Oncology Specialization
Transcription
Oncology Specialization
Appendix VI: Definition of the proposed specialty area and minimum criteria Specialists in oncologic physical therapists are to be designated as ONCS, which stands for Oncologic Certified Specialist. The oncologic clinical specialist has demonstrated advanced knowledge and skills in foundational science, behavioral science, clinical science, client management, practice management, and clinical research in the area of oncologic physical therapy. Oncologic physical therapy is delivered across the lifespan and full continuum of cancer care including prevention and survivor care (restorative interventions, supportive interventions, palliative interventions and end of life care). The oncologic clinical specialist is qualified to provide leadership and consultancy in oncologic rehabilitation. Minimum criteria to become ONCS are as follows: Applicants must be licensed physical therapists and submit fees as determined by ABPTS. In addition, Applicants must meet requirements for Option A or Option B. Option A: Applicants must submit evidence of 2,000 hours of direct patient care in the specialty area within the last ten (10) years, 25% (500) of which must have occurred within the last three (3) years. Applicants must also submit (1) one case reflection demonstrating specialty practice in oncologic physical therapy across the lifespan, e.g . pediatric, adult or geriatric. This case study must be based on a patient/client seen within the last three (3) years. Option B: Applicants must submit evidence of successful completion of an APTA-credentialed post professional clinical residency in oncologic physical therapy. Applicants who are currently enrolled in APTA-credentialed clinical residencies may apply for the specialist certification examination in the appropriate specialty area prior to completion of the clinical residency. These applicants will be conditionally approved to sit for the examination, as long as they meet all other eligibility requirements, pending submission of evidence of successful completion of the APTA-credentialed clinical residency to APTA’s Specialists Certification Program. Applicants applying under Option B must also submit one case study demonstrating specialty practice in oncologic physical therapy across the lifespan, e.g . pediatric, adult or geriatric. This case study must be based on a patient/client seen within the last three (3) years. ABPTS Review: 1.2 Estimate number of physical therapist positions that physical therapists with the specialized training and knowledge currently fill and estimate those positions that are vacant Decision: Did Not Adequately Meet Requirement Apart from statements like ‘the need for oncology trained physical therapists is reasonably obvious’ there was not an estimate of positions that were vacant. Estimates noted seem to be based solely on positions within a limited number of NCI Centers, and it is not clear that these numbers alone demonstrate a demand that should and will be met by ABPTS specialization. In summary, the information provided is vague with generalities. Additional data is requested. 1.3 Estimate number of filled and unfilled positions in each of the past three years to demonstrate a sustained or increased demand for physical therapists with specialized Criterion #1: knowledge andDEMAND training. Decision: Did Not Adequately Meet Requirement ABPTS has similar concerns for criterion 1.3 as were noted in criterion 1.2. More specific numbers are requested. The narrative provides an expected increase in demand, but does not provide much in terms of specifics of demand apart from population growth (and increased life expectancy). Information contained within this section seems to support the area of need much more so than demand. In addition, competency information noted within this section does not appear to address a level of advanced practice or specialization. REVISED SECTIONS: 1.2 Include estimates of the number of physical therapist positions that physical therapists with the specialized training and knowledge currently fill and those that are vacant. Identify these positions by types (e.g., academic, hospital, private practice, managed health care). Describe how these estimates were determined. Estimates of positions currently filled To generate estimates of numbers of current physical therapists with oncology training and experience, it is necessary to extrapolate from limited data. In the field of epidemiology, when directly measured data are not available, a standard methodology is to calculate expected rates based on related robust data that is available. The American Physical Therapy Association has published robust data on its membership rate as compared to the total number of physical therapists in practice in their 2011 APTA Membership Development Plan. The APTA document 1 “A Model to Project the Supply and Demand of Physical Therapists 2010-2020” utilized data from the Federation of State Boards of Physical Therapy to estimate the current number of physical therapists at 182,000.1 While no direct population data exist on how many oncologic physical therapists are in practice in the United States, we postulate that the Section on Oncology membership and classification of primary clinical focus at the time of APTA membership renewals serve as surrogates of PTs filling positions requiring oncologic knowledge and training. The percentage of these persons within the APTA should parallel that of the general population of physical therapists. We used this methodology to estimate the number of physical therapist positions requiring oncologic knowledge and training that are currently filled in the U.S. APTA PT membership -Number reporting oncology as primary clinical focus -Number of Oncology Section members reporting oncology as primary clinical focus 59,552 2,065 (3.5%) 165 Total number of APTA PT membership reporting oncology as primary clinical focus after removing duplicates from Section membership Number of Oncology Section PT members Total number of PTs with oncologic knowledge and training within APTA PT membership 1,900 Estimate of current number of PT positions filled requiring oncologic knowledge and training within the U.S. (based on 182,000 PTs) Facility/Setting Acute care hospital Health system or hospital-based outpatient facility or clinic Private outpatient office or group practice Skilled Nursing Facility (SNF)/Long Term Care Patient's home/home care School system (preschool/primary/secondary) 974 2,874 (4.8%) 8,736 (4.8%) 2010 % 11.4 20.9 Estimated PT positions filled specific to Oncology 996 1826 33.6 5.1 6.8 3.6 2935 446 594 314 2 Academic institution (post-secondary) Health and wellness facility Research center Industry Inpatient Rehab Facility (IRF) Other (please specify) 9.6 0.5 0.2 0.5 3.0 4.7 839 47 17 44 262 4144 Estimates of positions vacant The Bureau of Labor Statistics(BLS) describes a nationwide shortage of physical therapists.2 The demand for physical therapists is expected to spike upward by 30% between 2008 and 2018--a much quicker rate than average. The BLS reports that there were approximately 198,600 physical therapy jobs in the US in 2010 (the most recent data available) and that number is expected to rise by 39% to 276,000 in 2020. Although data does not exist specifically for oncologic physical therapy, SEER data indicates that over 12 million cancer survivors were alive as of 2010, and over 1.6 million new cases of cancer are expected to be diagnosed in 2012 across all age groups.3 The National Cancer Institute (NCI) lists 53 major cancer centers across the United States, but there are many major cancer centers that have developed outside the NCI umbrella.4 Approximately 2/3 of them provide physical therapy service on-site. Over 1500 cancer centers of various types are accredited by the American College of Surgeons Commission on Cancer, and current accreditation standards state that such programs must have a policy or procedure that “ensures access to rehabilitation services…either on-site or by referral.”5 It is clear that demand for physical therapists with advanced training and board certification in oncology is present and will increase in all practice settings given these requirements, and given the fact that cancer survivorship is steadily increasing . In the original petition we reported that based on a telephone survey of the Directors of 3 Rehabilitation in 10 NCI cancer centers, we identified 133 positions among the 10 centers and only 2 vacancies in one center at the time of the study. These telephone surveys were conducted in May 2011, specifically for the purpose of informing this document. The program directors were representative of a variety of practices and geographical areas across the country. Directors were asked about added positions over the three years immediately prior to the date of phone survey and about vacant positions in their clinics across that same time period. This was a cross sectional sample of course, so that those data represented vacancies existing at that moment in time only; the data did not reflect vacancies that had occurred and been filled over the past year. We did also reported that the among the 10 centers 38.5 positions had been added for oncology over the previous 2 years, thus there were over that time period 38.5 vacancies due to newly added positions (plus an unknown number of vacancies related to normal forces of staff attrition) and all but two of those had been filled. In addition all of the NCI cancer surveys surveyed had plans to add new positions in the next 1-3 years, ranging from 1 to 8 positions. In using vacancy rates to measure demand, it is important to remember competing interpretations of vacancy rates. There is a general shortage of physical therapists, thus physical therapists often have a choice which job they may choose to accept. All of the NCI centers surveyed in 2011 were actively growing in number of therapists and updated data as of August 2013 show that those centers not only added the planned positions, they continue to plan new growth. Their growth is occurring in response to increased demand on their services as evidenced by increasing referral numbers and increasing PT service counts. In conclusion, based on our methodology from Section 1.2, we estimated that 4.8% of the PT practice is filled 4 by physical therapists with oncologic knowledge and training. Therefore, it is reasonable to assume that a similar percentage of PT shortages based on APTA workforce reports. 2013 PT supply 2013 PT demand 182,000 general positions 202,000 general positions 2013 PT Shortage 2013 PT Content-specific shortage (based on 4.8%) 20,000 general positions 960 oncologic positions A more conservative estimate can be extrapolated from APTA documents. The APTA Workforce data documented in 2010 that a 10% vacancy rate existed for acute care settings. Of the 703 respondents, over 60% reported at least one vacancy at their facility.6 Outpatient private practice settings (n=1234) reported an average vacancy rate of 1.35 positions for PTs per facility. The mean number of full-time physical therapist vacancies in skilled nursing facilities was 1.2 based on 481 responses. We utilized these numbers to estimate total vacancies and then calculated oncologic PT vacancies based on a 4.8% representation per our previous calculations. Even with the small sample size which is normal with survey data, we were able to estimate 128 vacancies for PTs with oncologic training and knowledge. Using data from American Hospital Association, we identified 5,724 registered hospitals in the US.7 The Centers for Disease Control and Prevention reported 16,100 nursing homes in the U.S. based on 2004 data.8 We understand the difference between skilled nursing facilities versus nursing homes, but this was the most current data located by the Section. We were unable to identify an estimate of the total number of private practice outpatient clinics in the U.S. We used these numbers to further expand our projections based on growth potential. 5 Facility/Setting Reported vacancy/facility # of responses Estimated PT vacancies Acute care hospital 1 703 703 Private outpatient office or group practice Skilled Nursing Facility (SNF)/Long Term Care 1.35 1234 1,666 Estimated PT oncologic positions vacancies Based on Based on APTA public Workforce source Data data7, 8 19 5,724 all avail 275 ONC positions 80 N/A 1.2 481 578 28 2,418 2,947 127 Total 19,320ALL available 927 PT ONC positions 25,044 all 1202 ONC 1.3 Include estimates of the number of filled and unfilled positions in each of the past three (3) years to demonstrate a sustained or increased demand for physical therapists with specialized knowledge and training. Describe how these estimates were determined. Documented Vacancies in Ten NCI Cancer Centers The telephone survey of ten NCI cancer center physical therapy directors provided data specific to oncology to inform the process of generalizing predictions from the workforce study. Most NCI cancer centers have more than one cancer-related service area including both acute care and outpatient services. A total of 133 physical therapy positions existed in these NCI major cancer centers at the time of the survey, and this number was expected to increase because these centers also reported significant growth plans, as noted below. Among the NCI centers surveyed, the number of current physical therapist positions ranged from two to 51, and the vacancy rate was low at the time of the survey, with only one of the ten centers reporting two 6 current vacancies. Vacancies in the relatively young practice area of oncology rehabilitation are demonstrably occurring in major cancer centers as a result of growth in response to increasing numbers of cancer survivors with need for services, and increasing awareness among referral sources regarding the benefits of rehabilitation for these patients. Nine of the ten NCI major cancer centers surveyed by telephone had added therapist positions over the past three years, ranging from 1 position to 18 positions for a total of 38.5 positions added across the 10 facilities; average number of positions added 3.8. Each of the ten NCI centers surveyed reported plans to add at least one and as many as eight new therapy positions over the next three years, depending on budget. Using the APTA Workforce data6, we utilized supply as a surrogate of positions filled and demand to represent not filled positions. We then extrapolated oncologic PT positions filled and not filled based on the 4.8% representation calculated in Section 1.2. ** All sites 2010 Number of PT positions filled 176,000 180,000 180,000 182,000 Number of oncologic PT positions filled (based on 4.8% representation) 8,448 8,640 8,640 8,736 Number of PT positions not filled (based on demand) 19,000 18,000 18000 20000 864 864 960 Number of oncologic PT positions not filled (based on 912 4.8% representation) 2011 2012 2013 7 In the original petition we reported that based on a telephone survey of the Directors of Rehabilitation in 10 NCI cancer centers, we identified 133 positions among the 10 centers and only 2 vacancies in one center at the time of the study. This was a cross sectional sample of course, so that those data represented vacancies existing at that moment in time only; the data did not reflect vacancies that had occurred and been filled over the past year. We did also reported that the among the 10 centers 38.5 positions had been added for oncology over the previous 2 years, thus there were over that time period 38.5 vacancies due to newly added positions (plus an unknown number of vacancies related to normal forces of staff attrition) and all but two of those had been filled. In addition all of the NCI cancer surveys surveyed had plans to add new positions in the next 1-3 years, ranging from 1 to 8 positions. In using vacancy rates to measure demand, it is important to remember competing interpretations of vacancy rates. There is a general shortage of physical therapists, thus physical therapists often have a choice which job they may choose to accept. One very important explanation for a high vacancy rate is low desirability of the job in question. Jobs stand open for reasons of offering non-competitive pay, less desirable locations, poor management, and other reasons. We submit that the growth trends in these centers as well as in other centers that we now report on stand as evidence of demand for specialized therapists with advanced knowledge and skills in oncology. All of the NCI centers surveyed in 2011 were actively growing in number of therapists and updated data as of August 2013 show that those centers not only added the planned positions, they continue to plan new growth. Their growth is occurring in response to increased demand on their services as evidenced by increasing referral numbers and increasing PT service counts. 8 1. APTA Membership Development Plan: 2011. In: Association APT, ed., 2011. 2. Statistics BoL. Bureau of Labor Statistics Occupational Outlook Handbook 2010. 3. Surveillance Epidemiology and End Results Fact Sheets, vol. August 2013: National Cancer Institute, 2012. 4. National Comprehensive Cancer Network, vol. July 2013: National Cancer Institute, 2011. 5. Cancer Program Standards 2012: Ensuring Patient-Centered Care: American College of Surgeons Commission on Cancer, 2012. 6. 2010 Physical Therapy Workforce Project: Physical Therapy Vacancy and Turnover Rates in Acute Care Hospitals: American Physical Therapy Association, 2010. 7. Fast Facts on American Hospitals, vol. August 2013: American Hospital Association, 2013. 8. Fast Stats: Nursing Home Care: Centers for Disease Control, 2013. 9 ABPTS Feedback: 2.1 Identify specific public health and patient care needs that are not being met currently that physical therapists in the proposed specialty area can meet effectively. (Decision: Did Not Adequately Meet Requirement) The need for specialized training when working with cancer patients/survivors was well made. The point that was not as clear was the ‘patient needs that are not currently being met.” The narrative did demonstrate (with Healthy People Objective Criterion #2:care Need #C14) that this need was important, but it did not clearly demonstrate that the need was not being met. A more focused, organized description of unmet needs (e.g., prevention / wellness of population, unique pre / post-surgical needs, etc) should be provided. It would be helpful for the petitioner to explain why an advanced generalist would not have enough breadth of knowledge or depth within that breadth to adequately care for patients with cancer. REVISED SECTION 2.1 Identify specific public health and patient care needs that are not being met currently that physical therapists in the proposed specialty area can meet effectively. On December 2, 2010, the United States Department of Health and Human Services “unveiled Healthy People 2020, the nation’s new ten-year goals and objectives for health promotion and disease prevention.”1 Objectives listed in the Healthy People report are based on data from the National Health Interview Survey, a robust population-based cross-sectional survey of the United States population conducted by the Center for Disease Control since 1956.2 By definition, health and patient care objectives listed in the Healthy People document are not currently being met to the intended standard since the purpose of the Healthy People coalition is to improve health care and public health. Objectives C13 and C14 relate to oncology care: Healthy People Objective #C13: Increase the proportion of cancer survivors who are living five years or longer after diagnosis.1 The baseline for this objective is a 66.2% five-year survival rate as of 2007; the target rate is a 10% improvement, bringing the five-year survival rate to 72.8%.3 Healthy People Objective #C14: Increase the mental and physical health-related quality of life of cancer survivors.1 This is considered a developmental objective, meaning that there are not previous data for comparison of achievement of the objective. 1 These objectives illustrate a societal need for the physical therapist to participate in the care of cancer survivors. Physical therapists are experts in movement and function and contribute directly to an individual’s physical health. Cancer, the disease and its treatment, introduces unique needs among this patient population that require a specialized level of knowledge and skill. Currently this need is not being met by other health care providers and importantly, this need is not being met by other physical therapy professionals. The oncology specialist will provide a unique skill set, different from other physical therapy clinical specialists. In addition, the oncology specialist, by definition focused on this population, can provide focused leadership to prioritize development of more effective services to meet the needs of this population. Needs across the Continuum of Cancer Care The nature of cancer disease treatment lends itself to sequelae, both acute and late, that often persist as chronic conditions. Examples include; fatigue, pain, lymphedema, gait and balance abnormalities, soft tissue restriction and other contractures, limb loss or complex limb salvage, pelvic floor dysfunction, cardiopulmonary impairments, and chemotherapy-induced peripheral neuropathy.4 Many patients experience an aggregate burden of impairment that goes relatively unaddressed across the care continuum. When cancer rehabilitation services are prescribed today, they tend to have a onedimensional focus rather than comprehensive assessment and treatment of needs. For example, in a study of services offered by National Cancer Institute –designated comprehensive cancer centers, 70% of centers had a lymphedema management program, but no comprehensive cancer rehabilitation programs were reported.5 However, physical therapists with specialized knowledge in oncology are the only professionals capable of addressing all of these issues comprehensively in an integrated intervention. 2 The array of potential impairments related to cancer introduces multiple complexities in examination and treatment that require the nuance of a specialized and highly knowledgeable physical therapist. It is also the case that oncologic physical therapy takes place in a variety of settings that include general hospital practice, private practice, home health, pediatric settings, rehabilitation centers, skilled nursing facilities, hospice and palliative care settings, exercise facilities, academia and research centers. Physical therapists are a common denominator present among all of these facilities. Encouraging specialization in oncologic rehabilitation will serve to promote improved care to meet the needs of this population as physical therapists pursue specialization. A recent initiative; the Survivorship Training and Rehab (STAR) program has initiated efforts in this regard. The STAR program provides facilities and individual clinicians with tools and systematic, proven programs to deliver oncology rehabilitation care. Initiated in 2009 by Oncology Rehabilitation Partners, LLC the STAR program purports to provide facilities and individual clinicians with hospitals, cancer centers, group practices and individual clinicians and providers with “the training, protocols and other tools needed to deliver evidence-based “best practices” cancer rehab services.”6 Institutions and individuals who complete the training earn a STAR certificate. To date the STAR program has developed cancer rehabilitation programs at over 300 hospitals nation-wide with over 5,000 clinicians participating in oncologic rehabilitation programs. Currently, Rhode Island, Massachusetts, and Connecticut have acknowledged STAR certification as the standard for cancer rehabilitation care delivery. The growth of the STAR program supports our claim of the increased demand and need for oncology rehabilitation programs and highly trained providers. The STAR program focuses on workflow within organizations to support early identifications of cancer related side effects and appropriate referrals. The program provides education and training 3 regarding rehabilitative interventions for physical, occupational, and speech therapies. The Oncology Section has served as a resource for advanced training and education for STAR certified institutions and clinicians. The oncologic specialty DSP will provide a more comprehensive guide specifically to the practice of oncologic physical therapy. Providing these therapists with the opportunity to become certified oncologic specialists through APTA will further solidify their relevance in the care continuum and will serve to meet the needs of patients and survivors. Care Delivery Model Inadequacies Physical therapy is poorly integrated into the medical service delivery model for cancer care in hospitalbased settings and fragmented community-based care further exacerbates this problem pushing rehabilitation further from mainstream patient care. Cancer care and rehabilitation care are disconnected even in some institutions that have streamlined transition services and many community cancer programs lack rehabilitation care altogether.7, 8 Oncologic physical therapy services are relevant and necessary in primary, secondary and tertiary regards. There is a need to provide oncologic rehabilitation services throughout the continuum of care from the aspects of; prevention and screening, pre-operative assessment and prospective surveillance to identify pending impairments, provide rehabilitative interventions during the course of cancer treatment, and to provide follow up care through the post-disease treatment time frame including palliative care for those patients who’s disease returns. Pre-operative and prospective surveillance: One emerging model of physical therapist practice that can serve to meet the needs of the cancer population proactively is the Prospective Surveillance Model (PSM) for cancer rehabilitation. The PSM has been championed by the American Cancer Society as it provides a strong evidence-based, proactive 4 framework for the physical therapist to interface with patient with cancer throughout the continuum of care.9, 10 The relevance of this model to physical therapist practice is obvious; it improves the interface with the cancer population and promotes proactive care. The American Physical Therapy Association featured this model in its “Innovations in Practice” series.11 Comprehensive cancer rehabilitation using PSM can address pre-existing or treatment-related comorbid conditions; Diabetes, cardiovascular disease, congestive heart failure, bone loss, adverse body composition, and renal disease which are common in cancer survivors. These co-morbidities can have significant impact on the patient’s tolerance to and response to cancer therapies. It is critical for the oncologic clinical specialist to engage with the cancer population at the point of cancer diagnosis to improve the patient’s quality of life and maintain function throughout the care continuum. (Figure 1) Currently this model is emerging and is being implemented nation-wide, however reports from various cancer centers who are seeking physical therapists to fill these roles site the difficulty that they have in identifying a physical therapist who “feels comfortable treating patients with cancer”. This is a primary reason that the oncologic specialty is needed in physical therapy. Triage-based rehabilitation during cancer treatment Throughout the course of cancer treatment patients may experience various medical interventions including surgery, chemotherapy, and radiation therapy among other treatment. Each of these modalities introduces potential for functional decline and impairment. During the course of treatment referral to rehabilitation is not a standard of care and as a result, patients are suffering. Rehabilitation for patients going through cancer treatment is a critical piece that must be embedded into the current medical standards.4, 12 Physical therapists are experts at managing functional impairments and have evidence-based mechanisms to promote recovery when impairments present. 