHUHEHHQDQ\UHYLHZVRIWKHLQWHJUDWLRQRIJHQGHULQFRXQWU\SURJUDPPHV" +DYH DQ\ VSHFLILF JXLGHOLQHV RU LQVWUXPHQWV EHHQ GHYHORSHG WR DVVLVW LQ LQWHJUDWLQJ JHQGHULQWRFRXQWU\SURJUDPPHV" 'RHV WKH 'HOHJDWLRQ KDYH D URXWLQH SURFHGXUH IRU DVVHVVLQJ ZKHWKHU SURMHFWV QHHG WR KDYHDJHQGHUDQDO\VLVXQGHUWDNHQ" ,I RWKHU PHDVXUHV KDYH EHHQ SXW LQ SODFH WR DVVLVWLQLQWHJUDWLQJJHQGHULQWRSURJUDPPHVDQG SURMHFWV SOHDVH GHVFULEH EULHIO\ WKH W\SH RI PHDVXUHWDNHQ 4 'XULQJWKHSURFHVVRIIRUPXODWLQJWKHFXUUHQW&RXQWU\6WUDWHJ\3DSHU :HUHDQ\DVVHVVPHQWVRUDQDO\VHVRIJHQGHULVVXHVLQWKHFRXQWU\RULQIRFDOVHFWRUV FDUULHGRXW" :DVWKHUHDQ\GLDORJXHZLWKOLQHPLQLVWULHVRQJHQGHULQNH\VHFWRUV" :DVWKHUHDQ\FRQVXOWDWLRQZLWKQDWLRQDOJHQGHUERGLHV" ,IWKHUHZDVFRQVXOWDWLRQZLWKJHQGHUERGLHVZKLFKRUJDQLVDWLRQVZHUHLQYROYHG • *RYHUQPHQWHJ0LQLVWU\RI*HQGHURU:RPHQ¶V$IIDLUV • 1*2VVSHFLDOLVLQJLQZRPHQ¶VRUJHQGHULVVXHV • 2WKHUHJUHVHDUFKLQVWLWXWHRUJHQGHUQHWZRUN±3OHDVHVSHFLI\ ««««««««««««««««««««««««««««« 4 ,I\HV <HV ,VWKH'HOHJDWLRQLQYROYHGLQDQ\FRRUGLQDWLRQIRUXPZLWKRWKHUGRQRUVLQWKHFRXQWU\RQ JHQGHULVVXHV" ,VWKHLQYROYHPHQWRIWKH(& 5HJXODU :KLFKGRQRURURUJDQLVDWLRQWDNHVWKHOHDG" 2FFDVLRQDO 1R Annex 6 – Questionnaire to EC Delegations on Integration of Gender in EC Development Co-operation 4D +DYH DQ\ DFWLRQV RU SURJUDPPHV VXSSRUWHG E\ WKH (& LQ WKH FRXQWU\ PDGH D FOHDU FRQWULEXWLRQWRUHGXFHJHQGHULQHTXDOLWLHVRULPSURYHWKHVLWXDWLRQRIZRPHQ" Page 82 <HV ,I\HV 1RW NQRZQ 3OHDVHOLVWWKHDFWLRQVRUSURJUDPPHVWKDWKDYHKDGSRVLWLYHHIIHFWVRQUHGXFHGJHQGHULQHTXDOLWLHVRURQ WKHVSHFLILFVLWXDWLRQRIZRPHQQRWHWKDWWKHVHPD\EHDFWLRQVWDUJHWHGVSHFLILFDOO\DWZRPHQRUDWJHQGHU HTXDOLW\LVVXHVRUWKH\PD\EHPDLQVWUHDPSURJUDPPHVRULQVWUXPHQWV 3OHDVHLQGLFDWHWKHIROORZLQJLQIRUPDWLRQ 1DPHRUWLWOHRIWKH LQWHUYHQWLRQ 4E 0DLQVHFWRUFRQFHUQHG 7\SHRI(&ILQDQFLDO VXSSRUW 3RVLWLYHHIIHFWVRIWKH LQWHUYHQWLRQ ,IDSRVLWLYHHIIHFWVRI(&LQWHUYHQWLRQVRQJHQGHUHTXDOLW\FDQEHLGHQWLILHGZKDWRYHUDOOKDYHEHHQWKH PDLQFKDQJHV" • • ,QFUHDVHGLQYROYHPHQWRIPHQLQDGGUHVVLQJJHQGHULVVXHV ,PSURYHGZRPHQ¶VULJKWV 1RQH 6RPH 6LJQLILFDQW 1RQH 6RPH 6LJQLILFDQW 1RQH 6RPH 