ranney school strategic plan 2010–2013

Transcription

ranney school strategic plan 2010–2013
Turning Vision Into Reality ...
The Dream Continues
Final Report
Nil Sine Magno Vita
Labore Dedit Mortalibus
Life Grants Nothing
Without Hard Work
Lawrence Sykoff
Center for Excellence
A LIVING MISSION
During the 2009–2010 school year, Ranney School developed a three-year Strategic Plan, “Turning Vision into Reality ... The Dream Continues.” An all-encompassing,
collaborative effort developed by trustees, administrators, teachers and parents, the
Strategic Plan was designed to provide children with a 21st-century education in a
culturally stimulating, state-of-the-art environment while maintaining our traditional
values. Our school’s mission statement framed the plan’s direction and approach:
Ranney School provides students with an exemplary, well-rounded education,
one that promotes the development of every child’s intellectual, personal, creative and moral promise. By serving a diverse community that values a rigorous,
wide-ranging program of study, Ranney students are inspired to reach their full
potential. Guided by dedicated and compassionate professionals, the Ranney
experience is distinguished by the heartfelt bond between student and
teacher—the hallowed principle celebrating the unique nature of every child. In
an environment with contemporary learning resources, students learn the value of contributing to their local and global communities through leadership and
service. The school’s motto—Knowledge,Vision, Honor—is as much an inspiration as it is a social imperative, one that informs the thinking and actions of our
students. Awakening students’ intellectual potential and encouraging them to
FRPPXQLFDWHZLWKFRQÀGHQFHLQWKHLURZQXQLTXHYRLFHUHPDLQVIXQGDPHQWDO
to the Ranney experience. The ultimate success of our students is the result of
a simple yet powerful mission–promise: every child will be known and valued.
With this mission as a guide, our strategic plan was developed with one simple
JRDODLPHGDWIXOÀOOLQJRXUPLVVLRQ²SURPLVHWRGHYHORSRSSRUWXQLWLHVWKDWDGG
to the quality of student life. During the past three years, the school has steadily
achieved remarkable milestones and even surpassed its initial goals. Implemented
throughout the 2010–2013 school years, the strategic plan’s goals are now nearly
100% achieved and the stage is set for the development of a new set of strategic
initiatives in the years ahead.
About the Lawrence Sykoff Center for Excellence
On May 21, 2013, students, parents, faculty and board members joined
together to dedicate the Middle and Upper School Building on Ranney
School’s campus to Head of School Dr. Lawrence S. Sykoff, naming the
building the “Lawrence Sykoff Center for Excellence” in his honor. After
20 years as Headmaster of Ranney School, Dr. Sykoff is retiring at the
conclusion of the 2012–2013 school year, but leaves his everlasting vision and legacy to current and future students, saying: “I hope that the
Sykoff Center for Excellence will be a symbol of permanence and of
strength in your lives and in our community for many years to come.
While this dedication is a formal recognition of excellence, please remember each time you enter the Sykoff Center for Excellence, that
excellence is always the goal to pursue.”
The summaries included herein provide an overview
of our achievements in these areas:

Academic Life, including Technology
Student Life, including Athletics
Faculty & Administration
Family Life, including Summer Programs
Strategic Marketing
Financial Planning
Development
Governance
Facilities & Campus Infrastructure
The Board of Trustees, 2012–2013.
On behalf of the Board of Trustees Strategic Planning Committee, the faculty, staff and administration, we
thank you for your support and assure you that excellence remains in Ranney’s future and all that this great
school holds for our exceptional students and the community we serve.
James Price
President
Josephine Esquivel
Chair, Strategic Planning Committee
Lawrence S. Sykoff, Ed.D.
Head of School
Board of Trustees (2012–2013)
Headmaster’s Cabinet
James Price, President (Madison ’13)
Frank Austin ’88
Lawrence S. Sykoff, Ed.D., Head of School
Daniel Goldberg, M.D.
Past President (Adam ’99, Jeffrey ’03)
Robert Chandler
(Jillian ’21, Morgan ’22, Brooks ’27)
Patricia Marshall, Head of Lower School /
Associate Head of Academic Administration
Marshall Knopf, Sr.Vice President
(Emily ’01, Jennifer ’03, Laura ’06, Max ’09)
Scott Fischer
(Veronika ’13, Francesca ’15, Myles ’17)
David Fischer, Head of Middle School
(Lauren ’23, Drew ’26)
Josephine Esquivel,Vice President
(Alexandra ’14, Joseph ’14)
Kristen Gerhard (Peter ’15, Madison ’18)
Paul Zanowski, Head of Upper School
Michael Jones, M.D. (Siobhan ’21, Gavin ’25)
&KDUOHV=DOHZVNL&KLHI)LQDQFLDO2IÀFHU
Michael Oster (Aidan ’21, Devin ’22, Dylan ’24)
Stephen Papetti (Julia ’07, Anthony ’12)
Kathleen Deeken, Director of Student
Support Services and Summer Study
(Tessa ’05)
Douglas Roberts ’79
(Elizabeth ’15, Alexander ’18)
Valerie Francois, Director of Strategic
Marketing and Communications (Nicolas ’22)
Ann Ross, M.D. (Jillian ’18, Nicholas ’18)
Lynn Lucarelli, Director
of Development (Molly ’25)
Patricia Kurdyla, Secretary
(Amy ’88, Phillip ’94)
Christopher Fitzmaurice, Treasurer
(Liam ’17, Shana ’19, Tyge ’23)
Carol Martin, Educational
Development Advisor (Elizabeth ’14)
Brian Torpey, M.D. ,
Strategic Planning Advisor
(McCall ’11, Kendall ’13, Matthew ’17, Jack ’18)
Joseph Tweed, Director
of Admissions and Financial Aid
www.ranneyschool.org/strategicplan 1
ONCE UPON A TIME
ON HOPE ROAD . . .
I
t gives me great pleasure to present to you the
ÀQDO´UHSRUWFDUGµIRU5DQQH\6FKRRO·VWKUHH\HDU
strategic planning efforts described in detail in
WKH²´7XUQLQJ9LVLRQLQWR5HDOLW\«7KH
'UHDP&RQWLQXHVµUHSRUW7KDWGRFXPHQWUHSUHVHQWHG
two years of steady community planning and collabo
ration to develop a working set of strategies for the
years ahead.
The 2012–2013 school year, the capstone year, has
been incredibly successful and the details contained in
the report herein highlight the enormous momentum
our school has sustained for two decades. In the spring
of 2012, I announced my intention to retire at the end
of the current school year. The Board of Trustees and
Headmaster’s Cabinet know only too well that this
period of time would be just as ambitious as the past
decade, ramping up activity even more so to meet
KHDGRQWKHJRDOVSURMHFWVDQGKLJKDVSLUDWLRQVWKDW
ZHUHLQFOXGHGLQRXUWKUHH\HDUVWUDWHJLFSODQQLQJGRF
ument. We have done just that and our great school is
ZHOOSRVLWLRQHGWRDGYDQFHHGXFDWLRQDOH[FHOOHQFHZHOO
into the future.
In reading through the report, it will quickly become
clear that from every aspect of school life–programs,
teacher development, technology, student life, volun
teerism, facilities, safety and security, marketing and
DGPLVVLRQVIXQGUDLVLQJÀQDQFLDOSODQQLQJDQG%RDUG
governance, our school has reached new levels of
success. While there is always more to do and more
WRFRQWHPSODWHWKHWKUHH\HDUVWUDWHJLFLQLWLDWLYHV
gave meaning and direction to our school, providing
QHZRSSRUWXQLWLHVIRUFKLOGUHQDWDOOOHYHOVWRÁRXULVK
and thrive. The lists of student, teacher and program
achievements is far too numerous to mention here,
and I encourage you to visit our website and online
SXEOLFDWLRQVZKHUH\RXZLOOÀQGPDQ\RIWKHVHDFFRP
plishments featured.
2 Strategic Plan Final Outcomes 2010–2013
6XIÀFHLWWRVD\WKHFRQWLQXLQJDFKLHYHPHQWVRIRXU
students are the result of having them educated in a
VFKRROZLWKDFOHDUO\GHÀQHGPLVVLRQVWDWHPHQWWKDW
LVÀUPO\IRFXVHGRQWKHLURYHUDOOZHOOEHLQJJURZWK
and development. Each child is inspired by the mis
sion–promise held by every teacher and administrator
that ensures them that every child is known and valued.
Our mission is the centerpiece of our work—and an
expression of the dedication the community has for
Ranney School to remain a beacon of hope and inspira
tion in every child’s heart and mind.
In recent years, Ranney School has garnered regional
and national attention. Our graduates attend some
of the best colleges and universities in the world and
they continue to make a difference in their profes
sional lives beyond college. Our school’s facilities,
technology and programs are so highly regarded that
the New Jersey Association of Independent Schools
(NJAIS) selected our school as the host site for its
2012 Biennial Professional Development Conference
last fall. Close to 1,200 educators visited our cam
pus for the conference—an event that was widely
discussed in the independent school community
throughout the United States.
Our recent accreditation with the Middle States As
VRFLDWLRQRI6FKRROVDQG&ROOHJHVXQGHU´H[FHOOHQWµ
standing is one more exemplary demonstration of the
school’s outstanding record of success. The accreditation
was an opportunity for our school’s achievements to be
validated by other independent school educators from
nearby states with whom we share a common purpose.
+HUHLVDQH[FHUSWIURPWKHÀQDODFFUHGLWDWLRQGRFX
ment: “Ranney School has made tremendous strides not
just since the last Middle States visit, but over the last two
decades.… This type of growth does not happen without
deliberate, thoughtful, and strong strategic planning.”
7KHÀQDO\HDURIWKHVWUDWHJLFSODQLPSOHPHQWDWLRQVDZ
PDQ\ÀUVWVDW5DQQH\6FKRROZKLFKDUHKLJKOLJKWHGLQWKH
pages of this report. Below are just a few highlights that we
experienced during the past nine months:
5DQQH\6FKRROKRVWHGWKHSUHVWLJLRXVWKUHHGD\7ZR
Rivers Arts and Antiques Show; the funds raised sup
ported Monmouth Medical Center’s Wilentz Breast
Cancer Institute.
We entered the competitive Shore Conference.
The Board of Trustees completed the Head of School
search with the highly regarded selection of Dr. John
*ULIÀWK+HDGRI%DWWOH*URXQG$FDGHP\LQ7HQQHVVHH
The school community united during and after Hur
ricane Sandy, providing ongoing help to displaced and
challenged families within and outside our Jersey Shore
community. The outpouring of compassion from RSPA
volunteers, students, teachers, administrators and par
ents throughout that tough time was a moment in our
school’s history that our families will cherish forever.
The Athletic Department hosted its largest and most
highly attended Alumni Hall of Fame ever.
The Walling Aquatic Center was named after our be
loved coach, friend and mentor, Emmett Walling.
Ranney students performed at the legendary and
iconic Carnegie Hall in New York City.
The Communications Department launched a rede
VLJQHGZHEVLWH²DRQH\HDUSURMHFWWKDWRSHQHGDQHZ
world of digital and social media opportunities.
563$KRVWHGDZHOODWWHQGHGDQGVXFFHVVIXO3DQWKHU
Ball on our school campus, celebrating our community
of parents, alumni, past parents and friends.
The school community celebrated the completion of
the new Grandstands and Press Box with camera deck.
Upper School students successfully competed in the
VEX Robotics World Championship in California.
In my 20 years at Ranney, I have learned there is a pro
found difference between schools that are good and those
that strive to be great. The difference is often in a col
lective will to be the best—to offer unique experiences
that change children’s lives. Ranney School is that kind of
institution—a place where innovation and imagination are
embraced and goodness is the underlying goal. There is
never a greater sense of the importance of such a mission
WKDQLQWKHH\HVRIDFRQÀGHQWFKLOG5DQQH\KDVGHPRQ
VWUDWHGLQLWVWKUHH\HDUVWUDWHJLFSODQWKDWDVXVWDLQDEOH
level of high performance can be achieved. As a result, our
VFKRROKDVDGHÀQLQJFXOWXUHWKDWLVEXLOWWRZLWKVWDQGWKH
unexpected and advance with enduring greatness.
A few weeks ago, I visited with a few of my kindergarten
IULHQGVDVZHVDLGRXUÀQDOJRRGE\HVWRHDFKRWKHU7KHVH
talks with children have been one of the most heartwarm
ing aspects of my life as Headmaster. When I have time in
the years ahead, I will write a book to share these quiet
FRQYHUVDWLRQVDQGHQGHDULQJUHÁHFWLRQV,WZDVDQRVWDOJLF
PRPHQWIRUDOORIXV,WXUQHGWRRQHFKLOGDQGVDLG´5H
PHPEHUDOZD\VZRUNKDUGWREHDJRRGSHUVRQµ7KHFKLOG
ORRNHGDWPHDQGVDLG´7KDW·VHDV\'U6\NRIIµDQGDIWHU
DPRPHQWRIIHUHG´%HFDXVHWKHUHLVQRSODFHOLNH5DQQH\
6FKRROµ:HOO,FRXOGQ·WKDYHVDLGLWEHWWHUP\VHOI
Thank you for 20 years of irreplaceable opportunities and
cherished memories. I love our school and all the people I
have known over the years. I leave with enormous affection
and everlasting pride in what our school means in the lives
of children. They are all my heroes!
7KLVVWUDWHJLFUHSRUWZDVDSSURSULDWHO\WKHPHG´7KH
'UHDP&RQWLQXHVµDSWO\UHSUHVHQWLQJKRZZHIHHODERXW
Ranney. I know in my heart that the dream we share for
children will always continue.
With blessings and endless appreciation,
Lawrence S. Sykoff, Ed.D.,
Head of School
ACADEMIC LIFE
ACADEMIC LIFE
In 2010, the committee charged with developing goals for Academic Life at Ranney School set out to
GHÀQHSDWKZD\VWKDWZRXOGIRUJH5DQQH\WKURXJKWKHVWFHQWXU\DVDOHDGHULQHGXFDWLRQ7KLVFKDUJH
included shaping a modern and rigorous course of study that would serve to value the work students con
tribute to learning as much as the outcomes achieved, and thereby focused on creativity, design, ingenuity,
collaboration and communication. The committee’s goals also were centered on the value of character and
WKHTXDOLWLHVGHÀQHGDV´JULWµHWKLFDOSUDFWLFHSHUVHYHUDQFHFRPPLWPHQWGULYHDQGOHDGHUVKLS
.H\SULRULWLHVLQVWUDWHJLFSODQQLQJIRU$FDGHPLF/LIHZHUHWRUHGHÀQHWKHFRUHYDOXHVRIWKH5DQ
ney School academic experience and integrate these values into the academic program; make certain
WKDW5DQQH\·VDFDGHPLFSURJUDPLVGHÀQHGE\H[FHOOHQFHDQGLQVWUXFWLRQDOEHVWSUDFWLFHVHQVXUHWKDW
Ranney’s academic programming and facilities remain competitive and relevant; help prepare students
WRWKULYHLQWKH&RQFHSWXDODQG,QIRUPDWLRQ$JHVGHYHORS5DQQH\·VÀQHDQGSHUIRUPLQJDUWVSURJUDPV
into a regional center of excellence; expand summer academic opportunities; and showcase the Ranney
School educational experience by developing connections with the local, state, national and global com
munities. The Academic Life Committee also set goals focused on the environment of learning, thereby
VHWWLQJWKHVWDJHIRUVWDWHRIWKHDUWWHFKQRORJLHVDQGHGXFDWLRQDOWRROVDVSDWKZD\VWRDFKLHYHVXFFHVV
SIGNIFICANT ACCOMPLISHMENTS