5 Triage to rehabilitation services is lacking however in the traditional medical model. Patients frequently report that they seek out care and have difficulty finding physical therapists who are expert in understanding their cancer treatments and who are comfortable in treating their condition.13, 14 Even physical therapists themselves, who are cancer survivors, note that their skill set did not prepare them to deal with the functional impairments that they experienced during their cancer journey. They noted that the side effects they experienced, although familiar to them as rehabilitation professionals (eg. fatigue, scar tissue adhesion), were things that they and their colleagues were unfamiliar with treating in the context of cancer.15 In focus groups these patient/therapists noted that they frequently sought out care from physical therapists who were specialists in oncologic rehabilitation to address their impairments.15 This speaks to the dearth in understanding that the generalist and, even the advanced generalist, have in managing patients with common physical and functional impairments due to cancer treatment. The impairments are familiar in the rehabilitation paradigm but cancer and its treatment make managing those impairments different. For example; physical therapists are familiar with how to manage balance deficits but there are specific nuances to balance deficits in the patient with cancer, in fact, the etiology may be completely different requiring a nuanced intervention specific to the chemotherapeutic culprit that brought on the deficit. (eg. ototoxicity vs. vestibular radiation damage vs. peripheral neuropathy; each presents with different underlying mechanisms that impact gait and balance and without knowledge of the chemotherapy agents and delivery mechanism and side effects of radiation therapy and an understanding of the acute and late effects of such agents, the generalist becomes paralyzed in treatment planning.) The oncologic specialist can also intervene during the cancer care continuum providing selfmanagement skills and health promotion interventions to decrease the risk of additional late effects— 6 for example, the cardiac, pulmonary, endocrine, or bone complications of cancer treatment and may even reduce the risk of second malignancies.16-22 A final benefit is the joint focus on optimizing functional status and quality of life, preserving the ability to remain in the workforce and other life roles, and maximizing health and longevity.23 Currently, in the continuum of cancer care, the physical therapist is marginalized for various reasons: 1. In general therapists do not have the knowledge and skills that give them a level of confidence in treating patients with cancer in their individual scope of practice and have not sought to elevate their presence in cancer care. 2. There is a general lack of awareness among health care providers that rehabilitation interventions are both safe and effective for patients with cancer. The latter is demonstrated in several studies: Cheville et al found that in 163 women with metastatic breast cancer, 92% had at least one physical impairment, with a total of 530 impairments identified overall; 484 of these impairments (91%) required a physical rehabilitation intervention and 469 (88%) required physical and/or occupational therapy.24 Despite more than 90% of the participants needing cancer rehabilitation services, fewer than 30% received this care.24 Thorsen et al evaluated 1325 survivors of the 10 most prevalent cancers and found that 63% reported the need for at least one rehabilitation service, with physical therapy being the most frequently reported need (43%).25 They also reported that patients were often not referred for services; 40% of the participants reported unmet rehabilitation needs. A study by Schmitz et al found that at least 60% of breast cancer survivors had one or more treatment-related impairments at each checkpoint over a 6-year follow-up period.26 Cheville et al evaluated the detection and treatment of functional problems in cancer survivors and concluded that 7 “Functional problems are prevalent among outpatients with cancer and are rarely documented by oncology clinicians.”7 Not only does this evidence speak to the unmet needs of patient, it highlights the importance of the role the physical therapist who is an oncologic specialist can play in improving care. Other health care providers are not educated in impairment identification. Physical therapists are experts in movement dysfunction and have evidence-based tools and interventions to ameliorate or mitigate many of the aforementioned issues. Other health care providers are not educated to treat physical impairments and their scope of practice is limited to providing general, often broad recommendations towards activity and exercise and frequently there is not recognition of the need for therapeutic interventions.12, 27, 28 Safety is a significant concern when prescribing exercise in the cancer population and requires an advanced knowledge and understanding of the unique responses to exercise prescription these patients will exhibit. The oncologic specialist is the provider with the greatest knowledge base to appropriately screen, examine and recommend interventions for therapeutic exercise as well as physical activity. Lack of appropriate screening or treatment may result in injury or other medical complications.29, 30 8 Figure 1. APTA Innovations in Practice Prospective Surveillance Cancer Model11 Beyond Cancer Treatment: Survivorship After patients complete their medical treatment for cancer, they are often followed in community-based care programs typically by a primary care physician. The needs of the cancer survivor in a posttreatment setting are woefully unmet. In 2006, the Institute of Medicine in a seminal report titled “Lost 9 in Transition, From Cancer Patient to Survivor,” highlighted the unmet needs of cancer survivors with regard to follow up and care.31 This need arises from the many long term side effects and potential late effects that patients face long after cancer treatment is completed. The oncologic specialist can serve an important role in meeting the needs of survivors. The specialist has an advanced understanding of the side effects of cancer treatment that may be persistent or late in presentation and can serve as a critical partner on the health care team to promote improved survivorship care. This also speaks to oncologic specialists taking on advanced professional roles and responsibilities to hold them selves out as the provider of choice to meet the needs of this population following disease treatment. In recognition of national goals as are articulated in Healthy People and of the known growth in cancer survivorship, the American College of Surgeons Commission on Cancer has mandated that cancer centers provide access to rehabilitation.32 Physical therapists with advanced training are qualified to manage comprehensive oncology rehabilitation programs. However, comprehensive oncology rehabilitation programs require advanced education and training due to the complex nature of cancer and cancer treatment side effects. Oncology rehabilitation specialists require advanced skills in clinical practice that transcend the current physical therapy specialty areas (e.g. orthopedics, cardiology, neurology, etc.) not only across the practice patterns of musculoskeletal, neuromuscular, cardiopulmonary, and integumentary conditions, but across the continuum of cancer care from prevention, through diagnosis and treatment, in extended survivorship and for end of life care. Physical therapists require integrated training of caring for patients before, during, and after cancer treatments to individualize rehabilitation programs to accommodate acute, chronic, and long-term cancer side-effects. Physical therapists also require advanced training in management in order to manage the complex interdisciplinary rehabilitation programs that are necessary for cancer care. 10 1. Healthy People 2020 Objectives: U.S. Department of Health and Human Services, 2011. 2. National Health Interview Survey, vol. November 2012: Centers for Disease Control and Prevention, 2011. 3. American Cancer Society: Cancer Facts and Figures 2012, vol. November 2012: American Cancer Society, 2012. 4. Stubblefield MD. Cancer rehabilitation. Semin Oncol 2011;38(3):386-93. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21600368 5. Alfano CM, Ganz PA, Rowland JH, Hahn EE. Cancer survivorship and cancer rehabilitation: revitalizing the link. J Clin Oncol 2012;30(9):904-6. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22355063 6. Oncology Rehab Partners, 2011. 7. Cheville AL, Beck LA, Petersen TL, Marks RS, Gamble GL. The detection and treatment of cancer-related functional problems in an outpatient setting. Support Care Cancer 2009;17(1):61-7. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18478275 8. Silver JK. Strategies to overcome cancer survivorship care barriers. PM R 2011;3(6):503-6. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21665161 9. Stout NL, Binkley JM, Schmitz KH, Andrews K, Hayes SC, Campbell KL, et al. A prospective surveillance model for rehabilitation for women with breast cancer. Cancer 2012;118(8 Suppl):2191-200. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488693 10. Gerber LH, Stout NL, Schmitz KH, Stricker CT. Integrating a prospective surveillance model for rehabilitation into breast cancer survivorship care. Cancer 2012;118(8 Suppl):2201-6. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488694 11. Collaborative Care: Innovations in Practice: Prospective Surveillance Cancer Model ACO Video Series: American Physical Therapy Association, 2011. 12. Stubblefield MD, Hubbard G, Cheville A, Koch U, Schmitz KH, Dalton SO. Current perspectives and emerging issues on cancer rehabilitation. Cancer 2013;119 Suppl 11:2170-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23695929 13. Binkley JM, Harris SR, Levangie PK, Pearl M, Guglielmino J, Kraus V, et al. Patient perspectives on breast cancer treatment side effects and the prospective surveillance model for physical rehabilitation for women with breast cancer. Cancer 2012;118(8 Suppl):2207-16. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488695 14. Stout NL, Andrews K, Binkley JM, Schmitz KH, Smith RA. Stakeholder perspectives on dissemination and implementation of a prospective surveillance model of rehabilitation for breast cancer treatment. Cancer 2012;118(8 Suppl):2331-4. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488707 15. Levangie PK, Drouin J. Magnitude of late effects of breast cancer treatments on shoulder function: a systematic review. Breast cancer research and treatment 2009;116:1-15. 16. Holmes MD, Chen WY, Feskanich D, Kroenke CH, Colditz GA. Physical activity and survival after breast cancer diagnosis. JAMA 2005;293(20):2479-86. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=15914748 17. Pierce JP, Stefanick ML, Flatt SW, Natarajan L, Sternfeld B, Madlensky L, et al. Greater survival after breast cancer in physically active women with high vegetable-fruit intake regardless of obesity. J Clin Oncol 2007;25(17):2345-51. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17557947 18. Irwin ML, McTiernan A, Manson JE, Thomson CA, Sternfeld B, Stefanick ML, et al. Physical activity and survival in postmenopausal women with breast cancer: results from the women's health initiative. Cancer Prev Res (Phila) 2011;4(4):522-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21464032 19. Irwin ML, Smith AW, McTiernan A, Ballard-Barbash R, Cronin K, Gilliland FD, et al. Influence of pre- and postdiagnosis physical activity on mortality in breast cancer survivors: the health, eating, activity, and lifestyle study. J Clin Oncol 2008;26(24):3958-64. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18711185 20. Giovannucci E, Liu Y, Platz EA, Stampfer MJ, Willett WC. Risk factors for prostate cancer incidence and progression in the health professionals follow-up study. Int J Cancer 2007;121(7):1571-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17450530 21. Meyerhardt JA, Giovannucci EL, Ogino S, Kirkner GJ, Chan AT, Willett W, et al. Physical activity and male colorectal cancer survival. Arch Intern Med 2009;169(22):2102-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=20008694 11 22. Meyerhardt Ja, Heseltine D, Niedzwiecki D, Hollis D, Saltz LB, Mayer RJ, et al. Impact of physical activity on cancer recurrence and survival in patients with stage III colon cancer: findings from CALGB 89803. Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2006;24:3535-41. 23. de Boer AG, Taskila T, Tamminga SJ, Frings-Dresen MH, Feuerstein M, Verbeek JH. Interventions to enhance return-to-work for cancer patients. Cochrane Database Syst Rev 2011(2):CD007569. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21328297 24. Cheville AL, Troxel AB, Basford JR, Kornblith AB. Prevalence and treatment patterns of physical impairments in patients with metastatic breast cancer. J Clin Oncol 2008;26(16):2621-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18509174 25. Thorsen L, Gjerset GM, Loge JH, Kiserud CE, Skovlund E, Flotten T, et al. Cancer patients' needs for rehabilitation services. Acta Oncol 2011;50(2):212-22. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21231783 26. Schmitz KH, Speck RM, Rye SA, DiSipio T, Hayes SC. Prevalence of breast cancer treatment sequelae over 6 years of follow-up: the Pulling Through Study. Cancer 2012;118(8 Suppl):2217-25. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488696 27. Silver JK, Baima J, Mayer RS. Impairment-driven cancer rehabilitation: An essential component of quality care and survivorship. CA Cancer J Clin 2013. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23856764 28. Stout NL. Exercise for the cancer survivor: all for one but not one for all. J Support Oncol 2012;10(5):178-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22579267 29. Cousins N, MacAulay F, Lang H, MacGillivray S, Wells M. A systematic review of interventions for eating and drinking problems following treatment for head and neck cancer suggests a need to look beyond swallowing and trismus. Oral Oncol 2013;49(5):387-400. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23291294 30. Cristian A, Tran A, Patel K. Patient safety in cancer rehabilitation. Phys Med Rehabil Clin N Am 2012;23(2):44156. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22537705 31. Hewitt M, Ganz P, Eds, From Cancer Patient to Cancer Survivor – Lost in Transition. Institute of Medicine, 2005. 32. Cancer Program Standards 2012: Ensuring Patient-Centered Care: American College of Surgeons Commission on Cancer, 2012. 12 ABPTS Feedback: 2.3 Describe and document, with references, how the public’s health and well-being may be at risk if practitioners do not provide services in the proposed specialty area. {Decision: Did Not Adequately Meet Requirement} The major concern with this section of the petition is the fact that the cited statistics focused only on fatigue. Is there further data available addressing other areas of impairment beyond fatigue? It was noted that information from pages 28 and 29 of the petition may be well suited to further support this section of the petition. REVISED SECTION: 2.3 Describe and document, with references, how the public's health and well-being may be at risk if physical therapist practitioners do not provide the services in the proposed specialty area. Patients are surviving cancer diagnoses to a greater degree than ever before. Survival rates vary according to stage of cancer at diagnosis and differ among cancers. Current reports of Surveillance Epidemiology and End Results (SEER) data indicate a 66.7% five-year survival rate on average for all cancers combined. Certain cancers have much higher survival rates, such as cancer of the breast, which when discovered early has a five-year survival rate of 89.9%.1 The number of cancer survivors living in the United States has increased from approximately three million in 1971 to over 11 million as of 2007.1 Survivors of cancer have approximately 3.5 times the likelihood of having disability affecting physical function as individuals with other chronic diseases, and when cancer occurs in combination with other chronic diseases the likelihood of physical disability doubles over that rate.2 It has been clearly demonstrated that mobility related impairments persist or occur as late effects for months and years after successful cancer therapy is completed.3-11 Every patient who goes through any form of treatment for cancer is at risk for physical impairments to varying degrees (see Table 1). The risk incurred is one that persists for a lifetime following disease treatment. With survivorship rates continuing to climb, a great public health need has developed for health care providers who are able to recognize and treat the sequelae of cancer. 1 Depending on the specific treatment exposures, survivors of cancer can face numerous adverse consequences of cancer treatment, many of which are amenable to rehabilitation interventions.(See Figure 1) These include fatigue, depression, anxiety, fear of recurrence, cognitive dysfunction, pain syndromes, peripheral neuropathy, sexual dysfunction, balance and gait problems, upper or lower quadrant mobility issues, lymphedema, bladder and bowel problems, stoma care, problems with swallowing or dysphagia, and communication difficulty.12 The practice of physical therapy is uniquely situated to alleviate many of the negative sequelae and to mitigate their impact on function however, an advanced level of knowledge, skill and abilities among physical therapists is necessary as the nuances of the cancer disease process and side effects of treatment warrant an advanced understanding specific to cancer. Impairments present during active treatment: Many of the common impairments that the cancer population faces are familiar to the general physical therapist however when the nuances of cancer treatment are considered, the need for specialized education and training is elucidated. Cancer and its treatment introduce myriad considerations that impact a physical therapy plan of care. It is necessary for a physical therapist to have an advanced level of knowledge and a clinical skill set that is uniquely focused on the aspects of cancer treatment that impact impairment. Functional impairments associated with cancer treatment require consideration of; the disease process, the side effects of disease treatment agents, the late effects of these agents and the possibility that impairments are related to a recurrent disease process. Impairments in the cancer population are different; in etiology, in response to intervention, in interaction with therapeutic interventions and in anticipated outcomes. Recognizing the unique and specialized needs of integrating 2 rehabilitation and exercise with the cancer survivor’s needs, the American College of Sports Medicine (ACSM) convened an expert panel to provide an evaluation of the literature, and invited a multidisciplinary team of researchers and practitioners to evaluate the evidence and issue guidelines on exercise for cancer survivors.13 The ACSM recognized the need for an evaluation of the risks and benefits of exercise-based interventions for cancer survivors by a body that understands clinical medicine, oncology, and exercise. Their findings, outlined in the report by Wolin et al note that there is a substantial and significant need for the rehabilitative and exercise interventions for the patient with cancer to be overseen by a specialist in cancer and cancer rehabilitation.14 From a rehabilitation perspective, consideration of these critical points is best achieved by an oncologic clinical specialist. Impairment levels are high among patients treated for cancer. Some of the common impairments and their unique consideration include: Fatigue: Upwards of 60% of patients suffer chronic fatigue after cancer treatment. Fatigue is present in as many of 75% of persons newly diagnosed with cancer, and prevalence of fatigue rises as high as 96% in patients undergoing chemotherapy and as high as 93% in patients undergoing radiotherapy.15 This interferes with their participation and activity levels and may negatively impact return to work as well as impact psychosocial function. Aerobic exercise that is prescribed by a knowledgeable specialist with depth of understanding of the medical and radiographic treatments that the patient is undergoing has been shown to positively impact the fatigue burden.15 Therapeutic interventions aimed at mitigating fatigue, as identified by the general physical therapist, may impede the rehabilitative process or may introduce unsafe interventions if there is not an understanding of the unique presentation of 3 Cancer-related fatigue.14 Vital sign responses to intervention are different in the patient with cancer, strength training interventions need to be conducted with consideration for lab values unique to cancer care. NCCN guidelines recommend that certain survivor groups (eg, patients with comorbidities, recent major surgery, functional or anatomical deficits, or substantial deconditioning) obtain referral to physical therapy to facilitate exercise during fatigue.(NCCN guidelines) The general therapist and even an advanced specialist in another area of rehabilitation does not have this knowledge as a part of their individual scope of practice. Pain: Pain is a prevalent complaint among patients with cancer. It is estimated that 30% to 50% of patients undergoing acute cancer treatment will experience pain and up to 70% of those with metastatic disease will have pain.16 Promotion of wellness behaviors and the use of physical therapy examination and intervention early in cancer recovery may help to diminish the intensity and incidence of chronic pain in long-term survivors.17 The presentation and etiology of pain in this population are differ Peripheral Neuropathy: Chemotherapy-induced peripheral neuropathy, a possible side effect of some chemotherapy drugs, is the most prevalent neurologic complication of cancer.18 It is estimated that peripheral neuropathy may develop in 50% to 60% of patients treated with taxanes and can result from paraneoplastic phenomena as well.19 (Bristol Meyers-Squibb Insert*) Postural instability and balance impairments are noted to be significant impairments associated with peripheral neuropathies.20 Interventions include balance training, an emphasis on using visual compensation for proprioception, and orthotics. Patients need education about foot care and environmental hazards such as throw rugs.21 To ensure survivor safety, the ACSM * http://packageinserts.bms.com/pi/pi_taxol.pdf 4 guidelines for cancer survivors recommend that survivors undergo neuropathy evaluation prior to initiating an exercise program.14 This need can best be met by the oncologic clinical specialist. Soft Tissue Impairment: Cancer and/or its treatments can cause significant soft- tissue abnormalities. One of the most frequently observed is lymphedema, which is extremity swelling resulting from disruption of the lymphatics following axillary or groin lymph node dissection. The prevalence of lymphedema in patients with breast cancer has been generally reported to be between 15% and 30%.22 Complete decongestive therapy, which includes the use of manual lymph drainage and compression garments, is effective in controlling edema. When applied early in the course of treatment, before the development of a significant volume increase (eg, a greater than 250-cc increase in the arm), lymphedema can almost be reversed.23, 24 Weight lifting, traditionally believed to be contraindicated in patients with lymphedema, has subsequently been shown to be beneficial.25 Aerobic Capacity: Multimodal rehabilitation has also been studied in patients with cancer during chemotherapy. Adamsen et al randomized 269 patients to an intervention set or a control set.26 Of note, patients had 21 different types of cancer diagnoses, including solid tumors and hematologic malignancies. Patients in the intervention set received high-intensity and low-intensity supervised physical training, relaxation techniques, and manipulation. Supervision was performed by a physical therapist or trained nurse specialist. Those in the control set received standard medical care and were permitted to perform unsupervised physical activity as tolerated. After 6 weeks, patients in the intervention set demonstrated less fatigue, improved aerobic capacity, greater strength, improved vitality, and better emotional 5 well-being.26 The ACSM recommends that exercise testing and prescription for the patient with cancer are best done by exercise professionals or physical therapists with advanced education in oncology domains and in consultation with the cancer care team.13, 14 Impairments in various populations Prostate Cancer: In survivors of prostate cancer, a recent review found that incontinence, fitness, fatigue, body constitution, and QOL can be improved by “clinical exercise” during and after acute cancer treatments.27 Of note in this systematic review, the authors concluded that “supervised exercise” is more effective than “nonsupervised exercise” recognizing the need for a specialist to oversee the plan of care. Head and Neck Cancer: McNeely et al randomized 52 survivors of head and neck cancer to a control group that received a standard, supervised, therapeutic exercise program or to an intervention group that received a supervised progressive resistance program that was tailored to treat their individual needs associated with cancer-related impairment of the shoulder.28 Outcomes were measured at baseline and at the end of the 12-week intervention. The patients who underwent the progressive resistance exercise that was tailored to their needs demonstrated reduced pain and improved upper extremity muscular strength and endurance compared with the control subset. Advanced Stage Cancer: Cheville et al found that of 163 women with metastatic breast cancer, 92% had at least one physical impairment, with 530 impairments identified overall, and that fewer than 30% of the participants received the appropriate care.29 In 2011, Cheville et al reviewed the causes of underuse of rehabilitation services for individuals with advanced cancer.30 In this review, the authors suggested that much of the disability associated with 6 advanced cancer may be avoided and stated that this is “an important public health issue.” 