catalog
Transcription
catalog
2012 catalo g Table of ConTenTs Holsters 6 Duty Belts & Duty Gear 24 Tactical 38 Bags & Gun Cases 46 Accessories 52 Gun Care 64 Optics 78 TO THOSE WHO PROuD TO SuPPORT OuR NATION’S FINEST WITH AmERIcAN-mADE gEAR. It’s a humbling thought. At this very moment, one of your own is putting his or her life on the line to protect those who cannot protect themselves. Knowing this is what drives us every single day to serve those who so selflessly defend our American way of life. Since 1990, every piece of equipment we’ve produced has been rigorously developed and field-tested to ensure your absolute safety and performance in the line of duty. Now more than ever this promise comes American-made. Since April 2011, all of our nylon duty gear has been produced in the U.S. And by the end of 2012, we’re proud to say every piece of duty gear and duty holsters will be as well. Nothing you see in these pages will ever substitute for the training and confidence you bring to the job. So to every man and woman who wears a badge, thank you for serving us. We are forever humbled to serve you. Products proudly made in the USA in this catalog are indicated by this logo. HOLSTERS SERVE , WE WILL ALWAYS DEFEND. GROSS MOTOR SKILLS... aCtion Without thought. Mission stateMent Uncle Mike’s Law® Enforcement delivers high-quality, affordable equipment to the brave, dedicated men and women in uniform because their lives depend on it. our CoMMitMent to You This is our S.O.P. “Gear must promote officer safety first, ease of operation and enhance officer performance.” If our product fails within the first five years outside of normal wear and tear, we’ll replace it at no charge. Fight For LiFe PoLiCY If our gear becomes damaged, unserviceable or destroyed in the defense of your life, call us at 800.423.3537. Tell us about your experience and we’ll replace the damaged equipment at no charge. DavE bELiEvES in UncLE MikE’S® EqUipMEnT. “I have been a police trainer since 1985 and have seen all kinds of gear. We require each student to wear their assigned duty gear. When their gear breaks or becomes damaged, I give them Uncle Mike’s to replace it. Uncle Mike’s gear has shown to be the most dependable, reliable and trustworthy gear. I find Uncle Mike’s gear to be simple to use, easy to clean and dependable when you need it the most – when you’re fighting for your life. That is priceless!” – Dave Young, Director & Founder of ARMA Training. Dave Young is the Director and Founder of ARMA Training and has almost 30 years of combined civilian and military law enforcement experience. He has served as a sworn corrections and law enforcement officer, a gate sentry, patrol officer, watch commander, investigator, Special Reaction Team (SRT) member and a commander in the United States Marine Corps. Dave has trained both military and law enforcement personnel in crowd management operations and is one of the nation’s leading defensive tactics instructors. Dave developed the Survival Management Aggressive Response Training (SMART ™) for public safety. He is chairman of the Policeone.com Advisory Board, a member of the Police Magazine Advisory Board and a Technical Advisory Board member for Force Science Research Center. Dave has been a spokesperson and consultant for CNN and Fox World News on officer survival. He also hosted, wrote and performed all of his own stunts for a miniseries on the National Geographic channel called Crash Test Human. TakE THE UncLE MikE’S Law EnfORcEMEnT cHaLLEngE From holsters you can rely on to gear designed for comfort and endurance, Uncle Mike’s Law Enforcement has got you covered. Contact us or your area law enforcement representative and take the Uncle Mike’s Law Enforcement Holster Challenge today. HOLSTERS DavE’S biOgRapHy “When your life depends on it the most... Uncle Mike’s is there.” HAVE WARRANT. WILL ENTER. pRO-3® dUTy HOLSTERS Uncle Mike’s® Law Enforcement Holster Challenge Our holsters are made to work under real-world stress. Research shows that fine motor skills diminish in stressful conditions — even with repetitive training. That’s why we invite you to take the challenge. If you’re not using one of our duty holsters, test your current holster by using our action/react ball and other drills demonstrated on our website and from our holster resource kits. But for now, draw quickly and efficiently from all 12 positions outlined below. If you can’t draw your weapon in all 12 positions, we encourage you to step up to Uncle Mike’s. SUppORT Hand Standing Kneeling Sitting Ground Defense Ground Guard Prone HOLSTERS STROng Hand Standing Kneeling Sitting Ground Defense Ground Guard Prone For more drills and tips, visit our website at www.unclemikesle.com and click on the link for videos. Fight for Life Seminars We’re excited to offer regional training seminars across the country. With the expertise of Dave Young, Founder and Director of ARMA Training, the two-day seminars focus on selecting the right gear and using it effectively. And there’s no fee. Contact your area Uncle Mike’s representative or visit www.armatraining.com to find a seminar near you. uncle mike’s holsters Pro-3® holSter the picture of performance Heated to an extreme temperature of 500° F, this Pro-3 holster still functioned and engaged the trigger guard. That is performance like no other. Demand the best, demand Uncle Mike’s Law Enforcement. See this and other tests captured on video at our website, www.unclemikesle.com. Go to: www.uncleMike’sle.com PRO-3® Duty HOlSteRS Supreme Security without Sacrificing officerS’ Safety. The Pro-3 Duty Holster’s patented three-point locking system keeps your firearm both secure and ready. Just release the thumb break for a swift, easy draw. And thanks to its ergonomic design, you’ll carry your gun with ease and comfort. DecOnStRucting our patented pro-3 holSter 2 3 1 Molded thumb break. 1 2 Non-stretch retention strap works with molded thumb break to stay open for easy, one-handed reholstering. 3 Patented laminated construction – either MIRAGE® or Kodra® nylon exterior, foam core and smooth nylon lining. 4 Patented internal locking device* trigger–guard locking system. 5 Positive trigger–guard stop positions gun the same way every time. 4 5 6 Adjustable tensioning device. slimLine Pro-3 Holster™ 7 Holster suspended within patented Kydex® exoskeleton for support, strength and rigidi ty. 8 Patented, molded sight track protects front sight and reduces holster wear. *U.S. Patent no. 6,547,111 B2 PRO-3 Slimline Duty HOlSteRS size kodra mirage mirage nylon PlAIn bAsketweAve Fit inFormation 18 r L 35181 35182 –– –– –– –– 20 r L 35201 35202 35203 35204 35205 35206 Beretta 9mm, .40, Smith & Wesson 10mm, .45 (5” barrels except w/hook-type or extended trigger guards) 21 r L 35211 35212 35213 35214 35215 35216 Glock 17, 19, 22, 23, 31, Ruger SR9, SR40 22 r L 35221 35222 35223 35224 35225 35226 SIGARMS 9mm, .38S, .40, .45 23 r L 35231 35232 35233 –– –– 25 r L 35251 35252 35253 35254 35255 35256 Glock 20, 21, 29 , 30, 36 Smith & Wesson M&P, Slimline only 30 r L 35301 35302 35303 35304 35305 35306 HK USP 9mm, .40, .45, USP Compact, Walther P99 Smith & Wesson 9mm, .40, Sub-Compact .45 (3 1⁄ 2”-4” barrels), Beretta Centurion Ruger P85, P89, P90, P91, P93, P94, P95, KP90, KP93, KP94 –– PRO-3® DuTy HOLSTERS PRO-3® Original to SlimLine™ Conversion Chart SLiMLinE™ size ORiginaL DiSCOnTinuED kodra® MiraGe® MiraGe kodra MiraGe MiraGe nylon PlAIn bAsketweAve nylon PlAIn bAsketweAve Fit inForMation 18 r L 35181 35183 35185 95181 65181 65184 35182 35184 35186 95182 65182 65185 20 r L 35201 35203 35205 95201 65201 65204 35202 35204 35206 95202 65202 65205 Beretta 9mm, .40, Smith & Wesson 10mm, .45 (5” barrels except w/hook-type or extended trigger guards) 21 r L 35211 35213 35215 95211 65211 65214 Glock 17, 19, 22, 23, 31, Ruger SR9, SR40 35212 35214 35216 95212 65212 65215 22 r L 35221 35223 35225 95221 65221 65224 35222 35224 35226 95222 65222 65225 23 r L 35231 35233 35235 95231 65231 65234 35232 35234 35236 95232 65232 65235 25 r L 35251 35253 35255 95251 65251 65254 Glock 20, 21, 29, 30, 36 35252 35254 35256 95252 65252 65255 Smith & Wesson M&P, Slimline only 28 r L —— —— —— 95281 —— —— —— —— —— 95282 —— —— 29 r L —— —— —— 95291 —— —— —— —— —— 95292 —— —— 30 r L 35301 35303 35305 95301 65301 65304 HK USP 9mm, .40, .45, USP Compact, 35302 35304 35306 95302 65302 65305 Walther P99 34 r L 35341 35343 35345 —— —— —— 35342 35344 35346 —— —— —— Smith & Wesson 9mm, .40, Sub-Compact .45 (31⁄2”-4” barrels), Beretta Centurion Kodra Nylon SIGARMS 9mm, .38S, .40, .45 Ruger P85, P89, P90, P91, P93, P94, P95, KP90, KP93, KP94 Mirage Basketweave Smith & Wesson SIGMA 9mm, .40 Mirage Plain Smith & Wesson SW99 Beretta PX4 Storm If you used to order the original size PRO-3, you will now need to order from the SlimLine category. These have replaced the original sizes. Our Mirage nylon looks and feels like leather, but outperforms it in 6 ways. 1. Appearance – A Mirage duty rig starts out looking like leather and continues to look sharp despite wear, dirt, moisture and rough usage. 2. Weight – Your lower back will thank you because Mirage products are constructed of Nytek nylon, making them significantly lighter than leather or other synthetic rigs. 3. Durability – Mirage is incredibly strong and abrasionresistant, developed from microfibers that are 1,000 times finer than silk. It needs virtually no maintenance. 4. Comfort – More pliable than leather, Mirage flexes to your body’s contours for better fit and feel. 5. Cleaning – A damp cloth is all it takes. And spilled blood won’t seep into the pores of the Mirage material, so there’s no threat of pathogens remaining behind. It’s easy to decontaminate with bleach water. 6. Odor – Mirage doesn’t absorb body odor, perfume or other odors. Nor will it rot, mildew or wear away your gun’s bluing. Our pioneering use of multi-layer laminates and Kodra nylon assures benefits you just can’t get from nylon alone. 1. Appearance – The bonded foam creates clean lines and long-lasting good looks, while the Kodra exterior provides a professional, non-reflective surface. 2. Performance – Your duty items are properly supported and immediately removable – even under stress. 3. Durability – All materials used in our line resist abrasion and protect your sidearm, radio, cuffs and chemical canisters from harm. 4. Weight – Your rig weighs less, so it’s less tiring for you to wear. 5. Comfort – Soft flaps, flexible bound edges and backwalls won’t poke or cut into you. 6. Cleaning – A damp cloth will work for most stains, while a soft nylon brush and water lifts out stubborn stains. To disinfect, clean with 1 part bleach to 10 parts 160º water. 7. Decontaminates – Because chemicals (OC, CS, CN) lay on on the surface, our special laminates keep them there, making it easier using non-oil based soap and clean water. HOLSTERS h Finish Options Pro-2® Duty Holsters The perfecT balance beTween drawing quickly and holding fasT. Our Pro-2 Dual-Retention Holster allows you to draw your weapon with a quick, simple drawstroke. Until then, the firearm is held fast by a non-stretch retention strap (thumb break) and an outboard tensioning device. Plus, an internal detent engages the trigger guard. PRO-2 DUAL-RETENTION HOLSTERS MIRAGE BASKETWEAVE Pro-2 reteNtIoN Holsters - JACKet slot SIzE KodRA® MIRAGE® MIRAGE nylon PlAIn bAsketweAve 18 R L 43181 43183 43185 43182 43184 43186 20 R L 43201 43203 43205 43202 43204 43206 21 R L 43211 43213 43215 43212 43214 43216 22 R L 43221 43223 43225 43222 43224 43226 25 R L 43251 43253 43255 43252 43254 43256 A simple drawstroke is all it takes to produce your weapon. Until it’s called to action, the firearm is held fast by a non-stretch thumb break and a traditional outboard tensioning device. Internal detent engages the trigger guard. FIT InFoRMATIon Smith & Wesson 9mm, .40, Sub-Compact .45, (31 ⁄ 2"-4" barrels), Beretta Centurion Beretta 92, 96 all variations Glock 17, 19, 22, 23, 31, 32, 36, Ruger SR9, SR40 SIGARMS P220, P226, P228, P229, P245, 229 DAK Glock 20, 21, 29, 30, 36 Smith & Wesson M&P HIGH RIDE BELT LOOP ACCESSORY Removable Rotating Belt Loop • Providestheofficertheabilitytomaintainfirearmsafetywhen entering a facility where officers have to remove their firearm from their duty belt. • Easytoremoveandresecure. #98901 Convert your duty holster into a high ride holster. •Conversiontoolsincluded. •WorkswithMiragePlain,Basketweave or Kodra finishes. #96990 STandaRd RETEnTiOn HOLSTERS Standard retention HolSterS Uncle Mike’s® engineered these Dual-Retention Holsters to fit the spectrum of law enforcement pistols, revolvers and use scenarios. A non-stretch retention strap takes the point. It’s backed up by an independent tensioning device that adjusts to apply varying degrees of clamping pressure. STANDARD RETENTION HOLSTERS STandaRd RETEnTiOn HOLSTERS – JackET SLOT size kodra® Fit inFormation nylon r L 98521 98522 Certain 4" barrel med. & intermediate double action revolvers such as Colt, Ruger, S&W, Taurus, Dan Wesson 18 r L 98181 98182 Smith & Wesson 9mm, .40, Sub-Compact .45, (31 ⁄ 2"-4" barrels) 19 r L 98191 98192 Colt Gov’t 9mm, .38S, .40, 10mm, .45 20 r L 98201 98202 Beretta 9mm, .40, Smith & Wesson 10mm, .45 (5" barrels), Taurus 9mm, .40 21 r L 98211 98212 Glock 17, 19, 22, 23, 31, 32, 36 Smith & Wesson M&P 22 r L 98221 98222 SIGARMS 9mm, .38S, .40, .45, 229 DA 23 r L 98231 98232 Ruger P85, P89, P90, P91, P93, P94, P95, P97 25 r L 98251 98252 Glock 20, 21, 29, 30 Springfield XD 30 r L 98301 98302 HK USP 9mm, .40, .45, USP Compact FYI - JACKET SLOT BELT LOOP Offsets holsters outside an Ike or Tuffy jacket. Fixed angle for the Pro-3 ®. Adjustable angle for the Pro-2® and Standard Dual retention models: Vertical, muzzle forward or butt forward. Finish Options Kodra Nylon Mirage® Basketweave Mirage Plain HOLSTERS Dual-retention holsters that fit the spectrum of law enforcement sidearms and duty scenarios. A non-stretch retention strap is backed by an adjustable independent tensioning device. 2 REFLEX HoLstERs NOTHING IS AS SWIFT AND NATURAL AS A REFLEX Features/benefits • I.R.T. – Integrated Retention Technology. • Pancake style belt loop up to 13/4". • Injection-molded, impact-modified polymer construction. • Paddle attachment included. • Patented design, US Patent 5,419,474 & 6,547,111. • Made in the USA. • Right hand only. REFLEX HoLstERs ITEM NO. DEscrIpTION 74211 Glock 17, 19, 21, 22, 23, 26, 27, 31, 32, 33, 34, 35 74221 Sig Sauer P220, P220R, P226, P226R 74271 Springfield XD, XDm (all models) 74111 Commander Style 1911’s like Kimber, Sig Sauer and Springfield 74091 Smith & Wesson M&P (all models), SD9, SD40 74141 Ruger SR9, SR9c, SR40, SR40c 74201 Beretta 92, 96 UCC WAISTbAND ACCESSORy Covert Belt Clip— Secures over the pant waistband and under the outer belt for a lower profile. KydEx® RETEnTiOn HOLSTERS Designed for carry, it’s comfortable against the hip and is vented to minimize perspiration. And it’s adjustable for rake and height so you can tailor the holster position to your torso height and body type. • Easierdrawbecausethebody’sleadedgeiscutdown. • Anexcellentchoiceforbothmenandwomen. • Paddleandbeltloopaccessoriesincluded. KydEx COnCEaLmEnT HOLSTERS size iTeM NO. right/ Left FiT iNFOrMaTiON Thumb Break Paddle/ Belt Loop Paddle/ Belt Loop r L 54121 56121 54122 –– r L 54151 –– –– RugerP85,P89,P90,P91 r L 54161 –– –– RugerP93,P94,P95,P97 r L 54171 –– –– Smith&WessonM&P r L 54181 –– –– S&W5900&certain4000series 19 r L 54191 Upto5”bbl1911Types 54192 –– –– 20 r L 54201 56201 54202 56202 r L 54211 56211 54212 56212 22 r L 54221 –– –– SIGARMS220,226 23 r L 54231 –– –– SIGARMSPRO2340 r L 54241 –– –– SIGARMS225,245,228,229 54242 r L 54251 –– Glock21,20,29,30,36 54252 –– r L 54261 –– 54262 –– r L 54271 –– 54272 –– r L 54291 56291 –– –– 30 r L 54301 –– 54302 –– 31 r L 54311 –– HKP2000,HKUSPCompact 54312 –– (AllCalibers) 36 r L 54361 –– 54362 –– S&WJFrame38/357upto 21/8” barrel, Ruger LCR and S&W Body guard 12 15 16 17 18 21 24 25 26 27 29 –– –– 54172 54182 54222 54232 Glock 26, 27, 33 MostBeretta92&96Models (notfor96G) Glock17,22,19,23 Kydex Thumb Break Paddle Holster HOLSTERS Open Top Paddleletsyouadjustholster height to fit body contours for best concealment. Kydex Open Top Paddle Holster High Springfield XD - Full Size Springfield XD - Compact WaltherP99/SW99FullSize & Compact HKUSPFullSize Low Hi-Lo Adjustment— Paddle lets you adjust holster height to fit body contours for best concealment. Enhancedpaddledesignholds even better. Constructed from asoft,semi-flexiblematerial, it stays more firmly against the interior of your pants and beltwithoutcompromising comfort.Newwedgesprovide additional resistance to solidify hold. pancake Style/Belt Slide HolSterS Super Belt Slide Holsters Super Belt Slide HolSterS Aflattenedprofilemakesthemeasy toconceal.Amediumhigh-ride design positions your firearm for a smooth draw. 3-slot design on all configurations (except PRO-3®) allows for crossdraw, dual position or strong-side carry. • Extra-thinlaminatehasminimal thickness and conforms to body contours for comfort and concealment. • Thumbbreakandretentionstrap protectedbyStrapTraps™to prevent detaching and chafing. • Adjustmenttoolincluded. Side Bet™ and Baby Bet™ Belt Slide Holsters KODRA® MIRAGE® 0 86000 –– 2 - 3” barrel sml/med double action revolvers except 2” 5-shot 1 2 86010 –– 3 - 4” barrel medium autos 86020 –– 4” barrel medium and intermediate double action revolvers 5 12 86050 –– 4 86120 –– Glock 26, 27, 33 and other Sub-Compact 9mm /.40 cal autos 15 16 86150 63150 86160 63160 19 86190 –– Colt Gov’t large autos, Browning Hi-Power 30 86300 –– HK USP 9mm, .40, .45, USP Compact 36 86360 –– 2” barrel small frame 5-shot revolvers with hammer spur 40 –– 63401 R/L Kodra nylon has a woven rugged appearance. It’s abrasion-resistant and water-resistant. Now there’s an option for carrying very small revolvers and autos. Our Side Bet and Baby Bet carry the firearm at a butt-forward angle, ideal for strong-side concealment. • Ambidextrousdesign.Justreverse thumb break and retention strap to change from right to left. • Nylonwebbeltloopsonbothsidesfit belts up to 11/2” wide. • SideBetfitsmostautosandrevolvers. • BabyBetfits.22and.25autosandvery small frame .380s. Baby Bet Side Bet SIZE Nylon FIT INFORMATION Plain 3 1 /2 3 /4 1 /4 - 5” barrel large autos -4 1 /2” barrel large autos 3 /4” 3 -3 barrel medium & large autos 2” 5-shot hidden hammer revolvers (right hand only) #86901 #86900 Baby Bet for baby autos. HiddenHammer™ Super Belt Slide Holster Finally a holster for firearms that have a concealed, shrouded or spurless hammer. • Holds2-inch,5-shotrevolversusinganinternal retention mechanism. • Internal locking device fits into revolver trigger guard.Aseparate,sewn-downretentionstrapfits positively over firearm frame. Size 40 #63401 PADDLE HOLSTERS Uncle Mike’s® Paddle Holsters • Paddleadjustsforvertical,butt-forwardor