,QIDOOWKH6FLHQFH'HSDUWPHQWIRUJHGWKHÀUVW67(0VFLHQFHWHFKQRORJ\HQJLQHHULQJDQG
math) committee at Ranney School with faculty from the Science, Math and Technology Departments.
The committee developed initiatives that support curriculum development to advance STEM educa
WLRQZLWKLQWKHDFDGHPLFGHSDUWPHQWVDQGWKURXJKRXW6WXGHQW/LIHSURJUDPVVHHDOVR´6WXGHQW/LIHµ
In February 2013, the committee incorporated the Art Department and is now known as STEAM.
At left: The Upper School Robotics Team, Shorebots, competed in
the 2013 VEX High School World Championship. Above: Discovery
learning is threaded throughout all divisions, including the Early
Childhood curriculum.
ACADEMIC LIFE CONTIN.

Many achievements have occurred as a result:
The Upper School Robotics team, Shorebots, competed at the state level and national level, earning
an Excellence Award and placement to compete at the VEX Robotics High School World Champion
ships in April 2013.The world tournament was streamed live over the Internet during our Lower
6FKRROVFLHQFHIDLUGHPRQVWUDWLQJDFURVVSROOLQDWLRQRIWDOHQWDFURVVGLYLVLRQV
7KH/RZHU6FKRROUHFHLYHGWKH*ROGHQURG5RERWLFV<RXWK7RXFK*UDQWWREULQJUHDOZRUOG
examples of robotics engineering to the classroom.
In spring 2013, the Lower School formed a new Lego Robotics League for students in grades K–5.
Competitive Math Olympiad teams were established in each division, encompassing grades 4–12.
Students in all divisions have achieved regional, state and national recognition through the Math
League, Math Olympiad and the American Mathematics Competition.
The Upper School’s Science Research Club hosted its Fourth Annual Science Expo in the Ranney
6FKRRO3DUHQWV·$VVRFLDWLRQ563$3DQWKHU+DOOLQ)HEUXDU\D5DQQH\VRSKRPRUHSODFHGÀUVW
in the Delaware Valley Science Fair for her engineering project.
,QIDOOWKH/RZHU6FKRRODUWFXUULFXOXPZDVLGHQWLÀHGIRUH[FHOOHQFHDWWKHQDWLRQDOOHYHOE\5X
bicon Atlas for incorporating common core curriculum standards in STEM education at the elemen
tary level and demonstrating exemplar status for horizontal integration (i.e., across subjects).
2XU0LGGOH6FKRROQRZUDQNVQLQWKLQWKHFRXQWU\RXWRIVFKRROVDQGÀUVWLQWKHVWDWHRI1HZ
Jersey based on National Science League Testing that took place in spring 2013.
In spring 2013, students in all divisions received national honors in Spanish and French for their high
exam scores.World Language instruction throughout Ranney now includes three languages (Spanish,
English and Mandarin Chinese) spanning all three divisions, starting in Kindergarten.
Ranney School earned accreditation from the Middle States Association for Schools and Colleges with
exemplar status.The accreditation process established an institutional objective to support the develop
ment of curriculum in the areas of reading, writing and math across all divisions, thereby bridging cur
riculum development from Lower to Middle and Middle to Upper School.
Over the course of 2010–2013, faculty members at the elementary grade level completed the competi
tive Columbia University Teachers College Writer’s Workshop Project.
A reading framework was established in the Lower School that uses developmental reading assessments
to measure growth in reading. Assessments are conducted three times a year for differentiated ap
proaches to reading instruction, including the Daily Five and Reading Café programs.
In the area of standardized tests, 86% of Ranney students passed their Advanced Placement (AP) exams,
compared to the New Jersey pass rate of 75% and the global pass rate of 61%. In 2013, a junior achieved
a perfect score of 2,400 on the SAT and another junior was admitted to the highly selective Governor’s
School for Engineering (15% admittance rate).
College admission among Ranney seniors continues at 100%. Approximately 75% of the senior class of
HDUQHGDFFHSWDQFHLQWRWKHLUÀUVWRUVHFRQGVFKRRORIFKRLFH5DQQH\VHQLRUVDOVRFRQWLQXHWRJDLQ
DGPLWWDQFHWRKLJKO\VHOHFWLYHIRXU\HDUFROOHJHVDWDUDWHWKDWLVWZRWRWKUHHWLPHVWKHQDWLRQDODFFHS
tance rate of the same institutions. In addition to this success, Ranney students each year earn admission
WRVSHFLDOL]HGVFKRROVLQEXVLQHVVÀQHDUWVPXVLFDQGHQJLQHHULQJDQGRXUVFKRODU²DWKOHWHVDUHUHFUXLWHG
E\OHDGLQJFROOHJHVDQGXQLYHUVLWLHVVHHRXU´0DWULFXODWLRQDQG6SHFLDOL]HG6FKRROV/LVWVµ
SUMMARY AND FORWARD THINKING
As Ranney School concludes its strategic plan, it celebrates unprecedented success across all divisions and
academic departments that speak to Ranney students’ ability to participate and compete in creative design
and engineering forums, leadership conferences, standardized testing formats, stage and instrumental
performances, athletic leagues and championships, publishing opportunities and collaborative experiences,
service programs, and highly competitive college admissions—all within an environment that values the
tradition of school values and embraces modern technologies and learning tools.
ACADEMIC LIFE CONTIN.
Throughout the strategic planning process and implementation, the Academic Life Committee worked
diligently to envelop into each of the aforementioned goals the core experiences of Ranney student life.
We are proud to celebrate the achievements of academic strategic planning in the success of our teachers
and students. In reviewing these accomplishments, one cannot question the value of planning for success.
$V5DQQH\6FKRROSUHSDUHVWRFORVHGRZQLWVÀUVWVWUDWHJLFSODQZHDUHORRNLQJDKHDGDWQHZJRDOVWKDW
support curriculum development in science, math, engineering, the arts, technology, ethics and leadership,
health, character education and diversity, to name a few.
TECHNOLOGY UPDATE
Recognizing that technology offers students an avenue to success as citizens in a global community,
RXUVWUDWHJLFSODQHQFRPSDVVHGVHYHUDOWHFKQRORJ\JRDOVDLPHGDWDFKLHYLQJDVWFHQWXU\OHDUQLQJ
environment. A major goal was to develop and implement a 1:1 Student Laptop Program—one of the
most ambitious technology initiatives ever introduced in the history of Ranney School. In July 2012, we
FRQFOXGHGWKHÀUVW\HDURIWKLVVXFFHVVIXOSURJUDPZKLFKSURYLGHGODSWRSVWR0LGGOHDQG8SSHU
School students. The program was the culmination of several years of careful planning and implementa
tion among administrators, faculty, staff and parents—and it was just one of our many achievements in
the area of technology during the past three years.
In fact, during the past decade, Ranney School has been at the forefront of implementing educational
technology that allows students and faculty to connect, collaborate, present, inspire, listen, learn and
communicate. Today, other independent educational institutions aspire to emulate the technological suc
FHVVWKDW5DQQH\H[HPSOLÀHV/RRNLQJDKHDG5DQQH\6FKRROZLOOFRQWLQXHWRSURYLGHDWHFKQRORJLFDOO\
rich learning environment that can provide students with the instructional equity they need for thor
ough research and group collaboration and which will inspire productivity in today’s digitized learning
environments. Below are key technology achievements made recently.

The NJAIS Biennial Professional Development Conference brought more than 900 independent school
administrators and faculty to our campus for a full day of workshops that showcased the school’s tech
nology capabilities.Visitors experienced advanced technology in every building, from wireless capabilities
to fully connected classrooms.
When Hurricane Sandy made landfall, Ranney was prepared and safely secured all technology assets lo
cated on campus.The administration was able to stay in close contact using cellphones and our Google
Docs for Education software.The software, which students and faculty use regularly for learning and col
ODERUDWLRQDORQJZLWKRXUFORXGEDVHG5DQQH\(PHUJHQF\1RWLÀFDWLRQ6\VWHP5(16HQDEOHGDGPLQLV
WUDWRUVWRUHVWRUHFRQWDFWDQGLQIRUPWKHFRPPXQLW\DWODUJHDERXWRXUVFKRRO·VVWDWXVDQGUHRSHQLQJ
2XUXVHRI6N\SHDOORZHGXVWRH[SHULPHQWVXFFHVVIXOO\ZLWKDYLUWXDOFODVVURRPFRQFHSWGHPRQVWUDW
ing that the classroom no longer has to have walls.Teachers and students can use Skype to communicate
with experts outside the Ranney community, essentially opening their classroom to the world.
Middle and Lower School students were able to take full advantage of the Ranney laptop program with
ODSWRSFDUWVDQGZLUHOHVVDFFHVV,QDQH[DPSOHRIVWFHQWXU\WHVWWDNLQJVWXGHQWVWRRNWKHLU(GXFD
tional Records Bureau (ERB) tests online, eliminating the need for pencil and paper and increasing the
speed of obtaining results.
7RNHHSVWXGHQWVSDUHQWVDQGIDFXOW\DZDUHRIWKHHYHUHYROYLQJRQOLQHODQGVFDSHWKH7HFKQRORJ\
Department introduced a new Technology Blog for the Ranney community to highlight key changes in
Internet safety and protocols.The blog is also useful for providing administrators, faculty and parents
with the necessary information to make informed decisions in this area of technology use.
To accommodate the school’s growing rigorous academic requirements, we entered into multiyear
agreements with Internet providers to quadruple our web access and to provide streaming media as
well as redundancy to crucial systems. §
STUDENT LIFE
STUDENT LIFE
As we complete our Strategic Plan, the Student Life Committee continues to see the value of educating
WKH´ZKROHµFKLOG7KLVSKLORVRSK\FRQVLGHUVWKHGHYHORSPHQWDQGFRQVWDQWLPSURYHPHQWRI6WXGHQW/LIH
SURJUDPPLQJWREHYLWDO6XFKSURJUDPVZKLFKLQFOXGHFRFXUULFXODUDQGH[WUDFXUULFXODUDFWLYLWLHVDWKOHWLF
teams and service organizations, offer students the opportunity to explore varied interests, deepen their
passions, strengthen relationships with peers, teachers and coaches, and develop skills that will be crucial
as they mature in the 21st century. In implementing our strategic goals, the Student Life Committee fo
cused its energies on development programming, which enhances connections within our school commu
nity, strengthens our commitments to school values and traditions, and develops an understanding of the
value of community and global consciousness.

3HUIRUPLQJ$UWVLVQRZDUHJLRQDOO\UHFRJQL]HGGHSDUWPHQWDFURVVDOOGLYLVLRQVLQFOXGLQJRXUDZDUG
ZLQQLQJ0LGGOHDQG8SSHU6FKRROFKRLUVDOOVFKRRORUFKHVWUD8SSHU6FKRROMD]]EDQG8SSHU6FKRRO
theater program and stage performers. Three Upper School students and a faculty member were
QRPLQDWHGIRU&RXQW%DVLHDZDUGVLQDQGDVHQLRUZRQIRU´2XWVWDQGLQJ/HDG$FWRULQD
'UDPDµ3HUIRUPLQJ$UWVIDFXOW\PHPEHUVKDYHZRQDQGEHHQQRPLQDWHGIRUUHJLRQDODQGQDWLRQDO
awards as well, including for conducting, costume design and master teaching.
7KHVFKRRO·VVWHOODUSHUIRUPLQJDUWVVWXGHQWVVKLQHGGXULQJDVWXGHQWFKRUDOEDQGDQGRUFKHVWUDO
performance at the renowned Carnegie Hall in New York City in January 2013. Students in grades as
early as third grade participated, symbolizing a dream come true after years of devotion and planning
among our collective faculty, administration and community members.The event represented an oppor
WXQLW\WRZLWQHVVÀUVWKDQGWKHPHDQLQJRIWKH5DQQH\H[SHULHQFHDQGLWVLPSDFWRQRXUVWXGHQWV
The Ranney School Performing Arts
Department was proud to have held
its 2013 Winter Concert Extravaganza at the iconic Carnegie Hall in New
<orN City³a Àrst for the school.
STUDENT LIFE CONTIN.

International travel opportunities remained part of the Middle School experience in conjunction with
ISCA, which organizes international educational travel programs. In addition, Upper School students
traveled to Spain in 2012, and to the United Kingdom in 2013.
With guidance from RSPA and school leadership, students met the needs of many in our Jersey Shore
area after Hurricane Sandy, devoting time and energy to place families in homes and raise money and
material goods needed by those affected the most. Drives and awareness campaigns assisted organiza
tions such as Project Recover and Rebuild, Lunch Break and the American Red Cross.
To increase connections across campus divisions, new programs were created, including: Admissions
Ambassadors, Hands across the Campus, Lower School Internships, Robotics programs, Transition
mentorships and Upper School Forensics mentorships.
Ethics, Leadership, Diversity and Internship programming for Upper School students continued to
provide excellent learning opportunities outside the traditional classroom, including forums with
prominent community members. Thanks to Ranney parents who offered to provide dynamic experi
ential learning experiences, the upcoming 2013 Summer Internship program will offer rising seniors
PRUHWKDQLQWHUQVKLSVLQYDULRXVÀHOGV,QDGGLWLRQULVLQJMXQLRUVZLOOKDYHWKHRSSRUWXQLW\WR
acquire internship hours through a partnership with Monmouth Medical Center.
Our Upper School Diversity Club continued to enhance programming for our oldest students, includ
ing the development of a diversity seminar for all Upper Schoolers in May 2013.
Striking art shows by Lower, Middle and Upper School students are now showcased in the Panther
+DOO*DOOHU\DQGLQGLYLGXDOVWXGHQWDUWLVWVFRQWLQXHWRHDUQFRPSHWLWLYHÀQHDUWVDZDUGV)RUWKH
second year in a row, the Fine Arts Department includes a modern, online virtual arts exhibit called
$UWVRQLDDOORZLQJIRUSRUWIROLREXLOGLQJDWDOODJHV$5DQQH\VRSKRPRUHZRQWKH6LOYHU.H\$ZDUG
IURPWKH6FKRODVWLF$UWDQG:ULWLQJ&RPSHWLWLRQIRUKHUPL[HGPHGLDDUWZRUNVKHFRPSHWHGDJDLQVW
900 student artists from across northern New Jersey.
The MAG, Ranney’s Middle School literary and art magazine, has carried on what has now become a
nationally recognized winning tradition. The editorial staff and advisor earned awards from the Colum
ELDDQG$PHULFDQ6FKRODVWLF3UHVV$VVRFLDWLRQVIRUWKHPDJD]LQH·V´2ULJLQVµDQG´)XWXUHRI7HFKQRO
RJ\µHGLWLRQVThe Mag also earned the Columbia association’s prestigious Gold Award.
5DQQH\FRFXUULFXODUFOXEVFRQWLQXHWRWDNHDGYDQWDJHRIOHDUQLQJRSSRUWXQLWLHVRXWVLGHWKHFODVV
room, with students earning top honors in early 2013. In addition to the Upper School Robotics
7HDP·VSDUWLFLSDWLRQLQWKH9(;:RUOG&KDPSLRQVKLSWKH/RZHU6FKRRODOOJLUOV5RERWLFV7HDPZRQ
Approximately 40% of students in the Class of 2013 are “lifers.”