30 One of the central questions in this review was, “Why does functional loss in patients with cancer fail to trigger rehabilitation referrals?”30 Cheville et al explored several reasons, including that cancer-related disability is often insidious and that cancer care delivery systems are not conducive to the early detection of functional problems. In this particularly fragile population, the authors encouraged health care professionals to avoid underestimating the functional loss that may occur with minor impairments and stated, “Even seemingly benign impairments warrant attention, given their capacity to erode diminishing functional reserve.” 30 Albrecht and Taylor reviewed 16 articles published between 1994 and 2010 to determine the effect of physical activity in patients with advanced-stage cancer.31 They found that even patients with advanced-stage cancer can benefit from rehabilitation in terms of improvements in mood, pain, fatigue, shortness of breath, constipation, and insomnia. Cost of Cancer-related Morbidity The Union for International Cancer Control has recently reported that at a figure of $895 billion the economic cost of cancer in terms of years of disability and cost of lives lost (not including cost of treating the disease) is now the leading health care economic burden placed on countries world-wide.32 The oncologic specialist is uniquely positioned with a knowledge base that transcends body structure and function as well as a skill set that can impact every body system impacted by cancer. The advanced skills that enable the therapist to understand the disease, its side effects and adverse effects through the continuum of care will propel the oncology physical therapist specialist to the forefront in reducing not only the morbidity burden associated with the disease, but may directly impact the cost of ongoing lifetime care for this 7 chronic illness. These skills enable the oncologic specialist to participate in advanced professional roles as a consultant and advocate for the unique needs of these patients. As survivorship rates continue to escalate the oncologic specialist must step to the forefront as the only health care provider with the knowledge, skills and abilities to comprehensively manage the functional domains of patients with this disease. Care Delivery Model Inadequacies Physical therapy is poorly integrated into the medical service delivery model for cancer care in hospital-based settings and fragmented community-based care further exacerbates this problem pushing rehabilitation further from mainstream patient care. Cancer care and rehabilitation care are disconnected even in some institutions that have streamlined transition services and many community cancer programs lack rehabilitation care altogether.29, 33 Oncologic physical therapy services are relevant and necessary in primary, secondary and tertiary regards. Comprehensive cancer rehabilitation can address pre-existing or treatment-related comorbid conditions. Diabetes, cardiovascular disease, congestive heart failure, bone loss, adverse body composition, and renal disease are common in survivors of cancer2 and can be managed through rehabilitation interventions including medication, counseling, behavior change and promotion of healthy diets, physical activity, and weight control.12 Self-management skills and health promotion interventions provided in the context of comprehensive cancer rehabilitation also have the potential to decrease the risk of additional late effects—for example, the cardiac, pulmonary, endocrine, or bone complications of cancer treatment and may even reduce the risk of second malignancies.34-40 A final benefit is the joint focus on optimizing functional status and quality of life, preserving the ability to remain in the 8 workforce and other life roles, and maximizing health and longevity.41 The need to integrate rehabilitation and physical therapy into the continuum of cancer care is best met by the oncologic clinical specialist who brings an advanced skill set, knowledge base and can promote the advanced professional role of physical therapy for the cancer population. Currently, health care providers caring for patients along the continuum of cancer care do not adequately identify and refer patients for rehabilitation. Cheville et al found that in 163 women with metastatic breast cancer, 92% had at least one physical impairment, with a total of 530 impairments identified overall; 484 of these impairments (91%) required a physical rehabilitation intervention and 469 (88%) required physical and/or occupational therapy.42 Despite more than 90% of the participants needing cancer rehabilitation services, fewer than 30% received this care.42 Thorsen et al evaluated 1325 survivors of the 10 most prevalent cancers and found that 63% reported the need for at least one rehabilitation service, with physical therapy being the most frequently reported need (43%).43 They also reported that patients were often not referred for services; 40% of the participants reported unmet rehabilitation needs. This work demonstrates need for the oncologic specialist to take on a professional role as an advocate and leader in promoting the services that physical therapy can offer to the patient population. Further evidence of need includes a study by Schmitz et al found that at least 60% of breast cancer survivors had one or more treatment-related impairments at each checkpoint over a 6-year follow-up period.44 Cheville et al evaluated the detection and treatment of functional problems in cancer survivors and concluded that “Functional problems are prevalent among outpatients with cancer and are rarely documented by oncology clinicians.” 29 9 Not only does this evidence speak to the unmet needs of patient, it highlights the importance of the role the physical therapist who is an oncologic specialist can play in improving care. Other health care providers are not educated in impairment identification. Physical therapists are experts in movement dysfunction and have evidence-based tools and interventions to ameliorate or mitigate many of the aforementioned issues. Other health care providers are not educated to treat physical impairments and their scope of practice is limited to providing general, often broad recommendations towards activity and exercise and frequently there is not recognition of the need for therapeutic interventions.45, 46 Safety is a significant concern when prescribing exercise in the cancer population. Lack of appropriate screening or treatment may result in injury or other medical complications.47, 48 In this regard the oncologic clinical specialist, with advanced knowledge and skills regarding exercise prescription for the patient with cancer, can promote improved screening, identification of and treatment for impairments. 10 Figure 1. Rehabilitation interventions commonly used in cancer rehabilitation.45 11 Difficulty returning to premorbid activities General physical physical Specific REHABILITATION CATEGORY ▪ ▪ ▪ ▪ Weakness Deconditioningb limitations Cervical range-of-motion ▪ ▪ ▪ Balance dysfunction Bowel dysfunction ▪ ▪ Back pain ▪ ▪ ▪ Visceral pain ▪ ▪ ▪ Somatic pain Autonomic dysfunction ▪ ▪ ▪ ▪ ▪ BREAST ▪ ▪ ▪ ▪ ▪ LUNG Neuropathic pain pain) (eg, myalgias, myofascial Musculoskeletal pain arthralgias) Joint pain, diffuse (eg, Fatigue REASON TO REFER TO IMPAIRMENT ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ COLORECTAL ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ PROSTATE ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ CNS ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ HEAD/NECK ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ MELANOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ LYMPHOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OSTEOSARCOMA COMMON IMPAIRMENTS IN CANCER DIAGNOSES (modified from Silver et al45 ) ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OVARIAN ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ TESTICULAR ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ADVANCED 20 REHABILITATION CATEGORY Neck pain Muscular asymmetry Lymphedema Lumbosacral plexopathy limitations Joint range-of-motion Joint pain, localized Jaw excursion, limited History of falls Headaches disease Graft-versus-host Gait dysfunction ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ HEAD/NECK Dystonia ▪ ▪ CNS ▪ ▪ ▪ COLORECTAL ▪ ▪ ▪ Cognitive impairment ▪ PROSTATE Compression neuropathy ▪ ▪ BREAST ▪ ▪ LUNG Chest/thoracic pain peripheral neuropathy Chemotherapy-induced REASON TO REFER TO IMPAIRMENT ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ MELANOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ LYMPHOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OSTEOSARCOMA COMMON IMPAIRMENTS IN CANCER DIAGNOSES (modified from Silver et al45 ) ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OVARIAN ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ TESTICULAR ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ADVANCED 21 Psychosocial REHABILITATION CATEGORY Psychosocial dysfunction dysfunction proprioception Visuospatial and/or Urinary dysfunction ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ Trismus ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ADVANCED ▪ ▪ ▪ ▪ ▪ ▪ TESTICULAR ▪ ▪ ▪ ▪ ▪ ▪ ▪ OVARIAN ▪ Shoulder pain ▪ ▪ ▪ ▪ ▪ ▪ OSTEOSARCOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ LYMPHOMA Swallowing impairment ▪ ▪ ▪ ▪ ▪ ▪ MELANOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ HEAD/NECK ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ CNS Speech impairment ▪ ▪ ▪ ▪ ▪ COLORECTAL ▪ ▪ ▪ Sexual dysfunction ▪ ▪ ▪ ▪ PROSTATE ▪ ▪ ▪ Sensory deficits ▪ ▪ ▪ ▪ ▪ ▪ BREAST ▪ ▪ ▪ LUNG Scar adhesions Scapular winging Radiculopathy syndrome Radiation fibrosis Plexopathy Paralysis Osteopenia/osteoporosis REASON TO REFER TO IMPAIRMENT COMMON IMPAIRMENTS IN CANCER DIAGNOSES (modified from Silver et al45 ) 22 ▪ ▪ ▪ ▪ ▪ Workplace evaluation Driving evaluation ▪ ▪ ▪ ▪ ▪ BREAST ▪ ▪ ▪ ▪ ▪ ▪ LUNG Home safety evaluation equipment needs Durable medical needs Adaptive equipment reacher, etc) Assistive devices (cane, Prosthetics Orthotics (chores/shopping, etc) Difficulty with IADLs (dressing/bathing, etc) Difficulty with ADLs REHABILITATION CATEGORY Functional REASON TO REFER TO IMPAIRMENT ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ PROSTATE ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ COLORECTAL ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ CNS ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ HEAD/NECK ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ MELANOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ LYMPHOMA ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OSTEOSARCOMA COMMON IMPAIRMENTS IN CANCER DIAGNOSES (modified from Silver et al45 ) ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ OVARIAN ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ TESTICULAR ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ▪ ADVANCED 23 1. Institute NC. Surveillance Epidemiology and End Results Fact Sheets 2012. 2. Hewitt M, Rowland J, Yancik R. Cancer survivors in the United States: age, health, and disability. The Journals of Gerontology: Series A 2003;58:M82-M91. 3. Nagarajan R, Mogil R, Neglia JP, Robison LL, Ness KK. Self-reported global function among adult survivors of childhood lower-extremity bone tumors: a report from the Childhood Cancer Survivor Study (CCSS). Journal of cancer survivorship : research and practice 2009;3:59-65. 4. Ness KK, Hudson MM, Pui C-H, Green DM, Krull KR, Huang TT, et al. Neuromuscular impairments in adult survivors of childhood acute lymphoblastic leukemia: associations with physical performance and chemotherapy doses. Cancer 2012;118:828-38. 5. Ness KK, Hudson MM, Ginsberg JP, Nagarajan R, Kaste SC, Marina N, et al. Physical performance limitations in the Childhood Cancer Survivor Study cohort. Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2009;27:2382-9. 6. Ness KK, Morris EB, Nolan VG, Howell CR, Gilchrist LS, Stovall M, et al. Physical performance limitations among adult survivors of childhood brain tumors. Cancer 2010;116:3034-44. 7. Ness KK, Armenian SH, Kadan-Lottick N, Gurney JG. Adverse effects of treatment in childhood acute lymphoblastic leukemia: general overview and implications for long-term cardiac health. Expert review of hematology 2011;4:185-97. 8. Smoot B, Wong J, Cooper B, Wanek L, Topp K, Byl N, et al. Upper extremity impairments in women with or without lymphedema following breast cancer treatment. Journal of cancer survivorship : research and practice 2010;4:167-78. 9. Levangie PK, Drouin J. Magnitude of late effects of breast cancer treatments on shoulder function: a systematic review. Breast cancer research and treatment 2009;116:1-15. 10. Yang E, Park W, Seo K. Longitudinal change of treatment-related upper limb dysfunction and its impact on late dysfunction in breast cancer survivors: A prospective cohort study. Journal of Surgical Oncology 2010;101:84-91. 11. Ramchandren S, Leonard M. Peripheral neuropathy in survivors of childhood acute lymphoblastic leukemia. Journal of the Peripheral Nervous System 2009;14:184-89. 12. Stubblefield MD. Cancer rehabilitation. Semin Oncol 2011;38(3):386-93. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21600368 13. Schmitz KH, Courneya KS, Matthews C, Demark-Wahnefried W, Galvao DA, Pinto BM, et al. American College of Sports Medicine roundtable on exercise guidelines for cancer survivors. Med Sci Sports Exerc 2010;42(7):1409-26. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=20559064 14. Wolin KY, Schwartz AL, Matthews CE, Courneya KS, Schmitz KH. Implementing the exercise guidelines for cancer survivors. J Support Oncol 2012;10(5):171-7. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22579268 15. Stasi R, Abriani L, Beccaglia P, Terzoli E, Amadori S. Cancer-related fatigue: evolving concepts in evaluation and treatment. Cancer 2003;98:1786-801. 16. Cherny NI, Portenoy RK. The management of cancer pain. CA Cancer J Clin 1994;44(5):263-303. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=8076244 17. Miaskowski C, Cooper B, Paul SM, West C, Langford D, Levine JD, et al. Identification of patient subgroups and risk factors for persistent breast pain following breast cancer surgery. J Pain 2012;13(12):1172-87. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23182226 18. Mishra SI, Scherer RW, Snyder C, Geigle PM, Berlanstein DR, Topaloglu O. Exercise interventions on health-related quality of life for people with cancer during active treatment. Cochrane Database Syst Rev 2012;8:CD008465. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22895974 19. Kannarkat G, Lasher EE, Schiff D. Neurologic complications of chemotherapy agents. Curr Opin Neurol 2007;20(6):719-25. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17992096 20. Wampler MA, Topp KS, Miaskowski C, Byl NN, Rugo HS, Hamel K. Quantitative and clinical description of postural instability in women with breast cancer treated with taxane chemotherapy. Arch Phys Med Rehabil 2007;88(8):1002-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17678662 21. Hilkens PH, Verweij J, Stoter G, Vecht CJ, van Putten WL, van den Bent MJ. Peripheral neurotoxicity induced by docetaxel. Neurology 1996;46(1):104-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=8559354 22. Bunting RW, Shea B. Bone metastasis and rehabilitation. Cancer 2001;92(4 Suppl):1020-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=11519029 23. Ramos SM, O'Donnell LS, Knight G. Edema volume, not timing, is the key to success in lymphedema treatment. Am J Surg 1999;178(4):311-5. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=10587190 24. Stout Gergich NL, Pfalzer LA, McGarvey C, Springer B, Gerber LH, Soballe P. Preoperative assessment enables the early diagnosis and successful treatment of lymphedema. Cancer 2008;112(12):2809-19. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18428212 20 25. Schmitz KH, Ahmed RL, Troxel A, Cheville A, Smith R, Lewis-Grant L, et al. Weight lifting in women with breastcancer-related lymphedema. N Engl J Med 2009;361(7):664-73. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=19675330 26. Adamsen L, Quist M, Andersen C, Moller T, Herrstedt J, Kronborg D, et al. Effect of a multimodal high intensity exercise intervention in cancer patients undergoing chemotherapy: randomised controlled trial. BMJ 2009;339:b3410. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=19826172 27. Baumann FT, Zopf EM, Bloch W. Clinical exercise interventions in prostate cancer patients--a systematic review of randomized controlled trials. Support Care Cancer 2012;20(2):221-33. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21989678 28. McNeely ML, Parliament MB, Seikaly H, Jha N, Magee DJ, Haykowsky MJ, et al. Effect of exercise on upper extremity pain and dysfunction in head and neck cancer survivors: a randomized controlled trial. Cancer 2008;113(1):214-22. Available from http://www.ncbi.nlm.nih.gov/pubmed/18457329. 29. Cheville AL, Beck LA, Petersen TL, Marks RS, Gamble GL. The detection and treatment of cancer-related functional problems in an outpatient setting. Support Care Cancer 2009;17(1):61-7. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18478275 30. Cheville AL, Kornblith AB, Basford JR. An examination of the causes for the underutilization of rehabilitation services among people with advanced cancer. Am J Phys Med Rehabil 2011;90(5 Suppl 1):S27-37. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21765261 31. Albrecht TA, Taylor AG. Physical activity in patients with advanced-stage cancer: a systematic review of the literature. Clin J Oncol Nurs 2012;16(3):293-300. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22641322 32. Control UfIC. Costliest Disease is Cancer 2011. 33. Silver JK. Strategies to overcome cancer survivorship care barriers. PM R 2011;3(6):503-6. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21665161 34. Holmes MD, Chen WY, Feskanich D, Kroenke CH, Colditz GA. Physical activity and survival after breast cancer diagnosis. JAMA 2005;293(20):2479-86. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=15914748 35. Pierce JP, Stefanick ML, Flatt SW, Natarajan L, Sternfeld B, Madlensky L, et al. Greater survival after breast cancer in physically active women with high vegetable-fruit intake regardless of obesity. J Clin Oncol 2007;25(17):2345-51. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17557947 36. Irwin ML, Cadmus L, Alvarez-Reeves M, O'Neil M, Mierzejewski E, Latka R, et al. Recruiting and retaining breast cancer survivors into a randomized controlled exercise trial: the Yale Exercise and Survivorship Study. Cancer 2008;112(11 Suppl):2593-606. Available from http://www.ncbi.nlm.nih.gov/pubmed/18428192. 37. Irwin ML, McTiernan A, Manson JE, Thomson CA, Sternfeld B, Stefanick ML, et al. Physical activity and survival in postmenopausal women with breast cancer: results from the women's health initiative. Cancer Prev Res (Phila) 2011;4(4):522-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21464032 38. Giovannucci E, Liu Y, Platz EA, Stampfer MJ, Willett WC. Risk factors for prostate cancer incidence and progression in the health professionals follow-up study. Int J Cancer 2007;121(7):1571-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=17450530 39. Meyerhardt Ja, Heseltine D, Niedzwiecki D, Hollis D, Saltz LB, Mayer RJ, et al. Impact of physical activity on cancer recurrence and survival in patients with stage III colon cancer: findings from CALGB 89803. Journal of clinical oncology : official journal of the American Society of Clinical Oncology 2006;24:3535-41. 40. Meyerhardt JA, Giovannucci EL, Ogino S, Kirkner GJ, Chan AT, Willett W, et al. Physical activity and male colorectal cancer survival. Arch Intern Med 2009;169(22):2102-8. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=20008694 41. de Boer AG, Taskila T, Tamminga SJ, Frings-Dresen MH, Feuerstein M, Verbeek JH. Interventions to enhance return-towork for cancer patients. Cochrane Database Syst Rev 2011(2):CD007569. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21328297 42. Cheville AL, Troxel AB, Basford JR, Kornblith AB. Prevalence and treatment patterns of physical impairments in patients with metastatic breast cancer. J Clin Oncol 2008;26(16):2621-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=18509174 43. Thorsen L, Gjerset GM, Loge JH, Kiserud CE, Skovlund E, Flotten T, et al. Cancer patients' needs for rehabilitation services. Acta Oncol 2011;50(2):212-22. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=21231783 44. Schmitz KH, Speck RM, Rye SA, DiSipio T, Hayes SC. Prevalence of breast cancer treatment sequelae over 6 years of follow-up: the Pulling Through Study. Cancer 2012;118(8 Suppl):2217-25. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22488696 45. Silver JK, Baima J, Mayer RS. Impairment-driven cancer rehabilitation: An essential component of quality care and survivorship. CA Cancer J Clin 2013. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23856764 21 46. Stout NL. Exercise for the cancer survivor: all for one but not one for all. J Support Oncol 2012;10(5):178-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22579267 47. Cousins N, MacAulay F, Lang H, MacGillivray S, Wells M. A systematic review of interventions for eating and drinking problems following treatment for head and neck cancer suggests a need to look beyond swallowing and trismus. Oral Oncol 2013;49(5):387-400. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=23291294 48. Cristian A, Tran A, Patel K. Patient safety in cancer rehabilitation. Phys Med Rehabil Clin N Am 2012;23(2):441-56. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=22537705 22 6 $%3765(9,(: ,IRWKHUDUHDVRISK\VLFDOWKHUDS\SUDFWLFHRURWKHUKHDOWKSURIHVVLRQDOVDUHFXUUHQWO\ PHHWLQJWKHQHHGVGHVFULEHKRZWKHSK\VLFDOWKHUDS\VSHFLDOLVWVFDQPHHWWKHVHQHHGV PRUHHIIHFWLYHO\DQGHIILFLHQWO\ ^'HFLVLRQDid NotAdequately Meet Requirement` $%376GLGQRWIHHOSHWLWLRQHUDGHTXDWHO\DGGUHVVHGTXHVWLRQVFRQFHUQVUDLVHGGXULQJSUHYLRXV UHYLHZ:KLOHWKHQHHGIRUDVSHFLDOLVWZDVGRFXPHQWHGLWVWLOOZDVQRWHYLGHQWIURPWKH LQIRUPDWLRQSURYLGHGZLWKLQVHFWLRQZK\WKHSURSRVHGSK\VLFDOWKHUDS\VSHFLDOL]DWLRQPHHWV QHHGVPRUHHIIHFWLYHO\HIILFLHQWO\WKDQRWKHUKHDOWKSURIHVVLRQDOV7KHVXJJHVWLRQZDVPDGHWR XVHVSHFLILFH[DPSOHVWREHWWHUVXSSRUWWKHSHWLWLRQHU¶VFDVHIRUWKLVFULWHULRQ,VVSHFLDOL]DWLRQ WKHDQVZHUDQGLIVRKRZ"(YLGHQFHDQGVXSSRUWVHHPVWREHDYDLODEOHZLWKLQVHFWLRQVR WKHSHWLWLRQHUPD\FRQVLGHUPRYLQJWKDWVXSSRUWWRWKLVVHFWLRQSULRUWRDUHVXEPLVVLRQ 5(9,6('6(&7,21 7KHH[SDQVLRQRIWKHUROHRIWKH1DWLRQDO&DQFHU,QVWLWXWHLQWRUHKDELOLWDWLRQLQOHG WRWKHGHYHORSPHQWRIUHODWHGWUDLQLQJGHPRQVWUDWLRQDQGUHVHDUFKSURMHFWV6RPHREVHUYHUV KDYHQRWHGKRZHYHUWKDWFDQFHUUHKDELOLWDWLRQ³ZDVKDPSHUHGLQLWVGHYHORSPHQWEHFDXVH WKHUHZDVQRVSHFLILFLPSOHPHQWDWLRQSODQDODFNRIWUDLQHGSHUVRQQHODQGDIDLOXUHWRHGXFDWH UHIHUULQJKHDOWKFDUHSURIHVVLRQDOV´7KHUHKDELOLWDWLYHDQGVXSSRUWLYHFDUHQHHGVRIFDQFHU VXUYLYRUVFRQWLQXHVWRQRWEHDGHTXDWHO\PHWE\SK\VLFDOWKHUDSLVWVLQRWKHUDUHDVRISUDFWLFHRU E\RWKHUKHDOWKFDUHSURIHVVLRQDOV ,QVXUYH\DQGGLVFXVVLRQRIFDQFHUFHQWHUVDURXQGWKHFRXQWU\DQGDVUHIHUHQFHGLQWKH 'HPDQG6HFWLRQRIWKLVSHWLWLRQHPSOR\HUVVLWHGWKHQHHGIRUH[WHQVLYHRQWKHMREWUDLQLQJDQG HGXFDWLRQWRJHWJHQHUDOSK\VLFDOWKHUDSLVWVµXSWRVSHHG¶WRPDQDJHWKHXQLTXHQHHGVRIWKH FDQFHUSRSXODWLRQ7KHSK\VLFDOWKHUDSLVWSUDFWLFLQJLQWKHRQFRORJ\FDUHVHWWLQJUHTXLUHVDQ DGYDQFHGVNLOOVHWWRHIIHFWLYHO\DQGHIILFLHQWO\DGGUHVVWKHQHHGVRIFDQFHUVXUYLYRUV7KHYLWDO LPSRUWDQFHRIUHFRJQL]LQJWKHHIIHFWVRIFDQFHUWUHDWPHQWDGYHUVHHIIHFWVRIWUHDWPHQWDQGWKHLU LPSOLFDWLRQVRQWKHSK\VLFDOWKHUDS\NQRZOHGJHLVZHOOUHSUHVHQWHGLQWKH2QFRORJ\3UDFWLFH 6XUYH\7KHGLVHDVHRIFDQFHUDQGLWVWUHDWPHQWLQWHUSOD\ZLWKERG\V\VWHPVDQGIXQFWLRQV 3 GLIIHUHQWO\WKDQDQ\RWKHUGLVHDVHSURFHVVWKDWSK\VLFDOWKHUDS\SURIHVVLRQDOVH[SHULHQFHLQ WKHLUFOLQLFDOSUDFWLFHVHWWLQJV 'XHWRWKHV\VWHPLFQDWXUHRIWKHGLVHDVHSURFHVVDQGFDQFHUWKHUDSLHVWKH LPSDLUPHQWVUHODWHGWRFDQFHUWUHDWPHQWUDUHO\DUHEDVHGLQRQHERG\V\VWHP7KHUHIRUH RQFRORJ\VSHFLDOLVWVUHFRJQL]HWKHLPSRUWDQFHRIWKLVDGYDQFHGNQRZOHGJHDQGPDQDJHWKHLU FOLHQWVEDVHGRQWKLVDGYDQFHGNQRZOHGJH7KH\WHQGWRDJJUHJDWHDPRQJV\VWHPV VLPXOWDQHRXVO\ZKLOHDOVRDVVHVVLQJWKHULVNIRULPSDLUPHQWVGXHWRODWHHIIHFWVRIFDQFHURYHU RQH¶VOLIHWLPH6XFKNQRZOHGJHFULWHULDGHPRQVWUDWHVWKHQHHGIRUWKHVSHFLDOLVWWRUHFRJQL]HWKH LPSRUWDQFHRIDOOV\VWHPVDQGWKHLULQWHUSOD\ZLWKRQHDQRWKHUDVZHOODVWKHGLVHDVHSURFHVV DQGGLVHDVHWUHDWPHQWPRGDOLWLHVLQDQHIILFLHQWDQGHIIHFWLYHPDQQHU$OWKRXJKRWKHUFOLQLFDO VSHFLDOLVWVDQGJHQHUDOSK\VLFDOWKHUDSLVWVPD\KDYHFDQFHUUHODWHGNQRZOHGJHWKHNQRZOHGJH LVFRQFHSWXDOL]HGGLIIHUHQWO\DQGRUWKHEUHDGWKRINQRZOHGJHLVIRFXVHGRQDSDUWLFXODUSDWLHQW SRSXODWLRQRUVHWWLQJ2WKHUDUHDVRIVSHFLDOW\SUDFWLFHVXFKDV:RPHQ¶V+HDOWKPD\LQGHHG IRFXVRQVSHFLILFRQFRORJLFGLDJQRVHVHJEUHDVWFDQFHUVSHFLILFWRDSRSXODWLRQWKH RQFRORJ\VSHFLDOLVWIRFXVHVRQWKHRQFRORJLFSRSXODWLRQDVDZKROHDQGWKHLPSDLUPHQWVWKDW DUHHOLFLWHGE\WKHGLVHDVHDQGLWVWUHDWPHQWDFURVVDOOW\SHVRISDWLHQWSRSXODWLRQV ([DPSOHVRI+RZWKH2QFRORJLF6SHFLDOLVWFDQ$GGUHVV*DSVLQ(IILFLHQF\DQG(IIHFWLYHQHVV &DUGLRSXOPRQDU\7KHFDUGLRSXOPRQDU\VSHFLDOW\H[DPLQDWLRQFRQWHQWRXWOLQHLQFOXGHVYHU\ GHWDLOHGOLVWVRIPHGLFDOFRQGLWLRQVFDWHJRUL]HGDV³VHHQIUHTXHQWO\VHHQRFFDVLRQDOO\´DQG ³VHHQUDUHO\´EDVHGRQWKHLUSUDFWLFHVXUYH\7KHUHLVRQO\RQHPHQWLRQRIFDQFHULQWKH SXOPRQDU\FRQGLWLRQVWKDWDUHVHHQIUHTXHQWO\DQGWKDWLV³FDUFLQRPDLQVLWXRIWKHOXQJRU EURQFKXV´&RQGLWLRQVWKDWDUHUHSRUWHGWREHVHHQRFFDVLRQDOO\LQFOXGH³PDOLJQDQWQHRSODVP RIWKHWUDFKHDEURQFKXVOXQJDQGSOHXUD³DQGLQWKH³VHHQUDUHO\´FDWHJRU\LVIRXQG³JUDSK>VLF@ YHUVXVKRVWGLVHDVH´,WLVQRWVXUSULVLQJWKDWWKHUDSLVWVZKRGRQRWIRFXVRQRQFRORJ\VHHJUDIW YHUVXVKRVWGLVHDVHRQO\UDUHO\VLQFHLWLVDUDUHFRQGLWLRQZLWKOHVVWKDQFDVHVVHHQ 4 DQQXDOO\LQWKH8QLWHG6WDWHV 7KHUDSLVWVZKRVSHFLDOL]HLQRQFRORJ\KRZHYHUVHHWKLV FRQGLWLRQFRPPRQO\EHFDXVHSDWLHQWVXQGHUJRLQJ%RQH0DUURZ7UDQVSODQWDQGRUJDQ WUDQVSODQWVUHTXLUHKLJKO\VSHFLDOL]HGFDUHDQGDUHFDUHGIRULQKLJKO\VSHFLDOL]HGVHWWLQJVVXFK DVPDMRUFDQFHUFHQWHUV)XUWKHUPRUHLWLVLPSRUWDQWWKDWWKHUDSLVWVVSHFLDOL]LQJLQFDQFHUKDYH WKHH[SHULHQFHRIVHHLQJWKLVDQGRWKHUW\SHVRIFRPSOLFDWLRQRIFDQFHUWUHDWPHQWGXULQJWKHLU FDUHHUVEHFDXVHWKDWH[SHULHQFHKHOSVWKHPEHWWHUUHFRJQL]HWKHV\PSWRPVRIWKHVH FRPSOLFDWLRQVZKHQWKH\DSSHDUGXULQJWKHFRXUVHRISDWLHQWUHKDELOLWDWLRQDQGDVHDUO\RUODWH HIIHFWVRIWUHDWPHQW7KHLPSOLFDWLRQVRIWKHHDUO\V\PSWRPVRIWKLVYHU\VHULRXVFRPSOLFDWLRQ VXFKDVLWFK\UDVKZRXOGYHU\OLNHO\EHPLVVHGE\DJHQHUDOLVWRUDWKHUDSLVW $QQH6ZLVKHU373K'&&6FXUUHQW(GLWRURIWKHFDUGLRSXOPRQDU\MRXUQDOKDV SXEOLVKHGDUWLFOHVERWKRQFDUGLRSXOPRQDU\WRSLFVDQGRQRQFRORJLFWRSLFV6KHGHVFULEHV KHUVHOIDVD³SHUVRQZLWKD&&6ZKRKDVEHHQSUDFWLFLQJLQRQFRORJ\IRU\HDUV´$VNHG DERXWWKHGLVWLQFWLRQEHWZHHQRQFRORJLFVSHFLDOLVWVDQGFDUGLRSXOPRQDU\VSHFLDOLVWV'U 6ZLVKHUJDYHWKHIROORZLQJZHOODUWLFXODWHGUHVSRQVHZKLFKLQFOXGHVEXWLVQRWOLPLWHGWR FRPPHQWVDERXWFDUGLRSXOPRQDU\VSHFLDOLVWV³$SDWLHQWZLWKFDQFHUFDQDQGRIWHQZLOOKDYH PDQ\PDQLIHVWDWLRQVRIWKHGLVHDVHDQGRULWVWUHDWPHQWWKDWDUHIDPLOLDUWRSK\VLFDOWKHUDSLVWV SUDFWLFLQJRXWVLGHRIRQFRORJ\+RZHYHUZLWKRXWWKHVSHFLDOL]HGNQRZOHGJHRIFDQFHUDQGLWV YHU\FRPSOH[WUHDWPHQWUHJLPHQVWKRVHSK\VLFDOWKHUDSLVWVDUHQRWSUHSDUHGWRIXOO\GLDJQRVH DQGPDQDJHWKHLVVXHV 2UWKRSHGLFV)RUH[DPSOHDSDWLHQWPD\GHYHORSDGKHVLYHFDSVXOLWLVIROORZLQJEUHDVWFDQFHU VXUJHU\DQGUDGLDWLRQWKHUDS\KRZHYHUWKHRUWKRSHGLFSK\VLFDOWKHUDSLVWZRXOGQRWXQGHUVWDQG WKHLQIOXHQFHRIUDGLDWLRQRQEORRGIORZDQGERQHGHQVLW\LQWKHUHJLRQZKLFKLPSDFWVERWKWKH FRXUVHRIWKHFRQGLWLRQDQGWKHRSWLRQVIRUWUHDWPHQWHJDYRLGLQJJUDGH,9PRELOL]DWLRQH[WUD SUHFDXWLRQVIRUWKHUPDOPRGDOLWLHVVNLQFKDQJHVWKDWPD\OLPLWXOWLPDWHJDLQVLQIOH[LELOLW\QRU * http://www.rightdiagnosis.com/g/graft_versus_host_disease/prevalence.htm). 5 WKHLQIOXHQFHRIDURPDWDVHLQKLELWRUDVVRFLDWHGDUWKUDOJLDDVDGLIIHUHQWLDOGLDJQRVLVIRUVKRXOGHU SDLQ 1HXURORJ\$QHXURORJLFDOSK\VLFDOWKHUDSLVWPLJKWUHFRJQL]HLPSDLUHGEDODQFHGXHWR FKHPRWKHUDS\LQGXFHGSHULSKHUDOQHXURSDWK\EXWQRWXQGHUVWDQGWKDWWKHXVHRIWD[DQH FKHPRWKHUDS\DJHQWVDOVRLPSDLUFRJQLWLRQDQGDELOLW\WRUHPHPEHUVDIHW\SUHFDXWLRQVIRUD KRPHEDODQFHWUDLQLQJSURJUDP 7KHVHDUHMXVWLOOXVWUDWLRQVRIVLWXDWLRQVZKHUHD³VLPSOH37SUREOHP´OLNHLPSDLUHGDHURELF FDSDFLW\MRLQWOLPLWDWLRQVLPSDLUHGSRVWXUHRULPSDLUHGEDODQFHDUHTXLWHFRPSOLFDWHGWR GLDJQRVHDQGPDQDJHZLWKRXWDWKRURXJKXQGHUVWDQGLQJRIWKHSDWKRSK\VLRORJ\RIFDQFHU OLWHUDOO\KXQGUHGVRIVSHFLILFGLVHDVHVDQGWUHDWPHQWVVXUJHU\FKHPRWKHUDS\UDGLDWLRQ WKHUDS\ERQHPDUURZWUDQVSODQWELRORJLFDODJHQWVDQGWKHLUHIIHFWVRQPRELOLW\&DQFHU&HQWHU DGPLQLVWUDWRUVKDYHLGHQWLILHGGHILFLWVLQWKHJHQHUDOSK\VLFDOWKHUDSLVWLQDGGUHVVLQJWKH FRPSOH[LW\RIGHYHORSLQJUHKDELOLWDWLRQSODQVRIFDUHIRUFDQFHUVXUYLYRUV7KXVWKHRQFRORJ\ VSHFLDOLVWSK\VLFDOWKHUDSLVWGHPRQVWUDWHVDQXQLTXHVNLOOLQWKHPDQDJHPHQWRILPSDLUPHQWVLQ WKHQHXURORJLFDOPXVFXORVNHOHWDOFDUGLRYDVFXODUSXOPRQDU\DQGLQWHJXPHQWDU\V\VWHPVEXW DOVRDQXQGHUVWDQGLQJRIKRZFDQFHUDQGLWVWUHDWPHQWVZKLFKDUHQXPHURXVDQG LQGLYLGXDOL]HGPD\LPSDFWPRYHPHQWDQGIXQFWLRQ 7KHFDQFHUFHQWHUVVLWHGDERYHDUHRIWHQKRXVHGLQODUJHKRVSLWDOV\VWHPVDFDGHPLF PHGLFDOFHQWHUVRUDUHWKHPVHOYHVDQGLQGHSHQGHQWFDQFHUVSHFLDOW\KRVSLWDO2QFHSDWLHQWV OHDYHWKLVVSHFLDOL]HGVHWWLQJWKH\UHWXUQWRWKHLUFRPPXQLW\VHWWLQJVZKHUHVSHFLDOL]HGFDUHLV HYHQOHVVOLNHO\WREHUHFRJQL]HGRUGHOLYHUHGE\DSK\VLFDOWKHUDSLVW7KHPDMRULW\RIRQFRORJ\ UHKDELOLWDWLRQGRHVRFFXULQFRPPXQLW\VHWWLQJV$VSDWLHQWVWUDQVLWLRQWRYDULRXVVHWWLQJV LQFOXGLQJKRPHFDUHVNLOOHGQXUVLQJIDFLOLWLHVDQGORQJWHUPIDFLOLWLHVDVZHOODVRXWSDWLHQW UHKDELOLWDWLRQFHQWHUVWKHQHHGIRUDSK\VLFDOWKHUDSLVWZLWKRQFRORJLFVSHFLDOW\WUDLQLQJLVHYHQ PRUHFUXFLDOGXHWRWKHUHGXFHGUHVRXUFHVIURPWKHODFNRIWKHFRPSUHKHQVLYHFDUHWHDPDV VHHQLQODUJHDFDGHPLFPHGLFDOFHQWHUVKRVSLWDOV\VWHPVDQGFDQFHUVSHFLDOW\KRVSLWDOV7KH 6 ODFNRIRQFRORJLFVSHFLDOLVWVFDQUHVXOWLQRYHUXWLOL]DWLRQRISK\VLFDOWKHUDS\VHUYLFHVKLJKHU PHGLFDOFRVWVDQGSRRUSDWLHQWRXWFRPHV$VWKHKHDOWKFDUHV\VWHPWUDQVLWLRQVWRDPRUHYDOXH EDVHGFDUHSDWLHQWVDUHIUHTXHQWO\VHHNLQJRXWRQFRORJLFVSHFLDOW\WKHUDSLVWVIRULPSURYHG RXWFRPHVDQGORZHUKHDOWKFDUHFRVWVZKLFKFDQOHGWRDGHOD\LQWKHLUWUHDWPHQWDQGDOOHYLDWLRQ RILPSDLUPHQWV)UXVWUDWLRQZLWKWKHLQDELOLW\WRLGHQWLI\DQRQFRORJLFSK\VLFDOWKHUDS\VSHFLDOLVW FDQDOVROHDGWRRXUFRQVXPHUVVHHNLQJRXWRWKHUKHDOWKFDUHSURYLGHUVIRULPSDLUPHQWVEHVW DGGUHVVHGE\SK\VLFDOWKHUDS\LQWHUYHQWLRQV5HFRJQLWLRQRIVSHFLDOW\SUDFWLFHLQRQFRORJ\ZLOO KHOSWRSURPRWHLPSURYHGFDUHGHOLYHU\HIILFLHQFLHVDFURVVWKHFRQWLQXXPRIFDUHDQGDFURVVWKH OLIHVSDQ 2QHUHFHQWLQLWLDWLYHKDVGHYHORSHGLQUHVSRQVHWRWKHQHHGIRUEHWWHUFOLQLFDOHIILFLHQF\ DQGHIIHFWLYHQHVVLQWUHDWLQJWKHRQFRORJLFSRSXODWLRQ7KH&RPPLVVLRQWR$FFUHGLW$FXWH 5HKDELOLWDWLRQ)DFLOLWLHV&$5)FRQYHQHGDQ,QWHUQDWLRQDO6WDQGDUGV$GYLVRU\%RDUGWRGHYHORS FULWHULDIRUVSHFLDOL]HGDFFUHGLWDWLRQRI&DQFHU5HKDELOLWDWLRQSURJUDPV7KH$37$ZDV UHSUHVHQWHGRQWKH&$5)SDQHOE\WKHUDSLVWV$QGUHD%UDQDV37037DQG1LFROH6WRXW37 0372WKHUSDQHOLVWVLQFOXGHGRFFXSDWLRQDOWKHUDSLVWVQXUVHVPXVLFWKHUDSLVWVSK\VLDWULVWV FOLQLFDOQXUVHVSHFLDOLVWVUHKDELOLWDWLRQDGPLQLVWUDWLYHGLUHFWRUVSDWLHQWVDQG&$5) DGPLQLVWUDWRUV7KHSDQHOPHWIRUGD\VDQGGHYHORSHGFULWHULDIRU5HKDELOLWDWLRQ)DFLOLWLHVWREH FRPHDFFUHGLWHGDV&$5)VSHFLDOW\SURJUDPVLQ&DQFHU5HKDELOLWDWLRQ7KHVHFULWHULDZHUH LPSOHPHQWHGLQIRU5HKDELOLWDWLRQ&HQWHUVWRDFKLHYHDFFUHGLWDWLRQDIWHU-XO\7KH JRDORIWKHLQLWLDWLYHWRLVVXHVWDQGDUGVIRUDFFUHGLWLQJ&DQFHU5HKDELOLWDWLRQSURJUDPVLVWR VSHFLILFDOO\DGGUHVVWKHLQHIILFLHQFLHVFXUUHQWO\H[SHULHQFHGLQPDQDJHPHQWRIWKHSDWLHQWZLWK FDQFHUDFURVVWKHFRQWLQXXPRIFDUHWRDFFRXQWIRUWKHJDSVLQWUDQVLWLRQVEHWZHHQFDUH VHWWLQJVDQGWRLPSURYHFROODERUDWLRQDQGFRPPXQLFDWLRQWRRSWLPL]HFDQFHUFDUHGHOLYHU\6XFK DQLQLWLDWLYHIXUWKHUVXSSRUWVWKHQHHGIRUWKHRQFRORJLFFOLQLFDOVSHFLDOLVWWRSURPRWHRSWLPDO HIILFLHQF\RIFDUHDQGRSWLPDOHIIHFWLYHQHVVLQFDUHIRUWKLVSRSXODWLRQ 7 $VHYLGHQFHGE\6HFWLRQRIWKLVSHWLWLRQVSHFLDOW\SK\VLFDOWKHUDSLVWVLQDUHDVVXFK DV2UWKRSHGLFV&DUGLRYDVFXODUDQG3XOPRQDU\:RPHQ¶V+HDOWKDQG1HXURORJ\DOOFLWHWKHLU LQDELOLW\WRPHHWWKHQHHGVRIWKHFDQFHUSRSXODWLRQ7KHVHUHDVRQVDUHYDULHGWKH\GRQRWKDYH WKHNQRZOHGJHDQGVNLOOVWRFRPSUHKHQVLYHO\WUHDWWKHSDWLHQWWKH\DUHXQDZDUHRIWKHXQLTXH QHHGVRIWKHFDQFHUSRSXODWLRQRUWKH\EHOLHYHWKDWLWLVRXWRIWKHGRPDLQRIWKHLULQGLYLGXDO VFRSHRISUDFWLFHDQGVKRXOGEHDIRFXVHGFOLQLFDOVSHFLDOL]DWLRQVHSDUDWHIURPWKHLURZQ 7KHFRQYHUJHQFHRISUHH[LVWLQJDQGQHZFKURQLFFRQGLWLRQVLQROGHUVXUYLYRUVRIFDQFHU LVDPDMRUFKDOOHQJHIRUKHDOWKFDUHSROLF\DQGGHOLYHU\7RPHHWWKLVFKDOOHQJHZHPXVW GHYHORSDPRGHORIFDUHGHOLYHU\WRPD[LPL]HWKHKHDOWKDQGZHOOEHLQJRIVXUYLYRUVRIFDQFHU IRFXVLQJRQHIIHFWLYHV\PSWRPPDQDJHPHQWSUHYHQWLRQRIODWHHIIHFWVDQGKHDOWKSURPRWLRQ,W LVWLPHWRLQYHVWLJDWHDQHZPRGHORIFRPSUHKHQVLYHFDQFHUUHKDELOLWDWLRQWKDWSURPRWHVHIILFLHQW DQGHIIHFWLYHFDUH$VLJQLILFDQWEDUULHUWKDWFRQWULEXWHVWRSDWLHQWVQRWEHLQJWULDJHG DSSURSULDWHO\IRUUHKDELOLWDWLRQPHGLFLQHVHUYLFHVLVDODFNRIXQGHUVWDQGLQJDERXWDQGRU LPSOHPHQWDWLRQRIVFUHHQLQJTXHVWLRQVWRROVDQGSURFHGXUHVWKDWKHOSWRLGHQWLI\SK\VLFDO LPSDLUPHQWVLQVXUYLYRUV7KHH[SHFWDWLRQFDQQRWEHSODFHGDWWKHIHHWRIRWKHUKHDOWKFDUH SURYLGHUVWRWDNHRQWKHGRPDLQLQZKLFKWKHSK\VLFDOWKHUDSLVWLVVSHFLDOL]HG2WKHUKHDOWKFDUH SURYLGHUVPD\RUPD\QRWEHIDPLOLDUZLWKWKHSHQGLQJQHHGVRUSRWHQWLDOVHYHULW\RIWKH SUHVHQWLQJLPSDLUPHQW7KHRQFRORJLFFOLQLFDOVSHFLDOLVWFDQUHFRJQL]HDQGPDQDJHWKLVQHHG PRUHHIIHFWLYHO\ 1RWRQO\GRHVWKLVHYLGHQFHVSHDNWRXQPHWSDWLHQWQHHGVLWKLJKOLJKWVWKHLPSRUWDQFHRI WKHUROHWKHSK\VLFDOWKHUDSLVWZKRLVDQRQFRORJLFVSHFLDOLVWFDQSOD\LQLPSURYLQJWKH HIIHFWLYHQHVVRIFDUH2WKHUKHDOWKFDUHSURYLGHUVDUHQRWHGXFDWHGLQLPSDLUPHQWLGHQWLILFDWLRQ 3K\VLFDOWKHUDSLVWVDUHH[SHUWVLQPRYHPHQWG\VIXQFWLRQDQGKDYHHYLGHQFHEDVHGWRROVDQG LQWHUYHQWLRQVWRDPHOLRUDWHRUPLWLJDWHPDQ\RIWKHDIRUHPHQWLRQHGLVVXHV2WKHUKHDOWKFDUH SURYLGHUVDUHQRWHGXFDWHGWRWUHDWSK\VLFDOLPSDLUPHQWVDQGWKHLUVFRSHRISUDFWLFHLVOLPLWHGWR SURYLGLQJJHQHUDORIWHQEURDGUHFRPPHQGDWLRQVWRZDUGVDFWLYLW\DQGH[HUFLVHDQGIUHTXHQWO\ 8 WKHUHLVQRWUHFRJQLWLRQRIWKHQHHGIRUWKHUDSHXWLFLQWHUYHQWLRQV6DIHW\LVDVLJQLILFDQW FRQFHUQLQWKLVPHGLFDOO\FRPSOH[SRSXODWLRQDQGODFNRIDSSURSULDWHVFUHHQLQJRUWUHDWPHQW PD\UHVXOWLQIXUWKHULQMXU\RURWKHUPHGLFDOFRPSOLFDWLRQV 5HIHUHQFHV +HZLWW0*DQ]3(GV)URP&DQFHU3DWLHQWWR&DQFHU6XUYLYRU±/RVWLQ7UDQVLWLRQ ,QVWLWXWHRI0HGLFLQH /HYDQJLH3.6DQWDVLHU$06WRXW1/3IDO]HU/$TXDOLWDWLYHDVVHVVPHQWRIXSSHU TXDUWHUG\VIXQFWLRQUHSRUWHGE\SK\VLFDOWKHUDSLVWVWUHDWHGIRUEUHDVWFDQFHURUWUHDWLQJEUHDVW FDQFHUVHTXHODHSupport Care Cancer$YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV $OIDQR&0*DQ]3$5RZODQG-++DKQ((&DQFHUVXUYLYRUVKLSDQGFDQFHU UHKDELOLWDWLRQUHYLWDOL]LQJWKHOLQNJ Clin Oncol$YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV 6LOYHU-.6WUDWHJLHVWRRYHUFRPHFDQFHUVXUYLYRUVKLSFDUHEDUULHUVPM R $YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV 'LFLFFR%ORRP%&XQQLQJKDP567KHH[SHULHQFHRILQIRUPDWLRQVKDULQJDPRQJ SULPDU\FDUHFOLQLFLDQVZLWKFDQFHUVXUYLYRUVDQGWKHLURQFRORJLVWVJ Cancer Surviv $YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV 6LOYHU-.%DLPD-0D\HU56,PSDLUPHQWGULYHQFDQFHUUHKDELOLWDWLRQ$QHVVHQWLDO FRPSRQHQWRITXDOLW\FDUHDQGVXUYLYRUVKLSCA Cancer J Clin$YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV 6WRXW1/([HUFLVHIRUWKHFDQFHUVXUYLYRUDOOIRURQHEXWQRWRQHIRUDOOJ Support Oncol$YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV &RXVLQV10DF$XOD\)/DQJ+0DF*LOOLYUD\6:HOOV0$V\VWHPDWLFUHYLHZRI LQWHUYHQWLRQVIRUHDWLQJDQGGULQNLQJSUREOHPVIROORZLQJWUHDWPHQWIRUKHDGDQGQHFNFDQFHU VXJJHVWVDQHHGWRORRNEH\RQGVZDOORZLQJDQGWULVPXVOral Oncol $YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV &ULVWLDQ$7UDQ$3DWHO.3DWLHQWVDIHW\LQFDQFHUUHKDELOLWDWLRQPhys Med Rehabil Clin N Am$YDLODEOHIURP KWWSZZZQFELQOPQLKJRYHQWUH]TXHU\IFJL"FPG 5HWULHYHGE 3XE0HGGRSW &LWDWLRQOLVWBXL GV 9 Criterion #1umbeU7LPH ABPTS REVIEW: 3.1 Include a documented estimate of the number of physical therapists currently practicing in the proposed specialty area. Identify the types of practice settings for these physical therapists. Decision: Did Not Adequately Meet Requirement It was unclear, based on data provided, how the estimated number of PTs was determined. Please provide the number of respondents and the details of the survey used to establish the documented numbers. Questions were also raised as to whether or not simply surveying oncology section members adequately addresses this criterion. The petitioner may want to consider expanding the survey group. 3.3 Estimate the number of physical therapists who would likely seek board certification in the proposed specialty area during the first five years board certification would be available. Provide supporting documentation. Decision: Did Not Adequately Meet Requirement Before granting approval for this criterion, the board asks for clarification on the data provided. Please provide better linkage of numbers and % of noted survey respondents within this section to the survey conducted (Appendix VIII). Does 71% represent respondents who completed all or a portion of the survey? It was noted as well that only an approximate number of individuals was noted when stipulating 71%. An exact number should be available for inclusion. It was also unclear how the referenced 10% figure within this section was derived and request that this be clarified. Due to the lack of more definitive data, it was difficult for the board to see how the final estimate of 372 was determined. Finally, it was unclear why the final paragraph within this section was included as it focuses solely on the development of residency or fellowship programs. Is it believed this in some way will impact the number of individuals who will sit for the specialist certification examination within the first five years? If so, please clarify. REVISED SECTIONS Thank you for the opportunity to clarify this information. In our response we will explain how we determined our original estimate, and we will present a new estimate based on different data. No direct population data exist to describe how many physical therapists practice in the specialty area of oncology. In every response where we faced this situation we have used standard epidemiological method where we have estimated the size of the group in question by interpolating from robust existing related data. In our original petition, the robust source of data that we used to estimate number of therapists practicing in oncology was the American Physical Therapy Association (APTA) 2011 Membership 1 Development Plan. That document gave us the national rate of physical therapist membership in the APTA, which was 30%.1 To estimate a number of therapists practicing in the specialty area we first made two assumptions: 1) members of the Section on Oncology practice in the specialty area, and 2) the rate of oncologic physical therapist membership in the Section on Oncology would parallel the rate of general physical therapist membership in the APTA. At the time there were more than 1000 members of the Section on Oncology (there are now more than 1100) and our estimate was predicted using the formula (n = 1000 current members/0.30) which gave us the figure of “at least 3300.” (The actual calculated value is 3333.33.) For this response we have chosen to estimate the number of physical therapists practicing in oncology using a different robust data set because it more directly estimates area of clinical practice than Section membership would. The APTA document “A Model to Project the Supply and Demand of Physical Therapists 2010-2020”2 utilized data from the Federation of State Boards of Physical Therapy to estimate the current number of physical therapists at 182,000. We postulate that the physical therapist self-classification of primary clinical focus at the time of APTA membership renewal is an appropriate proxy to capture physical therapists working in the specialty area of oncology. APTA membership as reported in this document was 59,552, and of those members 2065 (3.5%) indicated that their area of primary clinical focus was oncology. Using the rate of 3.5% we can estimate using (n = 0.035 X 182,000) that there are 6370 physical therapists practicing in the specialty area of oncology including both APTA members and individuals who are not members of APTA. Our practice survey sampled individuals who were both members and non-members of the Section on Oncology, and the list of practice settings generated is comprehensive as judged by members of the Specialization Task Force based on their considerable experience in the field. That information is pasted below for the sake of completeness. 2 Respondents to the survey were individuals who practice in oncology and included members of the Section on Oncology (80%), APTA members who were not members of the Section on Oncology (7%) and non-members of APTA (13%). Details about the process of the survey, response rate, and demographics may be found in Appendix VIII. The majority of respondents (39%) practice in an outpatient hospital based clinic, followed by 18% in free-standing outpatient clinics and 17% in acute care hospitals. This compares to overall APTA membership distribution of 18% hospital based outpatient clinics, 40% free-standing outpatient clinics, and 11% acute care. Additional work settings in rank order included; academic institutions, other settings, research centers, home health, hospice, and long term care/skilled nursing facilities. The reported responses of “other settings” included; radiation therapy clinics, free standing cancer center and private consulting. 3.3 Estimate the number of physical therapists who would likely seek board certification in the proposed specialty area during the first five years board certification would be available. Provide supporting documentation. Thank you for the opportunity to clarify this information. We acknowledge with considerable embarrassment that there appears to be an error in our calculations for this section that was not caught by the 35 people who reviewed this document before submission. Our practice survey raw data includes the number of individuals that responded to each question as well as the number of people who returned the whole survey (n=368). Given that appropriate handling of survey research under human subjects guidelines requires that respondents be told they are free to skip any question, a variable number of people responded to each question. While there was indeed a group of people who seem to have not finished all questions on the survey because of a page turning error, that did not affect 3 Respondents to the survey were individuals who practice in oncology and included members of the Section on Oncology (80%), APTA members who were not members of the Section on Oncology (7%) and non-members of APTA (13%). Details about the process of the survey, response rate, and demographics may be found in Appendix VIII. The majority of respondents (39%) practice in an outpatient hospital based clinic, followed by 18% in free-standing outpatient clinics and 17% in acute care hospitals. This compares to overall APTA membership distribution of 18% hospital based outpatient clinics, 40% free-standing outpatient clinics, and 11% acute care. Additional work settings in rank order included; academic institutions, other settings, research centers, home health, hospice, and long term care/skilled nursing facilities. The reported responses of “other settings” included; radiation therapy clinics, free standing cancer center and private consulting. 3.3 Estimate the number of physical therapists who would likely seek board certification in the proposed specialty area during the first five years board certification would be available. Provide supporting documentation. Thank you for the opportunity to clarify this information. We acknowledge with considerable embarrassment that there appears to be an error in our calculations for this section that was not caught by the 35 people who reviewed this document before submission. Our practice survey raw data includes the number of individuals that responded to each question as well as the number of people who returned the whole survey (n=368). Given that appropriate handling of survey research under human subjects guidelines requires that respondents be told they are free to skip any question, a variable number of people responded to each question. While there was indeed a group of people who seem to have not finished all questions on the survey because of a page turning error, that did not affect 3 responses to the question about interest in sitting for the specialist certification exam since 363 people answered this question. It is possible that the 73% figure reported in the original petition came from a calculation that was based on preliminary survey data when we first started drafting this document, nearly a year before submission and the calculation was inadvertently not updated. We present corrected data below, and after that we present some new data from survey updates conducted in August 2013. The raw data for this question on our original practice survey were as follows: 23. The Oncology Section and the American Board of Physical Therapy Specialties are working together to develop this practice analysis in order to offer a board certification exam in Oncology. There is a detailed application process and the cost of the application and exam is currently $1200. The certification exam is administered through the National Board of Medical Examiners. Certification is good for ten years. When this board certification process is available, do you plan to take the exam? 1. Yes, definitely 111 31% 2. Yes, but not for a few years 110 30% 3. Probably not 110 30% 4. No 32 9% Total 363 100% Thus, 221 people (61% of survey respondents) indicated that they planned to take the Oncologic Specialist exam. We suggested that new therapists entering the field would increase this number by approximately 10% (22 individuals) per year because membership in the Section on Oncology has increased by approximately that much annually for the last several years. So, using that assumption and our original survey data we believe it is reasonable to predict that a core of 221 people would be interested in taking the exam and that each year after the first, for the remaining four years we could assume 22 new therapists would emerge who would choose to take the exam, for a total of 221 + 88 people, or 309 people. After receiving feedback on our petition we performed two quick surveys to attempt to update the information presented in the initial petition. One survey, sent to all Section on Oncology members, 4 asked the question “If and when Board Certification in Oncology Physical Therapy becomes a reality, would you consider seeking specialty certification?” Because of the tight turnaround time necessary to submit this response to ABPTS, this survey was sent to the section membership electronically and available to them only for about 10 days. In that period of time we received 187 responses (so approximately 17% of the section membership) and 185 people responded to this question. Of the 185 responders, 156 people (84.3%) responded yes. One possible explanation of the higher rate of specialty interest apparent in this most recent survey is growing interest in specialty certification of all types that is apparent among newer physical therapists. The two different surveys demonstrated a specialization interest rate ranging from 61% to 84%. If we apply this interest rate to the calculated number of physical therapists practicing in oncology (6370) it is potentially the case that the number of interested physical therapists would be much higher. In addition we did a social media survey using Facebook where we invited physical therapists who were NOT members of the Section on Oncology. That survey was available for only 6 days and it received 128 responses who reported working primarily in the following settings: 10% Academic institutions 18% Acute care 7% Acute rehabilitation 3% Subacute rehabilitation 34% Hospital based outpatient clinics 23% Free standing outpatient clinics 5% Home health 5 In this social media survey, 93% of respondents answered yes to the question “Would having a certified specialist in oncology either on your staff or available to consult to your staff enhance your practice?” We also asked these respondents who were not members of the Section on Oncology whether they would be interested in pursuing a specialty in Oncologic Physical Therapy, and 75 people (60% of respondents) said they would be interested. This group of interested individuals can be assumed to be a different group of people than those who responded to the Description of Practice. To briefly comment on the relationship between the availability residency training and number of individuals interested in pursuing specialty certification, we do believe that when there is formal comprehensive training available to prepare individuals for the specialty, numbers of therapists interested in pursuing specialist certification will increase. This is primarily because it is daunting to attempt to uptrain to work in oncology practice currently because each individual must construct a learning plan from among a potpourri of continuing education courses with no curricular guide. We believe that when there is such a guide (which will come in the form of the DSP more than simply residencies) the process of becoming an oncologic specialist will be clearer and more individuals will wish to pursue it. 1. APTA Membership Development Plan: 2011. In: Association APT, ed., 2011. 2. A Model to Project the Supply and Demand of Physical Therapists 2010-2020: American Physical Therapy Association, 2012. 6 ABPTS Feedback: 4.1 Describe in detail the specialized knowledge in physical therapy practice required for the proposed specialty area. Decision: Did#4: Not Specialized Adequately Meet Requirement Criterion The summary table Knowledge provided did not sufficiently address this criterion and did not “describe in detail” the specialized knowledge as required by this criterion. Additional detail should be provided to further clarify the broad topics included by including more descriptive summaries for each area (see section 5.2 as an appropriate example). REVISED SECTION: Section 4.1 Describe in detail the specialized knowledge of physical therapist practice required for the proposed specialty area. The Oncology Practice Survey assessed the domain of knowledge over 103 separate criteria (derived from the earlier pilot survey) asking about the importance of each area of knowledge to the oncology specialist on a scale of 0-4. Respondents ranked 57 of these knowledge areas 3.5/4.0. Approximately 30% of these knowledge factors were specific to cancer as a disease process and its specific treatments. The specialist recognizes the importance of understanding this unique disease process and its impact on body system and function. We have detailed the specialized knowledge of the oncologic clinical specialist based on the practice survey in the table below using the format of the patient/client management model. 