view the brochure - South Carolina Bar
Transcription
view the brochure - South Carolina Bar
GIVING PROTECTING OUR YOUTH VOLUNTEER PUBLIC IMPROVING COMMITTEE SIGN UP PROFESSIONAL DEVELOPMENT CINDERELLA PROJECT HABITAT FOR HUMANITY HELPING GIVING SERVICE the FAMILY PROFESSION VOLUNTEER INCOME TAX ASSISTANCE HELPING the YLD MILITARY SUPPORT 2016-2017 VOICES AGAINST VIOLENCE YOUNG LAWYERS DIVISION COURTHOUSE KEYS CLINICS WILLS SOUTH CAROLINA BAR FAMILIES FOREVER LAW WEEK THE COLOR OF JUSTICE ANNUAL BAR CONVENTION COMMITTEE DIVERSITY COMMITTEE WISH MAKE A COMMUNITY TECHNOLOGY FAMILY SPECIAL OLYMPICS BACKPACK DRIVE MEMBERSHIP ABA/YLD SERVICE PROJECT PUBLICATIONS & MARKETING BAR FOUNDATION MEMBERSHIP EVENTS Dear Young Lawyers of South Carolina: You are receiving this brochure because, by virtue of your admission to practice in this state, you DUHDPHPEHURIWKH6RXWK&DUROLQD%DU<RXQJ/DZ\HUV'LYLVLRQ</',KRSHWKLVÀQGV\RXZHOO in your practice and at home. The leadership of the YLD wants to make sure you get the most EHQHÀWSRVVLEOHIURP\RXUPHPEHUVKLSDQGWKDWLVWKHSXUSRVHRIWKLVEURFKXUH By way of background, the YLD is a professional organization comprised of nearly 4,000 members of the South Carolina Bar in good standing under 36 years of age, or those admitted WRWKH6RXWK&DUROLQD%DUDVWKHLUÀUVWEDUZLWKLQWKHSDVWÀYH\HDUV7KLQNLQJRIWKH</'DVD family tree, it is essentially divided into two separate branches, namely the Service to the Public branch and the Service to the Members branch. These two arms consist of 22 committees that SURYLGHDQDVVRUWPHQWRIEHQHÀWVWRRXUPHPEHUVDQGWKHSXEOLF$GGLWLRQDOO\HDFK-XGLFLDO Circuit has a YLD Circuit Representative to facilitate the committees’ involvement across our state. :HKRSH\RXWDNHWKLVRSSRUWXQLW\WRQHWZRUNZLWKRWKHU\RXQJODZ\HUVZKLOHIXOÀOOLQJ\RXUJRDOV for public service and improving the profession. Please take a few minutes of your day to review WKLVEURFKXUHWKDW\RXUDPD]LQJ%DUVWDIIZRUNHGYHU\KDUGWRFUHDWHIRU\RXUEHQHÀW,QLW\RX ZLOOÀQGGHVFULSWLRQVRIWKHFRPPLWWHHVDQGVRPHRIWKHLULQWHQGHGSURMHFWVIRUWKHXSFRPLQJ%DU \HDU-XO\²-XQH,JHQXLQHO\EHOLHYHWKDW\RXZLOOÀQGWKLVEURFKXUHEHQHÀFLDO in improving your understanding of what the YLD does for our members and our state. $IWHU\RX·YHLGHQWLÀHGWKHFRPPLWWHHV\RXZRXOGOLNHWRMRLQVLPSO\ÀOORXWWKHEDFNSRUWLRQRI this brochure, tear it off and place it in the mail to our wonderful Bar liaison, Kimberly Snipes. You can also complete the form online at www.scbar.org/yldcsu.$IWHU\RXKDYHVLJQHGXS \RXZLOOEHFRQWDFWHGE\WKHFRPPLWWHHFKDLUVLGHQWLÀHGLQWKLVEURFKXUHDERXWZD\VWRJHW LQYROYHGLQWKHFRPPLWWHHV\RXKDYHMRLQHG7KHQLWLVXSWR\RXWRGHFLGHKRZPXFK\RXZDQWWR participate in the YLD. In closing, I would be remiss if I did not mention how indescribably grateful I am to serve you this Bar year. I truly stand on the shoulders of those such as Patrick Wooten, Lynsey Kmetz, Will -RKQVRQ7UH\0LOOV5HEHFFD5RVHUDQGFRXQWOHVVRWKHUVZKRZRUNHGKDUGWRPDNHWKH</'D nationally-recognized and award-winning organization. I look forward to working with President- (OHFW/LQGVD\-R\QHUDQG6HFUHWDU\7UHDVXUHU$VKOHLJK:LOVRQWRSURYLGHHDFKRI\RXZLWKWKH PD[LPXPEHQHÀWRI\RXUPHPEHUVKLSLQWKH</' Sincerely, Irish “Ryan” Neville </'3UHVLGHQW ORGANIZATION DIVISION OF THE FROM THE A MESSAGE PRESIDENT 7KH6RXWK&DUROLQD%DU<RXQJ/DZ\HUV'LYLVLRQZDVIRXQGHGLQWRIRVWHUSULQFLSOHVRIGXW\DQGVHUYLFH to the public, promote professional responsibility, stimulate the interest of young lawyers in Bar activities, conduct programs of interest and value to young lawyers, and to assist in the coordination and improvement of local young lawyer organizations. $OOODZ\HUVSUDFWLFLQJLQ6RXWK&DUROLQDDUHOLFHQVHGWKURXJKWKH6RXWK&DUROLQD6XSUHPH&RXUWDQGDUH PDQGDWRU\PHPEHUVRIWKH6RXWK&DUROLQD%DU$OOPHPEHUVRIWKH6RXWK&DUROLQD%DULQJRRGVWDQGLQJ XQGHU\HDUVRIDJHRUWKRVHDGPLWWHGWRWKH6RXWK&DUROLQD%DUDVWKHLUÀUVWEDUIRUOHVVWKDQÀYH\HDUV are members of the Division. The Executive Council is the governing body of the Division. The Executive Council is composed of a president, president-elect, secretary-treasurer, immediate past president, an out of VWDWHFLUFXLWUHSUHVHQWDWLYHDFLUFXLWUHSUHVHQWDWLYHIURPHDFKMXGLFLDOFLUFXLWWKH$%$</'UHSUHVHQWDWLYH (in alternating years), a law student representative from the University of South Carolina School of Law and from the Charleston School of Law, and others appointed by the Division President during his or her term as President. 