muzzle-forward(crossdraw)carry. • Moldedoffsetspaceradjustsholsterheight forvariousbodytypes,torsolengths,gunbutt configurationsandmodesofdress. • Paddleconformstohipforcomfortandhidability. • Offsetspacerandverticaladjustabilitymakethisa greatholsterforwomen. • ThinKodra®laminatereducesbulk. • Holstercompletelyenclosestriggerguardand featuresanon-stretchretentionstrapandmolded thumbbreak. • Offsetspacerkeepsgunoffofhipstructureand paralleltocenterlineofbody. HOLSTERS PADDLE HOLSTERS SIZE RIght Only ItEM nO. FIt InFORMAtIOn 0 78001 2-3”barrelsml/meddoubleaction revolversexcept2”5-shot 1 2 78011 3-4”barrelmediumautos 78021 4”barrelmediumandintermediate doubleactionrevolvers 5 15 16 78051 41/2-5”barrellargeautos 78151 33 /4-41/2”barrellargeautos holsters,benefitfromourStrap 78161 31/4-33 /4”barrelmedium&large autos Traptechnology,whichkeeps thumbbreaksandstrapsfrom 19 78191 ColtGov’tlargeautos,Browning Hi-Power 21 36 78211 Glock17,19,20,21,22,23,29,30 strippingaway.Assuresyour adjustmentwillstayandprevents chafing.AllholsterswithStrap 78361 2”barrelsmallframe5-shot revolverswithhammerspur Trapincludeatoolforquick andeasyadjustment. adjustability and staying power ManyUncleMike’snylonholsters, includingPro-Pak®andpaddle specialized concealed holsters the sidekick® ambidextrous hip holster hip holsters • Twoholstersinone–Wearasabeltholster(fits beltsupto21/2”wide)oraninside-pantholster byreversingthebeltclip. • Secure–Non-stretchHook&Loopretention strapandmoldedthumbbreakkeepyour firearmsecure.Holsterincludesa StrapTrap™adjustmenttool. • Durable–MadefromourpatentedSidekick laminateofKodra®nylon.Padded,waterproof interiorholdsfirearmsnugly.Springsteelbelt clipispowdercoatedforrustandcorrosion resistance. SIZE ITEM NO. 1 2 MO70010 3-4”barrelmediumautos MO70020 3-4”barrelmediumandlarge doubleactionrevolvers 5 15 16 MO70050 4 1/2”-5”barrellargeautos R/L For well-armed ankles. UncleMike’s®ankleholstersaresuperdiscreetand amazinglycomfortable. • Kodranylonholsterconcealssmallandmedium firearmsandsomecompactlargeframeautosinside pantleg. • Softknitfabriciscomfortableenoughtobeworn rightagainstskin. • Closedcellfoamactsasamoisturebarrierand paddingforcomfort. • Nylonwebretentionstrapwithreinforced thumbbreak. • Cinch-downdesignwithHook&Loopadjustment. FIT INFORMATION 70150 3 3/4”-43/4”barrellargeautos 70160 3 3/4”-3 3/4”barrelmediumand largeautos 36 70360 Upto23/4”smallframe5-and 6-shotrevolverswithhammerspur 45 MO70450 FitsTaurusjudge3” Removable and reversible belt clip. Open view there’s no deeper concealment than our Body armor holster. Hook & Look adjustable, removable calf strap. • Holstercanbewornambidextrously. • Hook&Loopcoveredbeltloopaccommodates bodyarmorsideadjustmentstraps. • Suede-likeexterioriscomfortableenoughto bewornagainsttheskin. Side view of the ankle holster. ankle holsters SIZE Body armor holsters Shown with reversible Hook & Loop overstrap. ITEM NO. FIT INFORMATION 0 R L 88201 88202 2”barrelsmallframe5-shot revolversw/hammerspur 1 R L 88211 88212 3-4”barrelmediumautos (.32-.380cal.) Most.380s 10 R L 88101 88102 Smallautos(.22-.25cal.) 87453 2”5-shotrevolvers;Sigma.380 12 87454 Mostsub-compact9mm/.40 autos,upto33/4”barrels R L 88121 88122 Glock26,27,33&other sub-compact9mm/.40cal 16 R L 88161 88162 3 1/4-3 3/4”barrelmedium andlargeautos SIZE ITEM NO. 1 2 3 4 87451 Smallautos(.22-.25cal.) 87452 R/L R/L FIT INFORMATION SHOuLdER HOLSTERS uncle Mike’s® Pro-Pak® holsters ride close and discreet. PRO-Pak VERTiCaL SHOuLdER HOLSTERS SIZE ITEM NO. 1 2 75011 3-4”barrelmediumautos 75021 4”barrelmediumand intermediate double action revolvers 75051 41/2-5”barrellargeautos 75151 3 3/4-41/2”barrellargeautos Right Only Originally designed for professional detectives that need lightweight functionality and daylong comfort. Lays close to the body and flat under jackets. Made of rugged Kodra®, the smooth lining protects your gun’s finish while making it easier to draw and reholster. Most popular of the two Pro-Pak models. 5 15 FIT INFORMATION PRO-Pak HORizOnTaL SHOuLdER HOLSTERS Efficient weight distribution and a variety of comfort features. You’ll barely know you’re carrying. • Four-wayadjustment.Smoothnylon construction. • Waterprooffoampaddingrepels body moisture. • Addaccessories–uptotwo, vertical or horizontal. • Ambidextrous. • Removableonsidetiedowns. • StrapTraps™thumbbreakand retention strap. SIZE Right or Left ITEM FIT INFORMATION NO. 0 77000 2-3”barrelsml/med double actionrevolversexcept2”5-shot 1 77010 3-4”barrelmediumautos 77020 4”barrelmediumand intermediate double action revolvers 77050 41/2-5”barrellargeautos 77150 3 3/4-41/2”barrellargeautos 77160 3 1/4-33/4”barrelmedium& large autos 2 5 15 16 36 77360 2”barrelsmallframe5-shot revolvers with hammer spur CROSS-HaRnESS SHOuLdER HOLSTERS SIZE Right or Left ITEM FIT INFORMATION NO. 0 87000 2-3”barrelsm./med.dbl.action revolversexcept2”5-shot 1 87010 3-4”barrelmediumautos 87020 4”barrelmediumand intermediate double action revolvers 2 5 15 87050 41/2-5”barrellargeautos 87150 3 3/4-41/2”barrellargeautos 16 87160 3 1/4-33/4”barrelmediumand large autos 36 87360 2”barrelsmallframe5-shot revolvers with hammer spur HOLSTERS Cross Harness Horizontal Shoulder Holsters inside-the-pocket/pant holsters We consult with law enforcement agencies to continually refine our concealed carry offerings. Our goal is comfortable concealment and quick deployment. Suede-like exterior helps anchor holster inside pants or skirt. Go undetected with insidethe-pant holsters. • Unique,ultra-thin,four-layer laminate no thicker than suede leather holsters. • Internalmoisturebarrierwon’t transmit perspiration to firearm. • Smoothnylonliningforeasydraw. inside-the-pant holsters SIZE Right/Left Long-lasting polymer suede keeps holster steady when walking or running. Holsters are constructed with a unique four-layer laminate. Belt clip slips over pant top & belt to hold gun securely and anchor firearm for positive draw. ITEM NO . FIT INFORMATION Open Retention Style Strap 0 R L 89001 76001 89002 76002 1 R L 89011 76011 89012 76012 2 R L 89021 76021 89022 76022 4"barrelmediumand intermediate double actionrevolvers 5 R L 89051 76051 4½-5"barrellargeautos 89052 76052 10 R L 89101 76101 89102 76102 12 R L 89121 –– Glock26,27,33&other 89122 –– Sub-Compact9mm/.40cal 15 R L 89151 76151 89152 76152 16 R L 89161 76161 89162 76162 36 R L 89361 76361 89362 76362 RugerP85,P89,P90,P91 32-3"barrelsmall/ medium double action revolversexcept2"5-shot Smallautos(.22.25cal.) 3¾-4½"barrellarge autos 3¼-3¾"barrelmedium large autos 2”barrelsmallframe 5-shotrevolverswith hammer spur inside-the-pocket holsters keep clothes clean and firearms functional. • • • Laminatedconstructionlessensprint-throughrecognition, cushionsthewearer’slegfromsharpcontoursofthefire armandprovidesabarrieragainstperspiration. Open-topholsterprovidesgrip-uppositioningand preventsthemovementoflevers,buttonsorcatches. Non-slipmaterialbandsurroundsholsterbodyfor retention when firearm is drawn. Size 1 Size 2 Size 3 Size 4 inside-the-pocket holster SIZE R/L ITEM NO. 1 87441 Smallautos(.22-.25cal.) 2 3 4 87442 Most .380s 87443 2”5-shotrevolvers;Sigma.380 87444 Mostsub-compact9mm/.40autos FIT INFORMATION CONCEALMENT HOLSTERS Fanny Pack Updatedstylewithimprovedfunctionality.Agreatway toconcealyourfavoritesidearm. • Updatedmaterialswithimprovedlookandfeel. • All-newdesignprovidesfast,easyaccess. • Fitsmostpopularsidearms. #88751 GunRunner Fanny Pack Holsters ® Medium HOLSTERS Assures a quick, smooth draw and a simple one-handed return. • Generic-appearingfannypackhasthreezipperedcompartments. • Reholsterwithouttakingyoureyesoffsurroundings. • AHook&Loopbackpanelanda12”strapincludedtoposition andsecurefirearm. • Tough,11/2”wideadjustablenylonwebbeltwithquick-releasebuckle. • Largesizeis121/2”x7”.Fitslargerautosand4”barrelrevolvers. #88731 Hook & Loop belt loop on rear secures GunRunner to belt if desired. Gun Pak™ Belt Pouch Holsters Openthecentercompartmentwithoutexposingyourfirearmorusethehidden rearcompartmentforaquick,smoothdraw. • Fitsonanybeltupto21/4”wide. • Handy–Enoughroomtocarrysunglasses,awalletandID–inadditiontoa concealedfirearm. • Discreet–Attractsnomoreattentionthanaconventionalfannypack. • Originalsize:8”Wx53/4”Hx15/8”D.Carriesmostsmallandmediumframe pocketautos,compact9mms,andsmallframe2”to3”barrelrevolvers. #88891 CONCEALMENT HOLsTErs Universal Mag Cases • Kodra®nylonoutershell. • Backwallpaddedforcomfort; paddedflapknitliningandHook &Loopclosure. • Fitsmoststandard9mm, .40andsinglerow.45and 10mmmagazines. • Idealforcarryinglargefolding knives. • Beltloopfitsbeltsupto21/4"for verticalcarry;upto11/2"for horizontalcarry. Black All-Purpose Belt Pouch • Madeofdurable,water-resistant Kodranylon. • Singlecompartmentpouch. • 7"wide,43/4"high,11/2” deepexpandingto3”. Black #88381 Day-Timer Holster • Inconspicuous,zipperedcaselooks justlikeadayplanner. • Constructedoftough,durable ballisticnylon. • Internalholsterandmagpouch. • I.D.holder. #64002 #88321 PDA Holster Adiscreetcarrierthatlookslikeatypical PDA/cellphonecarrier. • Clipseasilytoyourbelt. • Softinteriorwon’tscratchyourpistol. • RugerLCP,KaHR,P380,Taurus738 TCP(sixshot),MagnumResearch ME350. #64003 TacTicaL HOLSTERS choose from three tactical drop-leg holsters. Our best-selling Pro-3® Holster. Internal locking device provides positive retention in any condition and the injection-molded thumb break and retention strap won’t stretch over time. Coupled with our molded tactical platform, it provides a durable drop-leg configuration for tactical operations. Our Dual-Retention Holster with its injectionmolded thumb break and retention strap with a tensioning screw, allows for a quick and easy draw. Our Universal Holsters were designed by leading tactical operators in the field. Configures to fit most handguns with or without a light. And its versatile MOLLE system provides multiple options for carry. Molded Single/Double Strap Tactical Platform • • • • Ultra-stabletacticalholsterplatform. Allowsconversionofdutyholstertotacticalholster. MOLLEcompatible. Rubberinlaidwebbingonthelegstraps. Universal Holster with MOLLE System • Quicklychangesbetweenlightbearingand non-light bearing pistols. • Convertseasilyfromright-handtoleft-handcarry. • WorkswithversatileMOLLEsystemforplacement anywhere on the body. • Canbemountedonany13/4” and 2” duty style belt. • Fitsmostmediumandlargeautopistols. • WorkswithSureFire®andStreamlight® weapon-mounted lights. • Mountsonvestordrop-legplatform. • TraditionalthumbbreakwithsecondaryITW- Ghillietex™ buckle strap for added retention. Black OD Green #7702001 #7702002 Modular Drop-Leg Platform • • • • • • Flexibleandstableplatform. Aperfectchoiceforstrongoroffsidecarry. MOLLEcompatibilitycreatestotalflexibility. Internalpocketcanholdarmororotheritems. Fullyadjustable. Legstraphasloosewebbingendsthatcanbe concealed, creating a clean, low-drag surface. • Paddedbandiscomfortabletowearandadjusts to any size. Black OD Green #7702520 #7702521 TacTicaL HOLSTERS Dual PRO-3 R L 99181 99182 –– –– R L 99201 99202 69201 69202 21 R L 99211 99212 69211 69212 Glock17,19, 22, 23 22 R L 99221 99222 69221 69222 SigSauer9mm, .38S,.40,.45 SIZE Right/Left 18 20 FIT INFORMATION Smith&Wesson 9mm, .40, Sub-Compact.45 (3½–4” barrels Beretta 9mm, .40, Smith&Wesson 10mm, .45(5” barrels); Taurus 9mm, .40 HOLSTERS Double Leg Strap #57000 Single Leg Strap #57010 Pro-Pak® Horizontal Pro-Pak® Vertical Tactical/Flashlight/Laser PRO-2 Jacket Slot Inside-Pant Open Ankle Autos — 16 — — 16 15 16 — — — — 10 1 16 19 19 16 15 16 19 19 — — — 1 16 19 19 16 15 16 19 19 — — — — 16 19 19 16 15 16 19 19 — — — — 16 15 5 16 15 16 15 5 — — — — — 15 5 1 1 1 15 5 — — — — — — — — — — — — — — — — — 19 19 — — — 19 19 — — — — — 15 5 — — — — 5 — — — — — — — — — — — — — — — 10 16 15 5 16 15 16 15 5 10 10 10 10 16 — — — — 16 — — 10 10 10 ASTRA Autos AUTO ORDNANCE Autos BAUER BERETTA Autos Autos 3 ½"- 3 ¾" 5" 4 ¼" 4 ¼" 4½" 4" 3 ½" 3 ½" 3 ¾" 4 5⁄8" 4 ¾" 4 ½" 2 ¾" 3 ½" 3 ¼" 1 5 15 15 15 15 16 1 1 — 15 15 1 16 1 1 5 15 15 16 15 16 1 1 19 15 15 — 16 1 1 5 15 15 15 16 16 — 1 19 15 15 — 16 1 1 5 15 15 5 15 16 1 1 19 15 15 1 16 1 1 5 15 15 15 15 15 1 1 5 15 15 1 16 1 1 5 15 15 5 15 — 1 5 15 15 — 1 1 — 20 18 — — 34 — — — — — 22 — — — — 20 20 — 20 18 — — — 19 22 22 — — — — 5 15 15 — — — — — 5 15 15 — — — — 20 18 20 20 — — — — — — — — — — 1 5 15 15 5 5 15 1 1 15 15 15 10 16 1 1 — — — — — — — 1 — — — 10 16 1 BERSA BROWNING Autos Autos COLT Autos 4 ¼" — 19 19 19 15 15 — 19 15 — 15 — Revolvers 5 19 19 19 5 5 — 19 5 — 5 — — 0 0 0 0 — — — — — 0 — 2 2 2 — 2 — 2 2 2 2 2 2 — — 2 — — — — — 2 2 — — CZ Autos 6" 3 ½" 4 ¾" 3.2" 3.66" 4.7" 4" 5" 4" 4 ½" 4 ½" 3 ¾" 3 ¼" 5¼" 4" 4" 3 ½" 3 ½"-4 ¼" 3 ½" 4 ½" 2 ½" 3"- 4" 3 ½" 4" 4 5⁄8" 2" 3.1" — 1 5 1 16 5 16 5 16 15 15 16 1 — 16 15 16 — 16 — — 1 16 1 5 — 16 3 1 15 1 16 15 — — 21 21 21 21 — 5 16 15 15 15 16 5 — 1 16 1 5 — 16 — 1 15 1 16 15 15 5 21 21 21 16 16 — 1 15 15 15 16 5 — 1 1 1 5 — 16 — 1 5 1 16 5 15 5 16 15 15 16 12 — 16 15 30 30 16 5 — 1 12 1 5 — 12 — 1 5 1 16 5 15 5 16 15 15 16 16 — 16 15 15 15 15 5 — 1 16 1 5 — 16 — 1 5 1 1 5 15 5 15 15 15 15 — — 1 15 15 15 15 5 — 1 — 1 5 — 15 — — — — — — 22 — 21 21 25 25 — — — — 30 30 — — — — — — — — — — — 19 — — — 22 — 21 21 25 25 21 — — — 30 30 — — — — — — — — — — — 5 — 15 5 — — 15 15 15 — — — — — — 15 15 5 — — — — — — — — — — — — — — — 21 21 25 25 — 25 — — — — — — — — — — — — — — 1 15 1 16 15 15 5 16 15 15 16 12 — 16 15 15 15 16 — 10 1 12 1 5 10 12 — 1 — 1 16 — — — 16 — — — 12 — — — — — 16 — 10 1 12 1 — 10 12 EUROPEAN AMERICAN ARMORY (EAA) FN Autos Autos GLOCK Autos HK Autos HI-POINT Autos JENNINGS Autos KAHR KBI Autos Autos KEL-TEC KIMBER Autos Autos 5" — 19 19 19 5 5 — 19 5 — 5 — 4" 3" 5" 3"- 4" 3 ½" 4"- 5" 3.7" 3 ½" 4 ¼" 5" 2 ½" — 16 — 1 16 5 1 16 — — — 19 16 19 1 16 5 1 16 19 19 — 19 16 19 1 16 5 1 16 19 19 — 19 16 19 1 16 5 1 16 19 19 — 15 16 5 1 16 5 16 16 15 5 — 15 1 5 1 1 5 1 1 15 — — — — — — — — — — — 19 — 19 — — 19 — — 19 19 — 15 — 5 — — — — 15 15 5 — — — — — — — — — — — — 15 16 5 1 16 5 1 16 15 5 — — 16 — 1 16 — — 16 — — 10 LES BAER LLAMA Autos Autos MAKAROV PARA ORDNANCE Autos Autos PHOENIX ARMS Autos Barrel Length “Backup” “Backup” .45 Skipper Hardballer .45 A-70, A-75 A-80, A-90, A-100 Pitbull General 1911 A1 .22, .25 Cal. 20, 21, 950 Series, Bobcat, Jetfire, Minx Tomcat 34, 70S, 70SP, 81, 82, 82B, 84, 84B, 84F, 85, 85B, 85F, 86, 87, 90, Puma, Jaguar 92, 92S, 92SB, 92D, 92F, 92G, 96, 96F, 92FS, Brigadier, 92FC 92 Centurion, 96 Centurion, 92D Centurion, 96D Centurion 92SBC, 92FM 92 FS Vertec PX-4 Storm 8000, 8040, 8045 Cougar, 9000 Thunder 380, Series 95 BDA .380 Hi-Power 9mm, .40 BDM 9mm, BPM-D, BRM-DOA BDA 9mm .38 Super, .45 ACP Mustang, Mustang Plus II, Mustang Pocketlite, Pony Officers ACP .45, Double Eagle Officers .45, 1991 A1 Compact 380 Government Model, Gov't. Pocketlite, Pocket 9 Commander, Combat Commander, Lightweight Commander, 1991 A1 Commander Combat Elite, Delta Elite, Gov’t. Model, Gold Cup, Combat Target, 1991 A1,1911 Agent, Cobra, Commando, Detective SPL, Lawman, DSII/38 SPF VI Commando, Lawman, Official Police, Marshall, Metropolitan, King Cobra, Peacekeeper, Python, Three-Five-Seven, Trooper, Mark III Diamondback Officers Model, King Cobra Peacekeeper, Official Police, Python, Three-Five-Seven, Trooper, Mark III CZ83 CZ75, CZ85 European .22, .380, .32 Witness Sub-Compact, FAB92 Witness, Witness Sport, Witness Combo, FAB92 49 5.7 19, 23, 32 17, 22, 31 20, 21 29, 30 26, 27, 33, G28 34, 35, 36 P7, P7M8, P7M10, P7M13 P9S P2000 V2 USP 9mm, .40, .45, USP Compact 9mm Compact, .380 Compact 9mm, .40, .45 J-22, J-25 48, 9mm 13-Shot K9,P9 9mm, K40 PMK .380, SMC .380 PJK-9HP PSP 25 P-11 9mm, P-32, P-40 Custom, Royal, Stainless, Gold Match, Stainless Gold Match, Gold Combat, Gold Combat Stainless Steel, Super Match, Custom CDP Compact, Compact Stainless Steel, Compact Aluminum Stainless Steel, Pro Carry, Stainless Steel Pro Carry, Pro Carry HD, Compact CDP, Pro CDP Ultra Carry, Stainless Steel Ultra Carry, Ultra CDP S.R.P. XV, XA, 111A, MicroMax, Plus Other Small Frame Autos MiniMax, MiniMax II 1XA, VIII, XI, Omni, Plus Other Large Frame Autos Makarov 9x18mm P12 .45, OPS, Companion P13 .45, LTC, Tac S P14 .45, P16, LDA, SSP HP22, HP25 Dual Retention Duty/Tactical Super Belt Slide Gun Make and Model AMT 5" 2"- 3" 4" 4" PRO-3® Duty/Tactical Paddle 2 ½" 3" 4 ¼" 5" 3 ½" 3 ¾" 3 ½" 4 ½" 5" 2" 2 ½" 2 ½" Ambidextrous Hip Hip-Thumb Break HOLSTER SELECTION GUIDE Holster Size — STAR Autos STEYR Autos TAURUS Autos Revolvers WALTHER Autos Dual Retention Duty/Tactical — 15 15 15 15 — 36 — 16 16 1 15 16 16 15 15 — 15 15 15 15 0 36 3 16 16 1 15 16 16 15 15 — 15 15 15 15 0 36 — 15 15 1 15 16 16 15 21 — 15 15 15 15 0 36 — 15 15 1 15 16 16 15 15 — 15 15 15 15 0 36 — 15 15 1 15 16 16 15 15 — 15 15 15 15 — — — 15 15 1 15 1 — 1 1 — 23† 23 — 23 — — — — 22 — 22 22 — — 25 — 23 23 — 23 — — — 22 22 — 22 22 — — 21 — 15 — — 5 — — — — — — 15 15 — 15 — — — — — — — — — 22 22 — 22 22 — 22 25 10 5 15 15 15 0 36 — 16 15 1 15 16 16 15 15 10 — — — — — — — — — 1 — — 16 15 — 3 ½" 16 16 16 16 16 1 18 18 15 — 16 16 3 ¾"- 4" 4 ¼" 15 15 15 15 15 15 15 15 15 15 15 15 18 18 18 — 15 15 18 — 15 15 — — 5" 3" 4"- 4 ¼" 4" 4 ¼" 3" 5" 4" 5" 5 1 15 15 15 1 5 15 5 5 1 15 16 15 1 5 15 19 5 1 15 16 15 1 5 15 19 5 1 15 15 15 1 5 30 19 5 1 15 15 16 1 5 15 5 5 1 15 15 15 1 5 15 5 20 — 28 28 28 28 — 29 — 20 — 28 21 28 — — 30 19 5 — 15 — 15 — — — — — — — 25 — — — — — 5 1 15 16 16 1 5 15 5 — 1 — — — 1 — — — 2" 36 36 36 36 36 — — — — — 36 0 2"- 2 1⁄8" 3" 3" 2"- 3" — — — — — 0 — 0 — 0 — 0 40 0 — 0 — 0 — 0 — — — — — — — — — — — — — — — — — — — — 36 — 0 0 — — — — 2 2 2 2 2 2 — 2 — — 2 — 3"- 4" 6" 4 ¼" 5" 4 ¾" 3 ¾" 3" 4" 3" 4" 2 ½" 3 ½"- 3 ¾" 4" 5 ½" 4" 2 ¾" 3 ¾" 3.8" 4" 4 ¼" 5" 3 ¼" 4¼" 2" 2" 2"- 3" 2 — — — 5 16 16 16 16 16 16 16 15 5 15 — 16 15 15 15 5 16 15 36 — — — 3 19 19 15 16 16 16 — 16 16 1 16 5 16 — 16 15 15 15 5 16 15 36 — 0 — — 19 19 15 16 16 15 16 15 16 1 16 5 — — 16 15 15 15 5 16 15 36 — 0 2 — 19 19 5 16 15 15 15 15 16 16 15 5 30 — 16 15 15 15 5 12 15 36 40 0 — — 16 5 5 16 — 5 — 5 16 1 15 5 15 — 16 15 16 15 5 16 15 36 — 0 2 — 1 5 5 1 — 5 — 5 1 15 15 5 15 — 1 15 15 15 5 15 15 — — — — — — — — — — — — 28 — — — — 22 — — — — — — — 22 — — — — — 19 19 — — — 25 — 30 — — — — 30 — — — 20 20 20 — 22 — — — — — 15 5 5 — — 15 — — — — 15 — — — 15 — 15 15 5 — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — — 16 5 15 16 0 16 0 5 16 1 15 5 16 10 16 15 16 15 5 12 15 36 36 0 — — — — — — — — — — 16 — — — 16 10 — — — — — 12 — 0 — — 4" 6"- 6 ½" 2½" 3 ¼"- 3 7⁄8" 4" 4 ½"- 5" 4 ½" 3¾" 5" 2 — — 1 15 5 15 15 5 2 3 — 1 16 5 16 15 5 2 — — 1 16 5 16 16 5 2 — — 1 30 5 15 16 5 2 — — 1 15 5 15 16 5 2 — — 1 15 5 1 15 5 — — — — 30 — — — — 2 — — — 30 — — 21 21 — — — — — — — — — — — — — — — — — — 2 — 10 1 15 5 16 16 5 — — 10 1 — — — 16 — 4" PRO-3® Duty/Tactical Ankle Autos Inside-Pant Open SPRINGFIELD ARMORY 2 ½" 4"- 4 ½" 4"- 4 ½" 4" 4" 2 ¾"- 3" 2" 6" 3¾" 4¼" 3 ½" 4 ½" 3 ¾" 3 ½" 3 ¾" 4" Barrel Length Holster Size HOLSTERS Revolvers PRO-2 Jacket Slot Tactical/Flashlight/Laser Autos Pro-Pak® Vertical SMITH & WESSON Revolvers Autos Pro-Pak® Horizontal SIG/SAUER Super Belt Slide Revolvers P-25 P85, P89, P90, P91, P93, P94, P95, KP90, KP93, KP94 KP97 KP345PR P345 Security Six, Service Six, Speed Six, SP 101 SP 101 (except spurless hammer) Security Six, Service Six, Speed Six, GP 100 229R (DAK) P220ST .45 Cal, P226R P230, P232 P220, P226 P225, P228, P229 P239 P245 MP 469, 669, 908, 3913, 3914, 3953, , 3954, 4013, 4013TSW, 4053, 5903SSV, 5943SSV, 6904, 6906, 6944, 6946 39, 59, 410, 411, 439, 457, 457D, 459, 539, 559, 639, 659, 909, 910, 915, 3904, 3906, 4003, 4004, 4006, 4026, 4043, 4044, 4046, 4516, 4536, 4556, 5903, 5904, 5905, 5906, 5926, 5943, 5944, 5946, 5967, 9mm, .40, Sub-Compact .45 1066, 1076, 1086, 4566, 4567, 4576, 4586 •All of the above applies to TSW variations 645, 745, 1006, 4506, 4526 2213, 2214 Sigma—Full Size 9mm, .40, SW9E, SW40E, SW40VE SW9VE Sigma—Compact 9mm, .40 Sigma—Compact .380 52 SW99 SW 1911 J Frames with hammer spur 31, 34, 36, 37, 60, 317, 317LS, 331, 337, 632, 634, 637 J Frames with shrouded or concealed hammers, including: 38, 40, 42, 49, 332, 342, 442, 631, 638, 640, 642, 649, 940 J Frames with hammer spur: 30, 31, 32, 34, 36, 37, 60, 317, 650 J Frames with concealed hammers, incl.: 242, 640, 940 All K Frames, including: 10, 12, 13, 15, 19, 64, 65, 66, 547 All K & L Frames, including: 10, 12, 13, 14, 15, 16, 17, 18, 19, 33, 48, 53, 64, 65, 66, 67, 547, 581, 586, 681, 686, 686+, L Frame (7 shot) All N Frames, including: 20, 21, 23, 24, 25, 27, 28, 29, 57, 58, 520, 625, 629, 657 All K & L Frames, includling: 10, 14, 16, 17, 19, 48, 53, 66, 586, 686 Commander 1911 A1, Defender, Omega P9 P9 Compact XD Compact XD-9, XD-40, XD357 XD-9 Sub HS-2000 Ultrastar 30 PK, Firestar 9mm, .40, Firestar Plus 9mm Firestar .45 GB 9mm M40, M9 PT-22, PT-25 PT-908, PT-911, PT-938, PT-940, PT-957 PT-400, PT-945 PT-58 PT-92C PT-92, PT-99, PT-100, PT-101 PT-111, PT-138, PT-140, PT-145, PT-157 24/7 85, 94, 941, 731 85CH concealed hammer 65, 66, 73, 74, 80, 82, 83, 415, 431, 441, 445, 605, 741, 817, 941 65, 66, 80, 82, 83, 84, 94, 425, 431, 441, 607 .44 Mag., 608, 627, 669, 689, 741, 827, 941 66, 86, 96, 441, M44, 607 .44 Mag., 608, 689, 761 TPH22, TPH25 PP, PPK, PPK/S, PP Super P99 P38, P38IV P5 P22 P22 Paddle Autos Autos Autos Hip-Thumb Break Gun Make and Model RAVEN RUGER Ambidextrous Hip How to use the UNCLE MIKE’S® LAW ENFORCEMENT Holster Selection Guide 1. Just look up the brand of your handgun, then the particular model of gun and the barrel length. 