ÀUVWSODFHDWWKH/HJR5RERWLFV&RPSHWLWLRQWKH8S
SHU6FKRRO+LVWRU\&OXETXDOLÀHGIRUHQWU\LQWRWKH
History Bowl/National Championship and the Nation
al Geography Quiz Bowl, the Middle School Science
2O\PSLDGWHDPFRPSHWHGLQUHJLRQDODQGVWDWHÀQDOV
and the Academic Challenge Team competed in the
National Academic Team Quiz Bowl, marking the
team’s fourth consecutive national competition (in
New Jersey, the team ranks ninth and one senior
ranks second).
Ranney Plus, which supports student enrichment
during afterschool hours, expanded in its second
year with new programs in robotics, Panther
Cub athletics, art, orchestra, community service
and leadership, allowing children and faculty
to explore and develop skills and interests on
campus beyond the school day.
Seniors and Beginners celebrate being
Ranney now has 40 student Admissions Ambassadors
together during senior transition day.
who serve as hosts to visiting families throughout the
school year.
7KHSHUFHQWDJHRI´OLIHUµVWXGHQWVWKRVHZKRKDYH
been part of the school community for 10 or more years) who graduate from Ranney has grown
(40% of the 2013 graduating class are lifers), demonstrating the value of the distinct Ranney experi
ence over time.
Several Ranney traditions experienced anniversary years, including the 10th annual College Alumni
panel and 10th annual Forensics Festival.
During the three years of strategic plan implementation, Ranney School’s Student Life offerings have both
increased in variety and availability, as well as in their ability to positively affect students and the commu
QLW\7KURXJKH[SDQGHGFRFXUULFXODUDFWLYLWLHVDQGXQLTXHSURJUDPPLQJLQDOOWKUHHGLYLVLRQVRXUFRP
munity has worked hard to develop experiences for our students that, in turn, expand learning outside of
WKHFODVVURRPDQGGHYHORSVNLOOVFUXFLDOWRVWFHQWXU\OHDUQLQJ)XWXUHHQKDQFHPHQWRIWKHVHSURJUDPV
along with their connection to emerging academic priorities, including technology and STEM initiatives, will
continue to position Ranney as a leading institution in the provision of student life.
ATHLETIC UPDATE
7KH$WKOHWLF'HSDUWPHQWLPSOHPHQWHG\HDUWZRRILWVVWUDWHJLFGRFXPHQW´VW&HQWXU\9LVLRQ
IRUWKH5DQQH\6FKRODU$WKOHWHµZKLFKLVVHSDUDWHEXWLQOLQHZLWKWKHRYHUDOOWKUHH\HDU5DQQH\6FKRRO
6WUDWHJLF3ODQ7KHDWKOHWLFVWUDWHJ\DVSLUHVWRGHYHORSDQHYHQPRUHGLYHUVLÀHGDQGFRPSHWLWLYHVSRUWV
program through all divisions. Today, the Panther Athletic Program has entered into a new phase of com
SHWLWLRQZKLFKLQFOXGHVWKHSXUVXLWRIDWKOHWLFH[FHOOHQFHWKURXJKSDUWLFLSDWLRQLQDKLJKTXDOLW\SURJUDP
that is centered on commitment, dedication, hard work, preparation and responsibility. These values also
incorporate a focus on community and stress the ideals of pursuing victory with honor. Going forward,
this vision will establish a standard of excellence that bridges current and future Ranney Panthers. Follow
ing are highlights of recent achievements in athletics.

7KHVFKRRO·V´SHUIHFWSDUWQHUVKLSVµSURJUDPHVWDEOLVKHGLQDQGDLPHGDWVWUHQJWKHQLQJUHODWLRQ
ships throughout the area, expanded to include more local athletic clubs: the New Jersey Wildcat Soccer
Club, United Lacrosse Club, Central Jersey Hawks Basketball Club, Hoop Group, New Jersey Race Club
Swim Team, Brian Bevin’s Golf, Atlantic Fencing Club and Two River Indoor Rowing.
7KHVFKRRO·VÀUVWFRPSHWLWLRQVZLWKLQWKHKLJKO\UHJDUGHG6KRUH&RQIHUHQFHEHJDQQRWRQO\ZHUH
several meets held in the Gerhard Pavilion for Athletics, but also the Ranney Varsity Girls’ Tennis team
EURXJKWKRPHWKH6KRUH&RQIHUHQFH´%&HQWUDOµ&KDPSLRQVKLSWLWOH
5DQQH\6FKRROZDVKRQRUHGZLWKWKH6KRUH&RQIHUHQFH·V´%&HQWUDOµ6SRUWVPDQVKLSDZDUG
7KH9DUVLW\*LUOV·%DVNHWEDOOWHDPZRQWKH3DQWKHU&ODVVLF7RXUQDPHQWIRUWKHÀIWKFRQVHFXWLYH\HDU
Director of Athletics Tom Moriau completed his 400th career win as Head Coach of the Varsity Girls’
Basketball team as well as his 25th year at Ranney. He was honored as the Shore Conference Coaches As
VRFLDWLRQ´%&HQWUDOµ&RDFKRIWKH<HDUDQGWKH1HZDUNStar Ledger Monmouth County Coach of the Year.
&RQFXVVLRQPDQDJHPHQWVDIHW\VWDQGDUGVZHUHSXWLQWRSODFHIRUYDUVLW\DWKOHWHVDQGZHFRQWLQXHG
RXU=DUJLVFDUGLRVFDQWHVWLQJIRU8SSHU6FKRRODWKOHWHV
The Lower School sports program expanded to include new baseball and softball offerings. Participa
tion in already existing soccer, golf and fencing programs grew as well, enabling more Lower School
students to be exposed to the important elements of sport that are not matched in the local area.
0LGGOH6FKRRODWKOHWHVH[SHULHQFHGDQRWKHUVXFFHVVIXOIDOOVHDVRQ:LWKSDUWLFLSDWLRQDWDQDOOWLPHKLJK
Ranney boys’ and girls’ soccer teams earned a trip to the league championship; the boys’ basketball team
won the Central Jersey Athletic League (CJAL) Championship; the boys’ swim team won the Ranney Swim
Invitational; the Middle School tennis and cross country teams enjoyed a large turnout and performed at
WRSOHYHOSOD\DQGWKHÀHOGKRFNH\WHDPRYHUFDPHDVPDOOURVWHUWRH[KLELWVWURQJSHUIRUPDQFHV
A freshman was selected to the New Jersey Interscholastic Association First Team All States Women’s
)RLOIRU5DQQH\6FKRRODÀUVWIRUWKH3DQWKHUV,Q0DUFKWKHVWXGHQWHDUQHGWKHVLOYHUPHGDOLQ*LUOV·
Foil at the New Jersey State Interscholastic Athletic Association (NJSIAA) Individual Championship;
WKLVVHFRQGSODFHÀQLVKZDVWKHÀUVW1-6,$$SRGLXPSODFHPHQWIRUDIHPDOH5DQQH\IHQFHU
7KH9DUVLW\&UHZWHDPHQMR\HGDQHZ´KRPHµRQWKH6KUHZVEXU\5LYHUURZLQJRXWRIWKH6KUHZV
bury Sailing and Yacht Club. The facility access provided a tremendous advantage to the team.
The Ranney Equestrian Club became an active addition to the athletic program in October 2012,
bringing together students who share a common passion for horseback riding. §
The new Panther Grandstands and Press Box were dedicated in spring 2013 during a pep rally.
ADMINISTRATION
FACULTY &
FACULTY & ADMINISTRATION
,QWKH)DFXOW\DQG$GPLQLVWUDWLRQ&RPPLWWHHVHWRXWWRDUWLFXODWHÀYHRYHUDUFKLQJJRDOVWRVWHHUWKH
important development of teaching success at Ranney School: project a standard of teaching excellence to
the community; enhance professional development programs; develop the school’s faculty/administrative
mentoring program; attract and retain the best and the brightest to serve our mission; and forge teaching
partnerships with universities and professional organizations. As a result of the committee’s work, Stan
dards of Teaching Excellence were developed in November 2010 and now serve as the guiding principles
of professional excellence for teachers and administrators alike. These standards, which outline the ex
SHFWDWLRQWKDWRXUHGXFDWRUVDUHH[SHUWOHDGHUVLQWKHLUÀHOGVVHWWKHVWDJHIRUDOOLQLWLDWLYHVRYHUWKHSDVW
three years and serve as the focal point for all goals moving forward. The committee has since played a
VLJQLÀFDQWUROHLQIRVWHULQJDVFKRROFXOWXUHWKDWKROGVKLJKH[SHFWDWLRQVIRU5DQQH\HGXFDWRUVDQGDGPLQ
istrators to serve the community as mentors, thereby contributing to a collaborative environment.