7KH'LYLVLRQLVDQDIÀOLDWHRIWKH<RXQJ/DZ\HUV'LYLVLRQRIWKH$PHULFDQ%DU$VVRFLDWLRQDQGVHQGV UHSUHVHQWDWLYHVWRWKHDQQXDODQGPLG\HDUPHHWLQJVDQGWRVSULQJDQGIDOOFRQIHUHQFHV$VDQDIÀOLDWH RIWKH$PHULFDQ%DU$VVRFLDWLRQ<RXQJ/DZ\HUV'LYLVLRQWKH6RXWK&DUROLQD%DU</'DQGLWVDIÀOLDWHG RUJDQL]DWLRQVVKDUH'LVWULFWZLWKWKH869LUJLQ,VODQGV 7KH6RXWK&DUROLQD%DU<RXQJ/DZ\HUV'LYLVLRQKDVHQMR\HGDPRPHQWXPRISURVSHULW\VLQFHLWZDVIRUPHG LQ7KHRUJDQL]DWLRQKDVEORVVRPHGIURPDVPDOOJURXSEUDLQVWRUPLQJDERXWSURMHFWVWRDQDZDUG winning organization of approximately 3,600 lawyers tackling and conquering a myriad of community VHUYLFHDQG%DUPHPEHUSURMHFWV 7KH<RXQJ/DZ\HUV'LYLVLRQVWULYHVWRVSRQVRUSURMHFWVWKDWKDYHDSRVLWLYHLPSDFWXSRQ6RXWK&DUROLQD·V FRPPXQLWLHV,WKDVEHHQFRQVLVWHQWO\UHFRJQL]HGE\WKH$%$LQQDWLRQDOFRPSHWLWLRQVIRULWVVHUYLFHWR WKHSXEOLFDQGVHUYLFHWRLWVPHPEHUV6HUYLFHWRWKHSXEOLFLQFOXGHVSURMHFWVDQGSURJUDPPLQJIRFXVHG on a variety of topics, including education on preventing domestic violence, civics education, adoption and foster care awareness, and assisting those with intellectual disabilities. Service to Bar members includes implementing programs which provide networking opportunities with other professional organizations, SODQQLQJVPDOOJDWKHULQJVZLWKPHPEHUVRIWKHMXGLFLDU\DQGLQFUHDVLQJDWWHQGDQFHDWWKH%DU&RQYHQWLRQ LQ-DQXDU\ 7KH'LYLVLRQRIIHUVRSSRUWXQLWLHVIRU\RXQJODZ\HUVWRLPSURYHWKHLPDJHRIWKHOHJDOSURIHVVLRQDQGIXOÀOO WKHLUSXEOLFVHUYLFHJRDOV7KH'LYLVLRQKDVQXPHURXVFRPPLWWHHVZLWKVSHFLDOSURMHFWVWREHFRPSOHWHG,W also coordinates social events to give young lawyers around the state opportunities to network and learn about each other. DIVERSITY COMMITTEE TO THE SERVICE BAR The purpose of the Diversity Committee is to advocate and support diversity in the legal community, to facilitate opportunities for law students and YLD members to grow in their own understanding of diversity, and to promote equality of opportunity for all. The committee is dedicated to creating a more inclusive legal community grounded in respect and appreciation for individual differences. The committee endorses a EURDGGHÀQLWLRQRIGLYHUVLW\DQGVHHNVWRFUHDWHDGLDORJXHWKURXJKSURJUDPVDQGUHVRXUFHVWKDWHQKDQFH knowledge and encourage understanding of diversity. ANNUAL BAR Teckla S. Henderson Administrative Law 6&$GPLQLVWUDWLYH/DZ&RXUW 3HQGOHWRQ6W6WH &ROXPELD6& [email protected] CONVENTION COMMITTEE 7KH$%&&RPPLWWHHSURPRWHV</'·VLQYROYHPHQWZLWKWKH6&%DU&RQYHQWLRQE\SODQQLQJRUJDQL]LQJDQG implementing a CLE program and attendance incentive event. The CLE component will offer a program that is of interest to young lawyers and provide at least three CLE credit hours for attendees. The attendance incentive event will be a social gathering for members of the YLD and their guests. Its purposes are to LQFUHDVH\RXQJODZ\HUSDUWLFLSDWLRQDWWKH&RQYHQWLRQDQGLQ%DU</'DFWLYLWLHV$GGLWLRQDOO\WKHFRPPLWWHH will be responsible for planning and organizing a meeting for the YLD Executive Council, committee chairs and co-chairs. Emily Bridges Franchising Smith Moore Leatherwood, LLP ::DVKLQJWRQ6W6WH *UHHQYLOOH6& [email protected] Adam Landy Tax/Estate Planning/ Economic Development 0F1DLU/DZ)LUP3$ 32%R[ &ROXPELD6& [email protected] Amity Edmonds Workers’ Compensation Defense *DOOLYDQ:KLWH%R\G3$ 32%R[ *UHHQYLOOH6& DHGPRQGV#JZEODZÀUPFRP Tommy Preston Jr. Policy and Regulatory Boeing South Carolina ,QWHUQDWLRQDO%OYG 1&KDUOHVWRQ6& [email protected] COURTHOUSE KEYS COMMITTEE The purpose of this committee is to provide young lawyers the opportunity to meet and interact with PHPEHUVRIWKHMXGLFLDU\LQDVPDOOJURXSVHWWLQJ7KHVHHYHQWVDUHOLPLWHGLQWHUPVRIWKHQXPEHURI\RXQJ ODZ\HUDWWHQGHHVDQGRIWHQWKHMXGJHVZLOORIIHUSUDFWLFDOWLSVLQVLJKWDQGZRUGVRIZLVGRPWRWKH\RXQJ ODZ\HUV'HSHQGLQJXSRQWKHSUHIHUHQFHVRIWKHSDUWLFLSDWLQJMXGJHV&RXUWKRXVH.H\VHYHQWVPD\YDU\IURP informal breakfasts to lunchtime or evening events. The members of this committee will work alongside the committee chairs and circuit representatives to coordinate at least two Courthouse Keys events in each circuit, as well any statewide events that the committee chooses to organize, such as the annual Supreme Court Breakfast in Columbia. Liam Duffy Business Litigation Rosen Rosen & Hagood, LLC 0HHWLQJ6W6WH &KDUOHVWRQ6& OGXII\#UUKODZÀUPFRP Paige Ornduff Law Clerk 6&&RXUWRI$SSHDOV 6HQDWH6W &ROXPELD6& [email protected] MEMBERSHIP EVENTS COMMITTEE This committee is tasked with engaging young lawyers in the Young Lawyers Division, regardless of whether they are newly admitted to the SC Bar or approaching the end of their eligibility in YLD. In addition to coordinating member networking events, family-friendly events and new admittee receptions, this committee will also coordinate events designed to provide opportunities for YLD members and law students to interact and introduce law students to the SC Bar and YLD. Sabrina E. “Sable” Burgess Creditors’ Rights/Bankruptcy and Collections 6KHUS\DQG-RQHV3$ 32%R[ /H[LQJWRQ6& H[W VHE#VKHUS\MRQHVODZFRP Chisa J. Putman Criminal/Family Law Rock Hill City Solicitor (0DLQ6W 5RFN+LOO6& FKLVDMSXWPDQ#JPDLOFRP TECHNOLOGY COMMITTEE PROFESSIONAL DEVELOPMENT COMMITTEE The purpose of this committee is to assist young lawyers in becoming successful in the profession by facilitating networking opportunities with other young professionals as well as educational opportunities for young lawyers, focusing on relevant issues to the profession. The members of this committee will work with the committee chairs to assist the circuit representatives in planning at least one Professional Development event in each circuit. These events will vary from after work events with other young professional RUJDQL]DWLRQVVXFKDVWKH6&<RXQJ%DQNHUV'LYLVLRQWKH6&$VVRFLDWLRQRI&HUWLÀHG3XEOLF$FFRXQWDQWV DQGWKH1DWLRQDO$VVRFLDWLRQRI,QVXUDQFHDQG)LQDQFLDO$GYLVRUVRI6&&/(VWDUJHWLQJ\RXQJODZ\HUVWR Lunch and Learn events for young lawyers, which take place in a one hour, lunchtime format. John Linton Business/Commercial Litigation 3UDWW7KRPDV:DONHU3$ 32'UDZHU &KDUOHVWRQ6& MSO#SWZFRP Perry MacLennan Employment & Labor Law +D\QVZRUWK6LQNOHU%R\G3$ 0HHWLQJ6WUG)ORRU &KDUOHVWRQ6& SPDFOHQQDQ#KVEODZÀUPFRP Ben Connell Injury and Death Cases/Trials The Connell Law Firm, LLC 32%R[ /XJRII6& [email protected] THE COLOR OF JUSTICE COMMITTEE Ashley R. Forbes Workers’ Compensation 0F$QJXV*RXGHORFN&RXULH (&DPSHUGRZQ:D\6WH *UHHQYLOOH6& [email protected] &RORURI-XVWLFHLVDQRXWUHDFKSURJUDPWKDWZDVHVWDEOLVKHGE\WKH1DWLRQDO$VVRFLDWLRQRI:RPHQ-XGJHV WRIRVWHUGLYHUVLW\LQWKHOHJDOSURIHVVLRQDQGMXGLFLDU\7KH</'&RORURI-XVWLFHFRPPLWWHHDGRSWHGWKLV SURJUDPDQGZRUNVWRLQWURGXFHPLGGOHDQGKLJKVFKRROPLQRULW\VWXGHQWVWRWKHÀHOGRIODZWKURXJKD SUHVHQWDWLRQWKDWLQFOXGHVDSDQHOGLVFXVVLRQDQGEUHDNRXWVHVVLRQZLWKMXGJHVDWWRUQH\VODZSURIHVVRUV DQGODZVWXGHQWV,QDGGLWLRQWRUHDFKLQJPLGGOHDQGKLJKVFKRROVWXGHQWVDFURVVWKHVWDWHWKH&2- Committee has implemented a College Roadshow, which includes the Historically Black Colleges and 8QLYHUVLWLHVLQ6RXWK&DUROLQD7KHSXUSRVHRIWKH&2-+%&85RDGVKRZLVWRHTXLSPLQRULW\FROOHJH students with the tools necessary to enter the legal profession, thereby increasing diversity within the legal profession. The committee and its volunteers will speak to the college students about the importance of three components—preparation, performance and practice. The preparation component will focus on what college VWXGHQWVVKRXOGGRWRSUHSDUHIRUODZVFKRRODQGWKH/6$77KHSHUIRUPDQFHFRPSRQHQWZLOODGGUHVVZKDW they should expect and how to succeed in law school. The practice component will give the college students insights on what it means to practice law. This committee is looking for young lawyers who are