1 Unique to the knowledge of the oncologic clinical specialist: History and System review: Unique knowledge related to cancer and its treatment need to be ascertained by the physical therapist who is an oncology specialist. While the knowledge of the therapist in patient interviewing is standard, the interviewing and processing of cancer related information impacts the knowledge needs of the therapist to effectively and efficiently the history and physical exam. 1. Foundational Sciences Cancer Biology a) b) Cancer Pathophysiology c) Cellular biology (eg. changes associated with cancer treatment and cancer disease) d) Neurophysiology (eg. Etiology of chemotherapy, muscle weakness, balance deficits) e) Radiation physics 2. Clinical Sciences a) Physiological and anatomic status (eg. Cardiovascular/pulmonary, integumentary, musculoskeletal and neuromuscular systems) with consideration for the cancer disease process, side effects of cancer treatment and possible recurrent disease Pharmacology b) c) Kinesology d) Pathokinesiology e) Taxonomy of cancer rehabilitation principles (e.g.preventive, restorative, supportive, palliative) (ref Dietz here) f) Cancer tumor staging g) Tumor Pathology h) Genetics and genomics (oncologic specific) i) Cancer control science and epidemiology (eg. prevention, screening and risk factor identification) j) Surgical oncology (including reconstructive surgeries) k) Medical oncology (including chemotherapeutic toxicities, hormonal agents, biological agents and targeted agents) l) Radiation oncology m) Laboratory tests n) Diagnostic imaging 3. Behavioral Sciences a) Developmental psychology (e.g., body image) b) Social psychology (e.g., depression, loss, survivorship, end of life issues) c) Communication theory (e.g., methods of communication and nonverbal language related to loss, grief, and end of life) d) Sexuality and cancer e) Policy issues in cancer 2 Examination: Tests and Measures: Many of the tests and measures commonly used in physical therapist practice are also used in the oncology population. It is unique to the function of the oncology specialist to synthesize information pertinent to the cancer diagnosis and treatment and appropriately choose tests and measures and apply them. Knowledge to select and prioritize tests and measures based on history, systems review, scientific merit, clinical utility and physiologic or fiscal cost to the individual relative to criticality of data. Effects of other cancer-related medical and pharmacological interventions on aerobic capacity/endurance measures (eg. Cardiotoxicity related to chemotherapy, pulmonary radiation fibrosis, cancer-related fatigue, myelosupression, cachexia, etc) Effects of cancer-related medical and pharmacological interventions on attention, arousal and cognition measures (eg. Chemotherapy-related cognitive changes, whole brain radiation, paraneoplastic disorders, metastatic disease to the brain) cancer-related medical and pharmacological interventions on 3 Evaluation: Critical to the function of the oncology specialist is the ability to appropriately evaluate changes in the patients status based on disease treatment. Cancer and its treatment are inherently dynamic and the specialist must be nimble in recognizing changes based on the disease and treatment trajectory and in making changes. Further, the specialist in oncology should have the knowledge to anticipate changes that are likely to occur with use of different cancer mitigating modalities. The ability to proactively identify these potential impairments and anticipate changes is unique to the function of the oncology specialist. Interpretation of data from examination (eg. Identify relevant, consistent, accurate data; prioritize impairments; assess patient’s needs, motivations and goals) with consideration for the cancer disease process, disease treatment side effects and late effects and for recurrent disease. Signs and symptoms that indicate referral to a physician or another health care provider is appropriate, based on specialized knowledge of the oncologic physical therapist and with recognition of oncologic emergencies. 4 Diagnosis: The oncology specialist functions differently from other therapists in their ability to determine the PT diagnosis and recognize the underlying components of cancer treatment that may lead to this diagnosis. This is of paramount importance when developing a plan of care. With unique knowledge of cancer and its treatments, the therapist functions at an advance level in their differential diagnosis skills and their ability to identify underlying aspects that may impact the plan of care. x Physical Therapy Prognosis The oncology specialist utilizes all available information regarding the known treatment side effects and late effects as well as their expert knowledge of the disease trajectory to prognosticate accurately. x x x x x x 5 Client, Caregiver and patient instruction: Perhaps one of the most important functions of the oncology specialist is their ability to translate their expert knowledge of the oncologic disease and treatment process to the patient and their care giver. No other physical therapist nor physical therapy specialty provider (nor often other medical provider) can coalesce the information related to function, impairment, physical, physiological and psychosocial needs related to cancer and it’s treatment to provide the patient with comprehensive education and instruction about their unique physical mobility needs. Use of assistive or adaptive devices based on the continuum of cancer care (eg. Limb salvage, skin integrity following radiation therapy, neurotoxicities, lymphedema) 6 ABPTS REVIEW: 4.4 Discuss in detail how this advanced knowledge differs from the knowledge base required for those specialty areas already recognized by ABPTS. Decision: Did Not Adequately Meet Requirement Sufficient detail was not provided for this section of the petition. While the petitioner made a brief reference to how the advanced knowledge for the oncologic specialty area differed from the women’s health specialty area, it is requested that the petitioner also detail the distinct differences between the advanced knowledge required of an oncologic specialist and the knowledge base required for pediatric, geriatric, cardiopulmonary, and orthopaedic specialists. Revised section: The concepts revealed in the Oncology Practice Survey data separate the oncology specialist from other ABPTS specialists as evidenced by the heavy emphasis on the aspects of cancer care. The vital importance of recognizing effects of cancer treatment, adverse effects of treatment and their implications on the physical therapy knowledge is well represented. The disease of cancer and its treatment interplay with body systems and function differently than any other disease process that physical therapy professionals experience in their clinical practice settings. Oncology specialists recognize the importance of this advanced knowledge and manage their clients based on this advanced knowledge. Due to the systemic nature of the disease process and cancer therapies, the impairments related to cancer treatment rarely are based in one body system. They tend to aggregate among systems simultaneously, and risk for impairments due to late effects of cancer persists for a lifetime. These knowledge criteria demonstrate the need for the specialist to recognize the importance of all systems and their interplay with one another as well as the disease process and disease treatment modalities. We acknowledge that core competency in foundational, behavioral, and clinical sciences exist 1 across all specialties, such as anatomy and physiology, kinesiology, psychology, clinical decision analysis, and clinical inquiry strategies. Although other clinical specialists may have cancer related knowledge, the knowledge is conceptualized differently and the breadth of knowledge is focused on a particular patient population or setting. Other areas of specialty practice such as Women’s Health may indeed focus on specific oncologic diagnoses (e.g., breast cancer) specific to a population; the oncology specialist focuses on the oncologic population as a whole and the impairments that are elicited by the disease and its treatment across all types of patient populations. To clarify distinct differences between advanced knowledge of oncology specialists and the knowledge base of specialists in orthopedics, pediatrics, geriatrics, cardiopulmonary and women’s health we created the table below that briefly outlines knowledge areas from the Cardiopulmonary, Neurologic, Pediatric, Orthopedic, and Women’s Health DSPs that may imply a knowledge base greater than a general practitioner related to cancer care. However, the description does not represent the extensive knowledge that an oncologic clinical specialist would need to deliver an advanced level of care; for an in-depth review of these DSPs beyond the review of knowledge in this section, see the DSP review in the table in section 5.4. We searched the journals of various Sections for the past three years with the keywords “cancer” and “oncology” to identify cancer-specific publications. The search yield very few results such as one article in Orthoapedic Physical Therapy Practice 2012;24(1):8-11 resulting from a search of the past 3 years, entitled, “Conservative Management of a Postsurgical Patient with Chordoma and Back Pain” by Mary Calderan. We conducted a similar search of CSM program over the past 3 years. Interestingly, the majority of cancer-specific programming was delivered 2 through collaboration with the Oncology Section. The recognition of Oncology Section as “content expert”, few journal populations, and minimal recognition of cancer-specific knowledge and functions in the DSPs of other specialties further support that the advanced knowledge of a oncologic clinic specialist will differ from the knowledge base required by current ABPTS specialty areas. Section/ Specialization Cardiovascular and Pulmonary Description of Specialty Practice Neurology Epidemiology and public health (prevention) knowledge identified in clinical sciences Interpretation of special tests, system based evaluations for geriatric patients, epidemiology of chronic disease Not available Orthopedics Not available Geriatrics Cancer related Section publications over the last 3 years None None Cancer-specific CSM programming over the last 3 years CSM 2011: none CSM 2012: Inflammation, Atherosclerosis, Neurodegeneration, and Cancer CSM 2013: none CSM 2011: none CSM 2012: none CSM 2013: none none CSM 2011: none CSM 2012: none CSM 2013: Balance Screenings for Cancer Survivors (joint programming with Oncology Section); Impairments Associated with Pediatric Brain Tumors (joint programming with Oncology and Pediatrics Sections) 2012: 1 publication CSM 2011: none CSM 2012: Managing Low Back Pain in a Direct Access Setting CSM 2013: An Evidenced-based Approach to Strength Training in Breast Cancer Survivors (joint 3 Pediatrics Public health and epidemiology Women’s Health Not available 2011: 2 publications 2011: 1 publication programming with Oncology Section) CSM 2011: none CSM 2012: none CSM 2013: Physical Therapy Across the Continuum of Care in Pediatric Oncology (joint program with Oncology Section) CSM 2011: none CSM 2012: none CSM 2013: The Complicated Patient; A Prospective Surveillance Model for Rehabilitation for Women With Breast Cancer (joint program with Oncology Section); Physical Therapy Considerations for the Patient Post Prostatectomy (joint program with Oncology Section) In addition to the data above to clarify distinct differences between advanced knowledge of oncology specialists and the knowledge base of specialists in orthopedics, pediatrics, geriatrics, cardiopulmonary and women’s health; we reviewed the examination content outline for each of the specialties and communicated with individuals who hold relevant specialty certification but who currently spend a significant portion of their current working time within the context of oncology. While the committee did not ask us about the neurologic specialty area, we have chosen to comment on it because it could be argued that some cancers affect the neurologic system and therefore could be handled by neurologic specialists. CARDIOPULMONARY 4 The cardiopulmonary specialty examination content outline includes very detailed lists of medical conditions, categorized as “seen frequently, seen occasionally,” and “seen rarely” based on their practice survey. There is only one mention of cancer in the pulmonary conditions that are seen frequently, and that is “carcinoma in situ of the lung or bronchus.” Conditions that are reported to be seen occasionally include “malignant neoplasm of the trachea, bronchus, lung, and pleura,“ and in the “seen rarely” category is found “graph[sic] versus host disease.” It is not surprising that therapists who do not focus on oncology see graft versus host disease only rarely since it is a rare condition with less than 200,000 cases seen annually in the United States* Therapists who specialize in oncology, however, see this condition commonly because patients undergoing Bone Marrow Transplant and organ transplants require highly specialized care and are cared for in highly specialized settings such as major cancer centers. Furthermore, it is important that therapists specializing in cancer have the experience of seeing this and other types of complication of cancer treatment during their careers, because that experience helps them better recognize the symptoms of these complications when they appear during the course of patient rehabilitation and as early or late effects of treatment. The implications of the early symptoms of this very serious complication (such as itchy rash) would very likely be missed by a generalist or a therapist with advanced training in a different specialty area, leading to delay of care. It is telling that there appears to be confusion about terminology with several errors in terminology appearing in the cardiopulmonary examination outline, revealing a clear difference in knowledge base about oncologic concepts and cancer as compared with oncologic * 1. http://www.rightdiagnosis.com/g/graft_versus_host_disease/prevalence.htm). 5 specialists. Knowledge and use of standard terminology by which knowledgeable practitioners in cancer care describe location and severity of disease (TNM staging) would have prevented a couple of these errors described below. The addition of certified specialists to physical therapy practice will provide a much needed resource to consult with generalists and other specialist about such matters, just as the availability of other specialists provides a critical resource to oncology specialists for consultation in their areas of most strength. These errors in the outline include: x The condition “graft versus host disease” is misspelled. In the cardiopulmonary document the condition is listed as “graph versus host disease.” x The practice survey apparently listed “carcinoma in situ” of the lung, and the majority of survey respondents stated that they commonly work with “carcinoma in situ” of the lung, not recognizing that in fact no one commonly works with carcinoma in situ of the lung. Carcinoma in situ of the lung is Stage 0 lung cancer. Stage 0 lung cancer is rarely diagnosed since it is asymptomatic and there are no screening tests available to reveal lung cancer at that stage. When it is diagnosed at all it is usually an incidental finding that is discovered in the process of testing for something else. Patients with Stage 0 lung cancer are not commonly (knowingly) seen by any physical therapist including physical therapists who currently specialize in oncology, indeed carcinoma in situ of the lung is not even commonly seen by oncologists much as they would like to have the opportunity to treat lung cancer at that stage because of the absence of effective screening procedures. That is a key reason why the overall survival rate of lung cancer 6 at all stages in 2006 through 2010 was 16.6%. The prognosis for survival of lung cancer is typically grim precisely because we have no means of early diagnosis. x The survey respondents indicated that they occasionally see patients with “malignant neoplasm” of the bronchus, trachea, lung, larynx, or pleura, apparently seeing that term as mutually exclusive of the term “carcinoma in situ.” The term “malignant” appears to have been used here as a synonym of the word “metastatic.” The two words are not synonyms. “Malignant” means that the tumor cells have the capacity to metastasize, that is, when the cells divide, they have the capacity to invade neighboring tissues and organs. “Cancer” is by definition “malignant neoplasm,” all cancers, regardless of stage, are “malignant neoplasms.” The term is relatively general and is not used to describe stage among professionals in cancer. Oncologic specialists would define the presence of metastasis and the extent of it by using the standard staging system that is the universally agreed upon language for describing cancer. Anne Swisher PT, PhD, CCS, current Editor of the cardiopulmonary journal; has published articles both on cardiopulmonary topics and on oncologic topics. She describes herself as a “person with a CCS who has been practicing in oncology for 10 years.” Asked about the distinction between oncologic specialists and cardiopulmonary specialists, Dr. Swisher gave the following well-articulated response which includes but is not limited to comments about cardiopulmonary specialists: “A patient with cancer can, and often will, have many manifestations of the disease and/or its treatment that are familiar to physical therapists practicing outside of oncology. However, without the specialized knowledge of cancer and its very complex treatment regimens, those physical therapists are not prepared to fully diagnose 7 and manage the issues. For example, a patient may develop adhesive capsulitis following breast cancer surgery and radiation therapy, however, the orthopedic physical therapist would not understand the influence of radiation on blood flow and bone density in the region, which impacts both the course of the condition and the options for treatment (e.g. avoiding grade IV mobilization, extra precautions for thermal modalities, skin changes that may limit ultimate gains in flexibility), nor the influence of aromatase inhibitor-associated arthralgia as a differential diagnosis for shoulder pain. A neurological physical therapist might recognize impaired balance due to chemotherapy-induced peripheral neuropathy, but not understand that the use of taxane chemotherapy agents also impair cognition and ability to remember safety precautions for a home balance training program. The cardiovascular and pulmonary physical therapist might recognize that cancer-related fatigue should be treated with moderateintensity aerobic exercise, but not be aware that anthracycline chemotherapy regimens can cause cardiac dysrhythmias with exercise or that other agents may cause impairments in cardiac or pulmonary function. Similarly, pediatric or geriatric physical therapists might recognize developmental delay or impaired sensory modalities and their effects on these age groups, but not have an understanding of how cancer and its treatment would impact diagnosis, prognosis and intervention planning across the lifespan. These are just illustrations of situations where a “simple PT problem” like impaired aerobic capacity, joint limitations, impaired posture or impaired balance are quite complicated to diagnose and manage without a thorough understanding of the pathophysiology of cancer (literally hundreds of specific diseases) and treatments (surgery, chemotherapy, radiation therapy, bone marrow transplant, biological agents, etc, etc) and their effects on mobility. Thus, the oncology specialist physical 8 therapist must be able to manage not only impairments in the neurological, musculoskeletal, cardiovascular/pulmonary and integumentary systems, but must have a unique understanding of how cancer and its treatments (thousands of options, individualized to the patient) impact movement and function.” GERIATRICS The geriatric examination content outline includes a relatively detailed list of conditions and diagnoses that are covered on the exam. This list reveals considerable overlap with other specialties including orthopedics, cardiopulmonary, and neurology. What distinguishes the geriatric specialist from these other overlapping specialties is the level of expertise and focus on the geriatric population. This distinction is a deep and nuanced understanding of the context in which the patient presents plus the focus on that context and population that gives the clinician the ability to anticipate risk for newly developing pathologies and the direction of change in patient function as changes occur. This is analogous to what distinguishes oncology from other specialty practice areas including geriatrics. Cancer is an age related condition. Surveillance, Epidemiology and End Results (SEER) data demonstrate that the median age of diagnosis for all cancers combined from 2006 to 2010 was age 66 years.1 Risk of developing cancer in numerous sites including bladder, breast, lung, kidney, prostate, pancreas, colon, and others increases with advancing age. Yet, despite the importance of cancer in the geriatric population, neither the geriatric examination content outline nor the geriatric DSP demonstrate placing the importance of cancer in the practice area necessary to take to manage a cancer survivor. The geriatric examination content outline mentions the word “cancer” one time, under the category “medical conditions, other.” The 9 position of this mention under the category “other” reveals the level of focus on cancer in the geriatric specialty. The geriatric DSP demonstrates focus on content such as osteoporosis, diabetes, fall prevention, and cardiopulmonary conditions in the elderly both in examples given in the content outline and in their choice of case scenarios presented. Beyond vague general phrases such as “epidemiology of chronic disease” the DSP mentions cancer only once in the phrase “Considering the prognostic impact of other medical interventions (e.g., implanted devices, pumps, radiation therapy, chemotherapy” as an example under “Practice Expectations.” In the same section there is a mention of end of life care without specific reference to cancer: “Considers quality of life in regard to end-of-life wishes, transitions, and advanced directives (eg, quality of life scales…” While this lack of focus on cancer may initially seem surprising, it is less so in view of the fact that the content of the practice survey leading to the Geriatric DSP was “based on the Guide to Physical Therapist Practice” which also had no mention of cancer. A communication from Jennifer Blackwood PT, PhD, GCS, Assistant Professor, Coordinator of the Geriatric Post Professional Physical Therapy Certificate & Residency Program, Physical Therapy Department, University of Michigan-Flint addresses this issue: “I have considered your question regarding the amount of information regarding cancer and other oncological related diagnoses described to be covered in the Description of Specialty Practice (DSP) in Geriatrics. After a thorough review of the DSP in Geriatrics (2009 edition), a very limited amount of information exists specifically addressing the age related changes in the older adult in those who have had a cancer diagnoses. Specifically, on page 21 of the DSP, cancer is listed as a medical condition covered in the ‘Other’ category aligned with both frailty and autoimmune disorders. The DSP for geriatric specialization tends to focus and categorize 10 subject matter based on a three systems approach grounded in foundational sciences, clinical sciences and behavior sciences with advanced age. Given the complexity of age related changes as well as how these might be exacerbated by either the pathogenesis of cancer or the treatments provided as a result of the disease process, it benefits the physical therapists who treat older adults with cancer to have available an area of specialty practice that takes into consideration the complexity of both of these areas of advanced practice. For example, the risk of falling in the older adult increases with age and more so in those with cognitive impairment. However, for the older adult with a history of chemotherapy induced peripheral neuropathy, the risk is increased further, which also may be exacerbated by the cardiovascular changes that may have occurred from various chemotherapy agents which can increase their risk of falling through orthostatic hypotension. I believe that the DSP in Geriatrics does a fine job in covering the three areas of science listed above for the older adult, however there is quite a limitation in how oncological diagnoses are addressed in this population. Therefore, in order to best serve the older adult with a history or current cancer diagnosis, I believe they would be best served through acquiring services from a physical therapist with an oncology specialization.” Mary Bessette, PT, GCS is a highly experienced therapist who has taken a special interest in cancer related fatigue and taken initiative to learn everything she can about that to use in her practice, which emphasizes home health care in the context of military veterans. She said the following when interviewed: “Becoming a geriatric specialist did not prepare me for oncology at all. The things that come to mind for me include the psychological issues which are huge for that population. All of the information about targeted cancer therapy and the human 11 genome information is very important and goes well beyond the focus of the geriatric specialty. Understanding metastases and even pain control for the person with cancer goes beyond what is typically included in the geriatric specialty. We absolutely need oncologic specialists. We need to be able to collaborate with one another to solve these very complex problems. “ This review stands as evidence for the need of genuine specialists in oncologic physical therapy to help develop the necessary knowledge and awareness of cancer among all physical therapists including geriatric physical therapists. NEUROLOGIC Physical Therapists The neurological DSP emphasizes degenerative and traumatic conditions affecting the nervous system. Oncologic diagnoses are only generally mentioned and used to elucidate neurological system impairment rather than being the primary content focus. Additionally an analysis of practice in 2008 noted that advanced neurological therapists have minimal exposure to oncological diagnoses (brain tumors are approximately 4% of total caseloads.2 Earllaine Croarkin, PT, NCS has worked predominantly for the National Institutes of Health since 1996. Earllaine said made the following remarks when interviewed: “Having seen numerous neuro and oncological cases, I can attest that these two fields (neurology and oncology) are unique and deserve their respective acknowledgement of advanced practice. I believe there is little overlap in knowledge, skills and abilities among those who practice advanced neurological and oncological physical therapy. And given the disease- based framework that the study of oncological physical therapy lends itself to and the inherently different subject matter, I believe there is sound reasoning to pursue the oncological specialization.” 