Demonstrating the school’s growing reputation and leadership in independent school education, numer
ous Ranney teachers presented at the 2012 NJAIS Biennial Professional Development conference. In fact,
our faculty and administrators are increasingly selected by national teaching organizations and conferences
to be presenters; they are also recognized at the state and national level as master teachers and fellowship
and grant recipients. Faculty have had speaking engagements for conferences and workshops hosted by
the National Association of Independent Schools (NAIS), the National School Public Relations Associa
tion, the American Association of Teachers of Spanish and Portuguese, the Council for the Advancement
and Support of Education, the New Jersey Association of Foreign Language Teachers and the New Jersey
Association of Art Educators, among others.
Hiring standards have been developed and published to attract the best teachers nationwide. As a result,
FDQGLGDWHVVHHNLQJWRWHDFKDW5DQQH\6FKRRODUHDWWKHWRSRIWKHLUÀHOGZLWKPRUHFDQGLGDWHVSRVVHVV
ing graduate and doctorate degrees.
More teachers and administrators are pursuing graduate degrees and fellowships. Approximately 50% of
faculty and administrators hold graduate degrees; seven have doctorates and two are pursuing doctorates.
Professional development programs and opportunities have expanded to be inclusive of departmental,
JUDGHOHYHODQGGLYLVLRQQHHGV,QDGGLWLRQVWDQGDUGVIRUSURIHVVLRQDOGHYHORSPHQWDQGUHQHZDOKDYHEHHQ
developed to build on professional portfolios.
Ranney has developed training partnerships with Monmouth University and Seton Hall University to sup
port training opportunities for teachers and athletic trainers. In addition, a mentoring program has been
established by an expert teacher who works with senior colleagues to support new faculty.
New recognition awards have been established to reward faculty in areas of leadership, student life,
instruction and commitment to the school’s mission.
The Headmaster Educational Longevity Program was established, focusing on health and wellness for staff.
,QWKHVFKRROUHLQVWDWHGLWVPHULWFRPSHQVDWLRQSURJUDPWRUHZDUGIDFXOW\ZKRDUHKLJKO\DFFRXQW
able in meeting the standards of excellence in teaching at Ranney School.
1HDUO\IDFXOW\PHPEHUVKDYHVHUYHGWKHVFKRROIRURUPRUH\HDUVDVRIHDUQLQJ´OLIHUµVWDWXV
Today, we are proud that our faculty and administrators embrace leadership within their profession; col
lectively, the work they do in and out of the classroom has brought regional and national recognition to
VWXGHQWVDQGWRWKHVFKRROIRUDFDGHPLFH[FHOOHQFH$VZHÀQDOL]HRXUVWUDWHJLFSODQQHZJRDOVHPHUJHIRU
the growth and development of Ranney’s teaching culture which will promise the preservation of the school’s
mission, incorporating a personalized learning experience, academic rigor and a culture that respects honor. §
FAMILY LIFE
FAMILY LIFE
$VSDUWRILWVVWUDWHJLFSODQQLQJWKH)DPLO\/LIH&RPPLWWHHDLPHGWRGHÀQHWKHFRUHYDOXHRIWKH
parent–student partnership as well as the community ties that bind our school together. The commit
tee’s strategic goals included expanding parent education offerings, enhancing the offerings for family
LQYROYHPHQWDQGVXSSRUWLQJVRFLDODQGFURVVFXOWXUDOSURJUDPPLQJ7RGD\5DQQH\6FKRROSULGHVLWVHOI
on its strong sense of community and our values of compassion, caring and community are abundantly
evident across the divisions, including a strong imperative to contribute to those in need at the local,
regional and global level.

The RSPA and the school leadership provided extraordinary support in the aftermath of Hurricane
Sandy, which devastated many area towns that our community calls home.Volunteers worked day
and night to ensure that community members were safe and had access to the supplies and support
systems they needed most. Demonstrating our strong community, volunteers served as the living
symbol of our school’s mission when so many families were experiencing enormous challenges.
In fall 2012, numerous community service initiatives took place, including the annual food and book
drives. The tradition of supporting those outside of the Ranney community continued in December
2012, with the fourth annual Holiday Express Concert in RSPA Panther Hall. In addition to provid
ing our Upper School performing arts students with the opportunity to take the stage with profes
sional musicians, the evening has cumulatively raised more than $55,000 since 2009, donating 100%
of ticket sales to help those in need during the holiday season and throughout the year.
During the second semester, community building activities were the focus, with two new Family
Nights introduced: a Lower School student/parent Pajama Party and Marionette Show, and a Family
%LQJR1LJKW7KHÀUVWHYHQWLQFOXGHGDGULYHWRVXSSRUW3URMHFW1LJKW1LJKWDQRUJDQL]DWLRQWKDW
provides blankets, pajamas, books and stuffed animals to children in need within New Jersey.
The annual Rock the Runway fashion show continued to grow in 2013. Expanding the family focus
RIWKHHYHQLQJWKLV\HDUKLJKOLJKWHG5DQQH\´OLIHUµVHQLRUVDQGWKHLUIDWKHUV7KH5RFNLQ·$QJHOV
FRPPXQLW\VHUYLFHDVSHFWRIWKHIDVKLRQVKRZSOD\HGDVLJQLÀFDQWUROHZLWKDOOFDPSXVFROOHFWLRQV
The RSPA Garden Sale and Parents’ Day are annual traditions at Ranney,
bringing parents on campus to participate in daily student-life activities.
FAMILY LIFE CONTIN.
going to help Monmouth Family and Children’s
6HUYLFHUHRSHQLWV7KULIW6KRS ZKLFKKDGEHHQ
destroyed by Hurricane Sandy. The center was
so grateful for the support of RSPA and the Ran
ney community that it has named Ranney School
as one of its honorees for its October 2013 gala.
7KH3DQWKHU%DOOFRQWLQXHGWREHWKHODUJHVW
fundraising event for RSPA. In April 2013, more
than 230 generous individuals helped to raise
more than $70,000 for the school through tickets
sales, sponsorship, and live and silent auctions.
+HOGIRUWKHÀUVWWLPHRQWKH5DQQH\FDPSXVDQG
building tremendous community spirit, the gala,
DSSURSULDWHO\WKHPHG´&RPH7RJHWKHUµSURYHG
RSPA was instrumental in bringing the Ranney
WREHDFRVWHIIHFWLYHZD\WRJHQHUDWHIXQGVIRUWKH
community back together after Hurricane Sandy.
mission, programs and operations of Ranney School.
RSPA worked to develop new ways for parents to contribute time to the Ranney community, with
the hope of including more parents into the fold of the volunteer corps.
The Parents’ Association Executive Board restructured the association’s bylaws in 2013, to incorporate
DFRSUHVLGHQF\PRGHOLQWRWKHOHDGHUVKLSVWUXFWXUHDQGWRLQFUHDVHWKHQXPEHURIHOHFWHGPHPEHUV
serving on the Executive Board, representing the expansion of the parent body over the years.
The strength of Ranney’s family ties, nurtured by the RSPA—whose membership includes every mem
EHURIWKHSDUHQWERG\LQÁXHQFHVWKHFRQWULEXWLRQVZHPDNHDVLQGLYLGXDOVDQGDVDVFKRROWRWKHODUJHU
FRPPXQLW\:LWKRXWWKHUHPDUNDEOHHIIRUWVRI563$DQGWKHHYHUH[SDQGLQJFRQQHFWLRQVWKH\IRUJHRQ
and off campus, our community could not provide the level of exceptional academic, athletic, commu
nity service and leadership opportunities that maximize the potential of every child. Going forward, it is
WKLVVHQVHRISXUSRVHDQGFRQWLQXHGHIIRUWWRGHÀQHWKHYDOXHVDQGPLVVLRQRIRXUFRPPXQLW\WKDWZLOO
sustain Ranney School as the special place it is for all of our children.
Finding ways to include all parents, regardless of the amount of time they can commit, will continue to
be a priority for the organization as it looks to increase participation in all divisions. Additionally, the
RSPA leadership plans to pursue the establishment of a speaker series, partnering with internal and
external experts, to bring programs to parents that are engaging and worthwhile.
At left: A Beginner student and a senior student
aim high after the Senior–Beginner breakfast.
At right: Celebrating Parents’ Day.
FAMILY LIFE CONTIN.
SUMMER PROGRAMS UPDATE
As the summer extension of Ranney School, our Summer Programs continue to expand and provide ex
ceptional opportunities for students of all ages. Children ages 3 to 18 can pursue an academic or talent
development interest or take part in our American Camp Association accredited Day Camp, Trip Camps,
6SRUWV&DPSVRURXUQHZ&RXQVHORULQ7UDLQLQJ3URJUDP%HORZDUHDIHZLPSURYHPHQWVDQGDGGLWLRQV
made to Summer Programs.