2. Numbers listed under each style of holster indicate the SIZE of holster you should buy. ® 3. Fit information for the following holsters can be found on earlier pages of this catalog: Kydex (Pg 18-19); Inside-the-Pocket holsters (Pg 21); Body Armor (Pg 22). IF yOu taKe On tHe laW, DOn’t eXPeCt a FaIr FIGHt. Tough belts for tight spots. Nylon Web Ultra Duty Belt finish Options Ultra Duty Belt Choosefromfourdurable,yetlightandcomfortable styles.Tripleretentionbucklesgiveyouheightened securitywhilelayeredconstructiondeliversdurability. Ultra Duty Belts Thesearebeltsyoucancounton. • Double-layer2”nylonthat’sedge paddedforcomfort. Mirage® Mirage Plain Kodra® Nylon Basketweave • Interiorpolymerstiffeneradds supportwhilereducingbulk. • Sturdynylonwebbing. FYI – • Hook&LoopliningmateswithUltra UltraDutyBeltscanbecleanedandsanitized.Learn andLoop-Backinnerdutybelts. moreonpage37. • Rigidenoughtocarrygear, ® Pro-3 Triple Retention Buckle flexibleenoughfordaylongcomfort. • Webedgesarefinishedwith smoothnylontopreventsnagging anddigging. Ultra Duty Belts Nylon Web Ultra Duty Belt Deluxe Duty Belt • Double-layer2”nylon. •Forlighttomoderateuse. •Rigidnessthatcomparestoheavierleatherbelts. •Rugged,double-layer2"nylonmeanscomfortandsupport. •Injectionmoldedbeltstays. •Patentedthreebuttonbuckle. Deluxe Duty Belt UncLE MikE’S® Law EnfORcEMEnT BELTS Size Sm med Lg X-Lg XX-Lg 3X-Lg 26-30 32-36 38-42 44-48 50-54 56-60 62-66 660-762 813-914 965-1067 1118-1219 1270-1372 1422-1524 1575-1676 KodraUltraDutyBelts 87761 87771 87781 87791 87792 87793 87794 KodraDeluxeDutyBelts 88231 88011 88021 88221 –– –– –– KodraUltraDutyBelts withoutHook&Loop 87721 87731 87741 87751 87752 –– –– MiragePlainUltraDutyBelts 70761 70771 70781 70791 70801 70811 70821 MirageBasketWeaveBelts 70921 70931 70941 70951 70961 70971 70981 incheS mm FYI – PRO-3 ® Triple Retention Buckle 4X-Lg PatentedbuckleusedonallUltraandDeluxeDutyBelts.Thetop,bottomandcenterreleasesmustbe usedtogethertoopenthebuckle,assuringthebeltstayssecure.Maybereleasedeasilywithonehand. Contouredforcomfort.Pleasecontactusformoreinformation. U.S. Patent no. 5,774,956 BELTS/GEaR HOLSTERS • Double-layer2”nylonthat’sedgepaddedforcomfort. • Interiorpolymerstiffeneraddssupportwhilereducingbulk. • Sturdynylonwebbing. • Hook&LoopliningmateswithUltraandloop-back innerdutybelts. • Rigidenoughtocarrygear,flexibleenoughfor daylongcomfort. • Webedgesarefinishedwithsmoothnylontoprevent snagginganddigging. •Injectionmoldedbeltstays. •Patentedthreebuttonbuckle. Duty Belts anD Gear Ultra Inner Duty Belt Deluxe Inner Duty Belt ultra inner Duty Belts Deluxe inner Duty Belt • Even more stability for extra gear. • Double-layer 11/2” nylon web with bound edges and Hook & Loop adjustments. • Full-length Hoop & Loop on the outer surface that mates to Hook & Loop on duty belts. • Reversible for administrative wear. • Single, sturdy layer of 11/2” nylon web. • Hook & Loop adjustable. loop Back inner Duty Belts • Reversible for dress wear. • Low-profile configuration. • Easy tightening and superior strength thanks to the loopback system of nylon loop and Hook & Loop. • Constructed of 11/2" nylon web covered in Hook & Loop on Ultra Duty Belts. Loop Back Inner Duty Belt uncle Mike’s® law enforceMent Belts Sm med Lg X-Lg XX-Lg 3X-Lg 26-30 32-36 38-42 44-48 50-54 56-60 62-66 660-762 813-914 965-1067 1118-1219 1270-1372 1422-1524 1575-1676 Ultra Inner Duty Belts 87811 87821 87831 87841 87842 87843 87844 Deluxe Inner Belts 88091 88061 88071 88081 –– –– –– –– 87921 87931 87941 –– –– –– Size iNCHeS mm Loop Back Inner Belts 4X-Lg DuTy BELTS AnD GEAR Load-Bearing Belt TheLoad-BearingBeltisergonomicallydesignedto helpyoucarrymoreweight,whiledecreasingthestress onyourback.Itsunique,angleddesignallowsittofit underavestsystem,whilemaintainingapivotpoint forcompletemobility. • Contouredtofitthehumanbody. • Workswithpacksoralone. • FrontandrearD-ringattachmentsallowattachment ofload-bearingsuspenders. • MOLLEcompatiblestrapsovermostofbeltsurface allowsflexibilityforplacementofpouches,holsters,etc. 8" – 34" 36" – 44" Black #7702760 #7702770 OD Green 7702761 7702771 3 Gun Competition Belt System •IncludesOuterandInnerbelt. •OuterbeltMOLLE/PALScompatible. •PaddedInnerBeltforaddedcomfort. •CompatiblewithKydex®andReflex™Holsters. •ITWFastMag®compatible. •Solutiondyedforcolorfastness. Medium Large X-Large XX-Large • QuickactionV-ringacceptsanysizecarabiner. • Hook&Loopadjustmentassuresaccuratesizing. • Canbeutilizedasaninnerorouterduty-stylebelt. • 13/4"sizingmeansthisbeltwillholdpouches andmostbeltaccessoriesandholsters. 26” 32" 38" 44" – – – – 30” 36" 42" 48" Black #7702699 #7702700 #7702710 #7702720 #87700 #87701 #87702 #87703 Reinforced Instructor’s Belt Tactical Rigger’s Belt Small Medium Large X-Large 32” – 36” 8” – 42” 44” – 48” 50” – 54” OD Green #7702704 #7702705 #7702715 #7702725 • Basedontheclassicrescueorrigger’sbelt. • Idealwidth(11/2")forkhakis,jeansandBDUs. • Heavypistolsupportthankstopolymerreinforcement betweentwolayersofrigidnylon. • Madefortherange,thesquadroomorthatraredayoff. Medium Large X-Large XX-Large 32" 38" 44" 50" – – – – 36" 42" 48" 54" #87671 #87681 #87691 #87692 BELTS/GEAR S/M L/XL Duty Belts anD Gear sentinel™ Duty Gear designed with your safety and budget in mind. Quality, affordable gear. Made of molded foam with a ballistic nylon outer shell, Sentinel Duty Gear delivers durability, functionality and value. Nylon Web Ultra® Duty Belt Silent Key Ring Utility Pouch Holder Double Speed Loader Case Flashlight Ring Standard Key Ring Baton Case Aerosol Chemical Agent Case Flashlight Case PR24 Cuff Case with Belt Loop Double Latex Glove Pouch Divided Double Pistol Magazine Case with Insert sentinel Duty Gear UNIveRSAL RADIo HoLDeR 89060 DoUBLe MAGAzINe CASe SINGLe StACK 89075 PAGeR/GLove PoUCH 89061 DoUBLe MAG CASe - GLoCK® 21 89076 SILeNt Key HoLDeR 89062 DoUBLe MAG PoUCH - GLoCK 17 89077 FLASHLIGHt HoLDeR 89063 BAtoN HoLDeR 89078 FItteD DoUBLe SPeeDLoADeR CASe 89064 PR-24 BAtoN HoLDeR 89079 21” eXPANDABLe BAtoN HoLDeR 89065 3/4” BeLt KeePeRS (Set oF 4) 89080 24/26” eXPANDABLe BAtoN HoLDeR 89066 NyLoN DUty BeLt- SMALL 89081 StANDARD Key HoLDeR 89067 NyLoN DUty BeLt- MeDIUM 89082 SINGLe HANDCUFF CASe 89068 NyLoN DUty BeLt- LARGe 89083 DoUBLe HANDCUFF CASe 89069 NyLoN DUty BeLt- X-LARGe 89084 SMALL oC/MACe PoUCH 89070 NyLoN DUty BeLt- XX-LARGe 89085 LARGe oC/MACe PoUCH 89071 NyLoN DUty BeLt- XXX-LARGe 89086 DoUBLe LAteX GLove HoLDeR 89072 DUty RIG KIt- MeDIUM 89087 MINI FLASHLIGHt HoLDeR 89073 DUty RIG KIt- LARGe 89088 StINGeR LIGHt HoLDeR 89074 DUty RIG KIt- X-LARGe 89089 sentinel 9-Piece Duty rig Kits come in three sizes and include: • Belt • Belt Keepers (4) • MKIII OC Case • Pager/Glove Case • 21" Baton Case • Stinger Case • Universal Radio Case • Silent Key Holder • Handcuff Case # 89087 # 89088 # 89089 Duty Rig Kit- Medium Duty Rig Kit- Large Duty Rig Kit- X-Large DuTy BELTS AnD GEAR Kydex® Belt Attachment Internal tensioning • Nearverticalrakeallowsfor device assures your conventionalbehind-the-hipcarry magazines are as secure orasanappendixcarry. • Kydexholstersonthispagenow as your firearm. • Fitsbeltloopsupto13/4”orclips overawaistband. • Singleordoublecases. includebothpaddleandbelt attachments. Right-hand Belt Loop #50111 Left-hand Belt Loop #50112 Kydex Paddle Attachment Soft,semi-flexiblematerialprovides morestayingpowerwithout compromisingcomfort. Newly-developedwedgesprovide additionalresistanceagainstthe interiorofyourpantsandbelt. Adjustmentpositionsonthepaddle allowforthree-cantpositioningof yourholster. Kydexholstersonthispagenow includebothpaddleandbelt attachments. Paddle #50121 Paddle #50121 Clip-On Tactical Light Holder KyDEx MAGAzInE CASES ITEM NO. FIT INFORMATION AcceptsInsight®TechnologyM-3,M-5and M-6lights,Glocklights,andsomeSurefire® models. • Clipsontoanydressordutybeltupto21/4”. • Carrieslightineitherlens-up(tactical) orlens-down(protective)position. # 50301 Single Mag CaSeS 50362 DoubleRowPolymer 9mm -.40cal. Metal.45caliber 50361 LargeDoubleRow Polymer10mm-45caliber Double Mag CaSeS 51361 DoubleRowBeltModel 51362 DoubleRowPaddle Model 51371 SingleRowBeltModel 51372 SingleRowPaddleModel Side view of Light Holder BELTS/GEAR • • • • Duty Belts anD Gear lights are only good when you have one our cases keep them with you! light Cases Mini light Cases • CarryaMini-Mag®orotherAAflashlight Moldedloopfitsbeltsupto21/4”. inthishandynylonbeltcase. • Closeddesignswithareinforcedflapprotects • Moldedbeltloopfitsanybeltupto2 1/4”. yourflashlight.Ano-glare,no-wearsnap securestheflap. • AvailableinMirage®orKodra®nylonfinishes. MIRAGE FlashliGht Cases anD rinGs* KODRA BushnellHDTorchTM MiniMagLite ® Basketweave 88185 74191 74192 –– –– 88181 74181 74185 Streamlight®Stinger® 88183 74183 74187 StreamlightStingerXT® 88184 –– –– ® StreamlightStingerLED/DS LED 88185 74191 74192 StreamlightPolyStinger®LED/DSLED 88185 74191 74192 StreamlightStrion LED 88186 74193 74194 MagLite ®D-Cell,StreamlightSL20 ®Series 88621 –– –– MagLiteC-Cell,StreamlightUltraStinger® 88631 –– –– ® surefire® M6 Flashlight Pouch • Carriesmultiplesizesoftacticalstyleflashlights. • Carrieslightbezeldown. • Paddedprotection. • Easilyconfiguredtobewornon13/4"or2"dutystylebelt. #7702490 #7702491 Plain 88671 SureFire ®6P,Streamlight®Scorpion®,T2®, Strion® Black OD Green MIRAGE Nylon DuTy BELTS AnD GEAR FiT ChART LiGhT CASE FiT ChART KODRA® NYLON MIRAGE® BASKETWEAVE MIRAGE PLAIN Type of LighT ModeL Various C CeLL Various d CeLL inoVa ® T1 inoVa T2 inoVa T3 inoVa T4 inoVa T5 MagLiTe® Mini Mag sTreaMLighT® propoLyMer ® 3n x x x sTreaMLighT sCorpion ® x x x sTreaMLighT sTrion ® x x sTreaMLighT sTrion Led 88181 88183 88184 88185 88186 88671 88631 88621 74185 74187 74192 74194 x 74631 74181 74183 74191 74193 x x x 74621 x x x ® x x x x sTreaMLighT nf2 Led x x x sTreaMLighT TL2® x x x sTreaMLighT TL3 ® sTreaMLighT Jr. Luxeon ® sTreaMLighT sTinger ® sTreaMLighT sTinger ds ® Led sTreaMLighT poLysTinger ® sTreaMLighT x x x x x x x x x x x sTinger xT® x x sTreaMLighT sTinger xThp® x x sTreaMLighT propoLyMer ® 2aa sTreaMLighT propoLyMer 3C sTreaMLighT propoLyMer 4aa surefire® e2d x x x surefire a2 x x x surefire Z2 x x x x x ® surefire 6p surefire 6r surefire 8nx surefire 9n ® surefire 9p surefire L7 surefire M2 surefire M3 surefire M3T surefire M4 x x x x x x x x x x x BELTS/GEAR x x Duty Belts anD Gear • Innovativeone-piecedesignlimitsbulk,yetaddsreinforcementfromflaptobackwall. • Low-cutfrontwallforfast,easygrippingandreholstering. • Dualslotbeltloopsonallmodelswithflapallowcasetofitdressordutybeltsupto21/4". • Opentopbeltmodelavailablewithstrongclipforeasyfitondressbeltsandwaistbands. slimline™ Dual-retention Cuff Case • NobiggerthanourSingleDutyCuffCase withflap. • Cuffsarebetterprotectedduetoa“pull through”internalfastener. • Producecuffssimplybyopeningtheflap andpulling. • Idealforspecialresponseteams,bikeand patrols,marineunitsandnaturalresource departments. • WorkswithconventionalsizedcuffsfromS&W®, Peerless®,AmericanHandcuff®andHyatt®. HanDCuff Cases KODRA® MIRAGE® Plain Basketweave Open TOp SingLe Cuff w/ BeLT LOOp 77921 –– –– Open TOp SingLe Cuff w/ BeLT CLip 88251 –– –– SingLe Cuff CaSe w/fLap 88781 74781 74782 DOuBLe Cuff CaSe w/fLap 88571 74571 74572 COmpaCT Cuff CaSe w/fLap Nylon MIRAGE 88351 74351 74352 SLimLine SingLe Cuff CaSe w/DuaL ReTenTiOn –– 74851 74852 SingLe HingeD Cuff CaSe w/ fLap 88782 Double Duty Cuff Case has two interior compartments and flap with both snap and Hook & Loop closures so it can be pressed shut after one set of cuffs has been removed. Kydex Molded Cuff Case • Fitstraditionally-sizedchainorhingecuffs. • Beltloopfor1"to13/4"beltwidths. Belt loop case #51251 Double Handcuff Case • Doublecuffcasecarriesbothstandardmetalandflexcuffs. • Flapkeepsstandardcuffssecure. • Flexiblecuffsstayaccessible. • Workswithmostflexcuffs. • Canbemountedorwornon13/4”and2”belts. Dimensions:4”Wx5”Hx1.5”D Black #7702510 OD green #7702511 Open Top Cuff Case has a break open snap—just pull cuffs to remove. DuTy BELTS AnD GEAR HAnDcuff cASE fiT cHART SlimLine ™ Plain w/ Flap SlimLine Basketweave w/ Flap Kodra ® Single w/ Flap Kodra ® Hinged Single w/ Flap Plain Single w/ Flap Basketweave Single w/ Flap Kodra Double w/ Flap Basketweave Double w/ Flap Compact w/ Flat Open Top Belt Loop 88781 88782 74781 74782 88571 74572 88351 77921 74851 74852 S&W # 1 Chain x x S&W # 100 Chain x x x x x x x x x S&W # 300 hinged x x x x x x x x x PeerleSS # 700 Chain x x x x x x x x x x PeerleSS # 7030 OverSized Chain x PeerleSS # 801 hinged x x x x x x x x x hiatt #2020, 2015 Chain x x x x x x x x x x x x x x x x x x x x x x x x x x hiatt # 2003, 2005 Xl Chain hiatt #2050, 2075 hinge x x hiatt #2054, 2055, 3154, 3155 Xl x x x x x x hiatt # 1010, 1015 x x x x x x x x x x x x x x x x x x x x x x x x x x x hiatt # 1003, 1005 Xl Chain hiatt # 1050, 1075 hinged x x hiatt # 1054, 1055 aSP Chain aSP hinged x PeerleSS hinged x x BELTS/GEAR hiatt lightWeight #3013, 3105 Chain Duty Belts anD Gear FitteD Pistol MaGazine Cases Fitted pistol magazine cases with insert. Divided double cases have separated compartments to facilitate grip on magazines. MIRAGE KODRA® MIRAGE® Plain Basketweave SingleCasew/FlapforDouble RowMags 88172 –– –– DoubleCasew/FlapsforDouble RowMags 88361 74361 74362 DoubleCasew/FlapsforSingle RowMags 88371 –– –– DividedCasew/FlapsforLg.Frame Glock&HKMags 88261 74261 74262 DividedCasew/FlapsforDouble RowMags 88367 74366 74367 Nylon Fitted pistol magazine cases. Built to last. Long-lasting, hard-working mag cases that look truly professional. Our mag cases offer: • Hardenedinsertsthatarerigidonthesides,frontandbottomformaximumprotection. • Separatecompartmentsforeachmagazine. • Separateinternaldevicesthatretaineachmagazine. • Soft-moldedbeltloopforbeltsupto21/4”. • Padded,reinforcedflapswithknitliningtocoverandprotectmagazine. • Anylonstiffenerintheflapsmakesthemeasiertoopenandkeepstheirshapeaftercontinueduse. • Versionsforbothsingleanddoublerow,metalandpolymermagsin9mm,.40S&W,10mmand.45ACP. • Wearhorizontallyorvertically. Our belt keepers are designed to lock the duty belt and the inner duty belt together. Tough, no-wear, no-glare snaps stay secure despite the most rigorous activity. Molded Belt Keepers • Bestonthemarketbecausethey’re moreflexiblethanhardenedplastic beltkeepers. • Moldedpolymerwon’tstretchoutof shape, crack, fray or fade with age likeotherwebbeltkeeperscan. Molded for 2” belts Molded for 21/4” belts Basketweave molded for 21/4” belts #88653 #88654 #88658 nylon Web Belt Keepers • Resist stretching or fraying. Nylon web for 2” belts Nylon web for 21/4” belts #88651 #88652 Duty suspenders Wearingadutybeltthataddsadditional18–21+ poundseverydayaddsalotofwearandtearon yourbody.UncleMike’s®DutySuspenderstransfer the weight of the duty rig from your hips to your shoulderstopreventlowerbackinjuries. • Fullyadjustablefrontandrear,withaspecialcross pieceinbackthatadjustsasyoumove. • Abreak-awaysnapdesignhelpsdefeatgrabbing. S/M L/XL Fits up to 40" chest Fits 42" and up chest #91203 #91204 DuTy BELTS AnD GEAR Aerosol Chemical Agent Cases FYI – Medium and large models have an impact-resistant insert to pro- • Keepspersonalchemicalagentswithin yourreach. • Worksforconventionaldutyandlarger canistersofmostpopularagents includingCS,CN,mace,peppermace, capstunandpunch. • Polymerinsertpreventscanisterdenting whilesmoothliningpreserves canistermarkings. • Foamspaceronmediumandlarge casesaccommodatescanisterswith oversizednozzles. • Fitsbeltsupto21/4". tect canister from damage. Fabric Insert Canister Expandable Baton Holders • Injectionmoldedfordurability. • Sametensionarmprincipleasour magazinepouchestokeepbaton inplace. • 16"modelretainspreviousflexible designwithKodrabody. • Holeinbacktopermitholstering fully-extendedbaton. Rear slot allows open baton to be reholstered under stress. BATon HoLDERS KODRA MIRAGE Plain Basketweave 16" 88811 –– –– 21"&26" 88841 74841 74842 AERoSoL AGEnT CASES MIRAGE® Plain Basketweave MKIII- Medium 88771 74771 74775 MKIV-Large 88691 74691 74692 Nylon MIRAGE universal Radio Case • availableinbothfixedbelt loopandswivelbeltloopfor easyremovalofcase. • Fitsmostpolice,fireand businessbandradios. • NylonwebandHook&Loop constructionadjuststheheight, widthanddepthofthecaseto fityourspecificneeds. • excellentforagencieswithmixed inventoriesorhard-to-fitdesigns. Laminated Radio Cases • Paddedtoprotectagainsttheday- to-dayabuseofstrikingthehandheld radioagainststeeringwheels, desktopsanddoorframes. • Twoconfigurations–swivelbelt loopandfixedbeltloop. RADio CASES KODRA MIRAGE Plain Basketweave Size1,Laminated Swivel 88981 –– –– Size1,FittedSwivel 88801 –– –– Size1,Fixed 88971 –– –– Szie2,Laminated Swivel 88982 –– –– Size2,FittedSwivel 88802 –– –– Size4,Laminated Swivel 88984 74984 74994 Size4,Fixed 88974 –– –– UniversalCaseSwivel 88806 –– –– SwivelBeltLoopOnly 88809 88809 88809 SHOULder MICrOPHONe ePaULeTCarrIer 88808 –– –– Nylon Laminated Radio Case Universal Radio Case Fitted Handheld Radio Cases with insert • Kodranylonoutercoverwithrigid polymerinsertforprotection. • Idealforbicycle,motorcycle,tactical andspecializedunitapplications wheresevereabrasionispossible. • Fittedwithaswivelbeltloop.Case canbedetachedquicklyfromthe beltloopsimplybyrotatingradio. MIRAGE Size1:13 / 4"dx27 / 8"Wx43 / 4"H Size2:13 / 4"dx27 / 8"Wx33 / 4"H Size3:11 / 2"dx23 / 4"Wx43 / 4"H Size4:13 / 8"dx23 / 4"Wx33 / 8"H MIRAGE BELTS/GEAR KODRA® Nylon Duty Belts anD Gear latex Glove Pouches Key ring holders • Made of Mirage® or Kodra® nylon, laminated to 1/8” closed cell foam core and knit interior to prevent snagging. • Double pouch with fold-up design has two pockets for standard latex gloves. • Fits belts up to 21/4”. • Rides higher for convenience and accessibility. • Features wrap-around hook and flap to hold keys quietly and securely. • Open holder has padded nylon flap and no-wear, no-glare double snaps on belt loops. • Holders fit belts up to 21/4”. Glove Pouches Kodra ® Nylon MIraGE Plain MIraGE Basketweave Single 88871 –– –– Double 88961 74961 74962 Pager cases Silent Key Ring Holder • Water-resistant case with molded belt loop fits belts up to 21/4". • Two sizes fit most common pagers, with or without their belt clips attached. • Also holds clip-on lights for pistols. • Medium case accepts many smallersized cell phones. Open with Flap Standard Key holDers PaGer cases Kodra Nylon MIraGE Plain MIraGE Basketweave Small (3" x 2" x 1" i.D.) 88521 -–– –– meDium (3 1 / 2" x 2" x 1" i.D.) 88531 74531 74532 Size Phone case with Belt clip • Rugged, padded Kodra case. • Fits on your belt. Belt loop accepts up to 21/4” duty belts. A removable belt clip accepts up to 13/4” dress belts. • Spring clip works even without belt. 21 / 8” W x 1” D x 5” H black #88551 Kodra Nylon PlaIn StanDarD 88711 74711 –– open w/flap 88601 74601 –– Silent 88581 74581 74582 remote Microphone carrier for epaulet • Positions microphone for easy, onehanded operation. • Snaps around epaulet. • Versatile – offers snap, Hook & Loop and Delrin® loop to accept remote microphone and attachments. #88808 Phone cases Size phone CaSe w/ belt Clip Kodra Nylon MIraGE Plain MIraGE Basketweave 88551 –– –– MIraGE Basketweave DuTy BELTS AnD GEAR BELTS/GEAR Our Mirage® nylon looks and feels like leather, but outperforms it in 6 ways. 1. Appearance – A Mirage duty rig starts out looking like leather and continues to look sharp despite wear, dirt, moisture and rough usage. 2. Weight – Your lower back will thank you because Mirage products are constructed of Nytek nylon, making them significantly lighter than leather or other synthetic rigs. 3. Durability – Mirage is incredibly strong and abrasionresistant, developed from microfibers that are 1,000 times finer than silk. It needs virtually no maintenance. 4. Comfort – More pliable than leather, Mirage flexes to your body’s contours for better fit and feel. 5. Cleaning – A damp cloth is all it takes. And spilled blood won’t seep into the pores of the Mirage material, so there’s no threat of pathogens remaining behind. It’s easy to decontaminate with bleach water. 6. Odor – Mirage doesn’t absorb body odor, perfume or other odors. Nor will it rot, mildew or wear away your gun’s bluing. Our pioneering use of multi-layer laminates and Kodra® nylon assures benefits you just can’t get from nylon alone. 1. Appearance – The bonded foam creates clean lines and long-lasting good looks, while the Kodra exterior provides a professional, non-reflective surface. 2. Performance – Your duty items are properly supported and immediately removable – even under stress. 3. Durability – All materials used in our line resist abrasion and protect your sidearm, radio, cuffs and chemical canisters from harm. 4. Weight – Your rig weighs less, so it’s less tiring for you to wear. 5. Comfort – Soft flaps, flexible bound edges and backwalls won’t poke or cut into you. 6. Cleaning – A damp cloth will work for most stains, while a soft nylon brush and water lifts out stubborn stains. To disinfect, clean with 1 part bleach to 10 parts 160º water. WHEN SECONDS COST LIVES. TACTICAL Universal Holster with MOLLE System • • • • • • • • Quicklychangesbetweenlightbearingandnon-lightbearingpistols. Convertseasilyfromright-handtoleft-handcarry. WorkswithversatileMOLLEsystemforplacementanywhereonthebody. Canbemountedonany13/4"and2"dutystylebelt. Fitsmostmediumandlargeautopistols. WorkswithSureFire® andStreamlight®weapon-mountedlights. Mountsonvestordroplegplatform. TraditionalthumbbreakwithsecondaryITW-Ghillietex™buckle strapforaddedretention. #7702001 #7702002 TACTICAL Black OD Green Modular Drop Leg Platform • Flexibleandstableplatform. • Aperfectchoiceforstrongoroffsidecarry. • MOLLEcompatibilitycreatestotalflexibility. • Internalpocketcanholdarmororotheritems. • Fullyadjustabletofitanysizeleg. • Legstraphasloosewebbingendsthatcanbeconcealed, creatingaclean,low-dragsurface. • Paddedbandiscomfortabletowearandadjustsforanysizeandsituation. Black OD Green #7702520 #7702521 TACTICAL HOLSTErS SIZE Molded Single/Double Strap Tactical Platform • Ultra-stabletacticalholsterplatform. • Allowsconversionofdutyholsterto tacticalholster. • MOLLEcompatible. • Rubberinlaidwebbingonthelegstraps. Double Leg Strap #57000 Single Leg Strap #57010 Dual PRO-3® Right/ Left FIT INFORMATION 18 R L 99181 99182 –– –– Smith&Wesson 9mm,.40, Sub-Compact.45 (3½-4”barrels) 20 R L 99201 99202 69201 69202 Beretta9mm,.40, Smith&Wesson 10mm,.45(5” barrels);Taurus 9mm,.40 21 R L 99211 99212 69211 69212 Glock17,19, 22,23 22 R L 99221 99222 69221 69222 SigSauer9mm, .38S,.40,.45 TacTical Retention lanyard Simple and effective retention with quick release for medium-sized pistols, objects, binoculars, etc. • Allows unrestricted drawing and reholstering. • Stretches from strong hand to support hand, and in all directions. Black OD Green #7702605 #7702606 load-Bearing Belt TheLoad-Bearingbeltisergonomicallydesignedtohelpyou carrymoreweight,whiledecreasingthestressonyourback. Itsunique,angleddesignallowsittofitunderavestsystem, whilemaintainingapivotpointforcompletemobility. • Contouredtofitthehumanbody. • Works with packs or alone. • FrontandrearD-ringattachmentsallowattachmentof load-bearing suspenders. • MOLLEcompatiblestrapsovermostofbeltsurfaceallows flexibilityforplacementofpouches,holsters,etc. Black OD Green #7702760 #7702761 #7702770 #7702771 S/M (28"– 34") L/XL (36"– 44") Reinforced instructor’s Belt • Basedontheclassicrescueorrigger’sbelt. • Idealwidth(11/2”)forkhakis,jeansandBDUs. • Heavypistolsupport,thankstopolymerreinforcement betweentwolayersofrigidnylon. • Madefortherange,thesquadroomorthatraredayoff. Medium Large X-Large XX-Large 32" 38" 44" 50" – – – – 36" 42" 48" 54" #87671 #87681 #87691 #87692 Kydex Retention Holster with MOllE Platform ThissystemincludesbothaKodra® MOLLEcompatibleplatformandaKydex injectionmoldedplate.Utilizingboth the plate and the platform together allowsyoutomountanUncleMikes®Law EnforcementKydexholsteranywhereyou needitonaMOLLEcompatiblesystem. Bydismountingtheplatefromthe platform,youcanattachanyUncleMike’s LawEnforcementholstertoaMOLLE compatiblevestsystem.Holstercanbe mounted in a vertical or angled position. Size 20 #MO68201 Right hand fits most Beretta® 92 & 96 Models Tactical Rigger’s Belt • QuickactionV-ringacceptsanysizecarabiner. • Hook&Loopadjustmentassuresaccuratesizing. • Canbeutilizedasaninnerorouterduty-stylebelt. • 13/4" sizing means this belt will hold pouches and most belt accessories and holsters. Small Medium (32" – 36") Large (38" – 42") XL (44" – 48") Black #7702699 #7702700 #7702710 #7702720 OD Green #7702704 #7702705 #7702715 #7702725 TACTICAL Breacher Vest • Hydrationcompatible,zippered, moldedbackpouchwithstays. • 4speciallydesignedpockets forshotgunrounds. • 4removablepanelstomark lethal/non-lethalmunitions. • 2utilitychestpouches. • Fitsupto72"girth. • DragstrapandMOLLEwebbingonback. Modular Entry Vest Black • MOLLEattachmentsonfrontandback forattachingmodularaccessorypouches. • Hydrationcompatible. Black OD Green Launcher Vest #7702220 #7702221 Multipurpose Entry Vest Cross Draw Entry Vest • 2smalland2largeutilitypouches. • 3dualM4/M16magpouches. • Pouchforflashlight,knifeorpistolmagazine. • Hydrationcompatible. • FeaturesourUniversalholster. • 2horizontalmagazinepouches. • 3dualM4/M16magpouches. • 1utilitypouch. • Hydrationcompatible. #7702215 #7702216 Black OD Green Zip Vest Black OD Green #7702283 #7702284 #7702210 #7702211 Plate Carrier Vest with Cummerbund [ Holds Armor Plate] • 4dualM4magpouches. • 2slotsforextrastoragebehindthe magpouches. • 2largegeneralpurposepouches. • Zipfrontwithplatepockets. • Adjustableshoulders. • DragstrapandMOLLEwebbingonback. • Beltattachmentsforaddedstability. • Sideadjustwithstraphiders. • Hydrationcompatible. #7702817 • Wraparoundloadpanels createanextremelyflexibleandstable loadcarriageplatform. • Holds10x12platesfrontandback. • Sidepanelsfeatureinternal pocketsforsupplementalsidearmor orquickstorageforotheritems. • Canturnshoulderstrapsaroundto accommodateriflebuttstock. [ Holds Armor Plate] Black OD Green #7702615 #7702616 TACTICAL • Hydrationcompatible,zippered,molded backpouchwithstays. • 2speciallydesignedpocketsfor launcherrounds. • 2utilitychestpouches. • 2MK-9sidepouchesformunitions. • Fitsupto72"girth. • DragstrapandMOLLE webbingonback. Black Black OD Green #7702815 TacTical Organization Patches • Embroideredletteringandborder. • Hook&Loopforquickon/off. • LargepatcheshaveremovableMOLLEattachment. Large 5” x 8” Small 2 1/4” x 4 1/4” Police – white lettering Police – gold lettering CERT – white lettering Sheriff – gold lettering SWAT – white lettering Medic – white lettering SRT – white lettering SORT – white lettering DCT – white lettering Police – white lettering Police – gold lettering CERT – white lettering Sheriff – gold lettering SWAT – white lettering Medic – white lettering SRT – white lettering SORT – white lettering DCT – white lettering #7705010 #7705011 #7705012 #7705013 #7705014 #7705016 #7705017 #7705018 #7705019 #7705020 #7705021 #7705022 #7705023 #7705024 #7705026 #7705027 #7705028 #7705029 TACTICAL Pistol Mag Pouches • Holdstwodoublestackorfoursingle stackpistolmags. • Canbemountedonvest,dropleg platform,LBVorarmorvest. • Easilyconfiguredtobewornon13/4" or2"duty-stylebelt. • Elasticstayskeepmagssecureeven ifflapisopen. • Grommetdrainholes. • Singlealsocarriesmostknives,small flashlightsandmulti-tools. Double Magazine Pouch— Elastic retention keeps spare mag secure when first mag is removed. Single Magazine Pouch Black OD Green M4/M16 Magazine Pouch Double Magazine Pouch Black OD Green Shotgun/Rifle Shell Carrier Pouch Immediateaccesstoyourshellsand cartridges.Justpullandthepouch foldsopen.Roundsaresecuredwith toughelastic. • Comeswithtwoshotgunpanelsand tworiflepanels. • Holds1012-gaugeshotgunrounds or16riflerounds. • Canbeusedforstoringlesslethal rounds,separatefromliveammunition. • UniqueHypalon®mountingsystem allowsmountingonanyMOLLE compatiblesystem. • Pouchopensawayfrombody,making reloadingfaster. • Hook&Loopclosurekeepsammo concealedandprotected. • Canbemountedorwornon1 3/4" and2"belts. Single 20-round Magazine Pouch #7702330 Double 30-round Magazine Pouch Black OD Green #7702450 #7702451 Triple 30-round Magazine Pouch Black OD Green #7702375 #7702376 #7702460 #7702461 Black OD Green #7702350 #7702351 Double 40MM/37MM Pouch Holdstwo40mmor37mmprojectiles. • Hook&Loopclosure. • MOLLEcompatible. • Canbemountedorwornon1 3/4"and2"belts. Black OD Green #7702470 #7702471 TACTICAL •Fast-flap™workswithMagPulls™. •Hook&Loopclosure. •MOLLEcompatible. •Canbemountedorwornon1 3/4" and2"belts. •Singlemagazinepouchalsoholds twoMP-5mags. •Triplemagazinepouch–Singleflap allowsaccesstoallthreemagazinesat onetime(notshown). •Canbeusedforsmokegrenades orflashbangs. •20-roundpouchalsocarriestwo pistolmagazines. Black #7702360 #7702361 TacTical Surefire® M6 Flashlight Pouch • • • • Carries multiple sizes of tactical style flashlights. Carries light bezel down. Padded protection. Easily configured to be worn on 13/4" or 2" duty style belt. Black #7702490 OD Green #7702491 Double Hand cuff case • Double cuff case carries both standard metal and flex cuffs. • Flap keeps standard cuffs secure. • Flexible cuffs stay accessible. • Works with most types of flex cuffs. Dimensions: 4" W x 5" H x 11/2" D Black OD Green #7702510 #7702511 Flashbang Pouches Fits bangs up to 6” in length. • Side-releaseITW-Ghillietex™buckle allowssilent,rapidaccess. • Bangfitssnuglywithadjustable closure. [ Double Pouch shown] Ultra Gas Mask Pouch • Accommodateslargergasmasks. • Fullylinedinteriortoprotectmask. • Outsidepocketforsparecanister. • IDwindowontop. • MOLLE,drop-legandshoulder strap compatible. Dimensions: 81/2" L x 81/2" W x 41/2" D Black #7702442 OD Green #7702443 Black Black OD Green OD Green Single Pouch Double Pouch Single Pouch Double Pouch #7702420 #7702425 #7702421 #7702426 Gas Mask Pouch The easiest way to carry your gas mask. • Drop-leg,beltorvestmountable. • Useasasidepanelonavest. • Includesdrop-legattachmentand leg strap. • Largeenoughforraingear or poncho storage. • ITW-Ghillietex™bucklesandstays. • Containstwointernalpocketsand an elastic cinch cord top. Dimensions: 8 1/2” L x 8 1/2” W x 4 1/2” D Black #7702440 [Gas mask not included] OD Green #7702441 TACTICAL Radio/GPS Pouch Collapsible Baton Pouch • Hook&Loopflapallowsquick,easyaccess tobaton. • Formstablesopouchstaysopenwhenbaton isremoved. • Holeinbackofpouchallowsbatontobe reholsteredevenwhilefullyextended. Black OD Green • Soft,paddedprotectionforpersonalradios andGPSunits.(Standardpouch) • Quickaccessthroughsilentbucklesystem. • Carriesmosthand-heldGPSunits. • Hook&Loopadjustableclosure. • MOLLEcompatible. • Canbemountedorwornon13 / 4"and 2" belts. • Elasticandpaddingprotectdevices. #7702500 #7702501 Black Black OD Green OD Green Ideal for use on a belt, vest system or a leg platform. Standard Pouch Large Pouch Standard Pouch Large Pouch #7702435 #7702430 #7702436 #7702431 [Supplies not included] [ Standard Radio Pouch shown] Personal Medical Pouch Black OD Green TACTICAL Carries a basic blow-out kit. • Canbewornonmodulardrop-leg platform,vest,beltorusedasasmall drop-legbag. • Twointernalandtwoexternal pocketshaveHook&Loopclosures forquickaccess. • Quickaccesstointernalelasticloops. • #10water/sand-resistantzipper. • Redtabidentifiesasamedicalpouch. Dimensions: 6 1/2" L x 4 3/4" W x 2 3/4" D #7702480 #7702481 Dump Pouch / Breacher Pouch Small pouch opening allows deposit of empty magazines. Large opening for bigger items. Aquickplacetostashempty/partially loadedmags. • Comeswithdrop-legmountingkit. • MOLLEattachmentsystemmounts directlyontobelt,webgearorarmor. • Twoopenings–Onesmallfor droppingmagsin,onelargeforuse asalargeGPorBreacherpouch. • Easy,silentopening. • Water/sand-resistantzipper. • Canevenbeusedasasidepanelon platecarriervest. Dimensions: 6 3/4” L x 7 1/2” W x 4” D Black OD Green #7702650 #7702651 GP/Utility Pouch Adurable,reinforcedpouchthatdoes whateveryouneedittodo. • Coveredzipperprotectscontents. • Drainholeatbottom. • MOLLEcompatible. • Water/sand-resistantzippers. • Canbemountedorwornon1 3/4" and2" belts. Dimensions: 4 1/2” W x 5” H x 2 1/2” D Black OD Green #7702400 #7702401 MOST PEOPLE WATCH THE 5:00 NEWS. SOME OF US LIVE IT. BAGS And GEAR Active Shooter Response Bag BAGS/GEAR • • • • • • • • • MOLLEcompatiblewebbingforcustomizingtoofficerneeds. D-ringsallowforright/lefthandcantandcross-harnessconfigurations. Includesonepaddedshoulderstrapandthreewebstraps. ShoulderstrapD-ringscliponshouldermic. Adjustablewaiststraphelpstokeepbaginplaceduringmotion. LargebodysidepocketallowsforgunshottraumaitemssuchasQuickClotACS+™, gauzebandages,ratchetingtourniquetandEMSshears. MediumouterpocketcanstoreCR123battery,energybars,flashlightandpistol magazinestorageandmaps/schematics. Bagincludestwothree-positionelasticstrips,onetwo-positionstripandmultiple Hook&Loopstripsforcustomization. OuterHook&Loopstripallowsforidentification/namestrip. Black #7702224 Bags and gear Uncle Mike’s Bag Measurements Wehavedesignedanicontoensureourmeasurements providetheproperfitforyourequipment. deluxe Car seat Organizer Large gear Bag Durable ballistic padded nylon construction keeps your bag upright. • Fourfootpadsonthebottomkeepyourbaginplace onsmoothsurfaces. • Twopocketsoneithersideforextrastorage. • Sixloopsonthefrontandbackforatotalof12loops allowforattachmentofpouches. • Built-inroll-outmatforcleaningoffirearmsorasa protective barrier. • Wrap-aroundwebhandle,shoulderstrapand side handles. • Dividedrearsectiongivesyouplentyofspaceforfiles. • Centerthree-sidedzippersectionisacooler. • Frontsectiongivesyoustorageforpens,cardsand cell phone. • Frontzippercompartmentallowsstorageof smalleritems. • Sitsonyourseatwithtuck-instrapstosecureit. Dimensions: 14” W x 12 1/2” D x 8 1/2” H #52562 Dimensions: Main Compartment 19” W x 9” H x 13” D Black #52590 Large Briefcase Compact duffel Bag • Choosefromplain,policeorsheriffversions. • ClearplasticI.D.holder. Dimensions: 26” W x 12” H (305 x 660mm) Plain #52441 Getthesameversatilityofourmediumbriefcaseinalarger size.Storeallyourrangegearinanultra-light,durable briefcasewithplentyofroom. • Newdesignfeaturingmultiplecompartments. • Constructedoflighter-weight,durablematerial. • Includesfoammoldingforaddedprotection. • Includesconcealedholster. side-armor™ Car seat Organizer • • • • • • • • Dimensions: 5 3/4” D x 13 1/2” W x 11” H #52582 1680Dx1680DSide-Armor™materialwithwaterresistantcoating. Maincentercompartmentforfiles. Centralzipperedcompartmenttosecureitems. Onefrontcompartment. Twosidecompartments. Adjustablestrapwithquickdetachbuckle. BusinessCard/I.D.Namewindow. 1,124in³/18.4Lofcombinedstorage. Dimensions Main compartments 16” L x 13” H x 4” D, 12” L x 10” H x .5” D Dimensions Side compartments 4” L x 10” H x 4” D Dimensions Front compartment 4” L x 3” H x 1” D # 53561 BAGS And GEAR Trunk Organizer Customcompartmentsizingmakestransportingand organizingyourlawenforcementequipmenteasy. • FourcornerE-ringsallowfortiedown. • Fouradjustabledividersforquickcompartmentresizing. • Twolargefrontpockets. • Removablehardbackersfolddownforeasystorage. • Twosturdysidehandlesmakeforeasycarrying. • RemovablelidwithMOLLE. • Fitsmostpolicecruisers. #52455 Dimensions: 41” W x 12” H x 22” D; 20 lbs. Compact Firearm Case • • • • Heavy-dutycasedesignedspecificallyforcompactfirearms. Caseopensatendtoinsertgunbarrelfirst. Twozipperedsleevesforstorageofextrabarrels,cleaningrods orsuppressor. OnesmallHook & Looppouchforadditionalstorage. #52103 Dimensions: 23 1/5” L x 13” W 33” and 43” AR15/M4 Rifle Case Full-lengthzipperopenscaseoutflatforbetteraccess. Tabandloopcanlockbagopen. Adjustablewebshoulderstrap. Zipperedaccessorypouchforstorage. Largecasehasfivemagazinepouches,mediumcase hasthree. Quick-accesscenterpocket. 