12 ORTHOPEDICS The orthopedic specialty examination content outline makes no mention of any concept specific to oncology whatsoever. Commonalities between the orthopedic examination outline and the outline of knowledge specific to oncology presented in the oncology Description of Practice (DSP) are limited to foundational categories such as knowledge of anatomy and history taking, which are categories that appear in and are common to every specialty content outline since they are basic to the practice of physical therapy regardless of focus area. Indeed those are categories that also appear in the CAPTE criteria for education of the entry-level physical therapist. While the specialist in orthopedics is has advanced training and competency in the management of many of the individual impairments that affect cancer survivors, there is nothing in the preparation of a specialist in orthopedics that gives that individual advanced competency in managing patients comprehensively within the context of cancer. Advanced practice management of the patient with cancer requires more than simply understanding management of each potential impairment in a general population. The specialist in oncology must be cognizant of the enormous and constantly changing literature related to new developments in cancer management in order to be able to manage the various impairments with a sophisticated and nuanced understanding of the impact of the medical, surgical, and radiologic treatments that the patient undergoes on those impairments and the safety and potential effectiveness of PT interventions. Patients in this population deserve to be managed by specialists who, due to extensive experience in working with this specific population and ongoing focus on this population, have a deep understanding of the social, spiritual, emotional, and functional needs of persons who experience cancer throughout the lifespan. The oncologic 13 specialist physical therapist is distinguished from the orthopedic specialist physical therapist in terms of the frequency with which they deal with the cancer population, the importance of cancer related concepts to their practice, and the sophisticated level of judgment that they bring to the process of preventing cancer, preventing morbidity resulting from cancer, managing morbidity when it occurs, and supporting patients across the entire experience of cancer from the point of diagnosis to the final outcome whether that be death or return to normal life. Melissa Mercogliano, PT, OCS has a private practice specializing in the treatment of women after surgery for breast cancer. Melissa stated the following about her OCS preparation: “I do an ortho eval on every oncology patient because often I find those impairments contribute to the overall picture of lymphedema and or limited ROM, but ortho in NO way prepares a person for the side effects of chemotherapy or the issues of radiated tissues, the prolonged period of time for dealing with radiated tissue. Ortho does not give you any of the tools for dealing with edema in a patient who has an impaired lymphatic system whether that damage is acute or chronic. Ortho does not require you to learn blood levels and when it is okay to exercise, etc. I do not recall learning anything specific to oncology when preparing for my OCS, but that was many years ago and they may have “tweaked” the requirements. I do know now with my understanding regarding oncology, I also make sure that anyone with a PMH of cancer, I am certain I understand what treatments they have received because it may change my approach.” 14 In gathering information for this document we conducted an email survey and interviews with a number of managers of physical therapy programs in various practice settings. A physical therapy director in a major cancer center happened to have hired a new staff physical therapist just within the last few months. This newly hired individual had also successfully attained the OCS just before taking the position at the major cancer center. These comments do not include information that could identify the director, the new hire, or the specific facility in order to protect confidentiality of personnel information. The physical therapy director said the following about the process of integrating that individual into the staff: “(This individual) is brilliant! (She or he) has so much potential because (she or he) has the drive to have sought this specialization in orthopedics, (she or he) has an analytical mind and the ability to critically analyze information in a way that will be so important to our practice. But (she or he) came to us with absolutely no knowledge of how to manage patients in this context. (She or he) needed the same training that new grads have needed with respect to a comprehensive understanding of cancer, it’s treatments and how they affect patient function across the lifespan, recognition of medical emergency situations in cancer, the language of cancer that is necessary in order to communicate on an appropriate level with the oncologists and surgeon s here, and everything else that is absolutely necessary in order to practice successfully and at the quality we require here.” PEDIATRICS The pediatric examination content outline is the most extensive of all of the specialist examination outlines in terms of mention of cancer related topics. The examination outline includes a list of conditions after the phrase “Prevention and management of impairments, 15 functional/activity limitations, and participation restriction in infants, children, adolescents, and adults whose impairments and limitations arose in childhood due to…” The condition list includes osteosarcoma and limb salvage, and brain tumors. Interestingly, the most common group of cancers affecting children, leukemia, is not specifically mentioned in this list. However, the examination content outline also includes the phrase “Management of impairments and functional limitations in infants, children, adolescents, and across the life span arising from other diseases and syndromes, including…” and the list that follows that phrase includes “hematology and oncology” which would include leukemia. Management of impairments and functional limitations in long term survivors of childhood cancers across the lifespan would overlap with geriatrics since those survivors can be often expected to have a normal lifespan; it is unlikely this was what was meant by the phrase. The work of Kirsten Ness, PT, PhD, a pediatric cancer physical therapy specialist who is an epidemiologist, a researcher, and associate faculty member at St. Jude Research Hospital, describes what may be meant by the lifespan reference. She has authored numerous journal articles reporting on the health problems that are experienced as late effects of childhood cancer across the lifespan and encourages surveillance for these problems in order to promote health among this population across the lifespan.3-6 Yet, even as the pediatric specialty demonstrates awareness of childhood cancers, the existence of that awareness does not negate the need for oncologic physical therapy specialists. While childhood cancers are the most common cause of death for children up to the age of 14, childhood cancers are indeed relatively rare and most cancers occur in adults.1 The incidence rate of all cancers combined climbs steadily with advancing age, and for example the incidence 16 rate of all cancers combined is 101 times higher for persons between the ages of 60 and 65 than it is for children between the ages of 5 and 9. The fact that both pediatric specialists and oncologic specialists would share advanced knowledge about pediatric cancers would simply enhance care for children.1 Carol Daly, PT, DPT, PCS, Lecturer, Coordinator of the Pediatric Post Professional Physical Therapy Certificate & Residency Program, Physical Therapy Department, University of Michigan-Flint made the following remarks in her communication: “I believe clinical specialization in oncology would be a step toward ensuring the best available care for pediatric patients/clients who are receiving treatment for cancer. The only two cancer diagnoses included under the “List of Medical Conditions Seen by Specialists” in the currently available Pediatric Description of Specialty Practice include brain tumors as a “Condition of the neuromuscular system” and osteosarcoma – limb salvage as a “Condition of the musculoskeletal system.” Clearly, this approach focuses on body system impairments rather than on the complex combination of physical, psychosocial, and life span concerns that should be addressed by physical therapists treating children affected by a wide range of cancers. I see the knowledge and skills required for advanced physical therapy practice in oncology as different from those of advanced physical therapy practice in pediatrics. I believe this is especially true as the science involved with cancer treatment continues to change at rapid pace, and in particular the ways that chemotherapy impacts the developing systems of a child. As an ABPTS pediatric clinical specialist, I reach out to physical therapists with expertise in oncology when I receive a referral for a child with a cancer diagnosis so that I can gain a 17 better understanding of current cancer treatment and how it will impact the physical therapy plan of care.” Annemarie F. Kammann, PT, MEd, PCS is a pediatric specialist who is also a cancer survivor states: “An oncology specialization is more than needed at this time. There are no expert resources specifically well versed in oncology to assist with school placements, integration back into the community and assisting the children and parents/caregivers deal with the lifestyle changes and other issues that arise. As a pediatric specialist, I have not felt prepared to deal with the above issues but have learned from trial and error to assist the children and families to the best of my ability. As a cancer survivor , I find the lack of extended care for fatigue, lifestyle changes and learning to cope at times seems like a moving target and is inexcusable. I thoroughly hope that you are able to establish an oncology specialty since I believe it is well overdue.” WOMEN’S HEALTH For the sake of completeness, we are also including comments about overlap with the Women’s Health Specialty. The Women’s Health DSP refers to cancer under the heading “Prognosis,” specifically using the general term “cancer” at one point in a list of chronic illnesses that can affect prognosis. The document specifically mentions considering “recurrent lymphedema” as a risk factor related to long term prognosis, and considering the effects of chemotherapy and radiation on musculoskeletal function following breast or urogenital cancers. These same areas of cancer are mentioned again in interventions. While women’s health specialists are involved in care of these specific cancers, and they demonstrate some advanced knowledge about that care, the key point is that women’s health specialists are 18 involved only with breast cancer and urogenital cancers. While breast and prostate cancer specifically are common cancers and some of this knowledge represents overlap between women’s health specialists and oncologic specialists, oncologic specialists deal with and have advanced knowledge about all types of cancer. Oncologic rehabilitation and the specialist physical therapists who lead care in that area must be based on a comprehensive knowledge base across all cancer types. In her letter supporting the oncologic specialty, Wendy Featherstone, PT, DPT, and President of the Section on Women’s Health said the following: “None of the specialty areas already established under ABPTS are entirely and absolutely unique. Women's Health, for example, might include treatment of the female athlete, or the geriatric client with incontinence. This does not negate the importance of certified specialty in women's health, sports, or geriatric physical therapy. There is no question in my mind that physical therapy treatment of the cancer patient is a specialty practice area. Although there is overlap among many areas of practice, I would challenge the notion that this detracts from the wealth of specific knowledge required to understand the intricacies of chemotherapy, radiation, and surgery, their effect on the various body systems, and their impact on physical therapy treatment. “ In conclusion, the information provided in this section identifies no reason to expect that specialists from other areas of practice will automatically have the knowledge and skills for advanced practice in oncology. Perhaps more importantly, to attempt to manage this complex and fragile population in a fragmented approach where 19 some of the cancers are handled by geriatrics, some pediatrics, some women’s health, etc., with no particular specialist holding advanced knowledge about the big picture of oncology will likely result in inefficient and less effective physical therapy care for cancer survivors. We can provide improved quality of care with the addition of clinical specialists in oncologic physical therapy. 1. Surveillance Epidemiology and End Results Fact Sheets, vol. August 2013: National Cancer Institute, 2012. 2. Perry SB, Rauk RP, McCarthy A, Milidonis MK. Competency-based validation of neurologic specialty practice. J Neurol Phys Ther 2008;32(2):62-9. Available from http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?cmd=Retrieve&db=PubMed&dopt=Citation&list_uids=1 8645293 3. Ness KK. Limitations on Physical Performance and Daily Activities among Long-Term Survivors of Childhood Cancer. Annals of Internal Medicine 2005;143:639. 4. Ness KK, Armenian SH, Kadan-Lottick N, Gurney JG. Adverse effects of treatment in childhood acute lymphoblastic leukemia: general overview and implications for long-term cardiac health. Expert review of hematology 2011;4:185-97. 5. Ness KK, Hudson MM, Pui C-H, Green DM, Krull KR, Huang TT, et al. Neuromuscular impairments in adult survivors of childhood acute lymphoblastic leukemia: associations with physical performance and chemotherapy doses. Cancer 2012;118:828-38. 6. Ness KK, Morris EB, Nolan VG, Howell CR, Gilchrist LS, Stovall M, et al. Physical performance limitations among adult survivors of childhood brain tumors. Cancer 2010;116:3034-44. 20 Criterion 5: Specialized Functions $%3765(9,(: 'HVFULEHLQGHWDLOWKHHGXFDWLRQWUDLQLQJDQGH[SHULHQFHUHTXLUHGWRDFTXLUHVXFK VNLOOVDQGKRZWKLVGLIIHUVIURPWKHHGXFDWLRQWUDLQLQJDQGH[SHULHQFHUHTXLUHGRID UHFHQWJUDGXDWHIURPDSURIHVVLRQDOSK\VLFDOWKHUDS\SURJUDP ^'HFLVLRQDid NotAdequately Meet Requirement` $%376LVUHTXHVWLQJDGGLWLRQDOVXSSRUWLYHLQIRUPDWLRQDQGGHWDLOIRUWKLVFULWHULRQ3HWLWLRQHU VWDWHGWKDWWKHUHTXLUHGHGXFDWLRQWUDLQLQJDQGH[SHULHQFHUHTXLUHGIRUDQRQFRORJLFDO VSHFLDOLVWVGLIIHUVVLJQLILFDQWO\IURPWKHPLQLPXPVNLOOVHWUHTXLUHGIRUJUDGXDWLRQIURPD SURIHVVLRQDOSK\VLFDOWKHUDS\SURJUDP:HZRXOGDVNIRUPRUHVSHFLILFVDVWRWKHDGGLWLRQDO VNLOOVHWUHTXLUHG$OVRLVWKHQRWHGPRGHOWKHRQO\PHDQVE\ZKLFKWRDFTXLUHWKHQHFHVVDU\ HGXFDWLRQWUDLQLQJDQGVNLOOV",VWKHSHWLWLRQHUHQGRUVLQJRQO\WKLVPRGHODVDPHDQVWR DFTXLULQJWKHQHFHVVDU\HGXFDWLRQDQGWUDLQLQJ",IVRZK\RQO\WKLVPRGHO",IWKLVLVRQO\RQH H[DPSOHZKDWDUHRWKHUH[DPSOHVWKDWFXUUHQWO\H[LVW" 5(9,6('6(&7,21 7KHHGXFDWLRQWUDLQLQJDQGH[SHULHQFHRIDQRQFRORJLFFOLQLFDOVSHFLDOLVWGLIIHU VLJQLILFDQWO\IURPWKHPLQLPXPVNLOOVHWUHTXLUHGIRUJUDGXDWLRQIURPDSK\VLFDOWKHUDS\SURJUDP 7KHPLQLPXPVNLOOVHWDUHVNLOOVWKDWDQ\SK\VLFDOWKHUDSLVWVKRXOGGHPRQVWUDWHIRUFRPSHWHQW DQGFRRUGLQDWHGPDQQHU+RZHYHUWKHRQFRORJLFDOFOLQLFDOVSHFLDOLVWIXQFWLRQVHIILFLHQWO\DQG HIIHFWLYHO\LQGHOLYHULQJRQFRORJ\UHKDELOLWDWLRQIRUWKHEHVWSDWLHQWRXWFRPHV7KHPLQLPXPVNLOO VHWGRHVGHVFULEHVWKHVNLOOVQHFHVVDU\WRVFUHHQDQGH[DPLQHSK\VLFDOLPSDLUPHQWV:H DFNQRZOHGJHWKDWDQHZJUDGXDWHRUSUDFWLFLQJSK\VLFDOWKHUDSLVWPD\LGHQWLI\FDQFHUUHODWHG LPSDLUPHQWV+RZHYHUWKHOLPLWDWLRQVRIWKHPLQLPDOVNLOOVHWUHODWHGWRRQFRORJ\UHKDELOLWDWLRQLV WKHHYDOXDWLRQGLDJQRVLVSURJQRVLVGHYHORSPHQWRISODQRIFDUHDQGVHOHFWLRQRILQWHUYHQWLRQV IRUWKHFDQFHUVXUYLYRUGXHWRLQDGHTXDWHNQRZOHGJHRIFDQFHULWVWUHDWPHQWWKHLQIOXHQFHRI WKHGLVHDVHRQFRPRUELGLWLHVXQLTXHSUHVHQWDWLRQRISK\VLFDOLPSDLUPHQWVGXHWRFDQFHU SDWKRSK\VLRORJ\DQGDQXQGHUVWDQGLQJRIWKHFDQFHUVXUYLYRU¶VUHVSRQVHWRFRPPRQSK\VLFDO WKHUDS\LQWHUYHQWLRQVGXHWRFDQFHUDQGLWVWUHDWPHQW 7KHRUWKRSHGLFFRPSRQHQWVRIWKHSK\VLFDOWKHUDSLVWHGXFDWLRQDOSUHSDUDWLRQDUHUREXVW DQGWKHFRUQHUVWRQHRIPLQLPXPVNLOOVRIWKHQHZJUDGXDWH0HOLVVD0HUFRJOLDQR372&6KDVD SULYDWHSUDFWLFHVSHFLDOL]LQJLQWKHWUHDWPHQWRIZRPHQDIWHUVXUJHU\IRUEUHDVWFDQFHU0HOLVVD VWDWHGWKHIROORZLQJDERXWKHUSUHSDUHGQHVVWRWUHDWFDQFHUVXUYLYRUV ³,GRDQRUWKRHYDORQHYHU\RQFRORJ\SDWLHQWEHFDXVHRIWHQ,ILQGWKRVHLPSDLUPHQWV FRQWULEXWHWRWKHRYHUDOOSLFWXUHRIO\PSKHGHPDDQGRUOLPLWHG520EXWRUWKRLQ12 ZD\SUHSDUHVDSHUVRQIRUWKHVLGHHIIHFWVRIFKHPRWKHUDS\RUWKHLVVXHVRIUDGLDWHG WLVVXHVWKHSURORQJHGSHULRGRIWLPHIRUGHDOLQJZLWKUDGLDWHGWLVVXH2UWKRGRHVQRW JLYH\RXDQ\RIWKHWRROVIRUGHDOLQJZLWKHGHPDLQDSDWLHQWZKRKDVDQLPSDLUHG O\PSKDWLFV\VWHPZKHWKHUWKDWGDPDJHLVDFXWHRUFKURQLF2UWKRGRHVQRWUHTXLUH \RXWROHDUQEORRGOHYHOVDQGZKHQLWLVRND\WRH[HUFLVHHWF´ 3K\VLFDOWKHUDSLVWVZKRFXUUHQWO\ILOORQFRORJLFSK\VLFDOWKHUDSLVWSRVLWLRQVKDYHUHSRUWHG H[WHQVLYHRQWKHMREWUDLQLQJDQGSDUWLFLSDWLRQLQUHJLRQDODQGQDWLRQDOFRQWLQXLQJHGXFDWLRQWR DGGUHVVWKHVHGHILFLWV6WDIIGHYHORSPHQWWLPHLVDVDOLHQWLVVXHIRURQFRORJLFSUDFWLFHVHWWLQJV VLQFHGLUHFWRUVRIWKHVHVHWWLQJVVXUYH\HGE\WHOHSKRQHXQLYHUVDOO\UHSRUWWKDWQHLWKHUHQWU\OHYHO HGXFDWLRQQRUJHQHUDOSK\VLFDOWKHUDS\H[SHULHQFHRXWVLGHWKHRQFRORJ\VSHFLDOW\DUHD DGHTXDWHO\SUHSDUHWKHSK\VLFDOWKHUDSLVWIRUVSHFLDOL]HGSUDFWLFHLQFDQFHUFHQWHUV$OOWHQ1&, FHQWHUVLQWHUYLHZHGRIIHUPDMRUVWUXFWXUHGRQWKHMREWUDLQLQJSURJUDPVWREULQJQHZO\KLUHG WKHUDSLVWVWRWKHVWDQGDUGUHTXLUHGIRUTXDOLW\RIFDUH'LUHFWRUVRIWKHVHFHQWHUVGHVFULEH H[WHQGHGRULHQWDWLRQSURJUDPVODVWLQJDWOHDVWIRXUZHHNVWKDWLQFOXGHDFRPELQDWLRQRIGLGDFWLF WHDFKLQJDQGPHQWRUHGSUDFWLFH-DQ6FKHHW]37&/7/$1$ZKRLVRXWSDWLHQWVXSHUYLVRU DWWKH8QLYHUVLW\RI7H[DV0'$QGHUVRQ&DQFHU&HQWHUSURYLGHGWKHIROORZLQJGHWDLOVRIWKH 0'$QGHUVRQQHZHPSOR\HHRULHQWDWLRQSURJUDPE\ZD\RIH[DPSOH ³1HZJUDGVDQGH[SHULHQFHGQHZKLUHVIROORZDVWUXFWXUHGRULHQWDWLRQIRUVL[ZHHNV FRPSRVHGRIUHDGLQJOHFWXUHVDQGVKDGRZLQJRWKHUFOLQLFLDQV7KH\DUHLQWURGXFHGWR SDWLHQWFDUHWKHWKLUGZHHNZLWKWKUHHSDWLHQWVDQGSOHQW\RIWLPHIRUGRFXPHQWDWLRQDQG WUHDWPHQWSUHS7KHIRXUWKZHHNWKH\KDYHIRXUSDWLHQWVDVVLJQHGDQGWKH\DUHDOVR H[SHULHQFLQJLQSDWLHQWWUHDWPHQWVRQWKHIORRU7KHILIWKZHHNILYHSDWLHQWVVL[WKZHHN VL[SDWLHQWVDQGWKHQWKH\DUHIXOO\ERRNHGZLWKHLJKWSDWLHQWVSHUGD\´ $FFRUGLQJWR-DQ6FKHHW]HDFKQHZO\KLUHGHPSOR\HHFRPSOHWHVWKHIROORZLQJPRGXOHV x 2QFRORJ\7KH%DVLFVVWDWLVWLFVWUHQGVULVNIDFWRUVVLJQVDQGV\PSWRPVFHOO GLIIHUHQWLDWLRQPHWDVWDVLV x 0DQDJHPHQWRIWKHSDWLHQW¶VFDQFHU3DUWFKHPRWKHUDS\UDGLDWLRQDQG VXUJHU\ x &RPPRQ,PSDLUPHQWVFKHPRWKHUDS\UDGLDWLRQWKHUDS\VXUJLFDOO\UHODWHGVWHURLG P\RSDWK\JUDIWYHUVXVKRVWGLVHDVHRVWHRSRURVLVULVNIRUIDOOV x 0HWDVWDWLF%RQ\'LVHDVH3DUWVVXUJLFDOLQWHUYHQWLRQKDUGZDUHSUHFDXWLRQV x /\PSKHGHPDFRPSUHVVLRQZUDSSLQJIRU8(DQG/(FRPSHWHQF\WUDLQLQJ GLIIHUHQWLDOGLDJQRVLVHYDOXDWLRQODEYDOXHVSHUIRUPDQFHPHDVXUHVUDWLRQDOHIRUWKH 0/'&'7SURJUDPPLQJ x &KDUW5HYLHZDVVXULQJWKDWDOOSHUWLQHQWLQIRUPDWLRQLVEHLQJUHYLHZHGSULRUWR LQWHUYHQWLRQHYDOXDWLRQV x 5HVSLUDWRU\,VVXHVLQ3DWLHQWVZLWK&DQFHUUHVWULFWLYHDQGREVWUXFWLYHOXQJGLVHDVH 3(VSOHXUDOHIIXVLRQV x 2QFRORJ\(PHUJHQFLHV/HSWRPHQLJHDOGLVHDVHFDUGLDFWDPSRQDGHSHULFDUGLDO HIIXVLRQVXSHULRUYHQDFDYDV\QGURPHVSLQDOFRUGFRPSUHVVLRQDYDVFXODU QHFURVLVQHXWURSHQLFIHYHUYHQRXVWKURPERHPEROLVPPHWDEROLFGHUDQJHPHQWV x &DVH6WXGLHV x &DQFHUIDWLJXHDQGHQHUJ\FRQVHUYDWLRQ x &RJQLWLYHLPSDLUPHQW -DQ6FKHHW]IXUWKHUGHVFULEHVWKDWWKHQHZO\KLUHGHPSOR\HHVPXVW³FRPSOHWHWKHIROORZLQJ FRPSHWHQFLHVLQWKHILUVWWRGD\V x x x x x x %DVLF2QFRORJ\ 3HUIRUPDQFHPHDVXUHVXVHGLQWKHRQFRORJ\VHWWLQJ %ORRGYDOXHVDQGRWKHUFKHPLVWULHVWUHDWPHQW6DIHW\ &RPSUHVVLRQEDQGDJLQJIRUXSSHUDQGORZHUH[WUHPLWLHV 6SHFLILFHYDOXDWLRQWRROVVXFKDV%UXLQLQNV2VHUHWVN\7HVW 2UWKRWLFV )LQDOO\HDFKQHZO\KLUHGWKHUDSLVWDW0'$QGHUVRQLVSDLUHGZLWKDVHQLRUWKHUDSLVWZKRDFWV DVDGHGLFDWHGFOLQLFDOPHQWRUIRUWKHQHZHPSOR\HHIRUDSHULRGRIRQH\HDU7KHH[DPSOH SURYLGHGE\0'$QGHUVRQGHPRQVWUDWHVWKDWFDQFHUFHQWHUVPXVWLQYHVWFRQVLGHUDEOHVWDII WLPHLQDFRQWH[WDOUHDG\VWUHVVHGE\SK\VLFDOWKHUDS\ZRUNIRUFHVKRUWDJHVLQRUGHUWRHGXFDWH WKHUDSLVWVWREHDEOHWRSUDFWLFHRQFRORJ\SK\VLFDOWKHUDS\DWDQDGYDQFHGOHYHO 7KH0'$QGHUVRQPRGHOQRWHGDERYHLVRQHRIPDQ\VWUDWHJLHVWRDGGUHVVWKH DGGLWLRQDOVNLOOVQHHGHGIRUWKHRQFRORJLFFOLQLFDOVSHFLDOLVW:HEHOLHYHWKDWSK\VLFDOWKHUDSLVWV FDQJDWKHUWKHVNLOOVQHHGHGWRSUDFWLFHDVDVSHFLDOLVWWKURXJKPDQGDWRU\RQVLWHWUDLQLQJORFDO DQGUHJLRQDOFRQWLQXLQJHGXFDWLRQRIIHULQJVRQOLQHSURJUDPPLQJDQGWKURXJKSURIHVVLRQDO FRQIHUHQFHVXFKDV$37$&RPELQHG6HFWLRQ0HHWLQJVDQG1(;7FRQIHUHQFHV7KH6HFWLRQ KDVSDUWQHUHGZLWK('8&$7$DQGRWKHURUJDQL]DWLRQVWRDGGUHVVNQRZOHGJHGHILFLWVWKURXJKD YDULHW\RIHGXFDWLRQDOSODWIRUPV:HORRNIRUZDUGWRZRUNLQJZLWKWKH$37$DQGRXUFRPPXQLW\ SDUWQHUVIRUWKHODXQFKRIRQFRORJ\UHVLGHQF\SURJUDPV7KHUHDUHFXUUHQWO\IRXUHGXFDWLRQDO DQGFOLQLFDOSDUWQHUVLQWHUHVWHGLQVWDUWLQJSURJUDPVLQRQFHRXUSHWLWLRQLVDSSURYHG 5HJDUGOHVVRIWKHPHWKRGWKHQHHGIRUDGGLWLRQDOVNLOOVIRUWKHJHQHUDOSK\VLFDOWKHUDSLVWWR SURYLGHHIILFLHQWDQGHIIHFWLYHSK\VLFDOWKHUDS\FDUHIRUWKHFDQFHUVXUYLYRULVXQGHQLDEOHEDVHG RQUHVSRQVHVIURP$37$PHPEHUVHPSOR\HUVDQGRXUFRQVXPHUV&RPPXQLW\EDVHGDQG QDWLRQDORUJDQL]DWLRQVUHFRJQL]HWKHQHHGIRUDGYDQFHGWUDLQLQJIRUWKHFDUHRIFDQFHUVXUYLYRUV 7KH%UHDVW&DQFHURUJVWDWHVWKDWVXUYLYRUVVKRXOGILQGDSK\VLFDOWKHUDSLVWZHOOYHUVHGLQ FDQFHUVXUYLYRUVKLS7KH$PHULFDQ6RFLHW\RI&OLQLFDO2QFRORJ\$6&2VXSSRUWHGWKHQHHGIRU DGGLWLRQDOWUDLQLQJGXULQJDQLQWHUYLHZRI-HDQ2 7RROH3703+&/7/$1$DSK\VLFDO WKHUDSLVWDW0DVVDFKXVHWWV*HQHUDO+RVSLWDO,QWKH$6&2([SHUW&RUQHUVKHUHSRUWHGWKDWVKH VHOILGHQWLILHGKHUODFNRINQRZOHGJHWRWUHDWWKHFDQFHUSRSXODWLRQDQGWKHWUDLQLQJVKHVRXJKW RXWWRDGGUHVVWKLVGHILFLW6KHDOVRVWURQJO\VXJJHVWWKDWFRQVXPHUVLQWHUYLHZWKHLUSK\VLFDO WKHUDSLVWDERXWKLVKHUNQRZOHGJHRIFDQFHUDQGH[SHULHQFHZRUNLQJZLWKFDQFHUVXUYLYRUV 7KLVVLWXDWLRQVXEVWDQWLDWHVWKHIDFWWKDWRQFRORJLFSK\VLFDOWKHUDS\LVDVSHFLDOW\DUHDRI SUDFWLFHDQGUHTXLUHVDGYDQFHGWUDLQLQJEH\RQGWKDWJDLQHGLQWKHWUDGLWLRQDOSK\VLFDOWKHUDSLVW FXUULFXOXP 5HIHUHQFHV %UHDVW&DQFHURUJ([HUFLVHDIWHUVXUJHU\$FFHVVHGRQ KWWSZZZEUHDVWFDQFHURUJWLSVH[HUFLVHWUHDWPHQWVXUJHU\ $PHULFDQ6RFLHW\RI&OLQLFDO2QFRORJ\$6&2([SHUW&RUQHU3K\VLFDO7KHUDSLVWVLQ 2QFRORJ\$FFHVVHGRQKWWSZZZFDQFHUQHWQDYLJDWLQJFDQFHUFDUHFDQFHUQHW IHDWXUHDUWLFOHVDVFRH[SHUWFRUQHUSK\VLFDOWKHUDSLVWVRQFRORJ\ $%3765(9,(: 'LVFXVVLQGHWDLOKRZWKHVHDGYDQFHGIXQFWLRQVGLIIHUIURPWKHIXQFWLRQVUHTXLUHGLQ WKRVHVSHFLDOW\DUHDVDOUHDG\UHFRJQL]HGE\$%376 ^'HFLVLRQDid NotAdequately Meet Requirement` $%376ZDVXQDEOHWRFRQGXFWDUHYLHZRIWKLVVHFWLRQDVLWZDVQRWLQFOXGHGZLWKLQWKHSHWLWLRQ UHVXEPLVVLRQ 5(9,6('6(&7,21 7KDQN\RXIRUWKHRSSRUWXQLW\WRIXUWKHUFODULI\WKLVUHVSRQVH:HKDYHDSSURDFKHGWKLV UHVSRQVHE\DQDO\]LQJGLIIHUHQFHVLQIXQFWLRQDVGHVFULEHGRQWKH'63VSURYLGHGIRUZRPHQ¶V KHDOWKJHULDWULFVSHGLDWULFVDQGFDUGLRSXOPRQDU\LQWKHFKDUWWKDWIROORZV&RPPRQDOLWLHV EHWZHHQRQFRORJ\DQGDQ\RIWKHRWKHUIRXUVSHFLDOWLHVDUHKLJKOLJKWHGLQ\HOORZZKLFKZLOOSULQW DVJUH\RQEODFNDQGZKLWHFRSLHV7ZRWKLQJVEHFRPHLPPHGLDWHO\REYLRXVLQYLHZLQJWKH LQIRUPDWLRQSUHVHQWHGWKLVZD\ 7KHUHDUHQXPHURXVFRPPRQDOLWLHVRIIXQFWLRQDPRQJH[LVWLQJDFURVVDOOVSHFLDOWLHV 2QFRORJLFSK\VLFDOVSHFLDOLVWVGLIIHUIURPRWKHUVSHFLDOLVWVLQWKDWWKHSURFHVVHVRI SK\VLFDOWKHUDS\DUHH[HFXWHGZLWKLQWKHFRQWH[WRIDQXQGHUVWDQGLQJRIFDQFHUDQGKRZ LWVWUHDWPHQWDIIHFWVPRWRUIXQFWLRQERWKDWWKHWLPHRIWUHDWPHQWDQGZLWKUHVSHFWWRODWH HIIHFWVZKLFKFDQRFFXUODWHULQOLIH7KHRQFRORJLFVSHFLDOLVWKDVWKHNQRZOHGJHDQG VNLOOWRVDIHO\GHOLYHUWUHDWPHQWLQWKHFRQWH[WRIFRPSOH[PHGLFDOFDUHZLWKVXIILFLHQW XQGHUVWDQGLQJRIFDQFHUPHGLFDWLRQVDQGHIIHFWVRIUDGLDWLRQWRSUHGLFWLPSDLUPHQWVIURP WKRVHSURFHVVHVDQGPLQLPL]HGLVDELOLW\ 2IcriticalLPSRUWDQFHSDUWLFXODUO\LQWKHDUHDRIFDQFHUZKHUHPDQ\RIWKHSDWLHQWVDUH H[WUDRUGLQDULO\IUDJLOHDQGLQXQVWDEOHPHGLFDOFRQGLWLRQWKHSDWLHQWWKHSDWLHQW¶VSK\VLFLDQV DQGWKHSXEOLFLQJHQHUDOPXVWKDYHDZD\WRNQRZZKRWKH\FDQWUXVWWRKDYHWKHDGYDQFHG NQRZOHGJHDQGVNLOOQHFHVVDU\WRWUHDWWKLVSRSXODWLRQDWDOHYHORIH[FHOOHQFH7KHUHLVQRZD\ IRUSDWLHQWVSK\VLFLDQVRUWKHSXEOLFWRUHOLDEO\LGHQWLI\ZKLFKJHQHUDOLVWVKROGH[WUDRUGLQDU\ VNLOOV%RDUGFHUWLILFDWLRQSURYLGHVWKLVFULWLFDOSURWHFWLRQWRSDWLHQWVDQGWKHFRPPXQLW\ 8 7KH³DGYDQFHGJHQHUDOLVW´LVQRWUHSUHVHQWHGRQWKHFKDUWWKDWIROORZV7KHWHUP³DGYDQFHG JHQHUDOLVW´ODFNVGHILQLWLRQDJUHHGXSRQE\RXUSURIHVVLRQ$VVXPLQJWKHSKUDVHUHIHUVWRD SK\VLFDOWKHUDSLVWZLWKPRUHWKDQDPLQLPXPVNLOOVHWZHDFNQRZOHGJHWKDWWKHUHDUHFXUUHQW SK\VLFDOWKHUDSLVWVZLWKH[WUDRUGLQDU\GULYHNQRZOHGJHDQGVHOIPRWLYDWLRQWRSURYLGHKLJK TXDOLW\HIILFLHQWDQGHIIHFWLYHFDUHIRUSHUVRQVZLWKFDQFHU,QGHHGHDFKH[LVWLQJVSHFLDOW\DV ZHOODVWKHSURSRVHGVSHFLDOW\SUDFWLFHDUHDRIRQFRORJ\ZDVGHYHORSHGE\MXVWVXFKSHRSOH :HKDYHLGHQWLILHGWKURXJKRXWWKLVSHWLWLRQWKHNQRZOHGJHGHILFLWVIRUWKHJHQHUDO SK\VLFDOWKHUDSLVWDQGRWKHUSK\VLFDOWKHUDS\VSHFLDOLVWV7KLVFODLPZDVVXSSRUWHGE\D WHOHSKRQHVXUYH\RIWHQPDMRUFDQFHUFHQWHUVFRQGXFWHGILUVWLQDQGXSGDWHGLQ$XJXVW IRUWKLVUHVSRQVH(YHU\PDMRUFDQFHUFHQWHULQWHUYLHZHGZLOOQRWDOORZDQHZO\KLUHG WKHUDSLVWWRWUHDWSDWLHQWVRQWKHLURZQXQWLOWKH\JRWKURXJKOHQJWK\RQWKHMREWUDLQLQJWKDW LQFOXGHVGLGDFWLFSUHVHQWDWLRQVDERXWLQIRUPDWLRQWKDWLVEDVLFWRWKHPDQDJHPHQWRIFDQFHU UHODWHGLPSDLUPHQWDQGIXQFWLRQDOORVVSOXVDOHQJWK\PHQWRUHGSUDFWLFH,QWKHXSGDWHGVXUYH\ ZHDVNHGWKHPDQDJHUVDWWKHVHLQVWLWXWLRQVWRLGHQWLI\ZKHWKHUWKH\KDGKLUHGH[SHULHQFHG WKHUDSLVWVRUQHZJUDGVLQWKHSDVWIHZ\HDUVDQGZKHWKHUWKH\ILQGWKDWWKHWUDLQLQJFDQEH VKRUWHQHGIRUDQH[SHULHQFHGWKHUDSLVW(YHU\PDQDJHULGHQWLILHGWKDWWKH\HLWKHUKLUHRQO\ H[SHULHQFHGWKHUDSLVWVRUWKDWWKH\KLUHDPL[RIH[SHULHQFHOHYHOV$PRQJUHFHQWO\KLUHG WKHUDSLVWVIRUWKHVHIDFLOLWLHVZHUHVHYHUDOLQGLYLGXDOVZKRKROGRWKHUVSHFLDOW\FHUWLILFDWLRQV (YHU\PDQDJHUVWDWHGWKDWXQOHVVWKHQHZO\KLUHGSHUVRQKDVVLJQLILFDQWH[SHULHQFHVSHFLILFDOO\ LQFDQFHUWKH\DOOQHHGWKHVDPHDPRXQWRIWUDLQLQJEHFDXVHQRQHRIWKHPKDVHYHUFRPHLQ ZLWKVXIILFLHQWNQRZOHGJHRIFDQFHUUHKDELOLWDWLRQ'HSHQGLQJRQWKHIDFLOLW\QHZO\KLUHGEXW H[SHULHQFHGWKHUDSLVWVZHUHGHVFULEHGDVFRQILGHQWHQRXJKWREHRQWKHLURZQZLWKSDWLHQWVQRW EHIRUHDWOHDVWPRQWKVRQWKHMREDQGWZRFHQWHUVGHVFULEHGWKDWLWWDNHVPRQWKVIRUPRVW QHZKLUHVWREHUHDG\WRKDQGOHDIXOOFDVHORDGLQGHSHQGHQWO\,QRWKHUSUDFWLFHVHWWLQJVVXFK DVSULYDWHSUDFWLFHZKHUHWKHUHZRXOGW\SLFDOO\EHQRPRUHWKDQRQHWKHUDSLVWZKRWDNHV UHVSRQVLELOLW\WROHDGFDQFHUFDUHVSHFLDOLVWFHUWLILFDWLRQDQGFRQVLGHUDEOHH[SHULHQFHZLWKWKLV 9 SRSXODWLRQLVDUJXDEO\HYHQPRUHFULWLFDOEHFDXVHWKHLQGLYLGXDOZRUNLQJLQVXFKDVLWXDWLRQ ZRXOGKDYHQRVXSSRUWWRKHOSVKRXOGDQXQIDPLOLDURUYHU\GDQJHURXVVLWXDWLRQDULVH(YHU\ 