6XPPHU3URJUDPVDUHQRZEXLOWLQWRWKHWXLWLRQRI%HJLQQHUVDQG3UH.LQGHUJDUWHQHUVVWDUWLQJ
ZLWKWKH²VFKRRO\HDUFUHDWLQJ\HDUURXQGOHDUQLQJIRUFXUUHQWDQGIXWXUHVWXGHQWV
$QHZ&RXQVHORULQ7UDLQLQJ3URJUDPZDVDGGHGIRU\HDUROGVLQDQHIIRUWWRSURYLGHDXQLTXH
H[SHULHQFHIRUWKLVDJHJURXSRIFDPSHUVDQGZLWKDQH\HWRZDUGGHYHORSLQJIXWXUHFDPSFRXQVHO
RUV2XU,QWHUDFWLYH3UHVFKRRO$GYHQWXUHVSURJUDPKDVH[SDQGHGWRLQFOXGHWZRRQHZHHNFKRLFHV
each week.
Summer academic courses, including reading, writing and math, expanded for the fourth year in a
URZZLWKVSHFLDOL]HGWDOHQWGHYHORSPHQWDQGDFDGHPLFRIIHULQJVIRU3UH.²HLJKWKJUDGH
/LWHUDWXUHSK\VLFDOÀWQHVVDQGVSHFLDOL]HG67(0DQGDUWVSURJUDPPLQJQRZLQFOXGHH[FHSWLRQDORS
portunities in archaeology, architecture, engineering, robotics and math and science labs.
Gifted & Talented courses expanded in grades 1–3 with new Advanced Reading & Writing programming.
Our Summer Music Conservatory Instrumental Insights Orchestra now features two levels of
VWULQJRUFKHVWUDVZLWKKDOIGD\LQWHUPHGLDWHZRUNVKRSVIRUYLROLQYLRODDQGFHOORPXVLFLDQVLQ
grades 3–8.
$QHZIXOOGD\RUFKHVWUDSURJUDPIRUDGYDQFHGPXVLFLDQVKDVEHHQDGGHGWRDFFRPPRGDWHKLJKO\
specialized and talented young musicians.
1RQFUHGLWKLJKVFKRROVXPPHUDFDGHPLFFRXUVHVKDYHEHHQUHVWUXFWXUHGDVWKUHHZHHNRIIHULQJV
to provide families with a better timeframe to pursue introductory humanities and math courses.
A 25% discount continues to apply to all Ranney families enrolling in summer academic and talent
development programs and Day and Trip Camps. §
Our Summer Programs enable students to gain
the beneÀts of year-round learning, including a
focus on specialized interests and talents, and
social development and growth.
STRATEGIC MARKETING
STRATEGIC MARKETING
7KHFKDUDFWHULVWLFVZLWKLQ5DQQH\6FKRRO·VPLVVLRQYLVLRQDQGYDOXHVGHÀQHWKH5DQQH\FXOWXUHDQG
differentiate our academic strengths and extracurricular opportunities from other academic institutions
in the region. As part of our strategic plan, the Strategic Marketing Committee set out to reinforce and
SURPRWHWKHVHFKDUDFWHULVWLFVDQGVKDUH´WKH5DQQH\VWRU\µE\GHÀQLQJRXUFRUHYDOXHVH[SORULQJRXU
GHPRJUDSKLFULFKHPHUJLQJPDUNHWVHQKDQFLQJRXUZHEFRPPXQLFDWLRQVDQGSUHVVUHODWLRQVVKRZ
casing our students’ success in meaningful ways and developing a new outreach plan for alumni. This
consistent platform was designed to assist Ranney in retaining and attracting the most talented faculty
and students while enhancing our reputation and mission through various communications vehicles.

,Q²5DQQH\H[SHULHQFHGLWVKLJKHVWVFKRROZLGHHQUROOPHQW'XULQJWKHSDVWWKUHH\HDUV
8SSHU6FKRROHQUROOPHQW LQSDUWLFXODUKDVJURZQWUHPHQGRXVO\LQFUHDVH,QWKH8SSHU
School is poised to have 320 total students compared with this school year’s 278. Interest in the ninth
JUDGHLVDWDQDOOWLPHKLJKZLWKPRUHWKDQWKUHHDSSOLFDWLRQVIRUHYHU\VSDFHZDLWSRROVDOVRKDYHEHHQ
established for grades 4, 6 and 8. Aligned with these increases has been the strategic growth of our
QHHGEDVHGÀQDQFLDODLGSURJUDPZKLFKKDVDOORZHGIRUDJUHDWHUGLYHUVLÀFDWLRQRIWKHVWXGHQWERG\
$QHZ*URZQ8S0H6DWXUGD\SURJUDPZDVGHVLJQHGWREULQJQHZSUHVFKRROIDPLOLHVWRFDPSXVWR
experience our athletic and arts programs as well as our stellar teaching staff.
The newly renovated Ranney School website launched in February 2013, after a year of planning and
development; the site provides a fresh and modern interface with easier navigation for visitors.
7KH&RPPXQLFDWLRQV7HDPSURGXFHGDSDJHFRPPHPRUDWLYHSULQWDQGGLJLWDOHGLWLRQRIWKHVFKRRO·V
ÁDJVKLSSXEOLFDWLRQColumns, which takes a retrospective look at Ranney School’s strategic history, includ
ing a pullout timeline.The digital version includes complementary video clips as well as a blog.
7ZRQHZKLJKTXDOLW\G\QDPLFSXEOLFDWLRQVWKHViewbook and At a Glance, were created to serve as key
marketing pieces for the school.
$SULQWDQGGLJLWDO6XPPHU3URJUDPVEURFKXUHZDVSXEOLVKHGWRKLJKOLJKWWKHVFKRRO·VXQLTXH\HDU
round learning opportunities from preschool to high school.
Student anthologies and newspapers, such as The MAG, RSVP and Taxi are now produced in digital format
and available to the Ranney community online.
Our Twitter (@RanneySchool) followers rose to a record high of nearly 800, and our Pinterest account
QRZKDVDFWLYHERDUGV:HRSHQHGDQRIÀFLDO)DFHERRNSDJHZZZIDFHERRNFRP5DQQH\6FKRRODQG
also launched four new School Press blogs, including one on college guidance.
7KHVFKRRO·VVRFLDOPHGLDSUHVHQFHVHUYHGDVDSULPDU\WRRODORQJZLWKWKH5DQQH\(PHUJHQF\1RWLÀFD
tion System (RENS), to communicate with the Ranney community during Hurricane Sandy.
Partnerships with targeted media publications have expanded our school’s visibility to women and fami
lies in Monmouth, Middlesex and Ocean counties. Articles written by faculty experts have appeared in
the print and online press, particularly furthering Ranney’s reputation in Early Childhood Education.
The National School Public Relations Association selected Ranney to present its Hurricane Sandy crisis
communication experience as a case study at its National Conference in 2013.
'XULQJWKHSDVWWKUHH\HDUVZHKDYHHQVXUHGWKDW5DQQH\·VPLVVLRQYLVLRQDQGYDOXHVDUHUHÁHFWHGLQDOO
DUHDVRI5DQQH\·VLQWHUQDODQGH[WHUQDOPDUNHWLQJDQGSXEOLFUHODWLRQVVWUDWHJLHV/RRNLQJDKHDGZHSODQ
WRVWUHQJWKHQWKLVIUDPHZRUNDVZH´VKDUHWKH5DQQH\VWRU\µE\FRQWLQXLQJWRSURPRWHRXUWDOHQWHG
faculty, students and alumni across all media channels. §
FINANCIAL PLANNING
FINANCIAL PLANNING
,QWKHDUHDRIVWUDWHJLFÀQDQFLDOSODQQLQJWKHVFKRROLVFRPPLWWHGWRFRQWLQXLQJWKHXVHRIDORQJUDQJH
PRGHOWRSURYLGHVXIÀFLHQWIXQGLQJWRFDUU\RXWWKHVFKRRO·VPLVVLRQEXLOGDQHQGRZPHQWIXQGWKDWZLOO
build a steady source of investment income to the operating budget, attract and retain the best employ
HHVE\H[SDQGLQJRXUFRPSHWLWLYHFRPSHQVDWLRQDQGEHQHÀWVSODQVDQGGLYHUVLI\UHYHQXHVWUHDPVE\
identifying additional revenue sources.

7KHVFKRROEXLOWDPRGHORIORQJUDQJHÀQDQFLDOSODQQLQJE\SURMHFWLQJÀQDQFLDOVWDWHPHQWVWKURXJK
2017. This strategy allows the school to prepare for the economic pressures of running an elite
educational institution. The plan has empowered the leadership at Ranney School to continue to
HQKDQFHWKHTXDOLW\RIWKHHGXFDWLRQDOH[SHULHQFHZKLOHPDLQWDLQLQJÀVFDOLQWHJULW\7KLVVWUDWHJ\
has offered the community a competitive tuition rate for an unmatched educational experience,
DOORZHGOHDGHUVKLSWRIRFXVRQFUHDWLQJHIÀFLHQFLHVDQGHQDEOHGWKHVFKRROWRDWWUDFWDQGUHWDLQ
educators of the highest quality.
Our compensation packages have been thoroughly reviewed to attract and retain quality staff. In
comparison to NAIS benchmarks, Ranney School faculty and staff are receiving highly competitive
compensation, valuing both employee tenure and dedication to the school and recognizing perfor
mance and teaching excellence. Furthermore, the school has encouraged and underwritten our
educators and professional staff to seek professional development opportunities so that they are
SUHSDUHGLQFXWWLQJHGJHSUDFWLFHVWRDIIRUGRXUVWXGHQWVWKHODWHVWLQLQQRYDWLYHOHDUQLQJ
:HKDYHFUHDWHG´SHUIHFWSDUWQHUVKLSVµZLWKOHDGHUVLQWKHLUDUHDVRIH[SHUWLVHWKDWRIIHURXU
students access to highly trained athletic and educational professionals that use our campus for
training and events and that allow the school to create additional revenue streams through the use
of our facilities. In addition, we have enhanced our Summer Programs to offer a wide variety of high
quality academic courses as well as fun and exciting camp activities that continue to obtain high
HQUROOPHQWV7KLVVWUDWHJ\RIGLYHUVLÀHGUHYHQXHVWUHDPVSOD\VDQLPSRUWDQWUROHLQUHGXFLQJWXLWLRQ
rates for all families.
7KHLPSURYHPHQWRIÀQDQFLDOSODQQLQJLQFOXG
LQJÀVFDOUHVSRQVLELOLW\LVDQRQJRLQJPLVVLRQRI
WKHVFKRRO2XUIRUZDUGORRNLQJJRDOVRQWKH
Financial Planning Committee include maintain
ing and enhancing green initiatives, creating
budgets to reward and retain top educators
and staff, and utilizing resources to continue to
educate through professional development—
all of which will result in an institution of the
highest quality. §
The 2013 RSPA Panther Ball and
Gala, themed “Come Together.”
DEVELOPMENT
DEVELOPMENT
At the start of this strategic plan, the Development Committee determined that there was an opportunity
WRLQFUHDVHSKLODQWKURSLFVXSSRUWPRYLQJIRUZDUGZLWKDFRQFHQWUDWHGHIIRUWLQWKUHHVSHFLÀFIXQGUDLV
LQJDUHDVDQQXDOJLYLQJDOXPQLVXSSRUWDQGHQGRZPHQW7KHFRPPLWWHHDOVRGHÀQHGWKHFRPSRQHQWVRID
successful development program, including: annual giving, leadership giving, planned giving and endowment,
special events, alumni programs and parenting programs through RSPA. The committee determined that
DIRFXVRQWKHVHDUHDVDQGDÀUPJUDVSRQWKHSURJUDP·VYDULRXVFRPSRQHQWVZRXOGSURYLGH5DQQH\
School with a greater program of advancement over the course of not only three years, but over 10 years,
and produce a more robust stream of revenue from which to achieve our mission.