enthusiastic and interested in promoting diversity and inclusion in the legal profession. PUBLICATIONS & MARKETING COMMITTEE Members of this committee prepare and update YLD publications and facilitate marketing of the YLD, not only among the Division’s members but also to all Bar members and to the public. The committee is responsible for the Division’s newsletter, South Carolina Young Lawyer, which is distributed quarterly to all YLD members and is published on the SC Bar’s website. South Carolina Young Lawyer has received national awards and recognition for the content provided to YLD members. The newsletter contains committee reports, upcoming events, member spotlights and practice tips, among other valuable information. Jonathan Knicely Law Clerk Hon. Dennis Shedd 86&RXUWRI$SSHDOVWK&LUFXLW 5LFKODQG6W &ROXPELD6& MPNQLFHO\#JPDLOFRP This committee will identify ways that young lawyers can improve their practices using technology and ways that technology can further the professional development of lawyers. This committee may organize CLEs relating to technology and will look for opportunities to work with other groups within the SC Bar. Emily Limehouse Law Clerk U.S. District Court, District of S.C. P.O. Box 338 &KDUOHVWRQ6& [email protected] Evan Guthrie Estate Planning Evan Guthrie Law Firm 0DUNHW6W6WH &KDUOHVWRQ6& [email protected] David Paavola Consumer Protection & Antitrust Lewis Babcock, L.L.P. +DPSWRQ6W &ROXPELD6& [email protected] Cashida Okeke Medical Device Litigation Nelson Mullins Riley & Scarborough, LLP 0DLQ6W0HULGLDQWK)ORRU &ROXPELD6& [email protected] BAR FOUNDATION COMMITTEE TO THE SERVICE PUBLIC ABA/YLD SERVICE PROJECT This committee will assist and support the SC Bar Foundation by planning events and assisting with events planned by others that support the grantees of the Foundation. Thomas Rode Business/Civil Litigation Thurmond Kirchner Timbes <HOYHUWRQ3$ 0LG$WODQWLF:KDUI &KDUOHVWRQ6& WURGH#WNW\ODZÀUPFRP Alexis Wimberly Civil Litigation %URZQ9DUQDGR &KXUFK6W 0W3OHDVDQW6& awimberly@brown-varnado.com COMMITTEE 7KLVFRPPLWWHHZLOOEHUHVSRQVLEOHIRULPSOHPHQWLQJWKH$%$</'6HUYLFH3URMHFWDVLWLVODXQFKHGLQ$XJXVW DWWKH$%$$QQXDO0HHWLQJ(DFK\HDUWKH3UHVLGHQW(OHFWDQGLQFRPLQJ&RPPLWWHH&KDLUVZLOOKDYHWKH GLVFUHWLRQWRPDLQWDLQWKHH[LVWLQJSURMHFWDQGWRVXSSOHPHQWRUVXEVWLWXWHWKHQHZO\ODXQFKHGSURMHFW7KH </'ZLOOSDUWQHUZLWKYDULRXVFRPPXQLW\RUJDQL]DWLRQVWRLPSOHPHQWWKHGHWHUPLQHGSURMHFWHDFK\HDU M. Stephen Blevins Jr. Complex Personal Injury Rankin Law Firm %URDG6W6WH &KDUOHVWRQ6& VWHSKHQ#WKHUDQNLQODZÀUPFRP Kathryn A. Waites Personal Injury/Wrongful Death/ Mass Tort Class Actions/ Environmental Law Motley Rice, LLC 28 Bridgeside Blvd. 0W3OHDVDQW6& [email protected] BACKPACK DRIVE COMMITTEE The purpose of this committee is to collect new backpacks and school supplies for donation to students, VFKRROVDQGFKDULWDEOHRUJDQL]DWLRQVLQQHHGWKURXJKRXWWKHVWDWH%HJLQQLQJLQODWH-XO\WKURXJKPLG $XJXVWFRPPLWWHHPHPEHUVFRRUGLQDWHGRQDWLRQGURSRIIORFDWLRQVDWYROXQWHHULQJODZÀUPVDQGDJHQFLHV pick up and organize the donated supplies, and then distribute them to the recipients in need prior to the start of the school year. Sandra Moser Criminal Law )LIWK&LUFXLW6ROLFLWRU·V2IÀFH 0DLQ6W6WH &ROXPELD6& [email protected] Jessica Christophillis Family Law &KULVWRSKLOOLV*DOOLYDQ3$ 300 N. Main St., Ste. 200 *UHHQYLOOH6& MHVVLFD#FJODZVFFRP Dyllan Rankin Personal Injury The Rankin Law Firm %URDG6W6WH &KDUOHVWRQ6& G\OODQ#WKHUDQNLQODZÀUPFRP CINDERELLA PROJECT &HOHEUDWLQJLWVWKVHDVRQWKH&LQGHUHOOD3URMHFWLQYROYHVJDWKHULQJGRQDWLRQVRIJHQWO\ZRUQIRUPDO JRZQVVKRHVDQGDFFHVVRULHVWREHQHÀWKLJKVFKRROVWXGHQWVDFURVV6RXWK&DUROLQD6WXGHQWVIURPDUHD high schools are invited to attend a boutique held in the spring to “shop” for a dress and other items at no cost. Members of this committee coordinate with local boutiques, commununity organiations, other legal DVVRFLDWLRQVDQGODZÀUPVIRUFROOHFWLRQRIWKHGUHVVHVDQGVROLFLWDWLRQRIGRQDWLRQV0HPEHUVZLOODOVR organize the boutiques and