33” #52121 43” #52141 Dimensions: Medium: 33” W x 10” H (838 x 254mm) Dimensions: Large: 43” W x 10” H (1041 x 254mm) Submachine Gun Case • • • • Heavy-dutycasedesignedspecificallyforHKcollapsiblestockMP-5 andsimilarweaponswithmagazineattached. Caseopensatendtoinsertgunbarrelfirst. SixmagazinepocketscoveredwiththreeHook & Loopflaps. Largeflappedpocketprovidesstorageforessentials. #52101 Dimensions: 24 1/2” W x 13” H (622 x 330mm) 36” and 43” Tactical Rifle Assault Case Protectyourrifleorshotguninthisruggedly-builttacticalcase.Stowextragearinexterior pouchesandyourfavoritepistolinahidden,interiorpocket. • Featuresthreeexteriorpocketsforgear. • Madeoftough,600Dpolyester. • Interiorhandgunpocket. • 2”foampaddingforaddedprotection. Black 36” #64004 Black 43” #64005 Canopy 36” #64006 Canopy 43” #64007 Dark Earth 36” #64008 Dark Earth 43” #64009 Dimensions (36”): 2 1/4” D x 11 1/4” H x 36” W Dimensions (43”): 2 1/4” D x 11 1/4” H x 43” W BAGS/GEAR • • • • • • Bags and gear Uncle Mike’s Bag Measurements We have designed an icon to ensure our measurements provide the proper fit for your equipment. side-armor™ Field equipment Bag • 1680Dx1680DSide-Armor™materialwithwaterresistant coating. • Twofull-lengthzipperedsidecompartments,Main. centercompartmentandTwofrontcompartments withduallockablezippers. • Webhandlesandremovablepaddedshoulderstrap. • Removablebottombackerpanel. • I.D.Namestripcompatible. • 4,122in³/67.5Lofcombinedstorage. Dimensions: Main compartment: 20” L x 14” H x 9” D Dimensions: Side Compartments: 19”L x 9” H x 3” D Dimensions: Front Compartment: 3” L x 13” H x 9” D # 53481 side-armor™ Tactical equipment Bag w/straps • 1680Dx1680DSide-Armor™materialwithwater- resistant coating. • Twofull-lengthzipperedsidecompartments,main centercompartmentandtwofrontcompartments withduallockablezippers. • Webhandlesandremovablepaddedshoulderstrap. • Carryasaduffelorpack. • I.D.Namestripcompatible. • Reinforcedabrasionresistantbottompanel. • 4,866in³/79.7Lofcombinedstorage. Dimensions: Main compartment: 30” L x 11” H x 12” D Dimensions: Side Compartments: 4”L x 7” H x 1” D, 6” L x 12” H x2” D, 13” L x 13” H x 2” D Dimensions: Front Compartment: 22” L x 9” H x 1” D #53492 side-armor™ Briefcase w/Holster • 1680Dx1680DSide-Armor™materialwithwater resistant coating. • Mainzipperedcentercompartment. • Foldoverflapwithquickdetachbucklesand zipperedcompartment. • Multi-usefrontpanelforpens,cards,keysandmore. • Moldedcarryhandleandremovablepadded shoulderstrap. • I.D.Namestripcompatable. • Zipperedexpandablebottom. • Internalholstercanbeadjustedformosthandguns. • Briefcasefitsupto15”laptopsinpadded internalpocket. • 1,528in³/25Lofcombinedstorage. Dimensions: Main Compartment: 18” L x 12” H x 3” D Dimensions:: Front Compartments: 18” L x 12” H, 12” L x 10” H x 3” D Dimensions: Multi-Use panel 12” L x 9” H Dimensions: Zippered Flap 14” L x 14” H #53551 BAGS And GEAR Side-Armor™ Tactical Equipment Bag • • • • • • • 1680Dx1680DSide-Armor™materialwithwater-resistantcoating. Maincentercompartmentwithduallockablezippers. Twosidecompartmentswithlockablezippers. Onefrontcompartmentwithlockablezippers. Webhandlesandremovablepaddedshoulderstrap. I.D.Namestripcompatable. 4,778in³/78.3Lofcombinedstorage. Dimensions: Main Compartment: 26” L x 14” H x 10” D Dimensions: Side Compartment: 2”L x 15” H x 9” D Dimensions: Front Compartment: 22” L x 13” H x 2” D #53491 Side-Armor™ Roll Out Bag • • • • • • • 1680Dx1680DSide-Armor™materialwithwater-resistantcoating. Hugecentercompartmentwithduallockablezippers. Twofull-lengthzipperedsidecompartmentswithlockablezippers. Internaltiedownsincentercompartmentkeepgearsecured. Toughdurableurethanewheelsforyearsofdependabilityunder heavyloads. Collapsiblehandlestoresintomoldedrecessfortravel. 6,293in³/103Lofcombinedstorage. Side-Armor™ Patrol Bag • • • • • • • • • 1680Dx1680DSide-Armor™materialwithwaterresistantcoating. Paddedmaincentercompartmentwithduallockablezippers. Twosidecompartmentswithlockablezippers. Onefrontcompartmentwithlockablezippers. Webhandlesandremovablepaddedshoulderstrap. MOLLEwebbingandcarabineer. Removablepanels. I.D.Namestripcompatible. 2,340in³/38.3Lofcombinedstorage. Dimensions: Main compartment: 20” L x 11” H x 9” D Dimensions: Side Compartments: 8” L x 9” H x 1” D Dimensions: Front Compartment: 12” L x 9” H x 2” D #53471 Side-Armor™ Range Bag • • • • • • • • 1680Dx1680DSide-Armor™materialwithwater-resistantcoating. Rollupdouble-zipperedflapovermaincompartment. Webhandlesandremovablepaddedshoulderstrap. Foampaddedwallsinmaincompartmentadds protection. I.D.Namestripcompatible. Paddedpistolrugincluded. Lockablezippers. 1213in³/19.9Lofcombinedstorage. Dimensions: Main Compartment: 17” L x 9” H x 5” D Dimensions: Side Compartment: 14” L x 8” H x 2” D Black #53411 BAGS/GEAR Dimensions: Main Compartment: 29” L x 13” H x 13” D Dimensions: Side Compartments: 29” L x 8” H x 3” D Dimensions: Front Compartment: 14” L x 12” H x 2” D #53451 THE DIFFERENCE IS I KNOW HOW TO USE MINE. Accessories Folding cartridge carriers • Flapprotectsammo. • Handguncarrierholds12cartridges,Rifleholds10,MagnumRifleholds6. Folding Handgun Folding Rifle Magnum Folding Rifle #88441 #88451 #88331 Neoprene Buttstock shell Holders • Heavy-dutyneoprenesleevestretchesovergunstock. • Sewn-onelasticloopssecureammo. Rifle (6 loops) Shotgun (5 loops) #88483 #88493 • • • • Elasticsleevequicklysecuresoverrifleor shotgunstock. Sewn-onelasticloopsholdammo. Openorflapstyle. FlapssecuredwithHook&Loop. Flap style Rifle (6 loops) Shotgun (5 loops) #88482 #88492 open style Rifle (9 loops) Shotgun (5 loops) #88481 #88491 cartridge slides • • • • Onyourbelt,atyourfingertips. Fitsbeltsupto2¼". Sturdyelasticshellloops. Toughnylonwebbacking. Handgun (6 loops) Rifle (10 loops) Shotgun (6 loops) #88401 #88411 #88471 Accessories Neoprene Buttstock shell Holders ACCESSORIES Mil-Spec Swivel • • • • QD®SSMIM Super-heavy-dutymadetomilitary specifications. Dependableunderthemost demandingconditions. Setoftwo1¼"swivels. Set No. #14023 Push Button Detachable • • • • QD100 Easytoinstallandversatile. Flush-mountfrontandrearbases forstud-freeprofilewhensling andswivelsareremoved. Basesglueinplace,noscrews required. Set No. Samesilenceandruggednessasthe originalwithouttheTri-Lockfeature. Betterfitformoldedstockswith molded-inswivelstuds. 1" Loops – Blued Set No. #14022 • QDWIN-1200/1300CAP • Replacementmagazinecapwith swivelbase,¾"woodscrewbuttstock swivelbaseandtwoSuperSwivels. Black #18202 #MO10112 Mossberg 500 12-Ga. Mag Cap Set Non Tri-Lock® Swivel • • Winchester® 1200/1300 12 Ga. Mag Cap Set Remington® 870/11-87 Mag Cap Sets Replacementmagazinecapwithswivel base,¾"woodscrewbuttstockswivel baseandtwoSuperSwivels®.Notfor 3½”mags. • QDMOSS-500CAP • Includesreplacementmagazine boltwithswivelbase,¾"wood screwbuttstockswivelbaseandtwo SuperSwivels. Set No. #18102 Express Mag 12-Ga. Cap Set Lifetime Warranty Swivel • • • Lifetimewarranty. Exceptionalstrength–testedto over400lbs. One-pieceMIM(MetalInjection Molding)constructionfor unrivaledintegrity. 1" Loops – Blued Set No. #14063 • QD REM-870 EXP CAP Set No. #18002 Mag 12-Ga. Cap Set • QD REM-870 CAP Set No. #18012 Mag 20-Ga. Cap Set • QD REM-870 CAP Set No. #18015 11-87 12-Ga. Cap Set • QD REM-11-87 CAP Set No. #18032 • Push Button #21011 • Fixed #14050 Picatinny Swivel Mounts NowyoucanmounttheRapid PivotsystemtoanyPicatinny-style accessoryrailtogetthecombination offlexibilityandrock-solidassurance that’srevolutionizedanindustry. Mountinghardwareonly–purchase RapidPivotBipodorTripodseparately. 3 Gun Shell Caddy Mossberg® 590/835 12-Ga. Mag Cap Set • QDMOSS-590/835CAP • Includesreplacementmagazine capwithswivelbase,¾"wood screwbuttstockswivelbaseand twoSuperSwivels. Black #18112 • • • • • • • CNCmachinedaluminum. TypeIIHardCoatanodizing. 303highyieldstainlessstealretentionclips. Springbeltclipforeasyon/offoperation. Fits4-2¾”12gaugeshells. Compatiblewithallcompetitionbelts. CompatiblewithTek-Lok. #88472 ACCESSORIES tactical Rings and tactical Rings w/ Accessory Rail Millett®tacticalringsarealightweight,strongsolutionforthemostdemanding uses.6cap-clampingscrewspositivelyholdyourscope,nomatterthelevelof recoilandthebaseclampholdsthescopetothebase.Ringswithaccessoryrail allowthemountingoflights,lasers,backupsightsandotheritems. Grabber™ TheGrabber,in1inchand30mm,is theanswerforquick,easy,repeatable mountingofscopesandothertactical tools,suchaslightsandlaserson Weaver/Picatinny-typerails. tACtICAL RInGS 45° Picatinny Mount Magni-Levers™ • • • • • • #PC00045 Bushnell Elite E1224 Bushnell 6500 Elite 651832M Burris XTR Millett DMS-1 Meopta TL-1 Meopta K-Dot Nightforce Leupold Mk4 CQT Leupold Mk4 AR Vortex Razor HD M4 Riser Rails 30mmMed-Matte DT00714 30mmHigh-Matte DT00721 34mmLow-Matte DT00722 34mmMed-Matte DT00723 34mmHigh-Matte DT00724 35mmLow-Matte DT00725 35mmMed-Matte DT00726 35mmHigh-Matte DT00716 30mmLow-Matte DT00717 30mmMed-Matte DT00718 30mmHigh-Matte GRabbeR RinGs 1”–30mm Mounts GB30002 30mmMed-Matte GB00002 1”Med-Matte Stout1”aluminumconstructionstandsup toheavyrecoilandaccommodatesscopes with1”or30mmtubes.Bothmounts featureanotchedcrossboltforpositive lockonPicatinnyrail. #DT00030 #DT00031 PICAtInny RAIL/M4 RISER Millett’sM4riserallowsthemounting ofscopesandotheropticsonflattop AR,M4andotherriflesusingnormal heightscoperings. DT00715 TacTical accessoRy Rail CNCmachinedaluminum. TypeIIHardCoatanodizing. Highlymachinedprecisionfit. Guaranteednottocrushscopetube. ¾”LeverArm. 4torxscrews. #TL122 #TL183 #TLXTR #TLDMS #TLTL1 #TLKDT #TLNFO #TLMK4 #TLMKR #TLRZR 30mmLow-Matte PC00001 Remington700,ShortActionRH -Matte PC00002 SavageAccu-Trigger,ShortAction RH-Matte PC00003 BlankTactical-Matte PC00005 Remington700LongActionRH- Matte PC00006 SavageAccuTrigger,LongAction RH-Matte M4 RiseR RI00003 ForFlatTop-Matte(.625inchhigh) Picatinny Saddle Mount Nomorethumbustin’onprotruding hardware.Millettsaddlemountsare easytoinstall,andtheyprovidea rock-solidfoundationforyourscope orreddotsight. PICAtInny SAddLE MOunt SE00045 Rem87020-gauge SE00020 Rem87012-gauge SE00022 Moss500,835 ACCESSORIES Perfectforattachingmini-reddotsights, lasers,flashlightsandotheraccessories. Anextremelyreliableanddurableoffset Picatinnyrailfortacticalactionshooters. DT00713 ACCESSORIES Quick Carry™ Sling Converts quickly from a carry position to a shooting sling – using just one hand. This versatile sling can be used in prone or marksman shooting positions and fits nearly everyone. • Multiplecarrypositions–carryovershoulderorasahastysling. • Installsquickly–notoolsnecessary.IncludesUncleMike’s® famous locking swivels for safety and security. • Fitseveryone–adjustsfrom27”to36”.Widthis11/4”. • Nocarryfatiguethankstoabuilt-inthumbloop. Black #80091 Mountain Sling 1¼”nylonwebslingwithSuperSwivel® • • Non-slipliningsewn on both ends. SLIngS sewn on both ends. MODEL LENGTH WIDTH ITEM NO. Mountain 48" 11/4" 26923 Utility 48" 48" 72" 1" 11/4" 1" 26702 26703 26712 48” 72" 11/4" 11/4" 26762 26742 Rifle Cartridge 48" 1" 26972 Military (leather) –– –– 1" 11/4" 26112 26113 Utility Sling • 1”nylonwebwithadjustmentbuckle. Ultra® Sling • PaddedKodra®1”nylonsling. • Stitched,quiltednon-slipshoulder. Rifle Cartridge Sling • Padded1”nylonslingcarries6cartridges. Leather Military Sling • Designed for shooting accuracy in prone or kneeling position. Ultra ACCESSORIES Tactical shotgun sling swings into action fast. • 11/4"nylonweb. • UncleMike’s® 11/4" QD®swivels sewn-on. • Flip-opensnapconvertsslingfrom carrytoshoot. • 48”lengthadjustseasilywithsnap open or closed. #26993 Standard Blued Folding Stock Solid Steel Folding Stock Folding Stock Fit Information Mossberg® 500/590 Blued Folding Stock #FS-MB Remington® Blued Folding Stock 870™ #FS-RB One Point Sling • Astreamlined,simplesolution for CQB. • Allowseasymovementofgun when operating inside tight spaces. • Maintainsitsstructureforeasy donning. • Foaminsertinslingareaatneck. • Sidereleasebuckleallowsforquick breakawayforemergencyreleaseof the weapon. • Easyattachment–Slingsnapsonto manymountinglocationsusinga secure, quick-detach hook. • Constructedofdurable11/4” nylonweb. Black OD Green #7702100 #7702102 Three Point Sling Demand quick transitions with this durable, flexible sling. • Doublewebbingatneckfor added structure. • Sidereleasebuckleinstantlyconverts sling to a single-point sling for tight spaces. • Setsupinavarietyofconfigurations and shooting positions. • Madeofdurable11/4”nylonweb. Black #7702105 ACCESSORIES Availablefor12-gaugeRemingtonand Mossbergpumpshotguns. • Certain shotguns require replacement of forearms with a shorterversiontoallowshell ejection while stock is folded. ACCESSORIES MultiFlex Flip-Open™ Scope Covers • Springactivatedforfastopeningaction.Thetight,flexiblecollar protectsagainstsnow,rain,dirtanddust. • Measureboththeoutsidediameteroftheeyeandobjective endsofyourscopeandusethesizinginformation onpage57tofindtherightcover. Silent action hinge provides flawless performance in all weather. Inner O-ring provides an airtight seal to keep out dust and moisture. Ergonomic button design has a non-slip surface for one-touch action. Flip-Open Scope Covers Customfittedtoyourspecificscopeformaximum protection.Quietopeninglidsflipopenattheslightest pressureofyourthumb,allowingyoutokeepyoureye onthetarget.Water-tightfrictionmountsanchorthe coverstoyourscopewhileanairtightsemiO-ringkeeps outdustandmoisture.Ourscopecovershavebeen testedtoperformfrom-40degreesto120degrees. • Designservesbothright/handedshooters. • Weighslessthananounce. Easily opens with the touch of a thumb for right/left-handed shooters. New Red Dot Twin Pack Includesbothobjectivelenscapsfor30mmsights. • One-fingeroperationtofolddowncaps. • 30mmreddotcompatibility. • Purchasebythepair–eyeandobjectivecoverprovided. #40010 Slip-On Grips Improveyourcontrolwithvirtuallyanypistol byslippingthesegripsontothepistolstock. Mediumandlargesizehavefingergrooves. Medium fits compact large frame autos #50542 Large fits full-size large frame autos #50543 ACCESSORIES butlER CREEk® FlIp-OpEn SCOpE COvER FIt ChARt FlIp-OpEn SCOpE COvER FIt SpECIFICAtIOnS MEASURE THE OUTSIDE DIAMETER OF THE EYE AND OBJECTIVE ENDS OF THE SCOPE. FIT RANGE IS .01 UNDER TO .025 OVER THESE MEASUREMENTS. EYEPIECE OBJECTIVE OBJECTIVE INCHES (MM) PRODUCT# SZ INCHES (MM) PRODUCT# SZ INCHES (MM) PRODUCT# 02 03A 01 03 05 07 09 09A 10 11 13 14 15 16 17 18 19 20 1.225 31.1 20020 25.4 30010 46.2 30260 33.0 20030 1.095 27.8 30040 1.840 46.7 30270 1.341 34.1 20010 1.181 30.0 30025 1.890 48.0 30280 1.388 35.3 20035 1.221 31.0 30020 1.919 48.7 30290 1.432 36.4 20050 1.300 33.0 30030 19.60 49.8 30300 1.457 37.0 20070 1.34 34.0 30035 1.998 50.7 30310 1.468 37.3 20090 1.387 35.2 30050 2.043 51.9 30330 1.485 37.7 20095 1.429 36.3 30070 2.100 53.3 30340 1.516 38.5 20100 1.485 37.7 30090 2.220 56.4 30390 1.550 39.4 20110 1.500 38.1 30100 2.250 57.2 30400 1.570 39.9 20130 1.54x1.34 39.1x34.0 30110 2.310 58.7 30430 1.605 40.8 20140 1.76x1.53 44.7x38.9 30120 2.360 59.9 30440 1.66x1.45 42.2x36.8 20150 1.530 38.9 30130 2.410 61.2 30450 1.660 42.2 20160 1.558 39.6 30150 2.430 61.7 30460 1.675 42.5 20170 1.612 40.9 30710 2.641 62.5 30470 1.700 43.2 20180 1.646 41.8 30190 2.500 63.5 30480 1.730 43.9 20190 1.700 43.2 30200 26 27 28 29 30 31 33 34 39 40 43 44 45 46 47 48 51 1.820 1.300 2.575 65.4 30510 1.775 45.1 20200 01 04 02A 02 03A 03 05 07 09 10 11 12 13 15 17 19 20 21 23 25 1.00 1.735 44.1 30210 1.760 44.7 30230 1.800 45.7 30250 ACCESSORIES SZ MultIFlEx ObjECtIvE lEnS COvERS MultIFlEx EyEpIECE COvERS SIZE INCHES (MM) ITEM 09-09A 10-11 13-14 16-17-18 19-20 1.468 – 1.485 37.3 – 37.7 20909 1.516 – 1.550 38.5 – 39.4 21011 1.570 – 1.605 39.9 – 40.8 21314 1.660 – 1.700 42.3 – 43.2 21618 1.73 – 1.775 43.9 – 45.1 21920 SIZE INCHES (MM) ITEM 9-10 13-15 17-19 20-21 25-26-27 28-29 30-31 33-34 39-40 43 - 44 46 - 47 1.45 – 1.500 37.7 – 38.1 30910 1.530 – 1.558 38.9 – 39.6 31315 1.612 – 1.646 40.9 – 41.8 31719 1.700 – 1.735 43.2 – 44.1 32021 1.800 – 1.840 45.7 – 46.7 32527 1.890 – 1.919 48.0 – 48.7 32829 1.960 – 1.998 49.8 – 50.7 33031 2.043 – 2.100 51.9 – 53.5 33334 2.220 – 2.250 56.4 – 57.2 33940 2.310 – 2.360 58.7 – 59.9 34344 2.43 – 2.461 61.7 – 62.5 34647 ACCESSORIES Strip LULA® Speed Loader .223 caliber ammo on stripper clips can now be loaded in your magazine with unmatched speed – 30 rounds in 12 seconds! The Strip LULA is the fastest, easiest-to-use strip loader on the market, and it fits in your pocket. • The quickest, simplest strip loader available today. • Ultra-compact – 1/3 the size of similar loaders. • Durable reinforced polymer. • No finger pain or injury. #24200 for AR-15/M-16 #24201 for Mini-14 1 2 3 LULA All-in-One Magazine Speed Loader and Unloader The fastest, most comfortable loading experience possible. Rounds slide in and out effortlessly – no finger or mag abuse. Slips on and off your mag with ease. LULA is a trademark of Maglula Ltd. and is used by permission. Made in Israel. #24215 #24217 #24216 #24218 Fits: Fits: Fits: Fits: M-16/AR-15/M4 #24219 MP5 #24221 AK-47/GALIL #24220 Colt 9 SMG Fits: UZI Fits: FN FAL Fits: M1A/M14/AR-10 LULA Universal Pistol Magazine Loader The amazing speed and convenience of our LULA Speed Loader and Unloader is now available to handgunners. One UpLULA model fits virtually all 9mm.45 caliber mags both single and double stack from all manufacturers – while our new Baby UpLULA is perfect for .22 - .380 caliber magazine. Load and unload with the flick of a switch. Load Unload #24222 #24223 9mm - 4.5 caliber .22 - .380 caliber UpLULA Baby UpLULA ACCESSORIES Bipod Feather-light, rock-steady bipods and monopods Telescoping Bipod Folding Steady Stix II Alwayshavesteadysupport.Legsquicklytelescope upordownandrigidlylockinplace.OurexclusivePosiLock™systemguaranteesarock-steadyhold andreliable,unlimitedadjustments.Protective over-molded rubber yoke. Manufactured from high-strength, lightweight, tempered aluminum with a corrosion-resistant, satin black anodized finish. Legsextendfrom35”to65”.Weighs18oz. Expedition Bipod #T2B65-BXX Rapid Pivot Bipod Standing 36" - 64" (91.44 - 162.56cm) Weighs 16 oz. (453g) Asteadyholdonanyterrain.More convenient, portable and versatile than attached bipods and won’t change your pointofimpact.Legsautomaticallyunfold and self-assemble to their full height at the pull of a tie cord. Non-slip rubber V-yoke for sitting or kneeling. Threesectionlegsunfoldfrom14”to39”. Steady Stix II #F3B39-R1X Rapid Pivot Bipod Sitting/Kneeling 25" - 43" (63.5 - 109.22cm) Weighs 12 oz. (340g) Rapid