6LJQLILFDQW 1RQH 6RPH 6LJQLILFDQW ,I ZRPHQµV ULJKWV KDYH LPSURYHG DV D UHVXOW RI (& LQWHUYHQWLRQV ZKLFKULJKWVDUHFRQFHUQHGHJOHJDOULJKWVSROLWLFDOULJKWVULJKWV WRHGXFDWLRQRUHPSOR\PHQWRWKHU" • • ,QFUHDVHGSDUWLFLSDWLRQRIZRPHQLQGHFLVLRQPDNLQJ ,PSURYHG HTXDOLW\ EHWZHHQ ZRPHQ DQG PHQ LQ DFFHVV WR UHVRXUFHVDQGVHUYLFHV ,IWKHUHKDVEHHQLPSURYHGDFFHVVWRUHVRXUFHVDQGVHUYLFHVZKDW W\SHV RI VHUYLFHV DQG UHVRXUFHV DUH SDUWLFXODUO\ FRQFHUQHG HJ HPSOR\PHQWLQFRPHHGXFDWLRQKHDOWKDJULFXOWXUDOWUDQVSRUW" • 2WKHUFRQWULEXWLRQVSOHDVHVSHFLI\ Annex 6 – Questionnaire to EC Delegations on Integration of Gender in EC Development Co-operation 4 Page 83 +DYHWKHUHEHHQDQ\QHJDWLYHHIIHFWVRI(&LQWHUYHQWLRQVRQWKHVLWXDWLRQRIZRPHQRURQ 1RW JHQGHUHTXDOLW\RUDQ\IDLOXUHVWRDGGUHVVJHQGHU" NQRZQ <HV ,I\HV :KDWQHJDWLYHHIIHFWVRUIDLOXUHVKDYHRFFXUUHGDQGFRQFHUQLQJZKLFKLQWHUYHQWLRQV":KDWKDYHEHHQWKH PDLQUHDVRQVIRUWKHVHHIIHFWVRUIDLOXUHV" 3OHDVHLQGLFDWHWKHIROORZLQJLQIRUPDWLRQ 1HJDWLYHHIIHFWRU IDLOXUH 4 1DPHRUWLWOHRIWKH LQWHUYHQWLRQ 0DLQVHFWRUFRQFHUQHG 0DLQUHDVRQIRUHIIHFW RUIDLOXUHLINQRZQ :KDWGR\RXFRQVLGHUWREHWKHPDLQREVWDFOHVWRWDNLQJJHQGHULVVXHVLQWRDFFRXQWLQ(&GHYHORSPHQW FRRSHUDWLRQ"LQGLFDWHWKHIROORZLQJLQRUGHURILPSRUWDQFHZLWKWKHPRVWLPSRUWDQWREVWDFOHDQGWKHOHDVW LPSRUWDQWREVWDFOH ,QVXIILFLHQWLQWHUHVWDQGFRPPLWPHQWZLWKLQWKH'HOHJDWLRQ 8QFOHDUSURFHGXUHVDQGWRROV ,QDGHTXDWHNQRZOHGJHDQGNQRZKRZLQWKH'HOHJDWLRQ :HDN QDWLRQDO FRQWH[W HJ ZHDN SROLF\ DQG LQVWLWXWLRQDOIUDPHZRUN ,QVXIILFLHQWLQIRUPDWLRQDQGGDWD ,QVXIILFLHQW FDSDFLW\ LQ 'HOHJDWLRQ WR DGGUHVV WKH LVVXH HJVWDIIWLPH :HDNVXSSRUWE\RWKHUGRQRUV 2WKHUSOHDVHVSHFLI\ ««««««««««««««« ,QVXIILFLHQWVXSSRUWDQGJXLGDQFHIURP%UXVVHOV ,I\RXKDYHRWKHUUHPDUNVWRPDNHRULI\RXFDQVXJJHVWUHOHYDQWGRFXPHQWDWLRQIRUWKHHYDOXDWLRQHJUHSRUWVRI QDWLRQDOLQLWLDWLYHVRQJHQGHULQ(&GHYHORSPHQWFRRSHUDWLRQSOHDVHLQGLFDWHWKHVHEHORZ 7KDQN\RXIRUWKHWLPHWKDW\RXKDYHVSHQWRQUHVSRQGLQJWRWKLVTXHVWLRQQDLUH<RXUFRQWULEXWLRQWRWKHHYDOXDWLRQ LVPXFKDSSUHFLDWHG Annex 6 – Questionnaire to EC Delegations on Integration of Gender in EC Development Co-operation Page 84