assist the belles of the ball as they shop on the day of the boutique. Sheila Bias, Statewide Chair Labor and Employment Law Fisher & Phillips, L.L.P. 0DLQ6W6WH Columbia, South Carolina [email protected] Ashley Hammack Aiken Coordinator Criminal Law 6HFRQG&LUFXLW6ROLFLWRU·V2IÀFH P.O. Drawer 3368 $LNHQ6& H[W [email protected] Leslie McIntosh Anderson Coordinator Family Law/Wills & Estates McIntosh, Sherard, Sullivan & Brousseau 32%R[ $QGHUVRQ6& OHVOLH#PVVODZÀUPQHW Lisa Bentley Greenville Co-Coordinator Criminal Law 7KLUWHHQWK&LUFXLW6ROLFLWRU·V2IÀFH (1RUWK6W6WH *UHHQYLOOH6& [email protected] Elizabeth Gailey Greenville Co-Coordinator Prosecutor WK&LUFXLW6ROLFLWRUV2IÀFH (1RUWK6W6WH *UHHQYLOOH6& [email protected] Sarah M. Ahmad Greenwood Coordinator Family/Probate Law South Carolina Legal Services :&DPEULGJH$YH *UHHQZRRG6& H[W [email protected] Cinderella Project Committee, continued. Erica Lybrand Midlands Coordinator Real Estate Litigation Rogers Townsend & Thomas, PC 220 Executive Center Dr. &ROXPELD6& erica.lybrand@rtt-law.com Sarah Ford Orangeburg Coordinator Criminal Law )LUVW&LUFXLW6ROLFLWRU·V2IÀFH 32%R[ 2UDQJHEXUJ6& VIRUG#VFVROLFLWRURUJ COMMUNITY LAW WEEK &RPPXQLW\/DZ:HHNLVDQDQQXDOHYHQWKHOGLQWKHEHJLQQLQJRI0D\LQFRQMXQFWLRQZLWKWKHQDWLRQDOO\ recognized Law Day. This week of service allows members of YLD to work together to promote the legal profession while at the same time serving the community. Committee members are tasked with selecting DQGFRRUGLQDWLQJVHUYLFHSURMHFWVWKDWZLOOEHLPSOHPHQWHGE\WKH&LUFXLW5HSUHVHQWDWLYHV&LUFXLW 5HSUHVHQWDWLYHVZLOOVHOHFWDWOHDVWRQHVHUYLFHSURMHFWSHUFLUFXLWDQGUHFUXLWYROXQWHHUVIURPWKH</' PHPEHUVLQWKHLUUHVSHFWLYHFLUFXLWV3RSXODUVHUYLFHSURMHFWVLQFOXGHWKH6&%DU$VN$/DZ\HU3KRQH Bank, in which young lawyer volunteers assist the public with legal questions, and the University of South &DUROLQD·V&RFN\·V5HDGLQJ([SUHVVZKLFKDOORZV\RXQJODZ\HUVWRMRLQ&RFN\LQUHDGLQJWRHOHPHQWDU\DJHG children in an effort to promote childhood literacy. Margaret “Meggie” Baker Transactional Healthcare/ Compliance & Risk Management Hope Health, Inc. 600 E. Palmetto St. )ORUHQFH6& (843) 664-3634 mbaker@hope-health.org Lyndey Zwing Business Litigation $GDPVDQG5HHVH//3 0DLQ6W &ROXPELD6& [email protected] DISASTER RELIEF COMMITTEE Per the request of the SC Bar, the YLD will have a Disaster Relief Committee trained and ready to provide GLVDVWHUOHJDOUHOLHILQLQVWDQFHVVXFKDVZKHQH[SHULHQFHGÁRRGLQJLQWKHIDOORI)XQGLQJZLOOEH XVHGWRFRPSHQVDWHWKH$%$</')(0$7UDLQHUWRWUDYHOWR6&WRWUDLQFRPPLWWHHPHPEHUVDQGRUWR provide similar training to committee members. Ashleigh Wilson Commercial Litigation/ Products Liability Defense Bowman and Brooke, LLP 0DLQ6W6WH &ROXPELD6& [email protected] FAMILIES FOREVER This committee focuses on educating the public and raising awareness about adoption and foster care in 6RXWK&DUROLQDDQGZDVUHFHQWO\UHFRJQL]HGDVDQ$QJHOLQ$GRSWLRQE\WKH&RQJUHVVLRQDO&RDOLWLRQ RQ$GRSWLRQ,QVWLWXWH&&$,LQ:DVKLQJWRQ'&0HPEHUVRIWKLVFRPPLWWHHZLOOSDUWLFLSDWHLQDGRSWLRQ DZDUHQHVVDQGHGXFDWLRQSURMHFWVE\FRRUGLQDWLQJDQGKRVWLQJ)DPLOLHV)RUHYHU)DLUVWKURXJKRXWWKHVWDWH in partnership with adoption agencies, attorneys and other professionals. Jacqueline Bond Anthony Family and Adoption Law &UDYHU&XUUHQW3$ 32%R[ &KDUOHVWRQ6& MDQWKRQ\#FXUUHQWODZÀUPFRP Jessica Means Animal Law Hall & Means, LLC %HOJUDGH$YH6WH &KDUOHVWRQ6& MHVVLFD#KDOODQGPHDQVFRP Jay Anthony Personal Injury/Civil Litigation 7KH$QWKRQ\/DZ)LUP3$ 32%R[ 6SDUWDQEXUJ6& MDQWKRQ\#DQWKRQ\ODZFRP iCIVICS COMMITTEE Members of this committee will assist with promoting awareness of this program and implementing HGXFDWLRQRIFLYLFVWKURXJKRXW6RXWK&DUROLQD$FWLYLWLHVIRUFRPPLWWHHPHPEHUVLQFOXGHVSHDNLQJDWHYHQWV to teach educators how to implement iCivics in their classrooms; planning and implementing scholarship RUJUDQWFRPSHWLWLRQVVXFKDVWKHLQDXJXUDO0\9RLFH0\9RWH6RXWK&DUROLQD%DU</'6FKRODUVKLS Competition, in which students use Instagram to create their submissions; planning and implementing handouts