7KH5DQQH\$QQXDO)XQGKDVJURZQIURPLQ)LVFDO<HDU²WRDQDOOWLPHKLJKRI
DWWKHFORVHRIWKH²\HDUFRPELQHGSKLODQWKURS\UHVXOWHGLQLQÀVFDO
year 2011–2012; and Leadership Giving (i.e., $2,500 or more) now comprises approximately 20% of all
philanthropic support.
Board participation in the Annual Fund has been at 100% for the past three years.
$
SDUHQWFRPPLWWHHVSHFLÀFDOO\IRFXVLQJRQH[SDQGLQJWKH5DQQH\$QQXDO)XQGKDVEHHQSXWLQWR
place and continues to grow; as a result, volunteer parent participation has increased. The average par
ent gift to the Annual Fund has grown substantially to $2,500; in addition, parent participation in the
Ranney Fund has doubled.
Gifts to the Ranney Fund have provided essential funding for the school’s overall operating require
ments as well as a variety of special programs and campus enhancements, including: the renovation
of the aquatic center, new crew boats, a trailer to transport our teams to and from regattas, musical
instruments and wireless microphones for performing arts, robotic equipment for our emerging Ro
botics Program, the new Panther Grandstands and Press Box, the Lacrosse and Soccer Practice Wall,
XSJUDGHGWHFKQRORJ\IDFXOW\SURIHVVLRQDOGHYHORSPHQWDQGÀQDQFLDODLG
The Annual Fund also has supported, in part, unique special trips and programming for students, such
DVWKHVFKRROZLGHSHUIRUPDQFHDW&DUQHJLH+DOOLQ1HZ<RUN&LW\LQ-DQXDU\
7
KH´6XSSRUW5DQQH\µVHFWLRQRQWKHZHEVLWHH[SDQGHGWRIHDWXUHRQJRLQJXSGDWHVDERXWWKHIXQG
Alumni support has steadily increased during the past three years with the largest alumni reunion in
Ranney history taking place during Homecoming and Reunion Weekend 2012; the event attracted
more than 100 alumni back to campus. A highlight of the event was the celebration of Coach Emmett
Walling and the dedication of the renamed Walling Aquatic Center. The event showcased the pool’s
recently added swim blocks and bulkhead, made possible by generous donors to the Annual Fund.
Connections with alumni through Facebook (900+) and LinkedIn (230+) have grown tremendously.
The largest alumni gift to the school to date was received in 2012 in the amount of $35,000.
There are currently 19 Legacy Families enrolled at the school, meaning that a family has sent more
than one generation to Ranney.
As the Annual Fund continues to gain momentum within our parent constituency, the prospect of increas
ing alumni Annual Fund participation and engagement within our community remains an area of opportunity
IRU5DQQH\)XWXUHGHYHORSPHQWSODQVZLOOFDOOIRUGHÀQHGVWUDWHJLFLQLWLDWLYHVVXUURXQGLQJWKHFUHDWLRQRIDQ
HQGRZPHQWZKLFKFDQSRVLWLYHO\LPSDFWRXUORQJWHUPÀQDQFLDOJURZWKWUDMHFWRU\DQGSURYLGHQHZUHYHQXH
VWUHDPVQHHGHGWRIXOÀOORXUPLVVLRQ²SURPLVHZKLOHNHHSLQJWXLWLRQLQFUHDVHVWRDPLQLPXP§
GOVERNANCE
GOVERNANCE
The Governance Committee set strategic goals aimed at strengthening the school and the community it
serves. With a complete understanding of their roles, the Board of Trustees committed to being involved,
DFWLYHOHDGHUVZKRDUHHQJDJHGLQPDNLQJORQJWHUPJURZWKDQGVWDELOLW\DUHDOLW\DW5DQQH\6FKRRO
*RYHUQDQFHLQYROYHVWKUHHLPSRUWDQWSDUWVDÀGXFLDU\UROHLQZKLFKWKH%RDUGDQGWKH+HDGIRFXVRQWKH
best use of and stewardship of tangible assets; a strategic element whereby the Board and administration
develop and implement a tactical plan that moves the school toward its mission at all times; and an ele
ment of envisioning a great future, which includes examining all possible ways to keep the school distinc
tive and relevant. In this last domain, the Board and the Governance Committee, along with Dr. Sykoff,
WKHDGPLQLVWUDWLRQDQGIDFXOW\XVHGWKHSDVWWKUHH\HDUVWRDVNWKHELJSLFWXUHTXHVWLRQVDQGRXUVWUDWHJLF
planning enabled us to realize enormous growth, even during a time when the economic landscape was
very unpredictable. Such results point directly to the importance of governance as leadership, and gover
nance as the advancement of the mission.

5DQQH\6FKRROZDVRIÀFLDOO\UHDFFUHGLWHGLQ2FWREHUZLWK0LGGOH6WDWHV$VVRFLDWLRQRI&ROOHJHV
DQG6FKRROVXQGHU´H[FHOOHQWVWDQGLQJµWKHKLJKHVWUDQNLQJRIWKHSUHPLHUHDFFUHGLWLQJDVVRFLDWLRQ
Our leadership team, with support and guidance from the Board, put its Crisis Communication Plan into
DFWLRQGXULQJDQGLQWKHDIWHUPDWKRI+XUULFDQH6DQG\DQGZRUNHGWRÀQHWXQHWKHSODQDIWHUWKHVWRUP
The plan includes new safety and security programs that are current with recommendations from police
RIÀFLDOVDQGDVHFXULW\DXGLWFRQGXFWHGE\DQRXWVLGHÀUPVSHFLDOL]LQJLQLQGHSHQGHQWVFKRROV
Acknowledging that strategic planning requires ongoing participation of the Board, members have be
FRPHPRUHLQYROYHGLQWKHGDLO\OLIHRIWKHVFKRROWUXVWHHVVHHWKHYDOXHLQ´YLVLRQLQJµRQJRLQJLQQRYD
tion to sustain the school’s distinctive qualities.
7KH%RDUGPDLQWDLQVDQDFWLYHFRPPLWWHHVWUXFWXUHLQVXSSRUWRIGHYHORSPHQWÀQDQFHHGXFDWLRQVXVWDLQ
ability and governance, among other areas; committees are required to report on their yearly goals.The
Board also conducts an assessment of its effectiveness through an annual survey as recommended by the
National Association of Independent Schools and a substantive review at the annual Board retreat.
In conjunction with bylaws, the Governance Committee has established a format to identify prospective
7UXVWHHVIURPWKHSRRORIFDQGLGDWHVZKRVHUYHRQVXEFRPPLWWHHV3URVSHFWLYH7UXVWHHVDUHLGHQWLÀHG
EDVHGRQSURIHVVLRQDOSURÀOHVWKDWDOLJQZLWKWKH%RDUG·VGHVLUHWRPDLQWDLQGLYHUVLW\RIVNLOOVDQGRWKHU
important elements such as demographics, alumni and former parents.
In coordination with administrators, RSPA and Educator’s Collaborative, the Board carried out a
ÀYHPRQWK+HDGRI6FKRROVHDUFKZKLFKLQFOXGHGKLULQJDQDWLRQDOVHDUFKFRQVXOWDQWVHQGLQJDTXHV
tionnaire to the Ranney community to build the Information For Candidates (IFC) document, and a
robust interview process including Trustees, administrators, teachers and parents; the search yielded
close to 50 candidates from across the globe. Because of our school’s strong reputation, the pool of
ÀQDOLVWVZDVUREXVWDQGHDFKFDQGLGDWHZDVWKRURXJKO\VFUHHQHG7KHFRPSUHKHQVLYHSURFHVVOHGWR
WKHDSSRLQWPHQWRI'U-RKQ*ULIÀWKDV5DQQH\·VIRXUWK+HDGRI6FKRROZKRZLOOEHJLQKLVWHUPRQ
July 1, 2013. Our Trustees planned extremely well to make the transition to new leadership as smooth
DVSRVVLEOH7KHFXUUHQWVFKRRO\HDUSURYLGHGWLPHWRFHOHEUDWHWKHZRUNRI'U6\NRIIGXULQJKLV
\HDUWHQXUHDQGWLPHWRSODQDZDUPZHOFRPHIRURXUQHZOHDGHU'U*ULIÀWK%RWK'U6\NRIIDQG'U
*ULIÀWKKDYHFUHDWHGDZRQGHUIXOFOLPDWHRIVXFFHVVIXOWUDQVLWLRQIRUWKHFRPPXQLW\
The strategic planning process now has solid roots in Ranney School’s approach to governance and will re
PDLQDQRQJRLQJH[HUFLVHE\WKH%RDUGDQGVFKRROOHDGHUVKLS$VLQFRPLQJ+HDGRI6FKRRO'U*ULIÀWKEHJLQV
his tenure, the strategic process will carry on, ensuring that our vision, mission and dreams continue. §
INFRASTRUCTURE
FACILITIES & CAMPUS
INFRASTRUCTURE
/RQJUDQJHSODQQLQJLVDNH\WKHPHRI5DQQH\
School’s strategic goals plan in the area of facilities
and campus infrastructure. Part of this planning by
the Facilities and Campus Infrastructure Committee
LQFRUSRUDWHGDWKUHH\HDUFDSLWDORSHUDWLRQVSODQH[
SORULQJDOWHUQDWLYHHQHUJ\DQG´JUHHQµLQLWLDWLYHVDQG
the ongoing pursuit of enhancing safety and security
measures on campus.