Pivot Bipod Prone/Bench 10" - 13" (25.4 - 33.02cm) Weighs 8 oz. (227g) TheRapidPivotBipodSystem can pivot up to 360 degrees for lethal versatility. The legs of the bipod move silently and independently, adapting to any type of terrain. Rapid Pivot Bipod System The quickest attaching bipod available. Snaps onto your swivel stud, giving you instant setup. Weighs less than more expensive and complex mechanical bipods, but uses pivoting action, flexibility and solid support to outperform them. Use it in the prone, sitting, kneeling or standing positions. • Quicklyattachanddetachfromyour forearm sling stud. • Pivotingactionallowsyouto follow target. • Silentsetup. • Accommodatesprone,sitting, kneeling and standing positions. Rapid Pivot Bipod Hardware #RPB-101 Rapid Pivot Bipod #T2B64-PXX Rapid Pivot Bipod #T2B43-PXX Rapid Pivot Bipod #T2B13-PXX Stock Attachment “Standing” “Sitting/Kneeling” “Prone/Bench” ACCESSORIES Folding Steady Stix II The Rapid Pivot Monopod Attachment provides optimum versatility. ACCESSORIES Tactical Bipod This new lightweight, folding bipod attaches to your Picatinny rail, giving you the ultimate blend of on-thefly deployment and bench rest-steady aim. Excellent for moving targets and uneven ground. • Deploysquickly. • Incrediblylightweight. • Balljointsystemforsilent360ºmotionandadapting to uneven terrain. • Quick-adjustinglegs. #84075 9”-12” Tactical Bipod Rapid Pivot Monopod Attachment with Hardware Converts a hiking staff into a shooting rest by quickly clipping onto your stock’s swivel stud. Allows you to immediately pivot your stock left or right, or make quick sighting adjustments by flexing up, down, left or right. Includes all mounting hardware. The Rapid Pivot Monopod Attachment provides optimum versatility. #RPM-102 eFYI – The Rapid Pivot Monopod Attachment turns a walking stick into a shooting rest by quickly attaching onto your swivel stud. Provides rocksolid support with excellent flexibility. Swivel Pod An attached bipod with unrivaled swiveling and pivoting versatility. With a lightweight, streamlined design and innovative folding mechanism, it’s easy to carry and deploys with blazing speed. The legs quickly adjust in height and move on individual ball joints for uneven ground. And its centralballjointpermits360°motionforrock-solidassurance on moving targets. • Deploysquickly. • Incrediblylightweight. • Balljointsystemfor360ºmotionandadaptingtouneven terrain. • Quick-adjustinglegs. #84065 #84070 Adjusts from 12” - 18” Adjusts from 15” - 26” The Rapid Pivot Monopod Attachment gives you great flexibility, allowing you to pivot the stock left or right, up or down. ACCESSORIES Bench Anchor™ Adjustable Shooting Rest Experience the ultimate level of precision and comfort from the bench. Our new Steel Structure Adjustable Shooting Rest keeps your rifle locked on target and virtually eliminates felt recoil. For the truest test of your rifle’s accuracy, there’s no finer choice. • Substantialall-steelconstructionandbuttplateguardcancelrecoil. • Rigidtubularsteelconstruction. • Coarseandfineelevationadjustments,frontandback. • Forleft-andright-handedshooters. • Studdedfeetkeepitinplace. • Includesshootingbagthatsaddles bottom support. #DSR-10 The included shooting bag anchors the Steel Structure’s bottom support. Stoney Point® Bench Rest ACCESSORIES Idealfortargetandhuntinguse,thisbenchrestiscraftedof stout cast metal, yet is light enough for convenient field carry. A sturdy rifle bed accepts the widest forearms (5" W x 3 1/4" D). • Heightextendsto81/4", retracts to 5 3/4". • Retractablescrew-typepointedanchorpinsineachfoot keep it in place on bench tops. #PBR-55 6 3 2 1 Stoney Point Shooting Bags Stoney Point Shooting Bags give you the extra support you need to make those long shots. New this year, these bags areconstructedofdurable,600-deniernylonandfeaturea non-skidbottomandasemi-smoothcradlethatallowsfor gun recoil. All bags are available filled with polypropylene pellets to retard moisture buildup and molding. 1. Standard rear Bag #FSRB-10 Size: 7” L x 5.5” H x 5” W #USR-40 Unfilled Bag 2. Standard Front Bag #FSFB-25 Size: 7” L x 4.25” H x 5” W #USF-45 Unfilled Bag 4 7 5 3. CompaCt rear Bag #FCRB-15 Size: 5.5” L x 4.5” H x 5.375” W 4. BenCh reSt/UniverSal Front Bag #FUFB-20 Size: 4.75” L x 2.5” H x 2” W 5. StaCker/elBow pad Bag #FEPB-35 Size: 5” L x 4.5” H x 5” W 6. markSman’S BenCh reSt - non-Skid Cradle #FMBB-30 Size: 11.25” L x 10.75” H x 7.5” W #UMBB-50 Unfilled Bag 7. FenCe Shooting Bag #FFSB-55 Size: 11.25” L x 6.5” H x 6” W every Field. every Mission. every Barrel. Combat Proven The American sportsman’s proven favorite for over a century. High-tech and odorless for the most active hunters and shooters. Probes to the molecular level for the world’s fastest-acting, Combat proven technology designed for military and law enforcement. deepest-penetrating clean. Heroes. Military. Police. all turn to us for barrel cleaners that work with any firearm, and serve every discipline. it’s a privilege we’re proud to carry, and a pledge we’re committed to honoring. For the world’s most advanced gun-care products, trust the unrivaled leaders. GUN CARE CoMBAt PRovEN CARE FoR EXtREME sHootiNG REGiMENs. M-Pro 7® series Gun Care Products. M-Pro 7 Gun Cleaner Vital to maintaining weapon reliability and performance by removing layers of fouling, embedded carbon and conditioning the bore to help prevent future build up. • Significantlycutscleaningtime. • Improvesaccuracyandreliability. • Conditionstoreducefuturefouling. • Removescarbon,leadandmostcopper fouling. • Odorless,non-toxicandbiodegradable. 070-1015 070-1002 070-1005 070-1008 070-1030 070-1040 070-1050 2 oz. 4 oz. 8 oz. 32 oz. Gallon 5 Gallon 55 Gallon NSN 6850016003233 NSN 6850016003251 M-Pro 7 Bore Gel Same incredibly effective formula as the gun cleaner, but in a thicker solution for intense deep cleaning and conditioning action. 4 oz. 070-1202 More than just gun oil, LPX is the next generation of lubricant and protectant for advanced military and law enforcement style handheld and crew-served weaponry used in extreme environment operations. Provides the highest possible protection against wear, humidity and moisture, including salt water. Leaves a longlasting film that repels dust/dirt and will not evaporate. Excellent for long-term storage. • Replacesandoutperformstraditional gun oils, CLPs and dry lubes. • Combineshigh-qualitysyntheticoils and LPX additives. • Uniquetechnologyisresistantto evaporation, separation and M-Pro 7 Gun Oil LPX gumming. contains a cleaning agent that repels dust/dirt and can • Formulatedfromtechnologywith be used as a “cleaner” to the lowest known friction coefficient. remove surface carbon in • Cleanssurfacefoulingwithoutthe the field. use of solvents. • MeetsrequirementsofMIL-L-63460 revision E. • Maxtemperaturerange(-85°F to462°F). 070-1452 070-1453 070-1454 070-1455 070-1456 2 oz. 4 oz. Gallon 5 Gallon 55 Gallon M-Pro 7 Copper REMovER Eliminates copper fouling without the use of ammonia or other toxic chemicals. Works even faster when used in conjunction with M-Pro 7 Gun Cleaner. • Upto4xfasterthanammonia-basedcleaners. • Improvesaccuracyandreliability. • Dissolvescopperfouling. • Conditionstoreducefuturefouling. • Safeonboresteel(foruseinside bore only). • Non-hazardous,non-toxicand non-flammable and odor free. 070-1150 070-1151 2 oz. 4 oz. NSN 6850016003253 GUN CARE The M-Pro 7 Military Grade Weapons Cleaning System is an effective tool for military, law enforcement and other professional weapon experts that aids in mission readiness, combat/ police operations and supports pollution prevention initiatives. This revolutionary gun cleaning system was developed for use on all rifles, handguns, shotguns, machine guns, grenade launchers, mortars, crew-served weaponry and more. M-Pro 7 products exceed gun cleaner and lubricant MILSPEC requirements, are commercially transportable worldwide and reduce maintenance time by up to 80%. M-Pro 7 Gun oil lPX GUN CARE NEW M-Pro 7 Tactical Cleaning Kits TheM-Pro7lineoftacticalcleaningkitsjustgotevenbetterwiththeadditionoftheNEWTacticalAssaultRifle CleaningKit,TacticalPistolCleaningKitandtheAdvancedSmallArmsCleaningKits. M-Pro 7 Advanced Small Arms Cleaning Kit DesignedbyandfortheUSSoldier,thiskit containseverythingneededtoproperly maintainamilitarystyleweaponinthe fieldandingarrison.Eachitemwas specificallyrequestedbysoldierstosimplify andspeed-uptheircurrentmaintenance process. SACK Kit SACK Kit Leatherman MUT 070-1507 070-1508 • • • • • • 4oz.M-Pro7GunCleaner 2oz.M-Pro7GunOilLPX 150CleaningPatches (5.56mm,7.62mm,9mm) 3BoreSnakes(5.56mm, 7.62mm,9mm) 3PhosphorBronzeBore Brushes(5.56mm,7.62mm, 9mm) 3NylonBoreBrushes (5.56mm,7.62mm,9mm) 3BrassJags(5.56mm, 7.62mm,9mm) • • • • • • • • • • • 1ChamberMop(5.56mm) 1Lint-FreeCloth 1DustBrush 1NylonUtilityBrush 1DentalPick 1T-HandleRod 1oz.FieldOilBottle(Empty) 1MagnetPad 1MolleFieldPouch 1LockablePlasticCase 1WeaponMaintenance Guide M-Pro 7 Advanced Small Arms Cleaning Kit plus Leatherman MUT ThiskitcontainseverythingfromourAdvancedSmall ArmsCleaningKitPLUStheLeathermanM.U.T. TheLeathermanMUTisthefirstmulti-toolthat functionsasbothatacticalandpracticaltoolfor military,LE,orcivilianshooters.Multipleareason thetoolthreadedforcleaningrodsandbrushesand screwdriverbitssizedforstandardmilitaryandcivilian sightingadjustmentwork. #070-1508 M-Pro 7 Advanced Small Arms Cleaning Kit with Leatherman M.U.T. *9mm BoreSnake can also be used on .38, .380, .357 and .35 calibers plus 9x19 Parabellum and 9x18 Makarov. M-Pro 7 Tactical 9mm Pistol Cleaning Kit ThefirstM-Pro7BoreSnakekitforthemostpopularmilitary andlawenforcementpistolcaliber.Alsoworkson.38cal, .357. .380 cal pistols and revolvers. • 4oz.M-Pro7GunCleaner • 4oz.M-Pro7GunOilLPX • 9mmM-Pro7BoreSnake* • LintFreeCleaningCloth • NylonUtilityBrush(dualhead) • FoamGunPad • WeaponMaintenanceGuide #070-1509 BoRESNAKE CLEANER FiT GUidE 24020M 24017M 24040M 24000M 24002M 24015M 24011M 24035M .50,.54caliber .338,.340caliber 37mm,40mmlauncher .22caliber .380,9mm,.38,.357caliber .308,30-30,.30-06,.300,.303caliber,7.62mm .223,.22cal.Centerfire&Rimfire,5.56mm 12-gauge GUN CARE M-Pro 7 Tactical Assault Rifle Cleaning Kit * 5.56mm BoreSnake can also be used on .22, .22 long rifle, .223, 5.7x28mm, .22-250. ** 7.62mm BoreSnake can also be used on 30 cal, 30-06, .308 Win, .300 Win Mag. • • • • • • • • • • ForallM-16andAR-15stylerifles 4ozM-Pro7GunCleaner 4ozM-Pro7GunOilLPX 5.56mmM-Pro7BoreSnake* 7.62mmM-Pro7BoreSnake** LintFreeCleaningCloth NylonUtilityBrush(dualhead) FoamGunPad WeaponMaintenanceGuide 1M-Pro7WeaponsMaintenance&ProductGuide #070-1510 M-Pro 7 Tactical Universal Cleaning Kit #070-1505 M-Pro 7 Tactical Universal Soft Sided Cleaning Kit Contains everything needed to maintain all weapons from .22 caliber to 12-gauge shotgun in a soft nylon pouch. • 2oz.M-Pro7GunCleaner • 2oz.M-Pro7GunOilLPX • ZipperedFoldingNylonCasewith • BeltAttachment • Multi-SectionRod • 5AssortedBronzeBristleBrushes: • CalibersRangingfrom.22to12-GaugeShotgun • 7AssortedBronze&PlasticJags • 75AssortedSwabs/Patches • M-16UtilityBrush • SiliconeCloth • Standard&ShotgunPatchLoops • ChamberFlag • M-Pro7WeaponMaintenanceGuide #070-1556 GUN CARE The Original M-Pro7 kit contains everything needed to maintain all weapons from .22 caliber to 12-gauge shotgun. Now includes an M-16 Chamber brush. • 4oz.M-Pro7GunCleaner • 2oz.M-Pro7GunOilLPX • 2oz.M-Pro7CopperRemover • 50CleaningPatches(.38-.45Caliber) • 1LintFreeGunCloth • 5AssortedBoreBrushes Small-.22,.223Caliber Medium-.30,.30-06,.300Mag Medium-9mm,.357,.38,.40Caliber Large-.45,.410Shotgun 12-GAShotgun • UtilityBrush • 1M-16ChamberBrush • 1ShotgunBrushAdapter • 1.22CaliberLoop • 1FoamGunPad • 1LockableGunCase • 1M-Pro7WeaponsMaintenance&ProductGuide GUN CARE NEW Hoppe’s Elite Pillow Packs. Gun care on the go! • • • • • SingleuseGunOilwithT3andEliteGunCleaner. In-fieldreadytubes. Spouttipforpreciseapplication. Easytocarryandwon’tleak. Availableinmultiplequantities. GCPP8 GCPP26 GOPP8 GOPP32 8 pack Gun Cleaner 26 pack Gun Cleaner 8 pack Gun Oil 32 pack Gun Oil Hoppe’s Elite® Bore Gel Same state-of-the-art technology as Hoppe’s Elite Gun Cleaner, but in a thicker formula that clings to the inside of your bore for extra-deep cleaning and metal conditioning. Hoppe’s Elite Gun Cleaner – NOW AVAILABLE IN AEROSOL Elite Gun Cleaner not only penetrates down to the steel’s molecular pores while cleaning carbon, copper and lead fouling, but it also conditions the metal to repel future fouling. Hoppe’s Elite reduces your cleaning time by up to 80% and it is odorless, biodegradable and non-toxic. Now available in a 4oz aerosol with spray nozzle with spray stick. GC2 GC4 GC8 GC32 GC4A Elite Gun Cleaner Elite Gun Cleaner Elite Gun Cleaner Elite Gun Cleaner Elite Gun Cleaner 2 oz. 4 oz. 8 oz. 32 oz. 4 oz. Aerosol – New BG4 BG1 4 oz. 1 gallon Hoppe’s Elite Gun Oil Uses a thin-coat technology to spread gun oil evenly in a micro-fine layer. This provides superior lubrication and corrosion protection. Traditional oils tend to puddle, not fully coating or protecting the firearm, leaving it vulnerable torustandpotentialmalfunction.Hoppe’sEliteGunOil’s exceptional coating technology provides effective, longlasting protection for your firearm. GO2 GO4 GO4S 2 oz. 4 oz. 4 oz. Spray Hoppe’s Elite Gun Oil with T3 – NOW AVAILABLE IN AEROSOL Hoppe’s best gun oil with a special T3 additive contains liquid molybdenum and liquid PTFE. With the lowest coefficient of friction known to man, this gun oil applies a thin coat technology that will not separate or breakdown, provides long-lasting corrosion protection, and has a temperature range of -40 F to 320 F. Now available in a 4 oz. aerosol with spray nozzle with spray stick. GOT2 GOT4 GO4A Elite Gun Oil with T3 2 oz. Elite Gun Oil with T3 4 oz. Elite Gun Oil with T3 4 oz. Aerosol – New GUN CARE Hoppe’s Elite® Copper Terminator Hoppe’s Elite Gun Tune-up Kit Quickly dissolves welded copper fouling from bore steel without the use of ammonia. Can be used alone or as a powerful systems approach with Hoppe’s Elite Gun Cleaner by removing layers of carbon build up allowing for more rapid copper etching. Does not leave ammonia-type crystals that can attract water causing corrosion and microscopic stress fractures. • Worksupto4timesfasterthanstandard copper removers. • Systemapproachconditionsboreforlesscopper build up. • Ammoniafreeandodorless. • Safeonboresteel. • Non-toxic,non-flammableandhasno shipping restrictions. 4 oz. Contains advanced cleaning and conditioning products to optimize firearm performance and renew the appearance of old and new firearms. Includes 2 oz. bottles of Hoppe’s Elite GunCleaner,CopperTerminator,Gun Oil and Foaming Gun Cleaner. #E4CCFO Hoppe’s Elite Starter Kit AnoldfavoriteinNEW packaging. The perfect way to get started with these top-selling,supereffective gun cleaning and lubrication products. Includes a 2 oz. bottle of Hoppe’s Elite Gun Cleaner and a 2 oz. bottle of Hoppe’s Elite Gun Oil. #ECC4 Hoppe’s Elite Foaming Gun Cleaner NowgettheexcellentborecleaningactionofHoppe’s Eliteinafoamingcleaner.Deep-cleaning,spray-on foam.Penetratesdeepintothebore,removingcarbon andfoulingbetterthanordinarycleaners.Odorless, non-toxic,non-flammableandbiodegradable.Ideal for black powder shooters #EFGC4 Bench Rest® 9 eliminates copper fast. Withthispowerfulsolvent,copper fouling can be cleaned from the bore overnightinsteadoftaking3to4 days.Safe,effectiveandcontainsno abrasives.Besidescopper,it’salsogreat forremovingpowder,leadandplastic foulingfromrifles,shotguns,pistols and revolvers. 5 oz. bottle 5 oz. bottle clamshell Gun Cleaner - Oil GUN CARE 4 oz. #E2CO #BR904 #BR904B Count on Hoppe’s® No. 9 Solvent. Ahighlyeffectiveremoverofpowder, lead,metalfoulingandrust.Flows freely and penetrates rapidly while remaining safe. 5 oz. bottle 5 oz. bottle in clamshell 2 oz. aerosol Pint Quart Gallon drum #904 #904B #905 #916 #932 #9501 Semi-Auto Solvent: The only solvent for semi-autos. Removescopper,leadandpowder foulingfromhigh-performance,semiauto firearms. This cleaner leaves no trace of residue that can cause sticking orjamminginsemis.Worksgreaton any firearm. 5 oz. bottle. #SA904 GUN CARE LUbRiCAtiON thAt kEEps wORkiNG hARd. Lubricating Oil High viscosity oil refined to perfection. Does not harden, gum or become rancid. 14.9 ml precision lubricator 2 1/4 oz squeeze bottle 4 oz. pump 4 oz. aerosol 10 oz. aerosol #3060 #1003 #1004 #1605 #1610 Lefttoright–Hoppe’s ®LubricatingOil in 2 1 / 4 oz. squeeze bottle, 4 oz. pump bottle, 14.9ml precision lubricator, 4 oz. and 10 oz. aerosol. Gun Grease Protects idle firearms by displacing metal ”sweat” when applied to bore or exterior metal. It also provides long-term protection against corrosion while keeping moving parts lubricated. 1 3/4 oz. tube #1102 Large Lubricating Gun Oil Field wipes • Lubricatinggunoilwipesperfectfor field applications. • Drivesoutmoistureandreducescost. • Wipeslubricateleavingthislayerofoil. • Eachwipeis6”x7”. 60 Ct. #9G0 bench Rest Lubricating Oil with weatherguard™ Use before and after range practice to provide moisture and rust protection. Contains a moisture-fighting agent that conventional lubricating oils don’t. 2 1/4 oz. squeeze bottle. #BR1003 Moisture displacing Lubricant MDLdrivesoutmoisturewhileitcleans,lubricates, protects and prevents corrosion on metal surfaces. Also prevents damage from moisture, salt and friction. 4 oz. aerosol #MDL Moly Aerosol, paste and Oil This molybdenum disulfide compound provides excellent lubrication under extreme heat and pressure. Bullets achieve higher velocities and greater accuracy. Also prevents wear and reduces fouling, making barrels easier to clean. 4 oz. aerosol #3068 GUN CARE BoRESNAkE® HAS REvolUTioNizEd THE wAy wE ClEAN oUR GUNS. This patented, one-piece wonder cleans, brushes and swabs all at once. Here’s how the BoreSnake works: Main floss area provides 160 times more surface area than a patch. Bore brush, with bronze bristles embedded in cord, loosens hard deposits. First floss area removes foreign particles prior to the scrubbing action of the brush. FYI The BoreSnake is great for cleaning weapons that shoot non-lethal ammunitions including your 37/40 mm launchers. Rifles ITEM NO. CALIBER 24011 .22 cal. Centerfire & Rimfire, .223 24014 .270, 7mm, .284, .280 caliber 24015 .308, 30-30, .30-06, .300, .303 caliber 24020 .50, .54 caliber launcheR ITEM NO. CALIBER 24040 37mm, 40mm Launcher GUN CARE The world’s fastest bore cleaner. With just one or two pulls, your bore will shine. To prep for storage, just add a few drops of Hoppe’s® No. 9®, Hoppe’s Elite® or Hoppe’s Lubricating Oil. A brass weight on the pull cord is stamped with the size. And we make machine-washable BoreSnakes for most popular calibers. See chart for details. BoreSnake Cleaner Fit Guide Pistols & RevolveRs ITEM NO. CALIBER 24002 .380, 9mm, .38, .357 caliber 24003 .40, .41 caliber 24004 .44, .45 caliber shotguns ITEM NO. GAUGE 24034 16-gauge 24035 12-gauge 24036 10-gauge Note: Blue text indicates popular law enforcement sizes. Here’s how the BoreSnake works... Main Floss area provides 160 times more surface area than a “patch.” Bore Brush, with bronze bristles embedded in cord, loosens hard deposits. First Floss area removes foreign particles prior to the scrubbing action of the brush. GUN CARE BoreSnake Viper™ Cleans even better than the BoreSnake. • • • • Brassweightonthepullcordisstampedwithsize. 