and curriculum for Constitution Day and Presidents’ Day; and planning and implementing iCivics Day. iCivics Day is an annual, statewide event that takes place in the spring and sends young lawyers into the classrooms of elementary school students to discuss a civics-themed topic. Past topics have included the LPSRUWDQFHRIGHPRFUDF\IHGHUDOLVPVHSDUDWLRQRISRZHUVWKHFRXUWV\VWHPDQGLQGLYLGXDOULJKWV Julie Moore Business Litigation/ Personal Injury Duffy & Young, LLC %URDG6W &KDUOHVWRQ6& MPRRUH#GXII\DQG\RXQJFRP Christy Rogers Labor and Employment Law Fisher & Phillips, LLP 0DLQ6W6WH &ROXPELD6& [email protected] MAKE A WISH SPECIAL OLYMPICS While doctors can treat the physical aspects of a disease, they cannot always treat the psychological impact WKHLOOQHVVKDVRQDFKLOG$VD)XQG$:LVK3DUWQHU</'PHPEHUVZLOOKDYHDQRSSRUWXQLW\WREHSDUWRID wish. Members will assist in the planning of the wish, raise funds for the wish through a Walk for Wishes, DQGRUKRVWDZLVKUHYHDORUVHQGRIISDUW\WKHPHGSDUW\ZLWKSL]]DFDNHGHFRUDWLRQVDQGSUHVHQWVIRU travel wishes). This committee’s support will have a direct and positive impact on the lives of seriously ill children and their families in the communities where we work and live. The SC Bar Young Lawyers Division supports the Special Olympics of South Carolina by providing sponsorships and volunteers to serve the needs of South Carolinians with intellectual disabilities. Members of this committee will be responsible for recruiting and coordinating volunteers and encouraging participation at Special Olympics events throughout the state. These events vary from Fall and Summer *DPHVWR7UDFNDQG)LHOG'D\%RFFH7RXUQDPHQWVDQG$QQXDO*DODVDQGSURYLGHRSSRUWXQLWLHVIRU\RXQJ lawyers to serve a worthy organization while interacting with one another. COMMITTEE Perry MacLennan Employment Law +D\QVZRUWK6LQNOHU%R\G3$ 0HHWLQJ6WUG)ORRU &KDUOHVWRQ6& SPDFOHQQDQ#KVEODZÀUPFRP Julie Moore Business Litigation/ Personal Injury Duffy & Young, LLC %URDG6W &KDUOHVWRQ6& MPRRUH#GXII\DQG\RXQJFRP Irish “Ryan” Neville Commercial Litigation :LOOV0DVVDORQ$OOHQ//& 32%R[ &KDUOHVWRQ6& UQHYLOOH#ZPDODZÀUPQHW Jeanmarie Tankersley Upstate Coordinator General Civil Defense Litigation 0F$QJXV*RXGHORFN&RXULH//& 32%R[ *UHHQYLOOH6& MHDQPDULHWDQNHUVOH\#PJFODZFRP Emily McMillan Columbia Coordinator Estate Planning/Probate Litigation & Administration 6ZHHQ\:LQJDWH%DUURZ3$ /DG\6W &ROXPELD6& [email protected] VOICES AGAINST VIOLENCE PROTECTING OUR YOUTH THROUGH LEGAL EDUCATION For the purpose of educating at-risk high school students on the consequences of their actions and choices, members of this committee will organize programs typically in the form of panel discussions on topics such as prosecuting students as adults, repeat offenders, new DUI laws and drug offenses. Programs will be held WKURXJKRXWWKHVWDWHDQGFRQGXFWHGZLWKDVVLVWDQFHIURPWKH6&'HSDUWPHQWRI-XYHQLOH-XVWLFH&KLOGUHQ·V Law Center, the Bar’s Children’s Law Committee and various other community organizations. Committee members will be responsible for contacting the participating schools; planning the programs; coordinating ZLWKWKHSDUWQHURUJDQL]DWLRQVUHFUXLWLQJODZ\HUMXGJHDQGODZHQIRUFHPHQWYROXQWHHUVWRVHUYHDV panelists; and participating in and oftentimes moderating the programs. Joseph Bias Construction Law/Litigation 0F$QJXV*RXGHORFN&RXULH//& 32%R[ &ROXPELD6& MRVHSKELDV#PJFODZFRP J. Scott Bischoff II Charleston Coordinator Criminal Defense Savage Law Firm 3ULROHDX6W &KDUOHVWRQ6& [email protected] Clarke Newton Civil Litigation/Criminal Defense Bluestein Nichols Thompson & Delgado, LLC 7D\ORU6W &ROXPELD6& [email protected] 9RLFHV$JDLQVW9LROHQFH9$9KDVWKHJRDOVRIHGXFDWLQJ\RXQJODZ\HUVDQGWKHSXEOLFDERXWWKHHSLGHPLFRI domestic violence and encouraging advocacy for domestic violence victims through legislative initiative, pro ERQRVHUYLFHDQGKDQGVRQVXSSRUWWRVKHOWHUVDQGRWKHUSURJUDPVDLGLQJYLFWLPVRIGRPHVWLFYLROHQFH9$9 SDUWLFLSDWHVLQVKHOWHUUHIXUELVKPHQWSURMHFWVZKLFKLQFOXGHVUHSDLQWLQJUHEXLOGLQJODQGVFDSLQJDQGRWKHU