37PDQDJHULQWHUYLHZHGVWDWHGHPSKDWLFDOO\WKDWWKH\FRXOGQRWZDLWXQWLOWKHUHLVDERDUG FHUWLILFDWLRQIRURQFRORJLFVSHFLDOLVWVGXHWRWKHFRVWRIWUDLQLQJDQGWKHSRVVLEOHUHGXFWLRQLQ WLPHQHHGHGIRUPHQWRULQJDQGWUDQVLWLRQWRLQGHSHQGHQWSDWLHQWFDUHGHOLYHU\7KHVHIDFWRUV LQFOXGLQJWKHGDWDSUHVHQWHGLQWKHWDEOHEHORZLQGLFDWHWKHKRZWKHDGYDQFHGIXQFWLRQVRIWKH RQFRORJLFFOLQLFDOVSHFLDOLVWGLIIHUIURPWKHIXQFWLRQVUHTXLUHGLQWKRVHVSHFLDOW\DUHDVDOUHDG\ UHFRJQL]HGE\$%376 20 )XQFWLRQZLWK GLVFXVVLRQRI FRPPRQDOLWLHVDQG GLIIHUHQFHV +LVWRU\DQG6\VWHP UHYLHZ $VFRPSDUHGWRRWKHU VSHFLDOLVWVRQFRORJLF VSHFLDOLVWVWDNLQJD KLVWRU\DQGUHYLHZLQJ V\VWHPVIRFXVRQ XQLTXHLQIRUPDWLRQ UHODWHGWRFDQFHUDQG LWVWUHDWPHQW )XQFWLRQRIWKH RQFRORJ\VSHFLDOLVW $V\VWHPDWLF JDWKHULQJRIGDWDIURP ERWKWKHSDVWDQG SUHVHQWUHODWHGWRZK\ WKHLQGLYLGXDOLVVHHNLQJ WKHVHUYLFHVRIWKH SK\VLFDOWKHUDSLVW 2EWDLQSDWLHQWKLVWRU\ WKURXJKLQWHUYLHZDQG GDWDIURP RWKHUVRXUFHVHJ 4XHVWLRQQDLUHVPHGLFDO UHFRUGVDQGWHVWUHVXOWV VSHFLILFWRFDQFHU WUHDWPHQWDQGRQFRORJLF SDWLHQWLVVXHV LQFOXGLQJ D0HGLFDWLRQLQWHUYLHZ E+HDOWKVWDWXVHJ&R PRUELGLW\QXWULWLRQ GHSUHVVLRQLQGLYLGXDO VHOI UHSRUWIDPLO\RU FDUHJLYHUUHSRUW F6RFLDOHQYLURQPHQW HJ/LYLQJVLWXDWLRQ IDPLO\VWUXFWXUH G)XQFWLRQDOVWDWXVDQG DFWLYLW\OHYHO H&DQFHUGLVHDVH FKDUDFWHULVWLFVHJ 7\SHRISULPDU\ FDQFHUVWDJHRI FDQFHUJUDGHRI FDQFHU I&XUUHQWDQGSDVW FDQFHUWUHDWPHQW LQFOXGLQJ )XQFWLRQDVGHVFULEHG LQ&DUGLRSXOPRQDU\ '63 )XQFWLRQDVGHVFULEHG LQ*HULDWULFV'63 )XQFWLRQDVGHVFULEHG LQ:RPHQ¶V+HDOWK '63 )XQFWLRQDVGHVFULEHG LQ3HGLDWULFV'63 &RQGXFWLQJDKLJKO\ HIILFLHQWHIIHFWLYHDQG IRFXVHGSDWLHQWFOLHQW LQWHUYLHZWRDQWLFLSDWH DQGGHWHFW FDUGLRYDVFXODUDQGRU SXOPRQDU\LPSDLUPHQWV FXUUHQWSUHYLRXV V\PSWRPV SK\VLFDODQG SV\FKRORJLFDO OLIHVW\OH HQYLURQPHQWDO H[SRVXUHV ULVNIDFWRULQIRUPDWLRQ YLVDYLV FDUGLRSXOPRQDU\ GLVHDVHV 5HYLHZLQJDQG LQWHUSUHWLQJWKHFOLQLFDO VLJQLILFDQFH IRUSK\VLFDOWKHUDS\RI DOODYDLODEOH SDWLHQWFOLHQWGDWD LQFOXGLQJWKHIROORZLQJ í3DWLHQWFOLHQWFKLHI FRPSODLQW V\PSWRPDWRORJ\ DQGJRDOVIRUSK\VLFDO WKHUDS\ í0HGLFDOVXUJLFDO VRFLDOSV\FKRORJLFDO DQG IDPLO\KLVWRU\LQFOXGLQJ KHDOWKKDELWVDQG ULVNIDFWRUVIRU FDUGLRYDVFXODUDQG SXOPRQDU\ GLVHDVH í(PSOR\PHQWZRUN KLVWRU\ $V\VWHPDWLFJDWKHULQJ RIGDWDIURPERWKWKH SDVWDQGWKHSUHVHQW UHODWHGWRZK\WKH SDWLHQWFOLHQWLVVHHNLQJ WKHVHUYLFHVRIWKH SK\VLFDOWKHUDSLVW 2EWDLQSDWLHQWKLVWRU\ WKURXJKLQWHUYLHZDQG GDWDIURPRWKHUVRXUFHV HJTXHVWLRQQDLUHV PHGLFDOUHFRUGVWHVW UHVXOWVVSHFLILF WRJHULDWULFSDWLHQW LVVXHVLQFOXGLQJ DDPHGLFDWLRQ LQWHUYLHZ EKHDOWKVWDWXVHJ FRPRUELGLW\QXWULWLRQ GHSUHVVLRQ SDWLHQW¶VFOLHQW¶VVHOI UHSRUWIDPLO\¶VRU FDUHJLYHU¶V UHSRUW FVRFLDOHQYLURQPHQW HJOLYLQJVLWXDWLRQ IDPLO\ VWUXFWXUHDEXVH GIXQFWLRQDOVWDWXVDQG DFWLYLW\OHYHO HSUHYLRXVWKHUDSHXWLF HIIRUWVIRUWKLVRUUHODWHG SUREOHPV DQGWKHLUVXFFHVVRU IDLOXUH 3HUIRUPDV\VWHPV UHYLHZWRDVVHVV SK\VLRORJLFDODQG DQDWRPLFDOVWDWXVHJ FDUGLRYDVFXODUSXOPRQDU \LQWHJXPHQWDU\ PXVFXORVNHOHWDODQG QHXURPXVFXODUV\VWHPV 2EWDLQSDWLHQWFOLHQW KLVWRU\WKURXJK LQWHUYLHZVDQGGDWDIURP RWKHUVRXUFHVHJ PHGLFDOUHFRUGVWHVWV UHVXOWVVSHFLILFWR ZRPHQ¶VKHDOWKLVVXHV WRLQFOXGH 0HGLFDWLRQLQWHUYLHZ &KLOGEHDULQJVWDWXV J\QHFRORJLFDOVWDWXV ODFWDWLRQVWDWXV 6LJQVV\PSWRPVDQG EHKDYLRUVRIFXUUHQWRU SDVWSK\VLFDORUVH[XDO DEXVH ,QIRUPDWLRQWKDWPD\EH YLWDOWRWKHSDWLHQW¶V FOLHQW¶VFRPSOHWH UHFRYHU\HJPDULWDO SUREOHPVGLIILFXOW\ZLWK DFKLOGDWKRPH WUDXPDWLFFKLOGELUWK SULRUGLVPLVVDORI V\PSWRPVE\RWKHU KHDOWKFDUHSURYLGHUV $V\VWHPDWLFJDWKHULQJ RIGDWDIURPERWKWKH SDVWDQGWKHSUHVHQW UHODWHGWRZK\WKH SDWLHQWFOLHQWIDPLO\LV VHHNLQJWKHVHUYLFHVRI WKHSK\VLFDOWKHUDSLVW 3DWLHQW KLVWRU\LVREWDLQHG WKURXJKLQWHUYLHZDQG GDWDIURP RWKHUVRXUFHVVSHFLILFWR SHGLDWULFSDWLHQWLVVXHV HJTXHVWLRQQDLUHV PHGLFDOUHFRUGVWHVW UHVXOWVLQFOXGLQJ &RQGXFWLQJDSDWLHQW FOLHQWIDPLO\LQWHUYLHZWR JDWKHULQIRUPDWLRQVXFK DVFXUUHQWSUHYLRXV V\PSWRPVSK\VLFDODQG SV\FKRORJLFDOOLIHVW\OH HQYLURQPHQWDO H[SRVXUHVULVNIDFWRUV XQGHUVWDQGLQJRIWKH GLVHDVHPRWLYDWLRQIRU OLIHVW\OHFKDQJHDQG SDWLHQW FOLHQWIDPLO\JRDOV 5HYLHZLQJDQG LQWHUSUHWLQJDOODYDLODEOH SDWLHQWFOLHQWGDWDWR GHWHUPLQHWKHFOLQLFDO VLJQLILFDQFHWR SK\VLFDOWKHUDS\FDUH ZKLFKPD\LQFOXGH ±±0HGLFDODQG SV\FKRORJLFDOKLVWRU\ LQFOXGLQJULVNIDFWRUV ±±3K\VLFDODVVHVVPHQW 21 6XUJHU\H[WHQWRI H[FLVLRQO\PSKQRGH UHPRYDO &KHPRWKHUDS\ DJHQWVXVHGDGYHUVH HIIHFWVH[SHULHQFHG 5DGLDWLRQWKHUDS\ ILHOGRIUDGLDWLRQ GHOLYHU\PHFKDQLVP GRVH UHVSRQVH +RUPRQHWKHUDS\ W\SHRIKRUPRQHVLGH HIIHFWVH[SHULHQFHG %LRORJLFDOWKHUDS\ W\SHRIDJHQWVXVHG VLGHHIIHFW H[SHULHQFHG &RPSOHPHQWDU\ PHGLFLQHDQG WKHUDSLHV J'DWDIURPVRXUFHV VSHFLILFWRWKHFDQFHU GLDJQRVLVLQFOXGLQJ ,PDJLQJWHVWVHJ; UD\&7VFDQERQH VFDQ05,SHWVFDQ PDPPRJUDP'RSSOHU XOWUDVRXQG /DERUDWRU\WHVWVHJ KHPRJORELQSODWHOHWV 36$OHYHO %LRSV\UHSRUWV K,QIRUPDWLRQUHJDUGLQJ SUHPRUELGIXQFWLRQDQG DFWLYLW\OHYHO Systems Review $VVHVVSK\VLRORJLFDO DQGDQDWRPLFVWDWXV HJ &DUGLRYDVFXODUSXOPRQD U\LQWHJXPHQWDU\ PXVFXORVNHOHWDO í)XQFWLRQDO VWDWXVOLYLQJ HQYLURQPHQW í*HQHUDOKHDOWKVWDWXV DQGSK\VLFDO H[DPLQDWLRQ ILQGLQJV í&DUGLRYDVFXODUDQG SXOPRQDU\FOLQLFDO WHVWVGLDJQRVWLFVWXGLHV UDGLRORJLFDOVWXGLHV SK\VLRORJLFPRQLWRULQJ LQFOXGLQJOLIH VXSSRUWUHTXLUHPHQWV DQGKHPRG\QDPLF VWDELOLW\PRQLWRULQJHJ PHFKDQLFDOYHQWLODWRUV LQWUDDRUWLFEDOORRQ SXPSVYHQWULFXODU DVVLVWGHYLFHVDQG ODERUDWRU\DQDO\VLV í0HGLFDOLQWHUYHQWLRQV LQFOXGLQJ SKDUPDFRORJLFDO LQWHUYHQWLRQVDIIHFWLQJ WKHFDUGLRYDVFXODU DQGSXOPRQDU\V\VWHPV í3URJUHVVQRWHVIURP RWKHUKHDOWKFDUHWHDP PHPEHUV ,GHQWLI\LQJDQG GHVFULELQJWRROV DSSURSULDWHIRU VFUHHQLQJWKH FDUGLRYDVFXODUSXOPRQDU \PXVFXORVNHOHWDO QHXURPXVFXODUDQG LQWHJXPHQWDU\ V\VWHPVIRUWKH SRSXODWLRQEHLQJWHVWHG $SSO\LQJWRROVLQD WLPHO\DQGHIILFLHQW PDQQHU Systems Review $VVHVVSK\VLRORJLFDO DQGDQDWRPLFDOVWDWXV HJFDUGLRYDVFXODU SXOPRQDU\ LQWHJXPHQWDU\ PXVFXORVNHOHWDO DQGQHXURPXVFXODU V\VWHPV $SSURSULDWHO\H[DPLQH FRPPXQLFDWLRQDIIHFW FRJQLWLRQ ODQJXDJHDQGOHDUQLQJ VW\OHRISDWLHQWFOLHQW ±±'LDJQRVWLFVWXGLHV SK\VLRORJLFPRQLWRULQJ DQGODERUDWRU\ ±±7KHUDSHXWLFUHJLPH ±±3URJUHVVQRWHV Systems Review ,GHQWLI\LQJDQG GHVFULELQJWRROV DSSURSULDWHIRUWKH SRSXODWLRQEHLQJWHVWHG $SSO\LQJWRROVLQD WLPHO\DQGHIILFLHQW PDQQHUZLWKLQ WKHFRQVWUDLQWVRI DYDLODEOHHTXLSPHQWDQG HQYLURQPHQW DQGZLWKDSSURSULDWH GHOHJDWLRQ 5HFRPPHQGLQJ DFWLRQVEDVHGRQWKH UHVXOWVZKLFKPD\ LQFOXGHGHFLVLRQWR 2 ([DPLQDWLRQ7HVWV DQG0HDVXUHV 6WDQGDUGWHVWVXVHG DFURVVDOOSK\VLFDO WKHUDS\DUHDVRI SUDFWLFHDUHDOVRXVHG LQWKHRQFRORJ\ SRSXODWLRQ,WLV XQLTXHWRWKHIXQFWLRQ RIWKHRQFRORJ\ VSHFLDOLVWWR V\QWKHVL]HLQIRUPDWLRQ SHUWLQHQWWRWKHFDQFHU GLDJQRVLVDQG WUHDWPHQWDQG DSSURSULDWHO\FKRRVH WHVWVDQGPHDVXUHV DQGDSSO\WKHPZLWK FRQVLGHUDWLRQWRIXWXUH DQGQHXURPXVFXODU V\VWHPVZLWK FRQVLGHUDWLRQIRUWKH FDQFHU GLVHDVHSURFHVVVLGH HIIHFWVRIFDQFHU WUHDWPHQWDQG SRVVLEOH UHFXUUHQWGLVHDVH $SSURSULDWHO\ H[DPLQHFRPPXQLFDWLRQ DIIHFWFRJQLWLRQ ODQJXDJHDQGOHDUQLQJ VW\OHRIWKHLQGLYLGXDO ZLWKLQWKHFRQVWUDLQWVRI DYDLODEOHHTXLSPHQWDQG HQYLURQPHQWDQGZLWK DSSURSULDWHGHOHJDWLRQ 2EVHUYLQJWKH SDWLHQWFOLHQWUHVSRQVH FROOHFWV GDWDLQDQDSSURSULDWH PDQQHUDQGDVVLJQVWR SDWLHQWFOLHQW DSSURSULDWH FODVVLILFDWLRQ 5HFRPPHQGLQJ DFWLRQVEDVHGRQWKH UHVXOWV 3RVVLEOHDFWLRQV LQFOXGHGHFLVLRQWR HYDOXDWH UHIHUUDOWRRWKHU SURYLGHUVDQGQRIXUWKHU LQWHUYHQWLRQ UHFRPPHQGHG 6HOHFWDQGSULRULWL]H WHVWVDQGPHDVXUHV EDVHGRQKLVWRU\ V\VWHPVUHYLHZ VFLHQWLILFPHULWFOLQLFDO XWLOLW\DQGSK\VLRORJLFRU ILVFDOFRVWWRWKH LQGLYLGXDOUHODWLYH WRFULWLFDOLW\RIGDWD 3HUIRUPWHVWVDQG PHDVXUHVWRLQFOXGH $$HURELF FDSDFLW\HQGXUDQFH ā$HFRELFFDSDFLW\ GXULQJIXQFWLRQDO DFWLYLWLHVHJ$'/ VFDOHV LQGH[HVREVHUYDWLRQV ā$HURELFFDSDFLW\ GXULQJVWDQGDUGL]HG 6HOHFWLQJDQGSULRULWL]LQJ DSSURSULDWHWHVWVDQG PHDVXUHVEDVHGRQWKH UHVXOWVRILQLWLDOKLVWRU\ DQGV\VWHPVUHYLHZ H[DPLQDWLRQ 3ULRULWL]LQJWHVW VHOHFWLRQEDVHGRQ VFLHQWLILF PHULWDQGFOLQLFDOXWLOLW\ DVGHWHUPLQHGE\EHVW DYDLODEOHHYLGHQFH 3HUIRUPLQJFOLQLFDO WHVWVDQGPHDVXUHV VXFKWKDW GDWDFROOHFWLRQLV DFFXUDWHDQGSUHFLVH LQFOXGLQJ WKHIROORZLQJ HYDOXDWHUHIHUUDOWR RWKHU SURYLGHUVDQGQR LQWHUYHQWLRQ UHFRPPHQGHG 'RFXPHQWLQJ DSSURSULDWHO\DQG FRPPXQLFDWLQJ UHVXOWVRIV\VWHPV UHYLHZDVQHHGHG 6HOHFWDQGSULRULWL]H WHVWVDQGPHDVXUHV EDVHGRQKLVWRU\ V\VWHPVUHYLHZ VFLHQWLILFPHULWFOLQLFDO XWLOLW\ DQGSK\VLRORJLFRUILVFDO FRVWWRSDWLHQWFOLHQW UHODWLYHWRFULWLFDOLW\RI GDWD 3HUIRUPWHVWVDQG PHDVXUHVWRLQFOXGH D$HURELF &DSDFLW\(QGXUDQFH $HURELFFDSDFLW\ GXULQJIXQFWLRQDO DFWLYLWLHVHJ DFWLYLWLHVRIGDLO\OLYLQJ >$'/@VFDOHVLQGH[HV 6HOHFWDQGSULRULWL]H WHVWVDQGPHDVXUHV EDVHGRQKLVWRU\ V\VWHPVUHYLHZ VFLHQWLILFPHULWFOLQLFDO XWLOLW\DQGSK\VLRORJLFRU ILVFDOFRVWWR SDWLHQWFOLHQWUHODWLYHWR FULWLFDOLW\RIGDWD 6HOHFWWHVWVDQG PHDVXUHVFRQVLGHULQJ VH[GLIIHUHQFHVLQKHDOWK VWDWXVDFURVVWKHOLIH VSDQ 6HOHFWPHDVXUHVWKDW UHVXOWLQDFFXUDWHDQG SUHFLVHGDWD $SSURSULDWHO\H[DPLQH FRPPXQLFDWLRQ $HURELFFDSDFLW\DQG HQGXUDQFH ±±([DPLQDWLRQRI SDWLHQWFOLHQW¶VDELOLW\WR FRQWURODXWRQRPLF QHUYRXVV\VWHP SK\VLRORJLFDODQG EHKDYLRUDO VLJQVRIVWUHVVDQG VWDELOLW\ ±±([DPLQDWLRQRIVLJQV RIUHVSLUDWRU\GLVWUHVVDW UHVWGXULQJDFWLYLW\DQG GXULQJUHFRYHU\ ±±([DPLQDWLRQRI SHUFHLYHGH[HUWLRQDQG G\VSQHDXVLQJ DYLVXDODQDORJRURWKHU UDWLQJVFDOH 3 IXQFWLRQDFURVVWKH OLIHVSDQLQFOXGLQJ SUHYHQWLRQRU UHFRJQLWLRQRI UHFXUUHQFHRIFDQFHU H[HUFLVHWHVWSURWRFROV HJ (UJRPHWU\ WLPHGLVWDQFHZDONUXQ WUHDGPLOOWHVWV ZKHHOFKDLUWHVWV ā&DUGLRYDVFXODUVLJQV DQGV\PSWRPVLQ UHVSRQVHWRLQFUHDVHG R]\JHQGHPDQGZLWK H[HUFLVHRUDFWLYLW\ LQFOXGLQJSUHVVXUHVDQG IORZ KHDUWUDWHUK\WKPDQG VRXQGVR[LPHWU\DQG VXSHUILFLDOYDVFXODU UHVSRQVHVHJ$QJLQD FODXGLFDWLRQDQG SHUFHLYHGH[HUWLRQ VFDOHV HOHFWURFDUGLRJUD\SK REVHUYDWLRQVSDOSDWLRQ ā3XOPRQDU\VLJQVDQG V\PSWRPVLQUHVSRQVH WRLQFUHDVHGR[\JHQ GHPDQGZLWKH[HUFLVHRU DFWLYLW\LQFOXGLQJEUHDWK DQGYRLFHVRXQGV F\DQRVLVJDV H[FKDQJHUHVSLUDWRU\ SDWWHUQUDWHYHQWLOWRU\ IORZ IRUFHDQGYROXPH ā(IIHFWVRIRWKHU FDQFHUUHODWHGPHGLFDO DQGSKDUPDFRORJLFDO LQWHUYHQWLRQVRQ DHURELF FDSDFLW\HQGXUDQFH HJ&DUGLRWR[LFLW\ UHODWHGWR FKHPRWKHUDS\ SXOPRQDU\UDGLDWLRQ ILEURVLVFDQFHU UHODWHG í$HURELF FDSDFLW\HQGXUDQFHH[HU FLVH²LQLWLDO H[DPDQG UHH[DPLQDWLRQ ,QGHSHQGHQWO\ FRQGXFWLQJRUDVVLVWLQJ ZLWKPD[LPXP V\PSWRPOLPLWHG H[HUFLVH WHVWVXVLQJDQ HUJRPHWHUWUHDGPLOO RUDSSURSULDWHPRGDOLW\ ZLWKRUZLWKRXW PHWDEROLF PHDVXUHPHQWV ,QGHSHQGHQWO\ FRQGXFWLQJVXEPD[LPDO H[HUFLVHWHVWV $VVHVVLQJFDUGLDF SXPSIXQFWLRQ GLIIHUHQWLDWLQJSDWLHQW GULYHQYHUVXV PHFKDQLFDOVXSSRUWHJ YHQWULFXODU DVVLVWGHYLFH9$' SDUDPHWHUV SXOPRQDU\DUWHU\ SUHVVXUHV LQVWUXPHQWDODFWLYLWLHVRI GDLO\OLYLQJ>,$'/@ VFDOHVREVHUYDWLRQV $HURELFFDSDFLW\ GXULQJVWDQGDUGL]HG H[HUFLVHWHVW SURWRFROVHJ HUJRPHWU\VWHSWHVWV WLPHGLVWDQFH ZDONUXQWHVWVWUHDGPLOO WHVWVR[\JHQWLWUDWLRQ ZKHHOFKDLUWHVWV &DUGLRYDVFXODUVLJQV DQGV\PSWRPVLQ UHVSRQVHWR LQFUHDVHGR[\JHQ GHPDQGZLWKH[HUFLVHRU DFWLYLW\ LQFOXGLQJSUHVVXUHVDQG IORZKHDUWUDWHUK\WKP DQGVRXQGVR[LPHWU\ DQGVXSHUILFLDOYDVFXODU UHVSRQVHVHJDQJLQD FODXGLFDWLRQDQG SHUFHLYHG H[HUWLRQVFDOHV HOHFWURFDUGLRJUDSK\ REVHUYDWLRQV SDOSDWLRQ VSK\JPRPDQRPHWU\ 3XOPRQDU\VLJQVDQG V\PSWRPVLQUHVSRQVH WR LQFUHDVHGR[\JHQ GHPDQGZLWKH[HUFLVHRU DFWLYLW\ LQFOXGLQJEUHDWKDQG YRLFHVRXQGVF\DQRVLV JDV H[FKDQJHUHVSLUDWRU\ SDWWHUQUDWHDQG UK\WKP DQGYHQWLODWRU\IORZ IRUFHDQGYROXPHHJ DXVFXOWDWLRQ FRJQLWLRQDIIHFWDQG OHDUQLQJVW\OH 3HUIRUPWHVWVDQG PHDVXUHVWRLQFOXGH D$FWLYHUDQJHRIPRWLRQ HJDVVHVVPHQWRI PXVFOHOHQJWKVLQJOH MRLQWDQGPXOWLVHJPHQWDO PRYHPHQWV E$VVLVWLYHDQGDGDSWLYH GHYLFHVHJ DVVHVVPHQWRI DSSURSULDWHQHVV DOLJQPHQWDQGILW VDIHW\ F%LRIHHGEDFNHJ HOHFWURP\RJUDSK\DQG SUHVVXUH G&LUFXODWLRQHJVFUHHQ IRUFLUFXODWRU\ DEQRUPDOLWLHV O\PSKHGHPD H&RPPXQLW\ZRUN MREVFKRROSOD\DQG OHLVXUHLQWHJUDWLRQRU UHLQWHJUDWLRQHJ ,QVWUXPHQWDO$FWLYLWLHVRI 'DLO\/LYLQJ,$'/V LQWHUFRXUVH I (UJRQRPLFV DQGERG\PHFKDQLFV J (QYLURQPHQWDO KRPHDQGZRUN MREVFKRROSOD\ EDUULHUVHJ DUFKLWHFWXUDOEDUULHUV K *DLW ORFRPRWLRQDQGEDODQFH HJDQDO\VLVZLWKDQG ZLWKRXWDVVLVWLYHRU RWKHUGHYLFHVRQ YDULRXVWHUUDLQVLQ ±±([DPLQDWLRQRI SHUIRUPDQFHGXULQJ HVWDEOLVKHG DJHDSSURSULDWH H[HUFLVHSURWRFROVHJ WUHDGPLOOHUJRPHWHU WLPHGWHVW ±±([DPLQDWLRQRIDJH DSSURSULDWHYLWDOVLJQV HJEORRG SUHVVXUHKHDUWUDWH UHVSLUDWRU\UDWHDWUHVW DFWLYLW\DQG UHFRYHU\ ±±([DPLQDWLRQRI WKRUDFRDEGRPLQDO PRYHPHQWVDQG EUHDWKLQJSDWWHUQV DSSURSULDWHIRU SDWLHQW¶VFOLHQW¶VDJH ±±$XVFXODWLRQRIOXQJ VRXQGV ±±0RQLWRULQJYLD WHOHPHWU\GXULQJDFWLYLW\ ±±3HUIRUPDQFHDQGRU DQDO\VLVRISXOVH R[LPHWU\ ±±3HUIRUPDQFHRIDJH DSSURSULDWHWHVWRI SXOPRQDU\ IXQFWLRQ E $QWKURSRPHWULF FKDUDFWHULVWLFV ±±([DPLQDWLRQRI DFWLYLWLHVDQGSRVWXUHV WKDWDJJUDYDWHRU UHOLHYHHGHPDRU HIIXVLRQ ±±([DPLQDWLRQRI HGHPDWKURXJK SDOSDWLRQYROXPHRU JLUWKPHDVXUHPHQWV ±±0HDVXUHPHQWRI KHLJKWDQGZHLJKWDQG OHQJWKDQG 4 IDWLJXH P\HORVXSUHVVLRQ FDFKH[LDHWF %$URXVDO$WWHQWLRQ DQG&RJQLWLRQ ā$URXVDODQGDWWHQWLRQ HJ$GDSWDELOLW\WHVWV DURXVDODQG DZDUHQHVVVFDOHV SURILOHVTXHVWLRQQDLUHV ā&RJQLWLRQLQFOXGLQJ DELOLW\WRSURFHVV FRPPDQGVHJ6DIHW\ DZDUHQHVV PDQDJHPHQWRIKRPH H[HUFLVHSURJUDP LQWHUYLHZV PHQWDOVWDWHVFDOHV REVHUYDWLRQV TXHVWLRQQDLUHV ā&RPPXQLFDWLRQDQG ODQJXDJHEDUULHUV ā&RQVFLRXVQHVV LQFOXGLQJGHPHQWLDRU GHOLULXPDFXWHPHQWDO VWDWXV FKDQJHV ā0RWLYDWLRQDQG FDSDFLW\WRSDUWLFLSDWHLQ LQWHUYHQWLRQ ā2ULHQWDWLRQWRWLPH SHUVRQSODFHDQG VLWXDWLRQ ā(IIHFWVRIFDQFHU UHODWHGPHGLFDODQG SKDUPDFRORJLFDO LQWHUYHQWLRQVRQ DWWHQWLRQDURXVDODQG FRJQLWLRQHJ &KHPRWKHUDS\ UHODWHGFRJQLWLYH FKDQJHVZKROHEUDLQ UDGLDWLRQ SDUDQHRSODVWLF G\VSQHDDQGSHUFHLYHG H[HUWLRQVFDOHV JDVDQDO\VHV REVHUYDWLRQVR[LPHWU\ SDOSDWLRQ SXOPRQDU\IXQFWLRQ WHVWV (IIHFWVRIRWKHU PHGLFDODQG SKDUPDFRORJLFDO LQWHUYHQWLRQVRQDHURELF FDSDFLW\HQGXUDQFHHJ WHOHPHWU\SDFHPDNHU FDUGLDFPHGLFDWLRQV E$URXVDO$WWHQWLRQ DQG&RJQLWLRQ $URXVDODQGDWWHQWLRQ HJDGDSWDELOLW\WHVWV DURXVDODQGDZDUHQHVV VFDOHVSURILOHV TXHVWLRQQDLUHV &RJQLWLRQLQFOXGLQJ DELOLW\WRSURFHVV FRPPDQGV HJVDIHW\DZDUHQHVV FKHFNOLVWVPDQDJHPHQW RI KRPHH[HUFLVHSURJUDP LQWHUYLHZVPHQWDOVWDWH VFDOHVREVHUYDWLRQV TXHVWLRQQDLUHV &RPPXQLFDWLRQDQG ODQJXDJHEDUULHUVHJ IXQFWLRQDO FRPPXQLFDWLRQSURILOHV LQWHUYLHZVLQYHQWRULHV REVHUYDWLRQV TXHVWLRQQDLUHV DVVHVVPHQWRI H[SUHVVLYHUHFHSWLYH DSKDVLD &RQVFLRXVQHVV LQFOXGLQJDJLWDWLRQ GHPHQWLD GLIIHUHQWHQYLURQPHQWV VDIHW\DVVHVVPHQW L ,QWHJXPHQWDU\ WLVVXHTXDOLW\HJVLJQV RILQIODPPDWLRQVRIW WLVVXH VZHOOLQJLQIODPPDWLRQLQI HFWLRQ M-RLQWLQWHJULW\HJ PRELOLW\DVVHVVPHQWRI MRLQWK\SHUDQG K\SRPRELOLW\WRLQFOXGH SDVVLYHUDQJHRIPRWLRQ SDVVLYHDFFHVVRU\ PRWLRQVUHVSRQVHWR PDQXDOSURYRFDWLRQ N0RWRUIXQFWLRQHJ DVVHVVPHQWRIPRWRU OHDUQLQJDQGPRWRU FRQWURO O0XVFOHSHUIRUPDQFH LQFOXGLQJVWUHQJWK SRZHUDQGHQGXUDQFH P1HXUDOPRELOLW\HJ OLPEWHQVLRQWHVWV Q1HXURPRWRU GHYHORSPHQWDQG VHQVRU\LQWHJUDWLRQHJ DVVHVVPHQWRI DSSURSULDWH GHYHORSPHQWGH[WHULW\ FRRUGLQDWLRQDQG LQWHJUDWLRQRI VRPDWRVHQVRU\YLVXDO DQGYHVWLEXODUV\VWHPV R2UWKRWLFSURWHFWLYH DQGVXSSRUWLYHGHYLFHV HJDVVHVVPHQWRI DSSURSULDWHQHVVXVH UHPHGLDWLRQRI LPSDLUPHQWDOLJQPHQW DQGILWVDIHW\ S3DLQHJDVVHVVPHQW XVLQJTXHVWLRQQDLUHV JLUWKRIUHOHYDQWERG\ SDUW ±±0HDVXUHPHQWRIOHJ OHQJWK ±±2WKHUPHDVXUHPHQWV QHHGHGIRUDVVLVWLYHDQG DGDSWLYH GHYLFHV F $URXVDO DWWHQWLRQDQGFRJQLWLRQ ±±([DPLQDWLRQRI DURXVDODWWHQWLRQDQG FRJQLWLRQXVLQJ VWDQGDUGL]HG DVVHVVPHQWV ±±([DPLQDWLRQRI IDFWRUVWKDWDIIHFWRU LQIOXHQFHPRWLYDWLRQDO OHYHO ±±([DPLQDWLRQRI EHKDYLRUDOUHVSRQVHV ±±6FUHHQLQJRIOHYHORI FRQVFLRXVQHVVHJ *ODVJRZFRPD VFRUH ±±6FUHHQLQJRIOHYHORI UHFDOOHJVKRUWWHUP DQGORQJWHUP PHPRU\ ±±6FUHHQLQJRI SDWLHQW¶VFOLHQW¶VOHYHORI DURXVDODQGDWWHQWLRQ ±±6FUHHQLQJRI SDWLHQW¶VFOLHQW¶V EHKDYLRUDOVWDWH RUJDQL]DWLRQ DQGVWDELOLW\ ±±6FUHHQLQJRI RULHQWDWLRQWRWLPH SHUVRQDQGSODFH DSSURSULDWHIRU SDWLHQW¶VFOLHQW¶VDJH ±±6FUHHQLQJIRUJURVV H[SUHVVLYHDQG UHFHSWLYHGHILFLWV 5 GLVRUGHUVPHWDVWDWLF GLVHDVHWRWKHEUDLQ &$VVLVWLYHDQG $GDSWLYH'HYLFHV ā$VVLVWLYHRUDGDSWLYH GHYLFHVDQGHTXLSPHQW XVHGGXULQJ IXQFWLRQDODFWLYLWLHV ā&RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUHIRUWKHDVVLVWLYH RU DGDSWLYHGHYLFHVDQG HTXLSPHQW ā5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO LPLWDWLRQVRUGLVDELOLWLHV ZLWKXVHRIDVVLVWLYHRU DGDSWLYHGHYLFHVDQG HTXLSPHQW ā6DIHW\GXULQJXVHRI DVVLVWLYHRUDGDSWLYH GHYLFHVDQGHTXLSPHQW ā$VVHVVPHQWRI ILQDQFLDO UHVRXUFHVFRPPXQLW\ UHVRXUFHVWRDVVLVW LQREWDLQLQJGHYLFHVDQG HTXLSPHQWDQGKRPH PRGLILFDWLRQ ā$SSURSULDWHSODQQLQJ IRUXVHRIDVVLVWLYHRU DGDSWLYHGHYLFHV EDVHGRQWKH FRQWLQXXPRIFDQFHU FDUHHJ/LPE VDOYDJHVNLQ LQWHJULW\IROORZLQJ UDGLDWLRQWKHUDS\ QHXURWR[LFLWLHV O\PSKHGHPD '&LUFXODWLRQ ā&DUGLRYDVFXODUVLJQV LQFOXGLQJKHDUWUDWH UK\WKPDQG GHOLULXPDQGFRPDHJ FOLQLFDOVLJQVDQG V\PSWRPV VFDOHV 0RWLYDWLRQDQG FDSDFLW\WRSDUWLFLSDWHLQ LQWHUYHQWLRQ 2ULHQWDWLRQWRWLPH SHUVRQSODFHDQG VLWXDWLRQ HJDWWHQWLRQWHVWV OHDUQLQJSURILOHVPHQWDO VWDWH VFDOHV 5HFDOOLQFOXGLQJ PHPRU\DQGUHWHQWLRQ HJ DVVHVVPHQWVFDOHV LQWHUYLHZV TXHVWLRQQDLUHV F$VVLVWLYHDQG $GDSWLYH'HYLFHV 7KHSK\VLFDOWKHUDS\ VSHFLDOLVWLQJHULDWULFV SHUIRUPV WHVWVDQGPHDVXUHVWR GHWHUPLQHWKHSRWHQWLDO EHQHILWV DQGXVHRI DVVLVWLYHDGDSWLYH GHYLFHVEDVHGRQ NQRZOHGJHRI$'$ JXLGHOLQHVRQ DFFHVVLELOLW\DQG EDVHGRQSDWLHQW PRELOLW\DQGDELOLW\WR SHUIRUP WDVNV7KHVHWHVWVDQG PHDVXUHVLQFOXGH $VVLVWLYHRUDGDSWLYH GHYLFHVDQGHTXLSPHQW XVHGXULQJIXQFWLRQDO DFWLYLWLHVHJ$'/ VFDOHV,$'/ EHKDYLRUDOVFDOHVYLVXDO DQDORJVFDOHV T3HOYLFIORRU H[DPLQDWLRQERWK YDJLQDODQGUHFWDO U3HULSKHUDOQHUYH LQWHJULW\HJSXGHQGDO QHUYH V3RVWXUHHJ DVVHVVPHQWRIERG\RU ERG\VHJPHQWV VWUXFWXUHDOLJQPHQW FKDQJHVLQGLIIHUHQW SRVLWLRQVERG\ FRQWRXUV W5HIOH[LQWHJULW\HJ DVVHVVPHQWRIQRUPDO DQGSDWKRORJLFDO UHIOH[HV 86FUHHQLQJIRU YRLGLQJGHIHFDWLRQ G\VIXQFWLRQ Y6HQVRU\LQWHJULW\HJ DVVHVVPHQWRI VXSHUILFLDOVHQVDWLRQ GHUPDWRPHV P\RWRPHVSURSULRFHSWLR QDQGNLQHVWKHVLD :6RIWWLVVXH DVVHVVPHQWHJ P\RIDVFLDOPRELOLW\ WULJJHUSRLQW DVVHVVPHQW 5HH[DPLQDWLRQ $GPLQLVWHUVHOHFWHG VSHFLILFWHVWVDQG PHDVXUHVIRUDGGLWLRQDO SUREOHPVQRWGHWHFWHG E\KLVWRU\RU UHDVVHVVPHQW DFFRUGLQJWR SDWLHQW¶VFOLHQW¶VDJH G$VVLVWLYHDQGDGDSWLYH GHYLFHV ±±$QDO\VLVRI DSSURSULDWHFRPSRQHQWV RIGHYLFH ±±$QDO\VLVRIHIIHFWV DQGEHQHILWVLQFOXGLQJ HQHUJ\FRQVHUYDWLRQ DQGH[SHQGLWXUHZKLOH SDWLHQWFOLHQWXVHV GHYLFH ±±$QDO\VLVRIWKH SRWHQWLDOWRUHPHGLDWH LPSDLUPHQW IXQFWLRQDOOLPLWDWLRQRU GLVDELOLW\WKURXJKXVHRI GHYLFH ±±([DPLQDWLRQRI DOLJQPHQWDQGILWRI GHYLFH ±±([DPLQDWLRQRIVDIHW\ GXULQJXVHRIGHYLFHV &RPPXQLW\DQG:RUN -RE6FKRRO3OD\ ,QWHJUDWLRQRU 5HLQWHJUDWLRQ ±±$GPLQLVWUDWLRQRI TXHVWLRQQDLUHVDQG FRQGXFWLQJRI LQWHUYLHZVZLWKWKH SDWLHQWFOLHQWIDPLO\ DQGRWKHUV ±±$GPLQLVWUDWLRQRI IXQFWLRQDORXWFRPHV PHDVXUH ±±$QDO\VLVRIDGDSWLYH VNLOOV ±±&RPSOLDQFHZLWK IHGHUDOOHJLVODWLRQHJ $'$DQG ,'($,$ 6 VRXQGVSUHVVXUHVDQG IORZDQGVXSHUILFLDO YDVFXODUUHVSRQVHV HJDXVFXOWDWLRQ HOHFWURFDUGLRJUDSK\ JLUWKPHDVXUHPHQW REVHUYDWLRQVSDOSDWLRQ VSK\JPRPDQRPHWU\ DQNOHEUDFKLDO LQGH[SHUFHLYHG H[HUWLRQVFDOHV ā&DUGLRYDVFXODU V\PSWRPVHJDQJLQD FODXGLFDWLRQ ā/\PSKDWLFV\VWHP IXQFWLRQHJJLUWKDQG YROXPH PHDVXUHPHQWV SDOSDWLRQREVHUYDWLRQRI VNLQWH[WXUHVXEFOLQLFDO O\PSKHGHPD ā3K\VLRORJLFDO UHVSRQVHVWRSRVLWLRQ FKDQJHLQFOXGLQJ DXWRQRPLFUHVSRQVHV FHQWUDODQGSHULSKHUDO SUHVVXUHVKHDUW UDWHDQGUK\WKP UHVSLUDWRU\UDWHDQG UK\WKPYHQWLODWRU\ SDWWHUQHJ DXVFXOWDWLRQ HOHFWURFDUGLRJUDSK\ REVHUYDWLRQV SDOSDWLRQVNLQFRORU FKDQJHV VSK\JPRPDQRPHWU\ SKDUPDFRORJLFDOVLJQV DQGV\PSWRPV ā$VVHVVPHQWRI FRPSURPLVHGRU DOWHUHGFLUFXODWLRQGXH WR FDQFHUWUHDWPHQWHJ 9DVFXODULW\RI VFDOHVLQWHUYLHZV REVHUYDWLRQV &RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUH IRUWKHDVVLVWLYHRU DGDSWLYHGHYLFHVDQG HTXLSPHQW HJLQWHUYLHZVORJV REVHUYDWLRQV SUHVVXUHVHQVLQJ PDSVSDWLHQWFDUHJLYHU UHSRUWV 5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQV RUGLVDELOLWLHVZLWKXVHRI DVVLVWLYHRUDGDSWLYH GHYLFHVDQGHTXLSPHQW HJDFWLYLW\VWDWXV LQGH[HV$'/DQG,$'/ VFDOHVDHURELFFDSDFLW\ WHVWVIXQFWLRQDO SHUIRUPDQFH LQYHQWRULHVKHDOWK DVVHVVPHQW TXHVWLRQQDLUHVSDLQ VFDOHVYLGHRJUDSKLF DVVHVVPHQWV DVVHVVPHQWVRIHQHUJ\ FRQVHUYDWLRQ DQGHQHUJ\H[SHQGLWXUH 6DIHW\GXULQJXVHRI DVVLVWLYHRUDGDSWLYH GHYLFHV DQGHTXLSPHQWHJ GLDULHVIDOOVFDOHV LQWHUYLHZV ORJVREVHUYDWLRQV SDWLHQWFDUHJLYHU UHSRUWV $VVHVVPHQWRI ILQDQFLDO UHVRXUFHVFRPPXQLW\ ±±$QDO\VLVRI FRPPXQLW\ZRUN MREVFKRROSOD\DQG OHLVXUHDFWLYLWLHV ±±([DPLQDWLRQRI SK\VLRORJLFUHVSRQVHV GXULQJFRPPXQLW\ ZRUNMREVFKRROSOD\ DQGOHLVXUHDFWLYLWLHV I&UDQLDOQHUYHLQWHJULW\ ±±([DPLQDWLRQRI GHUPDWRPHVLQQHUYDWHG E\WKHFUDQLDO QHUYHV ±±([DPLQDWLRQRIELWH VXFNLQJFRXJK VZDOORZDQGJDJ UHIOH[HV ±±([DPLQDWLRQRI PXVFOHVLQQHUYDWHGE\ WKHFUDQLDO QHUYHV ±±([DPLQDWLRQRI UHVSRQVHWRWKH IROORZLQJVWLPXOL DXGLWRU\JXVWDWRU\ ROIDFWRU\YHVWLEXODU YLVXDO ±±([DPLQDWLRQRI VXFNVZDOORZLQJ IXQFWLRQ J(QYLURQPHQWDO+RPH DQG:RUN -RE6FKRRO3OD\ %DUULHUV ±±([DPLQDWLRQRI FXUUHQWDQGSRWHQWLDO EDUULHUV ±±0HDVXUHPHQWDQG SK\VLFDOLQVSHFWLRQRI WKHHQYLURQPHQW ±±&RPSLODWLRQRI TXHVWLRQQDLUHVDQG LQWHUYLHZVFRQGXFWHG 7 LUUDGLDWHGWLVVXHVRIW WLVVXH IODSVIRU UHFRQVWUXFWLYH SURFHGXUHVQHFN IDFHEUHDVW ((QYLURQPHQWDO +RPHDQG:RUN %DUULHUV ā&XUUHQWDQGSRWHQWLDO EDUULHUVHJFKHFNOLVWV LQWHUYLHZV REVHUYDWLRQV TXHVWLRQQDLUHV ā3K\VLFDOVSDFHDQG HQYLURQPHQWHJ$'$ FRPSOLDQFH VWDQGDUGVREVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV TXHVWLRQQDLUHV VWUXFWXUDOVSHFLILFDWLRQV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWV ā+RPHDVVHVVPHQWHJ VWDQGDUGL]HGWHVWVIRU KRPH DVVHVVPHQWPRGLILFDWLR QLH)XQFWLRQDO+RPH $VVHVVPHQW 3URILOH ā$VVHVVPHQWRI ZLOOLQJQHVVWRFKDQJH DQGILVFDOUHVRXUFHVWR EULQJDERXWFKDQJH ā$VVHVVPHQWRI HQYLURQPHQWDOEDUULHUV WRUHWXUQWRZRUNHJ 'LVFULPLQDWLRQEDVHG RQFDQFHUGLDJQRVLV JHQHWLFWHVWLQJ LPSOLFDWLRQV UHVRXUFHVWRDVVLVWLQ REWDLQLQJGHYLFHVDQG HTXLSPHQW DQGKRPHPRGLILFDWLRQ G&LUFXODWLRQ$UWHULDO 9HQRXV/\PSKDWLF &DUGLRYDVFXODUVLJQV LQFOXGLQJKHDUWUDWH UK\WKP DQGVRXQGVSUHVVXUHV DQGIORZDQGVXSHUILFLDO YDVFXODUUHVSRQVHVHJ DXVFXOWDWLRQ HOHFWURFDUGLRJUDSK\ JLUWKPHDVXUHPHQW REVHUYDWLRQVSDOSDWLRQ VSK\JPRPDQRPHWU\ DQNOHEUDFKLDOLQGH[ SHUFHLYHGH[HUWLRQ VFDOHV &DUGLRYDVFXODU V\PSWRPVHJDQJLQD FODXGLFDWLRQ /\PSKDWLFV\VWHP IXQFWLRQHJJLUWKDQG YROXPH PHDVXUHPHQWV SDOSDWLRQREVHUYDWLRQRI VNLQWH[WXUH 3K\VLRORJLFDO UHVSRQVHVWRSRVLWLRQ FKDQJHLQFOXGLQJ DXWRQRPLFUHVSRQVHV FHQWUDODQGSHULSKHUDO SUHVVXUHVKHDUWUDWH DQGUK\WKPUHVSLUDWRU\ UDWH DQGUK\WKPYHQWLODWRU\ SDWWHUQHJ DXVFXOWDWLRQ HOHFWURFDUGLRJUDSK\ REVHUYDWLRQVSDOSDWLRQ VNLQ ZLWKWKHSDWLHQWFOLHQW IDPLO\DQGRWKHUVDV DSSURSULDWH K*DLW/RFRPRWLRQDQG %DODQFH ±±$GPLQLVWUDWLRQRI EDODQFHDVVHVVPHQW LQVWUXPHQWV ±±$QDO\VLVRI DUWKURNLQHPDWLF ELRPHFKDQLFDO NLQHPDWLF DQGNLQHWLF FKDUDFWHULVWLFVRIJDLW ORFRPRWLRQDQGEDODQFH XVLQJGDWDIURPYLVXDO DVVHVVPHQWOLQHDU PHDVXUHV JRQLRPHWULFPHDVXUHV HWF ±±$QDO\VLVRI DUWKURNLQHPDWLF ELRPHDFKDQLFDO NLQHPDWLF DQGNLQHWLF FKDUDFWHULVWLFVRIJDLW ORFRPWLRQDQG EDODQFHXVLQJGDWDIURP (0*YLGHRWDSH FRPSXWHUDVVLVWHG JUDSKLFVZHLJKWEHDULQJ VFDOHVDQGRUIRUFH SODWHV ±±$QDO\VLVRIJDLW ORFRPRWLRQDQGEDODQFH RQYDULRXV WHUUDLQVDQGLQGLIIHUHQW SK\VLFDOHQYLURQPHQWV ±±$QDO\VLVRI ZKHHOFKDLUPDQDJHPHQW DQGPRELOLW\ ±±$VVHVVPHQWRIVDIHW\ ±±,GHQWLILFDWLRQDQG TXDQWLILFDWLRQRIJDLW FKDUDFWHULVWLFV 8 )(UJRQRPLFVDQG %RG\0HFKDQLFV ā(UJRQRPLFVUHODWHG WRFDQFHUDQGFDQFHU WUHDWPHQWVLGH HIIHFWVVHHQLQWKH RQFRORJLFSRSXODWLRQ HJGHIRUPLWLHVDQG SRVWXUDOFKDQJHV UHODWHGWROLPE VDOYDJHDQG520DQG SRVWXUDO FKDQJHVDVVRFLDWHG ZLWKUDGLDWLRQILEURVLV SRVLWLRQDO FRQVLGHUDWLRQVZLWK VNHOHWDOFRPSURPLVH IURPPHWDVWDVLV ā%RG\PHFKDQLFV GXULQJVHOIFDUHKRPH PDQDJHPHQWZRUN FRPPXQLW\RUOHLVXUH DFWLRQVWDVNVRU DFWLYLWLHVHJ$'/DQG ,$'/VFDOHV REVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWV ā%RG\PHFKDQLFVZLWK FDUHJLYHUDFWLYLWLHVHJ REVHUYDWLRQ HQYLURQPHQWDO DVVHVVPHQWSDWLHQW KDQGOLQJQHHGVDQG VDIHW\ ZLWKVNHOHWDO FRPSURPLVHIURP PHWDVWDVLVVDIHW\ZLWK VSLQDO FRUGWXPRU FRPSUHVVLRQ FRORUFKDQJHV VSK\JPRPDQRPHWU\ SKDUPDFRORJLFDO VLJQVDQGV\PSWRPV H(QYLURQPHQWDO +RPHDQG:RUN 3XUSRVHIXO $FWLYLW\%DUULHUV &XUUHQWDQGSRWHQWLDO EDUULHUVHJFKHFNOLVWV LQWHUYLHZV REVHUYDWLRQV TXHVWLRQQDLUHV 3K\VLFDOVSDFHDQG HQYLURQPHQWHJ$'$ FRPSOLDQFH VWDQGDUGVREVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV TXHVWLRQQDLUHV VWUXFWXUDOVSHFLILFDWLRQV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF YLGHRJUDSKLF DVVHVVPHQWV +RPHDVVHVVPHQWHJ VWDQGDUGL]HGWHVWVIRU KRPH DVVHVVPHQWPRGLILFDWLR QLH)XQFWLRQDO+RPH $VVHVVPHQW3URILOH $VVHVVPHQWRI ZLOOLQJQHVVWRFKDQJH DQGILVFDO UHVRXUFHVWREULQJDERXW FKDQJH I(UJRQRPLFVDQG%RG\ 0HFKDQLFV (UJRQRPLFVUHODWHGWR FRPPRQGLDJQRVHV VHHQ LQWKHJHULDWULF SRSXODWLRQHJOLJKWLQJ VHDWLQJ DVDSSURSULDWHIRUDJH OHYHOV ±±,GHQWLILFDWLRQDQG TXDQWLILFDWLRQRIVWDWLF DQGG\QDPLF EDODQFHFKDUDFWHULVWLFV L,QWHJXPHQWDU\,QWHJULW\ )RU,QWHJXPHQWDU\ 'LVUXSWLRQ ±±$VVHVVPHQWRI DFWLYLWLHVSRVLWLRQLQJ DQGSRVWXUHVWKDW DJJUDYDWHRUUHOLHYH SDLQRURWKHUGLVWXUEHG VHQVDWLRQV ±±([DPLQDWLRQRI DFWLYLWLHVSRVLWLRQLQJ SRVWXUHVDQG DVVLVWLYHDQGDGDSWLYH GHYLFHVWKDWPD\UHVXOW LQWUDXPD WRDVVRFLDWHGVNLQ ±±([DPLQDWLRQRI FRQWLQXLW\RIVNLQFRORU ±±([DPLQDWLRQRI VHQVDWLRQHJSDLQ WHPSHUDWXUHWDFWLOLW\ ±±&RPSDULVRQRIVNLQ WHPSHUDWXUHZLWKWKDWRI DQDGMDFHQW DUHDRUDQRSSRVLWH H[WUHPLW\ ±±([DPLQDWLRQRIWLVVXH PRELOLW\WXUJRUDQG WH[WXUH M,QWHJXPHQWDU\,QWHJULW\ )RU:RXQGV ±±([DPLQDWLRQIRUVLJQV RILQIHFWLRQ ±±([DPLQDWLRQRI DFWLYLWLHVGHYLFHV SRVLWLRQLQJDQG SRVWXUHVWKDWDJJUDYDWH WKHZRXQGRUVFDURU WKDWPD\ 9 **DLW/RFRPRWLRQDQG %DODQFH ā%DODQFHGXULQJ IXQFWLRQDODFWLYLWLHVZLWK RUZLWKRXWWKHXVHRI DVVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYHRUSURVWKHWLF GHYLFHVRUHTXLSPHQW HJ$'/VFDOHV,$'/ VFDOHVREVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV FRQILGHQFHLQGH[HV ā%DODQFHG\QDPLFDQG VWDWLFZLWKRUZLWKRXW WKHXVHRI DVVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYHRUSURVWKHWLF GHYLFHVRUHTXLSPHQW HJEDODQFHVFDOHV GL]]LQHVVLQYHQWRULHV G\QDPLFSRVWXURJUDSK\ IDOOVFDOHVPRWRU LPSDLUPHQWWHVWV REVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWVSRVWXUDO FRQWUROWHVWV ā*DLWDQGORFRPRWLRQ GXULQJIXQFWLRQDO DFWLYLWLHVRQYDULRXV VXUIDFHVZLWKRUZLWKRXW WKHXVHRIDVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYHVXSSRUWLYH RUSURVWKHWLFGHYLFHVRU HTXLSPHQW IRRWZHDUDVVHVVPHQW HJ$'/VFDOHVJDLW LQGH[HV,$'/VFDOHV PRELOLW\VNLOOSURILOHV REVHUYDWLRQV GHYLFHVFRPSXWHU VFUHHQVZLWKUHJDUGWR ELIRFDOV GHIRUPLWLHVDQGSRVWXUDO FKDQJHVUHODWHGWR DUWKULWLV DQG520FKDQJHV DVVRFLDWHGZLWKDJLQJ %RG\PHFKDQLFV GXULQJVHOIFDUHKRPH PDQDJHPHQW ZRUNFRPPXQLW\RU OHLVXUHDFWLRQVWDVNV RUDFWLYLWLHVHJ$'/ DQG,$'/VFDOHV REVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWV %RG\PHFKDQLFVZLWK FDUHJLYHUDFWLYLWLHVHJ REVHUYDWLRQ HQYLURQPHQWDO DVVHVVPHQWSDWLHQW KDQGOLQJHTXLSPHQW QHHGV J*DLW/RFRPRWLRQ DQG%DODQFH %DODQFHGXULQJ IXQFWLRQDODFWLYLWLHVZLWK RUZLWKRXW WKHXVHRIDVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYH VXSSRUWLYHRUSURVWKHWLF GHYLFHVRUHTXLSPHQW HJ$'/VFDOHV,$'/ VFDOHVREVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV FRQILGHQFHLQGH[HV SURGXFHDGGLWLRQDO WUDXPD ±±([DPLQDWLRQRIEXUQ ±±([DPLQDWLRQRI HFFK\PRVLV ±±([DPLQDWLRQRIVFDU WLVVXHEDQGLQJ SOLDELOLW\VHQVDWLRQ ±±([DPLQDWLRQRI ZRXQGGUDLQDJHVL]H VKDSHGHSWK DQGWXQQHOLQJ N-RLQW,QWHJULW\DQG 0RELOLW\ ±±([DPLQDWLRQRIMRLQW K\SHUPRELOLW\DQG K\SRPRELOLW\ ±±([DPLQDWLRQRIWKH TXDOLW\RIPRYHPHQWRI WKHMRLQWRU ERG\SDUWGXULQJ SHUIRUPDQFHRIVSHFLILF PRYHPHQWV ±±([DPLQDWLRQRIVRIW WLVVXHVZHOOLQJ LQIODPPDWLRQRU UHVWULFWLRQ ±±([DPLQDWLRQRIVSUDLQ O0RWRU)XQFWLRQ0RWRU &RQWURODQG/HDUQLQJ ±±$GPLQLVWUDWLRQRI QHRQDWDOQHXURORJLFDO QHXURPRWRU DQGQHXUREHKDYLRUDO VFDOHV ±±$QDO\VLVRI JHVWDWLRQDODJH DSSURSULDWHQHRQDWDO SRVWXUH DQGPRYHPHQW ±±$GPLQLVWUDWLRQRI PRWRUDVVHVVPHQW VFDOHV 30 YLGHRJUDSKLF DVVHVVPHQWV ā*DLWDQGORFRPRWLRQ ZLWKRUZLWKRXWWKHXVH RIDVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYHVXSSRUWLYH RUSURVWKHWLFGHYLFHV RUHTXLSPHQWHJ IRRWSULQWDQDO\VHVJDLW LQGH[HVPRELOLW\VNLOO SURILOHVJDLWSDUDPHWHU VFDOHVREVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWVZHLJKW EHDULQJVFDOHV ZKHHOFKDLUPRELOLW\ WHVWV ā6DIHW\GXULQJJDLW ORFRPRWLRQDQGEDODQFH HJFRQILGHQFH VFDOHVGLDULHVIDOOULVN