50%morebrushcleaningpower. Cone-shapedboreguideontheleadingend. Nyloncordattacheddirectlytothebronze scrubbingbrush. HowtheBoreSnakeViperworks:Slipbrassweight throughthebarrel.Grabthecleaningchordandpull. Mainflossareaswabsyourborewithasurfacearea 160xthesizeofastandardpatch.Borebrush,with bronzebristlesembeddedinthecord,loosenshard deposits.Firstflossarearemoveslargeparticlesprior tothebrush. NEW BoreSnake Venom™ Gun Cleaner Howdoyoumaketheworld’sfastest borecleanerfaster?Giveitsomebite. IntroducingtheNEWBoreSnakeVenom GunCleaner.Formulatedtoworkwith theuniqueBoreSnakedesigntoremove morecarbonandotherfoulingin onepass. 2 oz. 4 oz. BVGC2 BVGC4 BoRESNAkE ClEANER Fit GUidE itEM No. FitS 24000V .22cal.pistols 24002V .357,9mm,.380&.38cal.pistols 24003V .40,.41cal.pistols 24004V .44,.45cal.pistols 24011V M-16,.22–.225cal.rifles 24012V 6mm,.240,.243,.244cal.rifles 24014V 7mm,.270,.284,.280cal.rifles 24015V .308&.30cal.rifles 24020V .50,.54cal.rifles 24033V 20-ga.shotguns 24035V 12-ga.shotguns NEW BoreSnake Venom Gun oil with t3 Thereisareasontheysay“slipperyasa snake.”ThenewgunoilforBoreSnake containsaspecialT3additivewhichcontains liquidmolybdenumandliquidPTFE.Elite PTFEhasthehighestcoefficientoffriction knowntoman. •Developedfromdentaldrilloil(which spinsupto1.5millionRPM). •Thincoattechnologythatwillnot separateorbreakdown. •Long-lastingcorrosionprotection. •Temperaturerange(-40°Fto320°F). 2 oz. 4 oz. BVG02 BVG04 How tHe BoreSnake workS: BraSS weigHt Slip brass weight through the barrel. Grab the cleaning chord and pull. Main floSS area swabs your bore with a surface area 160x the size of a standard patch. Bore BruSH, with bronze bristles firSt floSS area removes large embedded in the cord, loosens hard particles prior to the brush. deposits. GUN CARE BoreSnake® Soft-Sided Gun Cleaning kit A complete BoreSnake Gun Cleaning Kit in a rugged, soft-sided case. Kit includes BoreSnake, Hoppe’s® No. 9 Solvent, Hoppe’s Lubricating Oil, Hoppe’s Weatherguard Cloths and pulling tool. BoRESNAkE Soft-SidEd kit itEM No. fitS 34002 .357-38 cal. pistols 34004 .44, .45 cal. pistols 34010 17 HMR rifles 34011 .22 cal. Centerfire/ Rimfire rifles, .223, 5.56 cal. 34014 .270-7 mm cal. rifles 34015 .30 cal. rifles 34033 20-ga. shotguns 34035 12-ga. shotguns Has everything you need to quickly clean your gun, including the patented one-step Hoppe’s BoreSnake, Hoppe’s Elite Gun Cleaner and Hoppe’s Elite Gun Oil. #EBS9 #EBS12 #EBS15 BoreSnake 32-Piece. display Includes: • 4–24002.357,9mm,.380,.38pistol. • 4–24004.44,.45pistol. • 4–2400310mm/40cal. • 8–24011M16,.22,.222,.223,.225,.22Hornet. • 4–24015.308NATO,7.62x39mm,30-.30,etc. • 8–2403512-gaugeshotgun. #24053 9mm kit 12-ga. kit AR-15 kit GUN CARE Hoppe’s Elite® BoreSnake Cleaning kit GUN CARE FEw thiNGs ARE moRE sAtisFyiNG thAN A ClEAN GUN. Universal Field Cleaning Kit Excellent for pistols, rifles and shotguns. Accessories are neatly packed into a durable soft-sided case that attaches easily to a belt. Contains all necessary accessories, except brushes, with plenty of extra room for items like silicone cloth and cleaning brushes. Specially designed cleaning rod uses single rotating handle for all types of firearms. Great for when you can’t pack a full-size cleaning kit. #FC2 hoppe’s® Dry Cleaning Kits •Theultimaterod-basedcleaningkitwithbrushes, swabs, jags and patches suited for your needs. •Availableinfourassortments. •Perfectforanyfirearm. DKU DKRI DKSG DKPI UNIVERSAL KIT RIFLE KIT SHOTGUN KIT PISTOL KIT Premium Universal Field Kit The soft-sided version of our popular wooden Bench Rest® Premium Gun Cleaning Kit. This full-sized field cleaning kit has everything you need, plus extra room to add your personal tools. Kit includes: No. 9 Solvent, lubricating oil, assorted gun cleaning patches, 3-piece solid brass cleaning rod, 3 slotted ends, 2 adapters, 5 popular phosphor bronze cleaning brushes, silicone cleaning cloth, phosphor bronze utility brush, bore light, 12” x 36” gun cleaning mat, and Hoppe’s Guide to Gun Care. #DFC GUN CARE HoppE’s® ACCEssoRiEs ARE so fAmoUs foR A REAsoN. A long history of taking care of firearms. These kits contain everything you need to keep your firearm immaculate. From solvents and lubricating oils to patches, slotted ends and brushes, Hoppe’s cleaning kits have everything you need for shooting and storage. Available in plastic reusable boxes for easy storage. Or if you want something more economical, select from a Hoppe’s clamshell kit. Tornado Brushes Aspecialspiral-wounddesignmakesithighlyeffective for cleaning bores. The stainless steel loops eliminate any bristle ends that could leave scratches while removing fouling without damaging the bore. ITEM NO. Hoppe’s cleaning kits come with: Rifle Cleaning Kit Includes a brush to fit your specific caliber. Calibers Box .22,.222,.223,.224,.225 U22 Clamshell U22B 1250 .22caliber 1251 .30caliber 1252 .35caliber/9mm 12531 .243/.25caliber 1254 .270caliber/7mm PiStol 1256 .38caliber 1257 .44/.45caliber 1258 .40caliber Shotgun .243,.25,.25-06,.257,6mm,6.5mm —— U243B 1260 12-gauge .270,7mm,.280 .30,30-06,30-30,.303,.308,.32,8mm .17,.204 —— —— U27OB U30B 1262 20-gauge —— D17B Shotgun Cleaning Kit Includes a brush to fit your specific gauge, unless otherwise noted. Gauges 12-gauge Box Clamshell SGO12 SGO12B SGOU SGOUB All gauges (brushesnotincluded) Rifle & Shotgun Cleaning Kit Nobrushesincluded. Calibers/Gauges Allcalibersandgauges Box Clamshell UO UOB (brushes not included) Pistol Cleaning Kit Includes a knob and brush. Calibers Box Clamshell .38,.357,9mm —— PCO22B PCO38 PCO38B .40,10mm PCO4O PCO4OB PCO PCO45B PCOB .22 .44,.45 Allcalibers(brushesnotincluded) GUN CARE • Hoppe’sNo.9Solvent,2oz. • Hoppe’sLubricatingOil,2.25oz. • Squaredie-cutpatchesforanabsorbentsurface with deep cleaning. • Slottedendsandadapters,whereappropriate. • Aluminumcleaningrods. FITS Rifle GUN CARE No mAttER how StUBBoRN, yoUR vC will ComE ClEAN. Universal Bore Guide Exactly what you need to properly clean almost any caliber centerfire bolt-action firearm. Three interchangeable chamber tips fit bore sizes from .17 to .416 caliber. Aluminum action collar fits .695”/.700” (17.65mm/17.78mm) diameter bolt actions of any action length. Threaded brass pin locks the guide into the action in place of the bolt to allow proper cleaning from the breech. #UBG 3-Pack Brush/Swab Kits Super convenient. Our 3-packs give you a cleaning swab, a tornado brush and a phosphor bronze brush. ITEM NO. 1451BK 1452BK 1454BK 1455BK 1456BK 1458BK 1459BK GAUGE/CALIBER .357/9mm .44/.45 .22 caliber .270/7mm .30 caliber 20-gauge 12-gauge Chamber mop 100% cotton swab designed for 5.56mm/.223 caliber chamber cleaning. #1321M Cleaning Swabs 100% cotton swabs are soft, washable and will not scratch smooth shotgun bores. Swabs available for all gauges and most rifle calibers. Cleaning Swabs ITEM NO. 1317 1317A 1318 1319 1320 1321 1322 1323 1324 1325 GAUGE/CALIBER .410 gauge 28-gauge 20-gauge 16-gauge 12-gauge .22/.270 caliber .280/.32 caliber .35/.375 caliber .40/.45 caliber 17 HMR/.204 Nylon and Phosphor Bronze Brushes Nylon brushes will handle most cleaning jobs and the built-in memory makes the bristles return to their original shape so the brushes can be used over and over again. Nylon offers a unique scrubbing action for a thorough cleaning. Phosphor bronze brushes are available in the same styles and calibers as the nylon, but these brushes are most effective on lead. Phosphor Bronze & Nylon Brushes NYLON PHOSPHOR BRONZE GAUGE/CALIBER 1304 1305 – 1309 1310 – 1315 – 1316 1301P 1302P 1302AP .17 caliber (male end) 1304P 1305P 1305AP 1309P 1310P 1310AP 1315P 1315AP 1316P 6mm .17 cal, Centerfire/17HMR/.204 .17 cal, Centerfire/17HMR/.204 .22 caliber .270 caliber/7mm .30 caliber .338/8mm caliber .35 caliber/9mm .243/.25 caliber .416 caliber .44/.45 caliber .50/.54 caliber .375 caliber PISTOL 1306 1306A 1307 1307A 1308 1308A 1306P 1306AP 1307P 1307AP 1308P 1308AP .22 caliber .32 caliber .38 caliber 9mm .44/.45 caliber .40 caliber/10mm SHOTGUN 1311 1311A 1312 1313 1314 1314A 1311P 1311AP 1312P 1313P 1314P 1314AP .410 gauge 28-gauge 20-gauge 16-gauge 12-gauge 10-gauge RIFLE 1301 1302 GUN CARE Patches Uniformly woven patches. Pre-cut caliber and gauge sizes for optimum cleaning performance. Assorted Competition Targets All targets are printed to precise specifications on special target tag board or paper. Targets are shrink wrapped 20 per package or 100 per package (bulk). Shrink Wrapped 20/Pkg. Rifle item No. DescRiptioN A-1 A-5 A-9 A-14 A-17 Standard Patches ITEM NO. 1201 1202 1203 1204 1205 No.1 No.2 No.3 No.4 No.5 CALIBER #PER PAK Small bore, 17 HMR, .204 60 .22 to .270 caliber 60 .270 to .35 caliber 50 .38 to .45 caliber and .410 to 20-ga. 40 16/12-gauge 25 Bulk Patches CALIBER #PER PAK .22 to .270 caliber 500 .270 to .35 caliber 650 .38 to .45 caliber & .410 to 20-gauge 500 16/12-gauge 300 pistol item No. DescRiptioN B-2 50 ft slow fire 101/2 x 12 tag B-3 50 ft timed and rapid fire 101 / 2 x 12 tag B-7 50 yd slow fire centers 10 1 / 2 x 10 1 / 2 paper B-9 25 yd rapid fire center 10 1 / 2 x 10 1 / 2 paper B-16 25 yd slow fire center 10 1 / 2 x 12 tag B-24 50 ft rapid fire silhouette 12 x 20 tag B-27B* Police silhouette 35 x 45 paper * Packed only in box of 100. AiR Rifle AND pistol item No. DescRiptioN A-45 5 meter rifle five bulls 10 x 12 tag Bore Light Self-Adhering Bull’s Eye Dots Bull’s Eye dots allow the shooter or archer to pinpoint the way to better groupings and scores. Available for sighting-in rifles and target practice with slug shotguns and pistols. ITEM NO. SIZE PER PACKAGE #DOT1 1" 105 For sighting-in rifles & patching paper targets. • Now you can illuminate the bore entirely to expose nicks, scratches, pits and fouling. • Great for safety checks and lighting hard-to-reach areas. • Locking feature can keep light on for longer inspections. • Indispensable for buyers of used firearms. • Runs on two AAA batteries (not included). #BRL1 Cleaning and Maintenance Cradle The safe and easy way to clean, maintain or display virtually any long gun. Both sides of the cradle are notched to hold any size of cleaning rod. Adjusts for length and quickly disassembles without tools, for compact transport in your range bag or cleaning kit. #HCC GUN CARE ITEM NO. 1202S 1203S 1204S 1205S 50 ft junior rifle single bull 7 x 9 paper 50 ft five bulls 7 x 9 tag 50 yd single bull 7 x 9 paper 100 yd small bore single bull 14 x 14 paper 50 ft 11 bulls 10 1 / 2 x 12 tag You’ve been Given The GReen LiGhT. opTics Precision engineering. Optical excellence. Rock-solid reliability. They all converge in the finest family of tactical riflescopes in the world today. neW 6–24x 50mm Built for extended-range precision, featuring our first focal plane illuminated Mil-Dot reticle that gives you the ability to range a target across the entire magnification range, unlike standard Mil-Dot systems that are calibrated for a single setting. opTics Features •RainGuard® HD •Ultra Wide Band Coating •Fully multi-coated optics •Blacked-out cosmetics •Target turrets neW 10x 40mm neW 2.5–16x 42mm Fixed-power target scope with Mil-Dot reticle and target turrets. A standout of versatility with our blacked-out finish for concealment. ET1040 Reticle: Mil-Dot / Finish: Matte a a * a a a * a Denotes 30mm tube. *First focal plane. ET2164 Reticle: Mil-Dot Finish: Matte Special features: 3” Sunshade Optics First strike Red Dot sight • • • • • • Compact/Lightweight FullyWaterproof 5MOADot AutomaticBrightnessAdjustment IntegralmountcompatiblewithWeaver/Picatinnystylebase Protectivehoodincluded #730005 Red T-Dot Green T-Dot 1x Mp/ 2x Mp Findyourtargetfast.TheT-dotreticle illuminatesinredorgreenbehind1x magnification.There’snofasterwayto getonyourtarget.Featuresabuilt-in mountforWeaver-stylerailandaCR2032 battery.Mattefinish. #730132P - 1x Magnification #730232P - 2x Magnification tRs-25® Alwaysready.Shootwithbotheyesopen.3MOARed Dotwithadjustablebrightnesscontrol.Handlesextreme recoil.Theultra-compactTRS-25hasextendedbattery lifeat3000hoursandwaterprooftoIPX7standards. UsesCR2032battery. #731303 Optics tactical Rifle scopes (tRs) • • • • • • • • Adjustablegreenilluminationforprecisioninvaried lightingconditions. Mil-DotbarsystemfunctionsasaMil-Dotwithathinline foreasieralignmentforrangefindingandholdover. Magnification:4—16xor10x. Objectivediameter:50mm. Eyerelief:3.5”. tRs specificatiOns Tubediameter:30mm. TUBE ITEM POWER/ Optics:Multi-coated. NO. OBJ. Reticle:IlluminatedMil-Dotbar Lens mm RETICLE LENS COATING EyE RELIEf fINISH CLICK VALUE BK81001 4—16x 50mm 30mm Illuminated Mil-Dot Bar Multi-Coated 3.5” Matte .25 BK81008 4—16x 50mm 30mm Ill. Mil-Dot Bar Multi-Coated 3.5” Matte .1 mil BK81003 10x 50mm 30mm Illuminated Mil-Dot Bar Multi-Coated 3.5” Matte .25 BK81009 10x 50mm 30mm Ill. Mil-Dot Bar Multi-Coated 3.5” Matte .1 mil RETICLE LENS COATING EyE RELIEf fINISH CLICK VALUE Donut Dot Fully Coated 3.5” Matte .25 Designated Marksman scope (DMs) 12.6MOAdonutforrapidtargetacquisitionatranges ascloseas3meters. Illuminateddotreticleallowsyoutoseeyourtarget clearlyinlow-lightconditions. 1MOAdotforoptimummedium-toextended-range precisionupto500yards. Magnification:1-4x. Objectivediameter:24mm. FOV@100yards:23’@4xand90’@1x. Eyerelief:3.5”. DMs specificatiOns Tubediameter:30mm. ITEM POWER/ TUBE Optics:Fullycoated. NO. OBJ. Lens mm Reticle:Donutdot. BK81002 1—4x 24mm 30mm Optics • • • • • • • • • • Long Range scope (LRs) Huge56mmobjectiveforawiderfieldofviewandbrighter image. • Super-strong35mmtubeimprovesreliability. • Magnification:6—25x. • Objectivediameter:56mm. LRs specificatiOns • Eyerelief:3”. ITEM POWER/OBJ. NO. Lens mm • Tubediameter:35mm. • Optics:Fullymulti-coated. BK81004 6-25x 56mm • Reticle:Glass-etchedMil-Dotbar. CLICK VALUE LENS COATING fINISH .25 MOA Click Fully Multi-Coated Matte Mil-Dot Bar RETICLE BK81005 6—25x 56mm .1 Mil Click Value Fully Multi-Coated Matte Mil-Dot Bar BK81006 6—25x 56mm .25 MOA Click Fully Multi-Coated Matte Illum Mil-Dot Bar BK81007 6—25x 56mm .1 Mil Click Fully Multi-Coated Matte Illum Mil-Dot Bar Optics #781548P 15–45x 60mm #191142 #191144 Elite® 60mm Roof-prism spotter Critical missions demand reliable optics. Premium BaK-4 prisms and fully multi-coated lenses deliver flawless color fidelity, ultra-crisp images and optimum light transmission. Rugged, waterproof construction and Rainguard® HD coating keep things clear. #781548P 15-45x60mm NEW Monocular Now you can travel light without sacrificing true excellence in imagery. Our new Legend® Ultra HD Monocular incorporates the features of our worldfamous legend Ultra HD binoculars into an ultrastreamlined platform that easily tucks in the pocket of a pack or the console of your vehicle. Premium components like ED Prime Glass, PC-3 Phase Coated prisms and fully multi-coated optics deliver bright, clear views from edge to edge. Perhaps the finest monocular ever built, it can be handheld or mounted to a tripod for more stabiligy. Options include a Mil-Hash reticle for tactical, law enforcement and other long-range shooting applications. #191142 $191144 (Tactical) #786351ED Window Mount 12–36x 50mm #785460ED Legend® Ultra-HD spotters 15–45x 60mm ED glass performance at the right price. Delivers unbelievable performance at prices previously unheard of for scopes with ED (Extra-Low Dispersion) Prime glass. Creates incredible resolution and contrast by virtually eliminating chromatic aberration and color fringing—even under strong backlighting. Stacked, dual-focus controls permit you to make both fast and finely-tuned focus adjustments. Rainguard HD coating protects the lenses from the elements. #786350ED #786351ED #785460ED 12-36x50mm (straight eyepiece) 12-36x50mm (angled eyepiece) 15-45x60mm (straight eyepiece) #784407C Full-size, heavy-duty mount for larger scopes. car Window Mount #784405 Medium-duty mount suitable for 50 or 60mm scopes. Optics Legend® Ultra-HD Binoculars ED prime Glass. EDPrimeExtra-LowDispersion fluorite glass delivers amazing color resolution andcontrast,andvirtuallyeliminateschromatic aberrationandcolor-fringingtobringoutthemost distinctdetailspossibleinlow-lightconditions. Legend Ultra HD 10x42 #191042 #191036 #198042 #190125 10x42 10x36 8x42 10x25 Excursion® EX Binoculars Get a wide view at a great price. The widest field of view of any binoculars in its class for tactical scenarios. Perform at a level much higher than you would expect at this price. • Lockingfocuswheel. • Lightweight. • Bestopticalsysteminitsclass(Fullymulti-coated lenses+PC-3® Phase Coated prism). • BaK-4prism. • Twist-upeyecups. • 100%waterproof/fogproof. • Closefocusandlongeyerelief. • Soft-touchthumbgrip. • Quickattach/detachneckstrap. • Rugged,sure-griprubberarmoring. #244210 #244208 10x42 8x42 RainGuard® HD. Withoutit,you’renotready.Awet lens or a misguided breath that would fog conventionalglasswillnevercostyouaview.Thispatented, permanent,water-repellentcoatingcausesmoisture fromrain,snow,sleetorcondensationtobeadup andscatterlesslight,soyougetaclear,brightview when other optics would be rendered useless. Excursion EX 10x42mm pc-3® phase coating Foundonthebestroof-prismbinoculars,thischemical coating is applied to the prisms to enhance resolution andcontrast.Wouldnotprovideanadvantageonporroprism models. Waterproof/Fogproof SomebinocularsareO-ringsealedandnitrogenpurged for total waterproof and fogproof protection. These models can withstand complete immersion in water and staydryinside.Theinterioropticalsurfaceswon’tfog due to rapid temperature change or humidity. Optics Identifyyoursuspectinlowlight.Oursuper-premium EDPrimeglassgivesyouunparalleledcolorfidelity, brightness and light transmission. • UltraWideBandCoating. • RainGuard®HDwater-repellentlenscoating. • Ultra-widefieldofview. • Lightweight,magnesiumchassis. • Waterproof/fogproof. • Soft-touchgrips. • Lockingdiopter. • Includespremiumcarrycase,neckstrap, microfiber lens cloth and deluxe binocular harness. Ultra Wide Band coating. Ananti-reflection coating process that is customized for every lens element in the optical path in order to allow the best possible light from the front glass all the waybacktotheeyepiece.Theresult?Optimum brightness and true color across the light spectrum. Optics Legacy® Binoculars Perfectfortightbudgets.Featuresfullymulti-coated opticsandpremiumBaK-4prismsforexceptionallight transmissionandimageclarity. • BaK-4prisms. • Fullymulti-coatedoptics. • 100%waterproof/fogproof. • Wide-anglefieldofview. • Rubberarmoredforsecuregrip. • Centerfocus. • Twist-upeyecups. • Longeyerelief. #120150 #120842 10x 50mm #120150 10x50 8x42 Big 50mm objective for a larger, brighter field of view. fusion® 1600 arc an advanced fusion of Our finest technologies. Theultimateinefficiency,ourFusion1600ARCmelds thebestofBushnell®binocularswithworld-leadinglaser rangefindingcapabilities.Andit’snolargerorheavier thanapairof10x42mmbinoculars.Everydetailis magnifiedwithrichcontrastandstunningclarityfrom edgetoedgeusingpremiumfullymulti-coatedoptics andBaK-4prisms.Atthepushofabutton,itdisplays exactdistancetoyourtargetfrom10to1,600yards. VARIABLE SIGHT-IN FEATURE rangefinder features: • • • • • • 10-1600yardsrangingperformance. ARC(AngleRangeCompensation)from-90ºto+90º. RifleMode–Providesline-of-sight,angleandbullet- drop/holdoverupto199inches. VSITM(VariableSight-In)–Allowssight-indistance optionsof100,150,200,or300yardssight-in distancewheninRifleMode. SelectiveTargetingSystem–AutomaticSCAN,Bull’sEye &Brushmodes. +/–Oneyardaccuracy. Binocular features: • • • • • • XTR®technologyforultimatelighttransmission. Bak-4prismswithPC-3®PhaseCorrective Coatingforsuperiorresolutionandclarity. RainGuard®HDwater-repellentlenscoating. 