UHIXUELVKLQJQHHGV(DFKIDOO9$9UXQVDQHFHVVLWLHVDQGWRLOHWULHVGULYHFROOHFWLQJGRQDWLRQVWRGHOLYHUWR shelters throughout the state. The program has expanded to further its reach and impart support in areas WKDWPD\KDYHOHVVORFDOIXQGLQJ9$9RUJDQL]HVDQGKRVWVDIUHHRUUHGXFHGFRVW&/(SURJUDPRQGRPHVWLF violence and, through this CLE, works to educate young lawyers to represent victims of domestic violence RQDQXPEHURILVVXHV)LQDOO\9$9LVH[SDQGLQJLQWRQHZDUHDVZLWKSODQVWRGHVLJQSULQWDQGGLVWULEXWH informational materials and support a statewide initiative to bring dating and domestic violence education DQGSUHYHQWLRQSURJUDPVLQWRKLJKVFKRROV9$9LVDOZD\VORRNLQJIRUQHZLGHDVDQGVHHNLQJQHZFRPPLWWHH members to help further the goals of the program in combating domestic violence. Jasmine Smith Appellate Practice 6&&RXUWRI$SSHDOV 6HQDWH6W &ROXPELD6& MDVPLQHGHQLVHVPLWK#RXWORRNFRP Johanna Valenzuela Post Conviction Relief/Criminal & Civil Litigation 6&$WWRUQH\*HQHUDO·V2IÀFH 32%R[ &ROXPELD6& MYDOHQ]XHOD#VFDJJRY VOLUNTEER INCOME TAX ASSISTANCE THROUGH LEGAL EDUCATION Patrick Cleary Product Liability Defense Bowman & Brooke, LLP 0DLQ6W6WH &ROXPELD6& [email protected] OFFICERS 7KHSXUSRVHRIWKLVFRPPLWWHHLVWRSURYLGHIUHHZLOOVDQGHVWDWHSODQQLQJGRFXPHQWVIRUÀUVWUHVSRQVH personnel and Habitat for Humanity homeowners. During the clinics, young lawyers will conduct an interview and consultation and draft wills and advance directives. First responders and homeowners will leave with fully-executed documents. Members of this committee will plan clinics throughout the state and recruit attorney volunteers. Young lawyer volunteers need no prior estate planning experience to take part. Guidelines, forms and training sessions are provided prior to clinics. Trista A. Shigley Estate Planning BB&T Wealth 0HHWLQJ6W6WH &KDUOHVWRQ6& [email protected] Evan Guthrie Estate Planning Evan Guthrie Law Firm 0DUNHW6W6WH &KDUOHVWRQ6& [email protected] YLD MILITARY SUPPORT This committee will identify and implement outreach programs to assist military service members and veterans. This committee may also provide education to young lawyers on issues that service members and veterans face and will seek opportunities to work with other groups within the SC Bar. Cody Mitchell Plaintiff’s Civil/Family Law Criminal Defense Lucas, Warr, & White 32'UDZHU +DUWVYLOOH6& [email protected] Irish “Ryan” Neville President Commercial Litigation :LOOV0DVVDORQ$OOHQ//& 32%R[ &KDUOHVWRQ6& UQHYLOOH#ZPDODZÀUPQHW Patrick C. Wooten Immediate Past President Civil Litigation/ Business Litigation Nelson Mullins Riley & Scarborough LLP 0HHWLQJ6W6WH &KDUOHVWRQ6& [email protected] Lindsay Joyner President-Elect Business/Commercial Litigation *DOOLYDQ:KLWH%R\G3$ 32%R[ &ROXPELD6& OMR\QHU#JZEODZÀUPFRP Ashleigh Wilson Secretary/Treasurer Commercial Litigation/ Products Liability Defense Bowman and Brooke, LLP 0DLQ6W6WH &ROXPELD6& [email protected] Wm. Grayson Lambert Out of State Representative Business & Appellate Litigation McGuire Woods LLP 17U\RQ6W6WH Charlotte, NC 28202 [email protected] HELPING PUBLIC THE WILLS CLINICS Aliecia M. Bores Partnerships, Estate Planning, Trusts and Probate )DEHU3ODFH'U6WH 1&KDUOHVWRQ6& DERUHV#ÀQNHOODZFRP YLD COUNCIL EXECUTIVE The purpose of this committee is to provide free tax preparation for South Carolina residents with annual total household income of $64,000 or less. Members of this committee will receive training to prepare basic federal and state income tax returns in various communities throughout the state and will assist the chair with recruiting other lawyer volunteers to participate in the tax preparation “Super Saturdays.” The training will be sponsored and conducted by the Columbia Cooperative Ministry, the United Way of Greenville County RUWKH&KDUOHVWRQ7ULGHQW8UEDQ/HDJXHHDFKRIZKLFKRSHUDWH9,7$VLWHV IMPROVING PROFESSION YLD CIRCUIT REPRESENTATIVES 1st Judicial Circuit Representative Charles H. “Charlie” Williams III Personal Injury and DUI Defense