The strategy of safety and security proved to be
instinctual following the increase of school security Above: Ranney’s clock tower at night.
Below: The dedication and ribbon-cutting ceremony of
breaches nationwide in recent times.The school’s
ORQJUDQJHFDSLWDOSODQKDVEHHQIXUWKHUGHYHORSHG the Lawrence Sykoff Center for Excellence, May 2013.
to take into account the primary goals of safety and
security. Key outcomes in this area include:
A Safety and Security Summit was held on campus with representatives from Homeland Security,
New Jersey State Troopers and the Tinton Falls Police Department to set objectives for improving
school safety.
5DQQH\KLUHGDIXOOWLPH7LQWRQ)DOOV3ROLFH2IÀFHUDVZHOODVWZR/RZHU6FKRROUHFHSWLRQLVWVWR
PRQLWRUVWXGHQWGURSRIIVDQGSLFNXSVDQGVWDIIPHPEHUVKDYHEHHQLVVXHGLGHQWLÀFDWLRQWDJVWREH
worn at all times.
A security camera and access button have been installed to the aftercare program building.
Siren and panic buttons and their related systems have been purchased and will be fully installed
EHIRUHWKHHQGRIWKH²VFKRRO\HDUVRWKDWGULOOQRWLÀFDWLRQVRIDOONLQGVFDQEHKHDUGRQ
all parts of the campus.
7KH(DUO\&KLOGKRRG/HDUQLQJ&HQWHUXQGHUZHQWVLJQLÀFDQWXSJUDGHVWRVXSSRUWEHVWWHDFKLQJSUDFWLFHV
The facility goals for the center continue to unfold, to incorporate brighter and more spacious class
rooms that support team teaching and student development in areas of growth and movement.
Ongoing athletic improvements to campus included a new Grandstands and Press Box.
A Sustainability Committee has been formed to review the campus in total; many initiatives
KDYHEHHQLPSOHPHQWHGLQFOXGLQJLQFUHDVHGUHF\FOLQJ,QDGGLWLRQH[SDQVLYHDQGPRGHUQHQHUJ\
HIÀFLHQWIDFLOLWLHVWKURXJKRXWFDPSXVKDYHUHVXOWHGLQORZHURSHUDWLQJFRVWV
The facilities and campus infrastructure mission of Ranney School continues to look
LQWRWKHIXWXUH6DIHW\DQGVHFXULW\RQFDPSXVZLOOUHPDLQWKHQXPEHURQHSULRULW\ZLWK
enhancements to facilities and the process of keeping all constituents safe always at the
forefront. Upgrades to classrooms, auditoriums, athletic, performing art and dining facili
ties will be unending to allow current and future students to grow in a nurturing envi
ronment. Ranney is committed to the ongoing improvement of the tangible assets, as
ZHOODVWKHLQWDQJLEOHSURFHVVHVWKDWWDNHSODFHRQDGD\WRGD\EDVLV§
SPECIALIZED SCHOOLS &
ATHLETIC PROGRAMS*
ART/ARCHITECTURE
Drexel University, Westphal College
of Media Arts & Design
Maryland Inst. College of Art
Massachusetts College of Art & Design
New Jersey Inst. of Technology
Northeastern University
University of Notre Dame
Penn State University,
College of Arts & Architecture
Pratt Institute
Rhode Island School of Design
Ringling College of Art and Design
School of the Art Inst. of Chicago
School of the Museum of Fine Arts
Syracuse University, School of Archit.
Tulane University, School of Archit.
University of the Arts
Virginia Tech, Archit. & Urban Studies
BUSINESS
Babson College
Bentley University
Bryant University
Georgetown University–
McDonough School
New York University–Stern
Northeastern University
University of Richmond–
School of Business
Rutgers University–Business School
Villanova University–Business School
Washington University in St. Louis–
Olin School of Business
ENGINEERING
Columbia’s Fu School of
Engineering and Applied Sciences
New Jersey Inst. of Technology
Lehigh University
Stevens Inst. of Technology
Villanova University
Wentworth Inst. of Technology
FILM/TV PRODUCTION
Drexel University, Westphal
College of Media Arts & Design
Emerson College, Film Production
Ithaca College, Film Production
SUNY Purchase, Film Production
IVY LEAGUE
Brown
Columbia
Cornell
Dartmouth
Harvard University
University of Pennsylvania
Princeton University
JOURNALISM
Northwestern University–
Medill School of Journalism
MUSIC CONSERVATORIES
Carnegie Mellon College of Fine Arts
Cleveland Inst. of Music
Manhattan School of Music
New England Conservatory of Music
Peabody Inst. at Johns Hopkins
Rutgers Mason Gross School
San Francisco Conservatory of Music
MUSIC INDUSTRY
Drexel University–Music Industry
New York University’s Tisch
School of the Arts, Clive Davis
Inst. of Recorded Music
New York University Steinhardt–
Music Technology
OVERSEAS
University of Edinburgh
University of Saint Andrews
ATHLETIC PROGRAMS
Boys’ Lacrosse: Gettysburg College
(Div. III), Marist College (Div. I)
Boys’ Fencing: Brandeis Univ. (Div.
III), Columbia (Div. I), NYU (Div.
III), Pennsylvania (Div. I), Haverford
(Div. III), Stevens Inst. (Div. III)
Boys’ Baseball: Adelphi Univ. (Div. II)
Boys’ Soccer: US Naval Academy
Boys’ Swimming: Franklin
and Marshall (Div. III),Vassar
College (Div. III), Loyola Univ.
Maryland (Div. I)
Boys’ Track: Rollins (Div. III)
Girls’ Lacrosse: Muhlenberg
College (Div. III)
Girls’ Field Hockey: Massachusetts
Inst. of Technology
Girls’ Track: American Univ. (Div. I),
Univ. of Delaware (Div. I)
Crew: Duke Univ. (Div. I), Harvard
Univ. (Div. I), Univ. of North
Carolina–Chapel Hill (Div. I)
Girls’ Softball: Georgetown
Univ. (Div. I)
Girls’ Soccer: Susquehanna
Univ. (Div. III)
Girls’ Swimming: Lafayette
College (Div. I)
*Recent graduates were accepted into these
schools or recruited by these programs.
KNOWLEDGE
9,6,21+2125
NATIONAL MERIT
SCHOLARSHIP PROGRAM:
Class of 2013: 4 students commended
STANDARDIZED TESTS: 86% of Ranney stu
dents pass their Advanced Placement
(AP) exams, compared to the New Jer
sey pass rate of 75% and the global pass
rate of 61%. In 2013, a junior achieved a
perfect score of 2,400 on the SAT.
AP SCHOLAR AWARDS:
Class of 2013:
6 scholars
6 scholars with honor
8 scholars with distinction
Class of 2012:
10 scholars
1 scholar with honor
Class of 2011:
12 scholars
Class of 2010:
16 scholars
Class of 2009:
7 scholars
COLLEGE ENTRANCE: Approximately 75%
of Ranney graduates earn acceptance
WRWKHLUÀUVWRUVHFRQGFKRLFHFROOHJH
74% of the class of 2013 were admitted
through Early Action/Early Decision.
SCHOLARSHIPS: Students in the Class
of 2013 were awarded scholarships
totaling $2,558,060 over four years.
RANNEY SCHOOL COLLEGE MATRICULATION
2009–2013
Adelphi University
American University
Babson College (2)
Bard College (4)
Barnard College (4)
Bentley University
Boston College (3)
Boston University (3)
Bowdoin College
Brandeis University
Bryn Mawr College
Bucknell University (9)
Carnegie Mellon University (2)
College of Charleston (5)
The University of Chicago (3)
University of Colorado
at Boulder (2)
Columbia University (4)
Cornell University (4)
Dartmouth College (4)
University of Delaware
Dickinson College
Drexel University (4)
Duke University (4)
Elon University (2)
Emerson College
Emory University (3)
)DLUÀHOG8QLYHUVLW\
Fairleigh Dickinson University
Fordham University (3)
Franklin & Marshall College (5)
The George Washington
University (11)
Georgetown University (5)
University of Georgia
Gettysburg College
Hamilton College–New York (2)
Harvard University
Haverford College
Hobart and William
Smith Colleges
Hofstra University
Ithaca College
James Madison University
Johns Hopkins University (2)
Johnson and Wales University
Lafayette College (6)
Lake Erie College
Lasell College
Lehigh University (6)
Loyola Marymount University
Loyola University Maryland (7)
Lynchburg College
Manhattan School of Music
Marist College
Marquette University
University of Maryland–
College Park (2)
Massachusetts Institute
of Technology
University of Miami (4)
University of Michigan (4)
Middlebury College
Monmouth University
Moravian College
Muhlenberg College (6)
The College of New Jersey
New York University (28)
Northeastern University (5)
Northwestern University (2)
University of Notre Dame (6)
Ohio Wesleyan University
Pace University, New York City (3)
University of Pennsylvania (5)
Polytechnic Institute of NYU
Princeton University (3)
Providence College
Quinnipiac University (3)
Rhode Island School of Design
Richard Stockton College
of New Jersey
University of Richmond
Ringling College of Art
and Design
Rollins College
Rutgers,The State University of New
Jersey at New Brunswick (10)
Saint Joseph’s University (3)
Santa Clara University
Sarah Lawrence College
School of the Art Institute
of Chicago
University of Scranton
Skidmore College (2)
University of South Carolina
University of Southern California
Stanford University
Stetson University
Stevens Institute of Technology (4)
Susquehanna University (2)
Syracuse University (2)
Tufts University (2)
Tulane University (5)
Union College (2)
Ursinus College (2)
Villanova University (5)
Washington and Lee University
Washington College
Washington University
in St. Louis (3)
Williams College
The College of Wooster
*Parenthetical number designates
number of students maticulating at
the college.
Ranney School
E
Established 1960
235 Hope Road / Tinton Falls, NJ 07724
Phone: 732.542.4777 / Fax: 732.544.1629
www.ranneyschool.org