100%waterproof. VDT™(VividDisplayTechnology)–Enhancesdisplay readoutinalllightingconditions. Carryingcase,batteryandneckstrapincluded. #201042 #201250 10x42 12x50 BinOcuLar specificatiOns size Model Magnification class x obj. lens focus PrisM PrisM glass Pc-3® PHase lens rainguard® Hd field of view ft.@1000yds. / M@1000M close focus exit PuPil eye relief eyecuPs water/ fog Proof (ft / m) (mm) (mm) 201250 12x 50 standard center roof baK-4 yes fully Multi yes 252 / 77 10.5 / 3.2 4.2 16 twist-up yes 201042 10x 42 standard center roof baK-4 yes fully Multi yes 305 / 101 10.5 / 3.2 4.2 18 twist-up yes Laser rangefinder specificatiOns rangefinder range sPecs (yds) –––––––– TARGETING MODES –––––––– bullseye brusH Magnification weigHt (oz. / g) battery tyPe scan –––– ARC MODES –––– bow rifle –––––––––– RANGING PERFORMANCE –––––––––– tree deer accuracy rflctv. (yds.) (yds.) (yds.) (yds.) 201250 10–1600 12x 32.7 / 927 3-volt cr 123 (incl.) yes yes yes yes yes 1600 1000 500 +/– 1 201042 10–1600 10x 31 / 879 3-volt cr 123 (incl.) yes yes yes yes yes 1600 1000 500 +/– 1 Optics elite® 1600 arc™ • • • • • • • • • • • StandardScanmode. BullsEyeTMmode. BrushTMmode. RainGuardHD. 100%waterproof. Fullymulti-coatedopticsrubberarmored. Twist-upeyepiece. Built-intripodmountDiopteradjustment. VDT™(VividDisplayTechnology)enhancesdisplayreadoutin alllightingconditions. Compatiblewithmagneticattachmentsystem. Posi-Thread™batterydoor. #205110 neW – g-force 1600 arc™ Rubberarmoredmetalhousing. 6xmagnification. VDT(VividDisplayTechnology). E.S.P.(Extreme.Speed.Precision.). VSI(VariableSight-in). BowMode–providestruehorizontaldistancefrom5–99yards. RifleMode–providesbullet-drop/holdoverininches. Bullseye,BrushandScanmode. Range:5–1,300yards. Diopteradjustment. Compatiblewithmagneticattachmentsystem. FullywaterproofuBuilt-intripodmount. Posi-Thread™batterydoor. Optics • • • • • • • • • • • • • #201965 scout 1000 arc™ • • • • • • • • • • • • Built-ininclinometerprovidesARC. Pocket-sizeergonomicdesign. 5xmagnification. BowMode–providestruehorizontaldistancefrom5–99yards. RifleMode–providesbullet-drop/holdoverininches. Bullseye,BrushandScanmode. RainGuard®HD. Range:5–1,000yard. Diopteradjustment. Carryingcase,batteryandneckstrapincluded. Compatiblewithmagneticattachmentsystem. Posi-Thread™batterydoor. #201932 Laser rangefinder specificatiOns Model range (yds.) Magnification 205110 5–1600 7x size (in. / mm) weigHt (oz. / g) battery tyPe 1.7x5.1x3.7 / 43x129x94 12.1 / 343 3-volt (cr123) 201965 5–1300 6x 1.7x4.3x2.9 / 43x109x74 201932 5–1000 5x 1.6x2.8x4.3 / 41x71x108 6.6 / 187 7.4 / 210 3-volt cr2 (incl.) 3-volt cr2 (incl.) ––––––– ranging PerforMance –––– –––––––––––––––––– targeting Modes ––––––––––––––– scan rain reflector bow rifle bullseye brusH rflctv. tree deer accuracy (yds.) (yds.) (yds.) (yds.) yes built-in built-in yes yes yes yes 1600 1000 600+ +/– 1 yes built-in built-in yes yes yes yes 1300 900 600 uP to 1/2 yes built-in built-in yes yes yes yes 1000 650 325 +/– 1 TECHNOLOGY 3x 32mm Digital Color Night Vision Uses a new color technology to penetrate darkness with more true-to-life detail than ever before possible in a night vision optic of its class. Digital system offers supreme resolution and clarity over traditional Gen. 1 analog, with a maximum viewing range of approximately 350 ft. Also includes true 3x magnification, rugged armored housing and a wide field of view at 100 yds. • True3xmagnification. • Digitalimagegeneration. • In-viewcolorLCDdisplay(vs.green). • Over70-feetviewingrangeat100yds. • Weather-resistant. • Videooutputcapability. • Operateson4AAbatteries(notincluded). #260332 Equinox Delivering image clarity, illumination and field of view unrivaled –evenwithzeroambientlight–ournewEquinox™seriesraises thebarindustry-wideindigitalandGen.1nightvision.Thetwo digital configurations pierce the night with utmost efficiency, offering the option of a traditional green view for dusk and dawn while some ambient light is available, and white imaging for use in almost-dark to completely dark conditions. Whereincreaseddepthperceptioniscritical,oursuper-bright Gen 1 model packs more intensity than any Gen 1 optic before it. • True2xpowermagnification. • SuperbrightGen1. • IPX4water-resistant. • Durablerubberhousing. • Longbatterylife • Compactandlightweight. #260228 #260440 #260650 The Problem: Conventionalflashlights 5x 42mm StealthView™ Thepowerofdigitalnightvision.Equippedwithapowerful infraredspotlight,theStealthViewprovidescrisp,edge-toedge sharpness in the darkest conditions. • ImagecomparabletoGen2. • CMOSvs.imageintensifiertube. • In-viewB&Wmicrodisplay. • Adjustableeyepiece. • Powerfulinfraredspotlight. • Viewingrangeof600feet. • Weather-resistant. • Videooutput. • Built-intripodmount. • RunsonsixAAbatteries. • TwohoursofcontinuousruntimewithIRon. • EighthoursofcontinuousruntimewithIRoff. #260542 produce circular patterns of light that are non-uniform irregular “blobs” of light. The Solution: Innovativeandpatentedtechnology provides a uniform pattern of light – fromedgetoedge.Resulting inaperfectlyuniformsquare Bushnell® HD Torch • • • • • beam of light and providing “HighDefinitionIllumination.” Evenlydistributedsquarebeamlightpattern. Powerful165-lumenoutput. 1.5hourcontinuousruntime. Rotatingheadwithhighandsafetystrobesettings. Rugged,waterproof,aircraft-gradealuminumhousing with hard-anodized finish that won’t scratch or mark. • Find-Mefeatureandbatterylifeindicator. • Includestwo3-voltlithiumbatteries. #100400C TECHNOLOGY G GUN UN CARE CARE BackTrack™ Point-5 GPS BackTrack Point-5 GPS gives you more features than ever: a digital compass that shows you your latitude and longitude coordinates, the current time, temperature and altitude, as well as the ability to mark and store up to 5 locations and easily find your way back. s 5TILIZESTHELATESTDIGITALTECHNOLOGY s (IGHSENSITIVITY'03RECEIVER s 1UICKSATELLITEACQUISITION s 7EATHERRESISTANT s /PERATESON!!!BATTERIESNOTINCLUDED s #OMPACTSIZESTORESEASILYINYOURPOCKET s #ARABINERCLIPINCLUDEDFOREASYATTACHMENT s 3ELFCALIBRATINGDIGITALCOMPASS #360200 Surveillance Cameras #119436C #119446 (Camo) NEW Trophy Cam HD #119437C (Brown) #119447C (Camo) #119476C (Black LED) #119477C (Black LED, 2.4” Viewscreen) TECHNOLOGY Trophy Cam AUDIO RECORD G PS GEOTAG Trophy Cam Features T s -0 HIGHQUALITY FULL COLOR RESOLUTION s %XTERNAL POWER COMPATIBLE s !DJUSTABLE 0)2 ,O-ED(IGH s SECOND TRIGGER SPEED s 0ROGRAMMABLE TRIGGER INTERVAL SEC TO MIN s -ULTIIMAGE MODE IMAGES PER TRIGGER s 6IDEO LENGTH SECOND TO SECONDS PROGRAMMABLE s &IELD 3CAN TIMELAPSE MODE TAKES IMAGES AT PRESET INTERVALS MINUTE TO MINUTES s 4EMPERATURE RANGE ª & TO ª & s 0)2 SENSOR IS MOTION ACTIVATED OUT TO FT s 2UNS UP TO ONE YEAR ON ONE SET OF BATTERIES s !DJUSTABLE WEB BELT AND SOCKET s 3$ CARD SLOT UP TO '" Trophy Cam HD Features s -0HIGHQUALITYFULLCOLORRESOLUTION s External power compatible. s !DJUSTABLE0)2,O-ED(IGHOR!UTO0)2 s 0.6-second trigger speed. s Programmable trigger interval: 1 sec. to 60 min. s Multi-image mode: 1-3 images per trigger. s Video length: 1 second to 60 seconds, programmable. s &IELD3CANXTIMELAPSEMODETAKESIMAGESAT pre-set intervals, 1 minute to 60 minutes. s Temperature range -5° F to 140° F. s 0)2SENSORISMOTIONACTIVATEDOUTTOFT s 2UNSUPTOONEYEARONONESETOFBATTERIES s !DJUSTABLEWEBBELTANDSOCKET s 3$CARDSLOTUPTO'" 87 Optics BOllÉ tActicAl sunglAsses Bollé Tactical sunglasses feature ballistic polycarbonate lenses in an ultra-flexible nylon frame designed to ensure maximum high-impact protection against any event. Manufactured to the highest standards Bolle Tactical frames feature extreme wrap designs to ensure a close comfortable fit with an unrestricted field of view, non-slip temples, 100% UVA/UVB protection and the best anti-scratch/anti-fog coatings available. ESP Lens: (Extra Sensory Perception) An innovative coating enhances the ability to see detail and improve contrast without distorting colors by reducing glare, eyestrain and the harmful effects of blue light. ESP filters 70% of blue light while delivering 63% visible light transmission and 100% UVA/UVB protection. Twilight Technology: Built on the successful platform of Bollé Tactical’s ESP coating system, Twilight technology offers the added benefit of anti-fog coating on both sides of the lens to prevent fogging in the most challenging conditions. The high contrast, high definition and excellent light transmission of the lens proves ideal for low light, outdoor work environments, particularly early morning and late evening. Polarized Lens: Light can bounce and reflect off a myriad of surfaces, such as water, snow and the road. Bollé Tactical polarizing technology removes the glare and the stress it causes to your eyes. The lenses block virtually 100% of UVA/UVB rays. Protection that goes well beyond government and commercial standards. Smoke Lens: A technology approved for permanent wear and certified with a perfect optical quality. Our standard smoke lens provides excellent protection against UV and solar radiation with anti-fog and anti-scratch coatings. Silver Flash Lens: This coating is based on a grey tinted sun lens absorbing 88% of visible light. The additional mirror coating in silver reflects heat. This lens is ideally suited for outdoor use in strong sunlight. It filters: 90% blue light, 88% visible light and blocks virtually 100% UVA/UVB. Red Flash Lens: This coating is based on a grey tinted sun lens for increased light reduction. With 87% of visible light absorbed by this lens, it is ideally suited for outdoor use in strong sunlight. It filters: 89% blue light, 87% visible light and blocks virtually 100% UVA/UVB. ROgue clear ANSI Z87.1-2010 and MIL-PRF-31013 ROGUE is a unique model thanks to its wide field of view combined with a high ballistic resistance to accommodate for bright and low-light situation. Comes with non-slip nose and ear pieces for extra added protection. The ROGUE kit comes with clear, smoke and yellow lens, micro-fiber pouch and rigid carrying case. ROgue tActicAl sunglAsses Yellow Smoke SKU DeScription 40136 Rogue Mt Blk Clr U6+yel U6L1.3+smk U6L3 AS AF ANSI Z87.1+U6 MIL-PRF-31013 sWAt ANSI Z87.1-2010 and MIL-PRF-31013 Thanks to its non-slip bridge, flexible temples and ultra wrap design, SWAT provides comfort and maximum protection. Available in smoke, silver flash and polarized lens options. sWAt tActicAl sunglAsses Silver Flash Smoke polarized SKU DeScription 40137 Swat Shiny Blk Smoke AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40138 Swat Shiny Blk Silver Flash AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40139 Swat Shiny Blk Polarized AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 Optics RAngeR ANSI Z87.1-2010 and MIL-PRF-31013 Featuring a non-slip bridge, flexible temples, and lateral ventilation, RANgER is available in smoke, polarized and red flash lens options. RAngeR tActicAL sUngLAsses red Flash Smoke SKU DeScription 40140 Ranger Shiny Blk Smoke AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40141 Ranger Shiny Blk Red Flash AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40142 Ranger Shiny Blk Polarized AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 polarized sentineL Smoke red Flash sentineL tActicAL sUngLAsses SKU DeScription 40143 Sentinel Mt Blk Smoke AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40144 Sentinel Mt Blk Red Flash AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40145 Sentinel Mt Blk ESP AS AF ANSI Z87.1+U6L1.5 MIL-PRF-31013 eSp AssAULt ANSI Z87.1-2010 and MIL-PRF-31013 With its non-slip nose and ear pieces, flexible temples and its ultra wrap design, ASSAULT provides maximum comfort and protection. Assault is available in smoke, ESP and Twilight. twilight Smoke eSp AssAULt tActicAL sUngLAsses SKU DeScription 40146 Assault Mt Blk Smoke AS AF ANSI Z87.1+U6L3 MIL-PRF-31013 40147 Assault Mt Blk ESP AS AF ANSI Z87.1+U6L1.5 MIL-PRF-31013 40148 Assault Mt Blk Twilight AS AF ANSI Z87.1+U6L2 MIL-PRF-31013 Optics ANSI Z87.1-2010 and MIL-PRF-31013 Adjustable non-slip nose and ear pieces, flexible temples and ultra wrap design provide comfort and maximum protection. SENTINEL is available in smoke, red flash and ESP. POP Point of Purchase Uncle Mike's® Uncle Mike’s Authorized Dealer Decal 9106181106 Uncle Mike's Swivel Selection Guide 9107030907 Uncle Mike's Holster Selection Guide 9107040907 Uncle Mike's Event Banner 9108291008 Uncle Mike's Swivel Blade 9109411109 Uncle Mike's Sidekick Holster Blade 9109421109 Blade Display Slat Wall/Grid Blade Hook 9108311108 Reflex Holster Demo Display 9110730911 Uncle Mike's® law enfOrceMent UMLE Authorized Dealer Decal 9106211106 Reflex Holster Demo Display 9110730911 BUtler creek® Butler Creek Authorized Dealer Decal 9106191106 Butler Creek Antique Metal Sign 9106231106 Butler Creek Scope Cover Counter Mat 9106900807 Butler Creek Scope Cover Selection Guide 9107020907 Butler Creek Event Banner 9108271008 Butler Creek Scope Covers Blade 9108361108 Butler Creek Lula Loader Blade 9108371108 Butler Creek Slings Blade 9108381108 Display Slat Wall/Grid Blade Hook 9108311108 9106181117 Dimensions: 37” H x 19” w x 10” D 32-Piece kydex disPlay 9106181117 (Sporting goods and LE headers included) Qty. Item 4 54211 SZ21 Kydex Open Top Holster RH HOPPe's®, HOPPe’s® elite, M-PrO 7® 4 54201 SZ20 Kydex Open Top Holster RH Hoppe's Authorized Dealer Decal 9106171106 4 54191 SZ19 Kydex Open Top Holster RH Hoppe's LE Antique Metal Sign 9107050907 Hoppe's BoreSnake Counter Mat 9107151107 4 54121 SZ12 Kydex Open Top Holster RH Hoppe's 9 Event Banner 9108301008 4 54361 SZ36 Kydex Open Top Holster RH Hoppe's BoreSnake Blade 9108321108 4 54251 SZ25 Kydex Open Top Holster RH Hoppe's 9 Blade 9108331108 4 54221 SZ22 Kydex Open Top Holster RH Hoppe's Elite Blade 9108341108 Hoppe's Elite Counter Mat 9108170908 4 54261 SZ26 Kydex Open Top Holster RH M-Pro 7 Blade 9109381109 M-Pro 7 Counter Mat 9109391109 M-Pro 7 Banner 9109401109 2' Hoppe's 9, Hoppe's Elite, M-Pro 7 Header 9109710410 4' Hoppe's 9, Hoppe's Elite, M-Pro 7 Header 9109720410 Qty. Gun Care Blade 9109650210 6 89151 SZ15 ISP Holster RH Display Slat Wall/Grid Blade Hook 9108311108 6 89361 SZ36 ISP Holster RH 6 89051 SZ5 ISP Holster RH 6 89161 SZ16 ISP Holster RH 6 89121 SZ12 ISP Holster RH 6 89001 SZ00 ISP Holster RH stOney POint® 48-Piece inside-tHe-Pants disPlay 9106181118 (Sporting goods and LE headers included) Item Stoney Point Authorized Dealer Decal 9106201106 Stoney Point Event Banner 9108281008 Stoney Point Blade 9108391108 6 89101 SZ10 ISP Holster RH Blade Display Slat Wall/Grid Blade Hook 9108311108 6 89011 SZ01 ISP Holster RH Uncle Mike’s Law Enforcement® holsters are protected by U.S. Patents 5,282,559 and 5,419,474. BoreSnake is protected by US Patents 5,871,589 and 5,972,125; Australian Patent 723,977 and Canadian Patent 2,264,899. The PRO-3 Duty Belt Buckle is protected by U.S. Patent 5,774,956. The LoPro Swivel is protected by U.S. Patent 6,536,154. © 2011 Bushnell Outdoor Products All rights reserved. Product specifications, styles and packaging are subject to change without notice. Delrin, du Pont, Kevlar and Nomex are trademarks of du Pont de Nemours and Company. Hipora is a trademark of Kolon Industries, Inc. Kodra is a trademark of Gabriele Roleff. Kydex is a trademark of Kleerdex Company, LLC. Luxeon is a trademark of Philips Lumileds Lighting Company, LLC. Lycra and Spandex are trademarks of Invista North America, S.A.R.L. Mag-Lite and Mini-Mag are trademarks of Mag Instrument Inc. Mossberg is a trademark of O.F. Mossberg & Sons, Inc. M-Pro 7 is a trademark of Pantheon Chemical, Inc. Pelican is a trademark of Pelican Products, Inc. Reflexite is a trademark of Reflexite Corporation. Remington is a trademark of RA Brands LLC. SafariLand is a trademark of SafariLand Ltd, Inc. Scorpion, Stinger and Streamlight are trademarks of Streamlight, Inc. Spectra is a trademark of Royal DSM N.V. SuperFabric is a trademark of Higher Dimension Medical, Inc. Sure-Fire is a trademark of Surefire LLC. Thinsulate is a trademark of 3M Company. Velcro is a trademark of Velcro Industries, B.V. Winchester is a trademark of Olin Corporation. All other trademarks used in this catalog are property of their respective owners. GUn CaRe PoP 24053 Dimensions: 25” H x 17” W 9” D 80-Piece Holster Display Rack 9106181115 (Sporting Goods and LE headers included) • Includes header card and 20 holster hooks. • Holsters not included. ITEM QTY DESCRIPTION 24002 4 .357, 9mm, .380, .38 Caliber 24004 4 .44, .45 Caliber 24011 8 M-16, .22 - .225 Caliber Rifle 24003 4 .40, .41 Caliber 24015 4 .308 - .30 Caliber Rifle, Clam 24035 8 12-Gauge Shotgun, Clam 9107151107 1 Boresnake Counter Mat MO113255 8 Reorder Card POP F0105009091 9108960609 1 Boresnake Header Card PoP 24-Piece Gun Case Display Rack 9106181116 (Sporting Goods and LE headers included) • Includes header cards and 4 large water fall hooks. • Gun cases not included. 16-Piece Gun Case Display 27658 (Sporting Goods and LE headers included) • Includes header cards. • 16 “S” hooks. • Mounts to slat wall or pegboard. • Gun cases not included. Holster, belt and accessory Revolving Display 99603 Dimensions: 24” W x 24” D x 72”H (Sporting Goods and LE headers included) • 3-sided display is constructed of rugged wire grid. • 60 - 8" grid hooks and header cards. 9200 Cody, Overland Park, KS 66214 US 800.845.2444 • Outside US 913.752.3400 Fax: 913.752.3550 or 800.548.0446 www.unclemikesle.com © 2012 Lit. number: 9110931111 ®, ™ denote trademarks of Bushnell Outdoor Products. 30% PROUD USA COMPANY Cert no. SCS-COC-001158 The paper used to print this catalog contains 30% post consumer waste and has been made using green power.