Williams & Williams 32%R[ 2UDQJHEXUJ6& [email protected] 2nd Judicial Circuit Representative Ashley Hammack Criminal Law 6HFRQG&LUFXLW6ROLFLWRU·V2IÀFH P.O. Box 3368 $LNHQ6& H[W [email protected] 3rd Judicial Circuit Representative Mary A. “Mandy” Shuler Personal Injury/Civil & Domestic Litigation/Criminal Defense Whetstone, Myers, Perkins & Fulda, LLC 32'UDZHU .LQJVWUHH6& [email protected] 4th Judicial Circuit Representative Cody Mitchell Plaintiff’s Civil/Family Law/ Criminal Defense Lucas, Warr, & White 32'UDZHU +DUWVYLOOH6& [email protected] 5th Judicial Circuit Representative L. Foster Girard Corporate Transactions +D\QVZRUWK6LQNOHU%R\G3$ 32%R[ &ROXPELD6& IJLUDUG#KVEODZÀUPFRP 6th Judicial Circuit Representative Everett B. Stubbs III Personal Injury/Criminal Defense/ Domestic Litigation /DZ2IÀFHRI$SULO3&RXQWHUPDQ PC %LJ6N\'U &KHVWHU6& [email protected] 11th Judicial Circuit Representative Sable Burgess Creditors’ Rights/ Bankruptcy/ Collections 6KHUS\-RQHV3$ 32%R[ /H[LQJWRQ6& VHE#VKHUS\MRQHVODZFRP 7th Judicial Circuit Representative Samuel R. Bass II Personal Injury 6WHZDUW/DZ2IÀFHV//& (+HQU\6W6WH 6SDUWDQEXUJ6& VDP#VWHZDUWODZRIÀFHVQHW 12th Judicial Circuit Representative E. LeRoy “Lee” Nettles III Criminal Defense/ General Practice Nettles Turbeville & Reddeck 32%R[ /DNH&LW\6& [email protected] 8th Judicial Circuit Representative Will Maxey Criminal Law (LJKWK&LUFXLW6ROLFLWRU·V2IÀFH 32%R[ *UHHQZRRG6& [email protected] 13th Judicial Circuit Representative Ashley R. Forbes Workers’ Compensation 0F$QJXV*RXGHORFN&RXULH (&DPSHUGRZQ:D\ *UHHQYLOOH6& [email protected] 9th Judicial Circuit Representative Thomas A. Limehouse Jr. Civil Litigation Duffy & Young, LLC %URDG6W &KDUOHVWRQ6& [email protected] 14th Judicial Circuit Representative John P. Carroll Commercial Real Estate/ Hospitality & Tourism Nexsen Pruet, LLC 0DLQ6W6WH$ +LOWRQ+HDG,VODQG6& MFDUUROO#QH[VHQSUXHWFRP 10th Judicial Circuit Representative Brittany Senerius Family Court/Guardian ad Litem Senerius & Tye 32%R[ $QGHUVRQ6& EULWWDQ\#VHQHULXVODZÀUPFRP 15th Judicial Circuit Representative Ryan P. Compton *ROGÀQFK:LQVORZ//& 32%R[ 0XUUHOOV,QOHW6& U\DQ#JROGÀQFKZLQVORZFRP 16th Judicial Circuit Representative Emily N. Brown Eminent Domain/Zoning & Land Use <RUN&RXQW\$WWRUQH\·V2IF 26 W. Liberty St. <RUN6& [email protected] ([2IÀFLR Mannar Hanna 3UHVLGHQW6WXGHQW%DU$VVRFLDWLRQ USC School of Law 60DLQ6W &ROXPELD6& [email protected] ([2IÀFLR Sam Martin 3UHVLGHQW6WXGHQW%DU$VVRFLDWLRQ Charleston School of Law 0DU\6W &KDUOHVWRQ6& [email protected] NONPROFIT U.S. Postage PAID Columbia, SC Permit No. 599 P.O. Box 608 &ROXPELD6& HELPING THE PUBLIC IMPROVING PROFESSION Please select the committee(s) of your choiceVDYH and HPDLO thLV IRUP to Kimberly Snipes DWNVQLSHV#VFEDURUJor go to www.scbar.org/yld to sign up. Name: ____________________________________ Bar Number: ____________________________________________ Law Firm/Employer: _________________________________________________________________________________ Address: ____________________________________________________________________________________________ Phone: _____________________________________________________________________________________________ E-mail: _____________________________________________________________________________________________ ,DPLQWHUHVWHGLQWKHIROORZLQJ</'FRPPLWWHHV P ABA/YLD Service Project Committee P Annual Bar Convention Committee P Backpack Drive Committee P Bar Foundation Committee P Cinderella Project P Community Law Week P Courthouse Keys Committee P Diversity Committee P iCivics Committee P Families Forever P Make A Wish Committee P Membership Events Committee P Professional Development Committee P Protecting Our Youth Through Legal Education P Publications & Marketing Committee P Special Olympics P Technology Committee P The Color of Justice Committee P Voices Against Violence (VAV) P Volunteer Income Tax Assistance (VITA) P Wills Clinics P YLD Military Support