DVVHVVPHQWVFDOHV IXQFWLRQDO DVVHVVPHQWSURILOHV ORJVUHSRUWV +,QWHJXPHQWDU\ ,QWHJULW\ ā$FWLYLWLHVSRVLWLRQLQJ DQGSRVWXUHVWKDW SURGXFHRUUHOLHYH WUDXPDWRWKHVNLQHJ REVHUYDWLRQV LGHQWLILFDWLRQRI UDGLDWLRQ ILHOGWLVVXHFKDQJHV UHFRQVWUXFWLYHWLVVXH IODSSURWHFWLRQ ā$VVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYHRU %DODQFHG\QDPLFDQG VWDWLFZLWKRUZLWKRXW WKH XVHRIDVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYHVXSSRUWLYH RUSURVWKHWLFGHYLFHVRU HTXLSPHQWHJ EDODQFHVFDOHV GL]]LQHVVLQYHQWRULHV G\QDPLFSRVWXURJUDSK\ IDOOVFDOHVPRWRU LPSDLUPHQWWHVWV REVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWVSRVWXUDO FRQWUROWHVWV *DLWDQGORFRPRWLRQ GXULQJIXQFWLRQDO DFWLYLWLHV RQYDULRXVVXUIDFHVZLWK RUZLWKRXWWKHXVHRI DVVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYH RUSURVWKHWLFGHYLFHVRU HTXLSPHQWIRRWZHDU DVVHVVPHQWHJ$'/ VFDOHVJDLWLQGH[HV ,$'/ VFDOHVPRELOLW\VNLOO SURILOHVREVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV *DLWDQGORFRPRWLRQ ZLWKRUZLWKRXWWKHXVH RIDVVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYH RUSURVWKHWLFGHYLFHVRU HTXLSPHQWHJ IRRWSULQWDQDO\VHVJDLW LQGH[HVPRELOLW\VNLOO ±±$QDO\VLVRIKHDG WUXQNDQGOLPE PRYHPHQW ±±$QDO\VLVRISRVWXUH GXULQJVLWWLQJVWDQGLQJ DQGORFRPRWRU DFWLYLWLHVDSSURSULDWHIRU DJHHJZDONLQJ KRSSLQJ VNLSSLQJUXQQLQJ MXPSLQJ ±±$QDO\VLVRI VWHUHRW\SLFPRYHPHQWV ±±([DPLQDWLRQRI GH[WHULW\FRRUGLQDWLRQ DQGDJLOLW\ ±±([DPLQDWLRQRI SRVWXUDOHTXLOLEULXP DQGULJKWLQJ UHDFWLRQV ±±([DPLQDWLRQRIPRWRU IXQFWLRQPRWRUFRQWURO DQG PRWRUOHDUQLQJWUDLQLQJ DQGUHWUDLQLQJ P0XVFOH3HUIRUPDQFH 6WUHQJWK3RZHUDQG (QGXUDQFH ±±$QDO\VLVRIIXQFWLRQDO PXVFOHVWUHQJWKSRZHU DQGHQGXUDQFH XVLQJPDQXDOPXVFOH WHVWLQJRUG\QDPRPHWU\ ±±([DPLQDWLRQRI PXVFOHWRQH ±±([DPLQDWLRQRISDLQ DQGVRUHQHVV ±±$JHDSSURSULDWH PRGLILFDWLRQZKHQ DVVHVVLQJPXVFOH 1HXURPRWRU 'HYHORSPHQWDQG 6HQVRU\ ,QWHJUDWLRQ3URFHVVLQJ 31 SURVWKHWLFGHYLFHVDQG HTXLSPHQWWKDWPD\ SURGXFHRUUHOLHYH WUDXPDWRWKHVNLQHJ REVHUYDWLRQVULVN DVVHVVPHQWVFDOHV WHFKQLTXHVDQGGHYLFHV XVHGWRUHGXFHVNLQ WUDXPDZLWK WUDQVIHUV ā6NLQFKDUDFWHULVWLFV LQFOXGLQJEOLVWHULQJ FRQWLQXLW\RIVNLQ FRORUGHUPDWLWLVWURSKLF FKDQJHVPRELOLW\ VHQVDWLRQ WHPSHUDWXUHUDGLDWLRQ ILEURVLVWHOHDQJLHFWDVLD VNLQGLPSOLQJ VZHOOLQJ FKHPRWKHUDSHXWLF WR[LFLW\HJ REVHUYDWLRQV SDOSDWLRQ SKRWRJUDSKLF DVVHVVPHQWV ā6FDUWLVVXH DVVHVVPHQWLQFOXGLQJ LUUDGLDWHGWLVVXH DGKHUHQFH WRXQGHUO\LQJ VWUXFWXUHVFRUGLQJRU ZHEELQJIURP O\PSKDGHQHFWRP\ VFDUVFRORUDWLRQ FKDQJHVDVVRFLDWHG ZLWK ORFDOUHFXUUHQFHHJ 2EVHUYDWLRQ SDOSDWLRQ SKRWRJUDSKLF DVVHVVPHQW ,,QWHJXPHQWDU\ ,QWHJULW\:RXQG $VVHVVPHQW SURILOHVJDLWSDUDPHWHU VFDOHVREVHUYDWLRQV SKRWRJUDSKLF DVVHVVPHQWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWVZHLJKW EHDULQJ VFDOHVZKHHOFKDLU PRELOLW\WHVWV 6DIHW\GXULQJJDLW ORFRPRWLRQDQGEDODQFH HJ FRQILGHQFHVFDOHV GLDULHVIDOOULVN DVVHVVPHQW VFDOHVIXQFWLRQDO DVVHVVPHQWSURILOHV ORJVUHSRUWV ,QWHJXPHQWDU\,QWHJULW\ $FWLYLWLHVSRVLWLRQLQJ DQGSRVWXUHVWKDW SURGXFH RUUHOLHYHWUDXPDWRWKH VNLQHJREVHUYDWLRQV SUHVVXUHVHQVLQJPDSV VFDOHV $VVLVWLYHDGDSWLYH RUWKRWLFSURWHFWLYH VXSSRUWLYH RUSURVWKHWLFGHYLFHV DQGHTXLSPHQWWKDWPD\ SURGXFHRUUHOLHYH WUDXPDWRWKHVNLQHJ REVHUYDWLRQV SUHVVXUHVHQVLQJPDSV ULVNDVVHVVPHQW VFDOHVWHFKQLTXHVDQG GHYLFHVXVHGWRUHGXFH VNLQ WUDXPDZLWKWUDQVIHUV 6NLQFKDUDFWHULVWLFV LQFOXGLQJEOLVWHULQJ FRQWLQXLW\ ±±$QDO\VLVRIDJHDQG VH[DSSURSULDWH GHYHORSPHQW ±±$QDO\VLVRIJDLWDQG SRVWXUH ±±$QDO\VLVRI LQYROXQWDU\PRYHPHQW ±±$QDO\VLVRIUHIOH[ PRYHPHQWSDWWHUQV ±±([DPLQDWLRQRIJURVV DQGILQHPRWRUVNLOOV ±±([DPLQDWLRQRIRUDO PRWRUIXQFWLRQ ±±,QWHUSUHWDWLRQRI VHQVRU\ LQWHJUDWLRQSURFHVVLQJ WHVWUHVXOWV R2UWKRWLF3URWHFWLYH DQG6XSSRUWLYH'HYLFHV ±±$QDO\VLVRIFRVWVDQG EHQHILWVLQFOXGLQJ HQHUJ\FRQVHUYDWLRQ DQGH[SHQGLWXUHZKLOH LQGLYLGXDOZHDUVGHYLFH ±±$QDO\VLVRIPRYHPHQW ZKLOHSDWLHQWFOLHQWXVHV GHYLFH ±±$QDO\VLVRIWKH GHYLFH¶VSRWHQWLDOWR UHPHGLDWHLPSDLUPHQW IXQFWLRQDOOLPLWDWLRQRU GLVDELOLW\ ±±$QDO\VLVRI SUDFWLFDOLW\DQGHDVHRI XVHRIGHYLFH ±±$VVHVVPHQWRIDELOLW\ RI SDWLHQWFOLHQWIDPLO\FDUH JLYHU WRSXWRQDQGUHPRYH GHYLFHDQGXQGHUVWDQG LWVXVHDQG FDUH 2 ā$FWLYLWLHVSRVLWLRQLQJ DQGSRVWXUHVWKDW DJJUDYDWHWKH ZRXQGRUVFDURUWKDW SURGXFHRUUHOLHYH WUDXPDHJ REVHUYDWLRQVSUHVVXUH UHOLHIWHFKQLTXHV ā6LJQVRILQIHFWLRQHJ FXOWXUHVREVHUYDWLRQV SDOSDWLRQ ā6LJQVRIORFDO UHFXUUHQFHLQYROYLQJ WKHVNLQHJ 2EVHUYDWLRQ SKRWRJUDSKLF DVVHVVPHQW ā:RXQGFKDUDFWHULVWLFV LQFOXGLQJEOHHGLQJ FRQWUDFWLRQ GHSWKGUDLQDJH H[SRVHGDQDWRPLFDO VWUXFWXUHVORFDWLRQ RGRU SLJPHQWVKDSHVL]H W\SHVWDJLQJDQG SURJUHVVLRQWXQQHOLQJ DQGXQGHUPLQLQJHJ GLJLWDODQGJULG PHDVXUHPHQW JUDGLQJFODVVLILFDWLRQ REVHUYDWLRQVSDOSDWLRQ SKRWRJUDSKLF DVVHVVPHQWVZRXQG WUDFLQJ ā:RXQGVFDUWLVVXH FKDUDFWHULVWLFVLQFOXGLQJ EDQGLQJ SOLDELOLW\VHQVDWLRQDQG WH[WXUHHJ REVHUYDWLRQVVFDU UDWLQJ VFDOHV ā3HULZRXQG DVVHVVPHQW RIVNLQFRORUGHUPDWLWLV WURSKLFFKDQJHV PRELOLW\VHQVDWLRQ WHPSHUDWXUHDQGWXUJRU HJ REVHUYDWLRQVSDOSDWLRQ SKRWRJUDSKLF DVVHVVPHQWV L,QWHJXPHQWDU\ ,QWHJULW\:RXQG $VVHVVPHQW $FWLYLWLHVSRVLWLRQLQJ DQGSRVWXUHVWKDW DJJUDYDWH WKHZRXQGRUVFDURU WKDWSURGXFHRUUHOLHYH WUDXPDHJ REVHUYDWLRQVSUHVVXUH VHQVLQJPDSV SUHVVXUHUHOLHI WHFKQLTXHV 6LJQVRILQIHFWLRQHJ FXOWXUHVREVHUYDWLRQV SDOSDWLRQ :RXQGFKDUDFWHULVWLFV LQFOXGLQJEOHHGLQJ FRQWUDFWLRQ GHSWKGUDLQDJH H[SRVHGDQDWRPLFDO VWUXFWXUHVORFDWLRQ RGRUSLJPHQWVKDSH VL]H W\SHVWDJLQJDQG SURJUHVVLRQWXQQHOLQJ DQG XQGHUPLQLQJHJGLJLWDO DQGJULGPHDVXUHPHQW JUDGLQJFODVVLILFDWLRQ REVHUYDWLRQVSDOSDWLRQ SKRWRJUDSKLF DVVHVVPHQWVZRXQG WUDFLQJ :RXQGVFDUWLVVXH FKDUDFWHULVWLFVLQFOXGLQJ EDQGLQJ ±±$VVHVVPHQWRI DOLJQPHQWDQGILWRI GHYLFHDQGLQVSHFWLRQ RIUHODWHGFKDQJHVLQ VNLQFRQGLWLRQ S3DLQ ±±$QDO\VLVRISDLQ EHKDYLRUDQGUHDFWLRQ GXULQJVSHFLILF PRYHPHQWVDQG SURYRFDWLRQWHVWV ±±([DPLQDWLRQRISDLQ SHUFHSWLRQHJSKDQWRP OLPE SDLQ ±±$VVHVVPHQWRISDLQ WKURXJKDJHDSSURSULDWH XVHRI TXHVWLRQQDLUHJUDSKV YLVXDODQDORJVFDOHVHWF T3RVWXUH ±±$QDO\VLVRIUHVWLQJ SRVWXUHLQDQ\SRVLWLRQ ±±$QDO\VLVRIVWDWLFDQG G\QDPLFSRVWXUHVXVLQJ YLVXDO DQDO\VLVSRVWXUHJULGV SOXPEOLQHVDQG YLGHRWDSH ±±([DPLQDWLRQRIDJH DSSURSULDWHORZHU H[WUHPLW\DOLJQPHQW ±±6FUHHQLQJIRUVSLQDO PDODOLJQPHQW U 3URVWKHWLFV ±±$QDO\VLVRI DSSURSULDWHFRPSRQHQWV RIDSURVWKHWLF GHYLFH ±±$QDO\VLVRIHIIHFWV DQGEHQHILWVLQFOXGLQJ HQHUJ\FRQVHUYDWLRQ DQGH[SHQGLWXUHZKLOH SDWLHQWFOLHQWZHDUV SURVWKHVLV 3 --RLQW,QWHJULW\DQG 0RELOLW\ ā-RLQWLQWHJULW\DQG PRELOLW\HJ DSSUHKHQVLRQ FRPSUHVVLRQ DQGGLVWUDFWLRQGUDZHU JOLGHLPSLQJHPHQW VKHDUDQG YDOJXVYDUXVVWUHVV WHVWVDUWKURPHWU\ SDOSDWLRQFDSVXODU SDWWHUQ ā-RLQWSOD\PRYHPHQWV LQFOXGLQJHQGIHHOMRLQWV RIWKHD[LDO DQGDSSHQGLFXODU VNHOHWDOV\VWHPHJ SDOSDWLRQDFFHVVRU\ PRYHPHQWVVSHFLDO WHVWV ā-RLQWPRYHPHQWDQG IXQFWLRQDODFWLYLWLHVHJ SDLQ DVVHVVPHQWDQGRU DOOHYLDWLRQTXDOLW\ VXEVWLWXWLRQRUWKRWLF QHHGV ā-RLQWPRELOLW\LQWKH SUHVHQFHRIUDGLDWLRQ ILEURVLVFRQWUDFWXUH RUVFDUFRQWUDFWXUH .0RWRU)XQFWLRQ 0RWRU&RQWURODQG 0RWRU/HDUQLQJ ā'H[WHULW\FRRUGLQDWLRQ DQGDJLOLW\HJ FRRUGLQDWLRQVFUHHQV PRWRULPSDLUPHQWWHVWV PRWRUSURILFLHQF\WHVWV REVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV SOLDELOLW\VHQVDWLRQDQG WH[WXUHHJ REVHUYDWLRQV VFDUUDWLQJVFDOHV 3HULZRXQG DVVHVVPHQW M-RLQW,QWHJULW\DQG 0RELOLW\ -RLQWLQWHJULW\DQG PRELOLW\HJ DSSUHKHQVLRQ FRPSUHVVLRQDQG GLVWUDFWLRQGUDZHU JOLGH LPSLQJHPHQWVKHDU DQGYDOJXVYDUXVVWUHVV WHVWV DUWKURPHWU\SDOSDWLRQ FDSVXODUSDWWHUQ -RLQWSOD\PRYHPHQWV LQFOXGLQJHQGIHHOMRLQWV RIWKHD[LDODQG DSSHQGLFXODUVNHOHWDO V\VWHPHJ SDOSDWLRQDFFHVVRU\ PRYHPHQWVVSHFLDO WHVWV -RLQWPRYHPHQWDQG IXQFWLRQDODFWLYLWLHVHJ SDLQ DVVHVVPHQWDQGRU DOOHYLDWLRQTXDOLW\ VXEVWLWXWLRQ RUWKRWLFQHHGV N0RWRU)XQFWLRQ 0RWRU&RQWURODQG 0RWRU /HDUQLQJ 'H[WHULW\FRRUGLQDWLRQ DQGDJLOLW\HJ FRRUGLQDWLRQ VFUHHQVPRWRU LPSDLUPHQWWHVWVPRWRU SURILFLHQF\ ±±$QDO\VLVRI PRYHPHQWZKLOH SDWLHQWFOLHQWZHDUV SURVWKHVLV ±±$QDO\VLVRIWKH SURWKHVLV¶VSRWHQWLDOWR UHPHGLDWH LPSDLUPHQWIXQFWLRQDO OLPLWDWLRQRUGLVDELOLW\ ±±$QDO\VLVRIWKH SUDFWLFDOLW\DQGHDVHRI XVHRIWKHSURVWKHVLV ±±([DPLQDWLRQRI DOLJQPHQWDQGILWRI SURVWKHVLVDQG LQVSHFWLRQRIUHODWHG FKDQJHVLQVNLQ FRQGLWLRQ ±±([DPLQDWLRQRI UHVLGXDOOLPEIRUUDQJH RIPRWLRQ VWUHQJWKVNLQLQWHJULW\ DQGHGHPD$VVHVVPHQW RI SDWLHQWFOLHQWFDUHJLYHU WRSXWRQDQG UHPRYHSURVWKHVLVDQG XQGHUVWDQGLWVXVHDQG FDUH ±±5HYLHZRIUHSRUWV SURYLGHGE\ SDWLHQWVFOLHQWVIDPLO\ FDUHJLYHUVDQGRWKHU SURIHVVLRQDOV FRQFHUQLQJXVHRIRU QHHGIRUGHYLFH V 5DQJHRI 0RWLRQ,QFOXGLQJ 0XVFOH/HQJWK ±±$QDO\VLVRIIXQFWLRQDO 520DSSURSULDWHIRU FKURQRORJLFDODJH ±±$QDO\VLVRI520 XVLQJJRQLRPHWHUVWDSH PHDVXUHV 4 ā,QLWLDWLRQPRGLILFDWLRQ DQGFRQWURORI PRYHPHQWSDWWHUQV DQGYROXQWDU\SRVWXUHV HJDFWLYLW\LQGH[HV JURVVPRWRU IXQFWLRQSURILOHV QHXURPRWRUWHVWV REVHUYDWLRQVSK\VLFDO SHUIRUPDQFHWHVWV SRVWXUDOFKDOOHQJHWHVWV YLGHRJUDSKLF DVVHVVPHQWV /3HUIRUPDQFH LQFOXGLQJVWUHQJWK SRZHUDQGHQGXUDQFH ā0XVFOHVWUHQJWK SRZHUDQGHQGXUDQFH HJG\QDPRPHWU\ PDQXDOPXVFOHWHVWV PXVFOHSHUIRUPDQFH WHVWVSK\VLFDO FDSDFLW\WHVWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWVWLPHG DFWLYLW\ WHVWV ā0XVFOHVWUHQJWK SRZHUDQGHQGXUDQFH GXULQJIXQFWLRQDO DFWLYLWLHVHJDFWLYLWLHV RIGDLO\OLYLQJ>$'/@ VFDOHVIXQFWLRQDO PXVFOHWHVWV LQVWUXPHQWDODFWLYLWLHVRI GDLO\OLYLQJ>,$'/@ VFDOHV REVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV 06HQVRU\,QWHJUDWLRQ ā6HQVRULPRWRU LQWHJUDWLRQLQFOXGLQJ SRVWXUDOHTXLOLEULXP DQG WHVWVREVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV ,QLWLDWLRQPRGLILFDWLRQ DQGFRQWURORI PRYHPHQW SDWWHUQVDQGYROXQWDU\ SRVWXUHVHJDFWLYLW\ LQGH[HVJURVVPRWRU IXQFWLRQSURILOHV QHXURPRWRU WHVWVREVHUYDWLRQV SK\VLFDOSHUIRUPDQFH WHVWVSRVWXUDOFKDOOHQJH WHVWVYLGHRJUDSKLF DVVHVVPHQWV O3HUIRUPDQFH LQFOXGLQJVWUHQJWK SRZHUDQG HQGXUDQFH 0XVFOHVWUHQJWK SRZHUDQGHQGXUDQFH HJG\QDPRPHWU\ PDQXDOPXVFOHWHVWV PXVFOHSHUIRUPDQFH WHVWVSK\VLFDOFDSDFLW\ WHVWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWVWLPHG DFWLYLW\WHVWV 0XVFOHVWUHQJWK SRZHUDQGHQGXUDQFH GXULQJ IXQFWLRQDODFWLYLWLHVHJ DFWLYLWLHVRIGDLO\OLYLQJ >$'/@VFDOHVIXQFWLRQDO PXVFOHWHVWV LQVWUXPHQWDO DFWLYLWLHVRIGDLO\OLYLQJ >,$'/@VFDOHV REVHUYDWLRQV YLGHRJUDSKLF DVVHVVPHQWV P6HQVRU\,QWHJUDWLRQ IOH[LEOHUXOHUVRU LQFOLQRPHWHUV ±±([DPLQDWLRQRI PXVFOHMRLQWRUVRIW WLVVXHFKDUDFWHULVWLFV DSSURSULDWHIRU FKURQRORJLFDODJH W5HIOH[,QWHJULW\ ±±([DPLQDWLRQRI GHYHORSPHQWDOO\ DSSURSULDWHUHIOH[HV RYHU WLPH ±±([DPLQDWLRQRI QRUPDOUHIOH[HVHJ VWUHWFKUHIOH[ ±±([DPLQDWLRQRIRUDO PRWRUUHIOH[HV ±±([DPLQDWLRQRI SULPLWLYHUHIOH[HV ±±([DPLQDWLRQRI SDWKRORJLFDOUHIOH[HV X6HOI&DUHDQG+RPH 0DQDJHPHQW ±±$QDO\VLVRIVHOIFDUH DQGKRPHPDQDJHPHQW DFWLYLWLHV ±±$QDO\VLVRI HQYLURQPHQWDQGVFKRRO RUMREWDVNV ±±([DPLQDWLRQRI PRELOLW\LQWKHKRPH HQYLURQPHQW ±±([DPLQDWLRQRIDELOLW\ WRWUDQVIHU ±±([DPLQDWLRQRI SK\VLRORJLFUHVSRQVHV GXULQJVHOIFDUH DQGKRPHPDQDJHPHQW ±±5HYLHZRIUHSRUWV SURYLGHGE\ SDWLHQWVFOLHQWVIDPLO\ FDUHJLYHUVDQGRWKHU SURIHVVLRQDOV 5 ULJKWLQJUHDFWLRQVHJ PRWRUDQGSURFHVVLQJ VNLOOWHVWV REVHUYDWLRQVSRVWXUDO FKDOOHQJHWHVWVUHIOH[ WHVWVVHQVRU\ SURILOHVYLVXDO SHUFHSWXDOVNLOOWHVWV 12UWKRWLF3URWHFWLYH DQG6XSSRUWLYH'HYLFHV ā&RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUHIRUWKH RUWKRWLFSURWHFWLYHDQG VXSSRUWLYHGHYLFHVDQG HTXLSPHQWHJ LQWHUYLHZVORJV REVHUYDWLRQVUHSRUWV ā2UWKRWLFSURWHFWLYH DQGVXSSRUWLYHGHYLFHV DQGHTXLSPHQW XVHGXULQJIXQFWLRQDO DFWLYLWLHVHJDFWLYLWLHV RIGDLO\OLYLQJ>$'/@ VFDOHVIXQFWLRQDO VFDOHVLQVWUXPHQWDO DFWLYLWLHVRIGDLO\OLYLQJ >,$'/@VFDOHV LQWHUYLHZV REVHUYDWLRQVSURILOHV ā5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQVRU GLVDELOLWLHVZLWKXVHRI RUWKRWLFSURWHFWLYHDQG VXSSRUWLYH GHYLFHVDQGHTXLSPHQW HJDFWLYLW\VWDWXV LQGH[HV$'/VFDOHV DHURELFFDSDFLW\WHVWV IXQFWLRQDOSHUIRUPDQFH LQYHQWRULHV KHDOWKDVVHVVPHQW TXHVWLRQQDLUHV,$'/ VFDOHVSDLQVFDOHV 6HQVRULPRWRU LQWHJUDWLRQLQFOXGLQJ SRVWXUDO HTXLOLEULXPDQGULJKWLQJ UHDFWLRQVHJPRWRU DQGSURFHVVLQJVNLOO WHVWVREVHUYDWLRQV SRVWXUDO FKDOOHQJHWHVWVUHIOH[ WHVWVVHQVRU\SURILOHV YLVXDO SHUFHSWXDOVNLOOWHVWV Q2UWKRWLF3URWHFWLYH DQG6XSSRUWLYH'HYLFHV &RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUH IRUWKHRUWKRWLF SURWHFWLYHDQG VXSSRUWLYHGHYLFHV DQGHTXLSPHQWHJ LQWHUYLHZVORJV REVHUYDWLRQV SUHVVXUHVHQVLQJPDSV UHSRUWV 2UWKRWLFSURWHFWLYH DQGVXSSRUWLYHGHYLFHV DQG HTXLSPHQWXVHGXULQJ IXQFWLRQDODFWLYLWLHVHJ DFWLYLWLHVRIGDLO\OLYLQJ >$'/@VFDOHVIXQFWLRQDO VFDOHVLQVWUXPHQWDO DFWLYLWLHVRIGDLO\OLYLQJ >,$'/@VFDOHV LQWHUYLHZV REVHUYDWLRQVSURILOHV 5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQV RUGLVDELOLWLHVZLWKXVHRI RUWKRWLFSURWHFWLYH DQGVXSSRUWLYHGHYLFHV DQGHTXLSPHQW Y B6HQVRU\ ,QWHJULW\ ,QFOXGLQJ 3URSULRFHSWLRQDQG .LQHVWKHVLD ±±([DPLQDWLRQRI FRPELQHGFRUWLFDO VHQVDWLRQVHJ VWHUHRJQRVLVWDFWLOH ORFDOL]DWLRQYLEUDWLRQ ±±([DPLQDWLRQRIGHHS SURSULRFHSWLYH VHQVDWLRQVHJ SRVLWLRQVHQVHRU NLQHVWKHVLD ±±([DPLQDWLRQRIJURVV UHFHSWLYHHJYLVLRQ KHDULQJ ±±$JHDSSURSULDWH PRGLILFDWLRQWRVHQVRU\ H[DPLQDWLRQ Z9HQWLODWLRQ 5HVSLUDWLRQDQG &LUFXODWLRQ ±±([DPLQDWLRQRIDELOLW\ WRFOHDUDLUZD\ ±±([DPLQDWLRQRI FDSLOODU\UHILOOWLPH ±±([DPLQDWLRQRI FDUGLRYDVFXODUSXOPRQDU \UHVSRQVHDW UHVWDQGLQDFWLYLW\ ±±([DPLQDWLRQRIFKHVW ZDOOPRELOLW\H[SDQVLRQ DQG H[FXUVLRQ ±±([DPLQDWLRQRIFRXJK DQGVSXWXP ±±([DPLQDWLRQRI YHQWLODWRU\PXVFOH VWUHQJWKSRZHU DQGHQGXUDQFH ±±3DOSDWLRQRISXOVHV 6 YLGHRJUDSKLF DVVHVVPHQWV ā6DIHW\GXULQJXVHRI RUWKRWLFSURWHFWLYHDQG VXSSRUWLYH GHYLFHVDQGHTXLSPHQW HJGLDULHVIDOOVFDOHV LQWHUYLHZVORJV REVHUYDWLRQVUHSRUWV 23DLQ ā3DLQVRUHQHVVDQG QRFLFHSWLRQHJDQJLQD VFDOHVDQDORJ VFDOHVGLVFULPLQDWLRQ WHVWVSDLQGUDZLQJVDQG PDSV SURYRFDWLRQWHVWVYHUEDO DQGSLFWRULDOGHVFULSWRU WHVWVSDLQ MRXUQDO ā3DLQLQVSHFLILFERG\ SDUWVHJSDLQLQGH[HV SDLQ TXHVWLRQQDLUHV VWUXFWXUDOSURYRFDWLRQ WHVWV ā$QDO\VLVRISDLQ EHKDYLRUDQGUHDFWLRQV GXULQJVSHFLILF PRYHPHQWVDQG SURYRFDWLRQ ā$QDO\VLVRISDLQ EHKDYLRUDQG UHDFWLRQVDVVRFLDWHG ZLWKWKH FDQFHUGLVHDVH SURFHVVPHWDVWDWLF OHVLRQVRUSURFHGXUDO LQWHUYHQWLRQV DVVRFLDWHGZLWK GLVHDVHWUHDWPHQWRU SRWHQWLDOIRU GLVHDVHUHFXUUHQFH 33RVWXUH HJDFWLYLW\VWDWXV LQGH[HV$'/VFDOHV DHURELF FDSDFLW\WHVWVIXQFWLRQDO SHUIRUPDQFH LQYHQWRULHV KHDOWKDVVHVVPHQW TXHVWLRQQDLUHV,$'/ VFDOHV SDLQVFDOHV YLGHRJUDSKLF DVVHVVPHQWV 6DIHW\GXULQJXVHRI RUWKRWLFSURWHFWLYHDQG VXSSRUWLYH GHYLFHVDQGHTXLSPHQW HJGLDULHVIDOO VFDOHVLQWHUYLHZVORJV REVHUYDWLRQVUHSRUWV R3DLQ 3DLQVRUHQHVVDQG QRFLFHSWLRQHJDQJLQD VFDOHV DQDORJVFDOHV GLVFULPLQDWLRQWHVWV SDLQGUDZLQJV DQGPDSVSURYRFDWLRQ WHVWVYHUEDODQG SLFWRULDO GHVFULSWRUWHVWV 3DLQLQVSHFLILFERG\ SDUWVHJSDLQLQGH[HV SDLQ TXHVWLRQQDLUHV VWUXFWXUDOSURYRFDWLRQ WHVWV $QDO\VLVRISDLQ EHKDYLRUDQGUHDFWLRQV GXULQJ VSHFLILFPRYHPHQWVDQG SURYRFDWLRQ S3RVWXUH 3RVWXUDODOLJQPHQWDQG SRVLWLRQVWDWLFDQG Pediatric Physical Therapy 7 ā3RVWXUDODOLJQPHQWDQG SRVLWLRQVWDWLFDQG G\QDPLF LQFOXGLQJV\PPHWU\DQG GHYLDWLRQIURPPLGOLQH HJJULG PHDVXUHPHQW LQFOLQRPHWHU\ REVHUYDWLRQVKHLJKW DVVHVVPHQW YLGHRJUDSKLF DVVHVVPHQWV ā3RVWXUDOGHYLDWLRQV UHODWHGWRFDQFHU WUHDWPHQWLQFOXGLQJ WLVVXHUHFRQVWUXFWLRQ SURFHGXUHVEUHDVW LPSODQWVVXUJLFDO H[FLVLRQRIVWDELOL]LQJ PXVFOHVHJ 2EVHUYDWLRQ FRQWUDODWHUDO PXVFOHVWUHQJWK WHVWLQJLQFOLQRPHWU\ YLGHRJUDSKLF DVVHVVPHQW 43URVWKHWLF 5HTXLUHPHQWV ā&RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUHIRUWKH SURVWKHWLFGHYLFHHJ LQWHUYLHZVORJV REVHUYDWLRQV SUHVVXUHVHQVLQJ PDSVVNLQFKHFNV UHSRUWV ā3URVWKHWLFGHYLFHXVH GXULQJIXQFWLRQDO DFWLYLWLHVHJ DFWLYLWLHVRIGDLO\OLYLQJ >$'/@VFDOHVIXQFWLRQDO VFDOHV G\QDPLFLQFOXGLQJ V\PPHWU\DQGGHYLDWLRQ IURPPLGOLQHHJJULG PHDVXUHPHQW LQFOLQRPHWHU\ REVHUYDWLRQVKHLJKW DVVHVVPHQW YLGHRJUDSKLF DVVHVVPHQWV3URVWKHWLF 5HTXLUHPHQWV &RPSRQHQWV DOLJQPHQWILWDQGDELOLW\ WRFDUH IRUWKHSURVWKHWLFGHYLFH HJLQWHUYLHZVORJV REVHUYDWLRQVSUHVVXUH VHQVLQJPDSVVNLQ FKHFNV UHSRUWV 3URVWKHWLFGHYLFHXVH GXULQJIXQFWLRQDO DFWLYLWLHV HJDFWLYLWLHVRIGDLO\ OLYLQJ>$'/@VFDOHV IXQFWLRQDO VFDOHVLQVWUXPHQWDO DFWLYLWLHVRIGDLO\OLYLQJ >,$'/@VFDOHV LQWHUYLHZV REVHUYDWLRQV 5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQV RUGLVDELOLWLHVZLWKXVHRI WKHSURVWKHWLF GHYLFHHJDHURELF FDSDFLW\WHVWVR[LPHWU\ DFWLYLW\ VWDWXVLQGH[HV$'/DQG ,$'/VFDOHVIXQFWLRQDO SHUIRUPDQFH LQYHQWRULHVKHDOWK DVVHVVPHQW 8 LQVWUXPHQWDODFWLYLWLHVRI GDLO\OLYLQJ>,$'/@ VFDOHVLQWHUYLHZV REVHUYDWLRQV ā5HPHGLDWLRQRI LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQVRU GLVDELOLWLHVZLWKXVHRI WKHSURVWKHWLFGHYLFH HJDHURELF FDSDFLW\WHVWVR[LPHWU\ DFWLYLW\VWDWXVLQGH[HV $'/DQG,$'/ VFDOHVIXQFWLRQDO SHUIRUPDQFH LQYHQWRULHVKHDOWK DVVHVVPHQW TXHVWLRQQDLUHVIHDURI IDOOLQJVFDOHVSDLQ VFDOHV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWV ā5HVLGXDOOLPERU DGMDFHQWVHJPHQW LQFOXGLQJHGHPDUDQJH RIPRWLRQVNLQLQWHJULW\ DQGVWUHQJWKHJ JRQLRPHWU\PXVFOH WHVWVREVHUYDWLRQV SDOSDWLRQSKRWRJUDSKLF DVVHVVPHQWVVNLQ LQWHJULW\WHVWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWVYROXPH PHDVXUHPHQW ā6DIHW\GXULQJXVHRI WKHSURVWKHWLFGHYLFH HJGLDULHVIDOO VFDOHVLQWHUYLHZVORJV REVHUYDWLRQVUHSRUWV TXHVWLRQQDLUHVIHDURI IDOOLQJVFDOHVSDLQ VFDOHV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWV 5HVLGXDOOLPERU DGMDFHQWVHJPHQW LQFOXGLQJ HGHPDUDQJHRIPRWLRQ VNLQLQWHJULW\DQG VWUHQJWKHJ JRQLRPHWU\PXVFOH WHVWVREVHUYDWLRQV SDOSDWLRQSKRWRJUDSKLF DVVHVVPHQWVVNLQ LQWHJULW\WHVWV WHFKQRORJ\DVVLVWHG DVVHVVPHQWV YLGHRJUDSKLF DVVHVVPHQWVYROXPH PHDVXUHPHQW 6DIHW\GXULQJXVHRI WKHSURVWKHWLFGHYLFH HJ GLDULHVIDOOVFDOHV LQWHUYLHZVORJV REVHUYDWLRQV UHSRUWV U6HOI&DUHDQG+RPH 0DQDJHPHQW,QFOXGLQJ $'/ DQG,$'/ $ELOLW\WRJDLQDFFHVV WRKRPHHQYLURQPHQWV HJ EDUULHULGHQWLILFDWLRQ REVHUYDWLRQVSK\VLFDO SHUIRUPDQFH WHVWV $ELOLW\WRVDIHO\ SHUIRUPVHOIFDUHDQG KRPHPDQDJHPHQW 9 56HOI&DUHDQG+RPH 0DQDJHPHQW,QFOXGLQJ $'/DQG,$'/ ā$ELOLW\WRJDLQDFFHVV WRKRPHHQYLURQPHQWV HJEDUULHU LGHQWLILFDWLRQ REVHUYDWLRQVSK\VLFDO SHUIRUPDQFHWHVWV ā$ELOLW\WRVDIHO\ SHUIRUPVHOIFDUHDQG KRPHPDQDJHPHQW DFWLYLWLHVHJ$'/ VFDOHVDHURELFFDSDFLW\ WHVWV,$'/VFDOHV LQWHUYLHZV REVHUYDWLRQVIDOO VFDOHV 69HQWLODWLRQDQG 5HVSLUDWLRQ*DV ([FKDQJH ā3XOPRQDU\VLJQVRI UHVSLUDWLRQJDV H[FKDQJHLQFOXGLQJ EUHDWKVRXQGVHJJDV DQDO\VHVREVHUYDWLRQV R[LPHWU\ ā3XOPRQDU\V\PSWRPV HJG\VSQHDSHUFHLYHG H[HUWLRQ REVHUYDWLRQLQGH[HV DQGVFDOHV ā3XOPRQDU\YROXPH UHGXFWLRQIURPRUJDQ H[FLVLRQHJ '\VSQHDSHUFHLYHG H[HUWLRQR[LPHWU\JDV DQDO\VHV 7:RUN -RE6FKRRO3XUSRVHIXO $FWLYLW\&RPPXQLW\ DQG/HLVXUH ,QWHJUDWLRQRU 5HLQWHJUDWLRQ,QFOXGLQJ ,$'/ DFWLYLWLHVHJ$'/ VFDOHVDHURELFFDSDFLW\ WHVWV,$'/VFDOHV LQWHUYLHZV REVHUYDWLRQV IDOOVFDOHV V9HQWLODWLRQDQG 5HVSLUDWLRQ*DV ([FKDQJH 3XOPRQDU\VLJQVRI UHVSLUDWLRQJDV H[FKDQJH LQFOXGLQJEUHDWKVRXQGV HJJDVDQDO\VHV REVHUYDWLRQV R[LPHWU\ 3XOPRQDU\V\PSWRPV HJG\VSQHDSHUFHLYHG H[HUWLRQREVHUYDWLRQ LQGH[HVDQGVFDOHV W:RUN -RE6FKRRO3XUSRVHIXO $FWLYLW\ &RPPXQLW\DQG/HLVXUH ,QWHJUDWLRQRU 5HLQWHJUDWLRQ,QFOXGLQJ ,$'/ $ELOLW\WRDVVXPHRU UHVXPHZRUN SXUSRVHIXO DFWLYLW\FRPPXQLW\ DQGOHLVXUHDFWLYLWLHV ZLWK RUZLWKRXWDVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYH VXSSRUWLYHRUSURVWKHWLF GHYLFHVDQGHTXLSPHQW HJDFWLYLW\SURILOHV GLVDELOLW\LQGH[HV IXQFWLRQDO VWDWXVTXHVWLRQQDLUHV ,$'/VFDOHV REVHUYDWLRQV SK\VLFDOFDSDFLW\WHVWV 40 ā$ELOLW\WRDVVXPHRU UHVXPHZRUN SXUSRVHIXODFWLYLW\ FRPPXQLW\DQGOHLVXUH DFWLYLWLHVZLWKRUZLWKRXW DVVLVWLYH DGDSWLYHRUWKRWLF SURWHFWLYHVXSSRUWLYH RUSURVWKHWLFGHYLFHV DQGHTXLSPHQWHJ DFWLYLW\SURILOHV GLVDELOLW\LQGH[HV IXQFWLRQDOVWDWXV TXHVWLRQQDLUHV,$'/ VFDOHVREVHUYDWLRQV SK\VLFDOFDSDFLW\WHVWV 5HH[DPLQDWLRQ $5HVSRQGWRHPHUJLQJ GDWDIURPH[DPLQDWLRQV DQGLQWHUYHQWLRQVE\ SHUIRUPLQJVSHFLDOWHVWV DQGPHDVXUHVWR HYDOXDWHSURJUHVV PRGLI\RU UHGLUHFWLQWHUYHQWLRQ %5HVSRQGWRFKDQJHV LQFDQFHUWUHDWPHQW GHOLYHU\WKURXJKWKH FDUH FRQWLQXXPE\ SHUIRUPLQJWHVWVDQG PHDVXUHVWRHYDOXDWH WKHLPSDFW QHZWUHDWPHQW PRGDOLWLHVKDYHRQWKH LQGLYLGXDODQGWKHLUSODQ RIFDUH HJ1HZ FKHPRWKHUDSHXWLF DJHQWVLQWURGXFHG UDGLDWLRQWKHUDS\ LQWURGXFHGKRUPRQDO RUELRORJLFDODJHQWV LQWURGXFHGWRPRGLI\ RU $ELOLW\WRJDLQDFFHVV WRZRUNSXUSRVHIXO DFWLYLW\ FRPPXQLW\DQGOHLVXUH HQYLURQPHQWVHJ EDUULHULGHQWLILFDWLRQ LQWHUYLHZV REVHUYDWLRQV SK\VLFDOFDSDFLW\WHVWV WUDQVSRUWDWLRQ DVVHVVPHQWV 6DIHW\LQZRUN SXUSRVHIXODFWLYLW\ FRPPXQLW\ DQGOHLVXUHDFWLYLWLHV DQGHQYLURQPHQWVHJ GLDULHV IDOOVFDOHVEDODQFH DVVHVVPHQWLQWHUYLHZV ORJVREVHUYDWLRQV GH[WHULW\DQG FRRUGLQDWLRQ DVVHVVPHQW YLGHRJUDSKLF DVVHVVPHQW HQYLURQPHQWDO DVVHVVPHQWV 5HH[DPLQDWLRQ 5HVSRQGWRHPHUJLQJ GDWDIURPH[DPLQDWLRQV DQG LQWHUYHQWLRQVE\ SHUIRUPLQJVSHFLDOWHVWV DQG PHDVXUHVWRHYDOXDWH SURJUHVVPRGLI\RU UHGLUHFW LQWHUYHQWLRQ 41 (YDOXDWLRQ &ULWLFDOWRWKHIXQFWLRQ RIWKHRQFRORJ\ VSHFLDOLVWLVWKHDELOLW\ WRDSSURSULDWHO\ HYDOXDWHFKDQJHVLQ WKHSDWLHQWVVWDWXV EDVHGRQGLVHDVH WUHDWPHQW&DQFHUDQG UHGLUHFWLQWHUYHQWLRQ &5HVSRQGWR FKDQJHVFRQVLVWHQW ZLWKODWHHIIHFWVRI FDQFHU WUHDWPHQWE\ SHUIRUPLQJWHVWVDQG PHDVXUHVWRHYDOXDWH WKHLPSDFWRI SK\VLFDOFKDQJHVHJ 1HZRQVHWVZHOOLQJ QHZQHXURORJLFDO FKDQJHV FDUGLRWR[LFLW\WR PRGLI\RUUHGLUHFW LQWHUYHQWLRQDQGWR JXLGHUHIHUUDO WRRWKHUKHDOWKFDUH SURYLGHUV '5HVSRQGWR FKDQJHVLQWKH GLVHDVHVWDWXVRIWKH LQGLYLGXDOE\ SHUIRUPLQJWHVWVDQG PHDVXUHVWRHYDOXDWH WKHLPSDFWRIUHFXUUHQW RU SURJUHVVHGVWDWHRI GLVHDVHHJ1HZ RUJDQPHWDVWDVLV SODFHPHQWRQ FOLQLFDOWULDOPRYHWR SDOOLDWLYHFDUHSODQWR PRGLI\RUUHGLUHFW LQWHUYHQWLRQ (YDOXDWLRQLVWKH G\QDPLFSURFHVVRI FOLQLFDOMXGJPHQWLQ LQWHUSUHWLQJ H[DPLQDWLRQGDWD7KH\ SK\VLFDOWKHUDSLVW SUDFWLFLQJDVDQ RQFRORJLFFOLQLFDO VSHFLDOLVWGHPRQVWUDWHV HYDOXDWLRQE\ 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVD FDUGLRYDVFXODU DQGSXOPRQDU\FOLQLFDO VSHFLDOLVWGHPRQVWUDWHV HYDOXDWLRQ E\ 'LIIHUHQWLDWLQJDPRQJ LPSDLUPHQWVIXQFWLRQDO (YDOXDWLRQLVWKH G\QDPLFSURFHVVRI FOLQLFDOMXGJPHQW LQLQWHUSUHWLQJ H[DPLQDWLRQGDWD7KH SK\VLFDOWKHUDSLVW SUDFWLFLQJDVDJHULDWULF FOLQLFDOVSHFLDOLVW GHPRQVWUDWHV HYDOXDWLRQE\ (YDOXDWLRQLVWKH G\QDPLFSURFHVVRI FOLQLFDOMXGJPHQWLQ LQWHUSUHWLQJH[DPLQDWLRQ GDWD ,QWHUSUHWGDWDIURP KLVWRU\DQGV\VWHPV UHYLHZHJLGHQWLI\ UHOHYDQWFRQVLVWHQW DFFXUDWHGDWDSULRULWL]H (YDOXDWLRQLVWKH G\QDPLFSURFHVVRI FOLQLFDOMXGJPHQWLQ LQWHUSUHWLQJ H[DPLQDWLRQGDWD7KH SK\VLFDOWKHUDSLVW SUDFWLFLQJDVD SHGLDWULFFOLQLFDO VSHFLDOLVWGHPRQVWUDWHV HYDOXDWLRQE\ 2 LW¶VWUHDWPHQWDUH LQKHUHQWO\G\QDPLF DQGWKHVSHFLDOLVW PXVWEHQLPEOHLQ UHFRJQL]LQJFKDQJHV EDVHGRQWKHGLVHDVH DQGWUHDWPHQW WUDMHFWRU\DQGLQ PDNLQJFKDQJHV )XUWKHUWKHVSHFLDOLVW LQRQFRORJ\FDQ DQWLFLSDWHFKDQJHV WKDWDUHOLNHO\WRRFFXU ZLWKXVHRIGLIIHUHQW FDQFHUPLWLJDWLQJ PRGDOLWLHV7KHDELOLW\ WRSURDFWLYHO\LGHQWLI\ WKHVHSRWHQWLDO LPSDLUPHQWVDQG DQWLFLSDWHFKDQJHVLV XQLTXHWRWKHIXQFWLRQ RIWKHRQFRORJ\ VSHFLDOLVW 3URFHVVHVRIHYDOXDWLRQ DUHVWDQGDUGRISUDFWLFH DFURVVDOODUHDVRI SK\VLFDOWKHUDS\EXWWKH FDQFHUVSHFLDOLVWLV XQLTXHLQWKHDELOLW\WR H[HFXWHWKHVH SURFHVVHVZLWKD FRPSUHKHQVLYH XQGHUVWDQGLQJRIFDQFHU DFURVVWKHFRQWLQXXPRI FDUH ā,QWHUSUHWLQJGDWDIURP H[DPLQDWLRQHJ,GHQWLI\ UHOHYDQWFRQVLVWHQW DFFXUDWHGDWD SULRULWL]HLPSDLUPHQWV DVVHVVSDWLHQW¶VQHHGV PRWLYDWLRQVDQGJRDOV ZLWKFRQVLGHUDWLRQIRU WKHFDQFHUGLVHDVH SURFHVVGLVHDVH WUHDWPHQWVLGHHIIHFWV DQGODWH HIIHFWVDQGIRU UHFXUUHQWGLVHDVH ā'HWHUPLQLQJZKHQ VLJQVDQGV\PSWRPV WKDWLQGLFDWHUHIHUUDOWRD SK\VLFLDQRU DQRWKHUKHDOWKFDUH SURYLGHULVDSSURSULDWH EDVHGRQVSHFLDOL]HG NQRZOHGJHRIWKH RQFRORJLFSK\VLFDO WKHUDSLVWDQGZLWK UHFRJQLWLRQRI RQFRORJLF HPHUJHQFLHV OLPLWDWLRQVGLVDELOLWLHV DQGULVNIDFWRUVWKDW UHTXLUH FRPSHQVDWRU\VWUDWHJLHV YHUVXVLQWHUYHQWLRQ VWUDWHJLHV IRFXVLQJRQUHFRYHU\RI QRUPDOPRYHPHQW /LQNLQJLPSDLUPHQWV IXQFWLRQDOOLPLWDWLRQV GLVDELOLWLHV DQGSV\FKRVRFLDO IDFWRUVWRWKHSDWLHQW¶V FOLHQW¶VDQGFDUHJLYHU¶V H[SUHVVHGJRDOV $QDO\]LQJDQG LQWHUSUHWLQJREVHUYHG SK\VLRORJLFDO UHVSRQVHWR LQWHUYHQWLRQVLQFRPSOH[ SDWLHQWV $QDO\]LQJDQG LQWHUSUHWLQJWKHUHVXOWV RIDQH[HUFLVH WHVWWRZULWHDQ LQGLYLGXDODQGVSHFLILF H[HUFLVH SUHVFULSWLRQ $QDO\]LQJLQWHUSUHWLQJ DQGUHFRPPHQGLQJ LQWHUYHQWLRQV LQWKHSUHVHQFHRIULVN IDFWRUVIRU FDUGLRYDVFXODU DQGRUSXOPRQDU\ GLVHDVH 5HFRJQL]LQJDQG DSSURSULDWHO\ UHVSRQGLQJWRSRWHQWLDOO\ OLIHWKUHDWHQLQJFKDQJHV LQSK\VLRORJLFVWDWXV ,QWHJUDWLQJGDWDIURP PRQLWRUVWHVWVVFUHHQV DQGHYDOXDWLRQVXVHGRU SHUIRUPHGE\RWKHU ,QWHUSUHWLQJGDWDIURP H[DPLQDWLRQHJLGHQWLI\ UHOHYDQW FRQVLVWHQWDFFXUDWH GDWDSULRULWL]H LPSDLUPHQWV DVVHVVSDWLHQW¶VQHHGV PRWLYDWLRQVDQGJRDOV 'HWHUPLQLQJZKHQ VLJQVDQGV\PSWRPV WKDWLQGLFDWH UHIHUUDOWRDSK\VLFLDQRU DQRWKHUKHDOWKFDUH SURYLGHULV DSSURSULDWHEDVHGRQ VSHFLDOL]HGNQRZOHGJH RIJHULDWULF SK\VLFDOWKHUDS\ LPSDLUPHQWVDQG DVVHVVSDWLHQW¶VFOLHQW¶V QHHGVPRWLYDWLRQVDQG JRDOV 6HOHFWWHVWVDQG PHDVXUHVWKDWDUH FRPSUHKHQVLYH FRQVLVWHQWZLWKKLVWRU\ DQGV\VWHPVUHYLHZ DJHDSSURSULDWH DSSURSULDWHO\ VHTXHQFHGDQGWKDW KDYHDFFHSWDEOH PHDVXUHPHQWSURSHUWLHV HJYDOLGUHOLDEOHKLJK VSHFLILFLW\VHQVLWLYLW\ (YDOXDWHDQGLQWHUSUHW GDWDIURPWKH H[DPLQDWLRQFRUUHODWLQJ KLVWRU\DQGSK\VLFDO H[DPILQGLQJVDQG VSHFLDOWHVWVLQFOXGLQJ D6SHFLILFILQGLQJVRI SHOYLFIORRUG\VIXQFWLRQ WHVWLQJHJELRIHHGEDFN SDOSDWLRQPDQXDO PXVFOHWHVWLQJ E(IIHFWVRIFHUWDLQ PHGLFDWLRQVIRRGVRU IOXLGLQWDNHRQEODGGHU ERZHORUSHOYLFIORRU PXVFOHIXQFWLRQ F,QIRUPDWLRQJOHDQHG IURPDEODGGHUGLDU\HJ YRLGLQJLQWHUYDOV OHDNDJHIOXLGLQWDNH DQGDYHUDJHQXPEHURI YRLGVSHUGD\ 'HWHUPLQHZKHQ SDWLHQWVFOLHQWVQHHG IXUWKHUH[DPLQDWLRQRU FRQVXOWDWLRQE\D SK\VLFLDQRURWKHUKHDOWK FDUHSURIHVVLRQDOHJ VLJQVDQGV\PSWRPVRI 'LIIHUHQWLDWLQJEHWZHHQ FRPSHQVDWRU\VWUDWHJLHV WKDWIRFXVRQ LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQVGLVDELOLWLHV DQGVWUDWHJLHVWKDWIRFXV RQUHFRYHU\RIQRUPDO PRYHPHQW /LQNLQJLPSDLUPHQWV IXQFWLRQDOOLPLWDWLRQV GLVDELOLWLHV DQGSV\FKRVRFLDO IDFWRUVWRWKH SDWLHQW¶VFOLHQW¶V IDPLO\¶VFDUHJLYHU¶V H[SUHVVHGJRDOV ,GHQWLI\LQJDFWLYLW\ OLPLWDWLRQVDQG SDUWLFLSDWLQJUHVWULFWLRQV DQGUHODWLQJWKHPWR H[DPLQDWLRQILQGLQJV ,QWHUSUHWLQJREVHUYHG PRYHPHQWDQGIXQFWLRQ ,QWHJUDWLQJ LQVWUXPHQWVWHVWV VFUHHQVDQG HYDOXDWLRQV XVHGRUSHUIRUPHGE\ RWKHUKHDOWKFDUH SURIHVVLRQDOV 3 KHDOWKFDUH SURIHVVLRQDOV 'LDJQRVLV 7KHRQFRORJ\ VSHFLDOLVWIXQFWLRQV GLIIHUHQWO\IURPRWKHU WKHUDSLVWVLQWKHLU DELOLW\WRGHWHUPLQH WKH37GLDJQRVLVDQG UHFRJQL]HWKH XQGHUO\LQJ FRPSRQHQWVRIFDQFHU WUHDWPHQWWKDWPD\ OHDGWRWKLVGLDJQRVLV 7KLVLVRISDUDPRXQW LPSRUWDQFHZKHQ GHYHORSLQJDSODQRI FDUH:LWKXQLTXH NQRZOHGJHRIFDQFHU DQGLWVWUHDWPHQWVWKH WKHUDSLVWIXQFWLRQVDW DQDGYDQFHOHYHOLQ WKHLUGLIIHUHQWLDO GLDJQRVLVVNLOOVDQG WKHLUDELOLW\WRLGHQWLI\ XQGHUO\LQJDVSHFWV 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDQ RQFRORJLFFOLQLFDO VSHFLDOLVWGHPRQVWUDWHV GLDJQRVLVE\ ā%DVHGRQHYDOXDWLRQ RUJDQL]LQJGDWDLQWR UHFRJQL]HGFOXVWHUV V\QGURPHVRU FDWHJRULHV ā(VWDEOLVKLQJGLIIHUHQWLDO GLDJQRVHVEDVHGRQ DZDUHQHVVRIFDQFHU GLVHDVH SURFHVVGLVRUGHUVDQG FRQGLWLRQVDVVRFLDWHG ZLWKVLGHHIIHFWVDQG ODWHHIIHFWV RIFDQFHUWUHDWPHQWDQG ZLWKFRQVLGHUDWLRQIRU GLVHDVHUHFXUUHQFHDQG GHWHUPLQHWKHQHHGWR UHIHUWKHVHFOLHQWVWR RWKHUKHDOWKFDUH SURYLGHUV 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVD FDUGLRYDVFXODU DQGSXOPRQDU\FOLQLFDO VSHFLDOLVWGHPRQVWUDWHV GLDJQRVLV E\ $QDO\]LQJDQG LQWHUSUHWLQJGDWDIURP WKHH[DPLQDWLRQ WRGHYHORSDSK\VLFDO WKHUDS\GLIIHUHQWLDO GLDJQRVLV 'LIIHUHQWLDWLQJDPRQJ LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQVGLVDELOLWLHV DQGULVNIDFWRUVWKDWDUH UHVSRQVLYHWR LQWHUYHQWLRQ 5HIHUULQJSDWLHQWFOLHQW WRRWKHUSURIHVVLRQDOV IRU ILQGLQJVWKDWDUHRXWVLGH WKHVFRSHRIWKH SK\VLFDO IHWDOGLVWUHVV SUHHFODPSVLDKLJKULVN SUHJQDQF\ J\QHFRORJLFDOFDQFHUV 'HWHUPLQHZKHQVLJQV DQGV\PSWRPVLQGLFDWH WKDWUHIHUUDOWRD SK\VLFLDQRURWKHUKHDOWK FDUHSURYLGHULV DSSURSULDWHEDVHGRQ VSHFLDOL]HGNQRZOHGJH RIZRPHQ¶VKHDOWK 5HVSRQGWRHPHUJLQJ GDWDIURPH[DPLQDWLRQV DQGLQWHUYHQWLRQVE\ PRGLILFDWLRQDQG UHGLUHFWLRQRI LQWHUYHQWLRQ 7KHSK\VLFDOWKHUDSLVW %DVHGRQHYDOXDWLRQ SUDFWLFLQJDVDJHULDWULF RUJDQL]HGDWDLQWR UHFRJQL]HGFOXVWHUV FOLQLFDO VSHFLDOLVWGHPRQVWUDWHV V\QGURPHVRU FDWHJRULHV GLDJQRVLVE\ %DVHGRQHYDOXDWLRQ (VWDEOLVKGLIIHUHQWLDO RUJDQL]LQJGDWDLQWR GLDJQRVHVEDVHGRQ UHFRJQL]HG DZDUHQHVVRIGLVHDVHV FOXVWHUVV\QGURPHVRU GLVRUGHUVDQGFRQGLWLRQV FDWHJRULHV WKDWDIIHFWZRPHQ¶V (VWDEOLVKLQJGLIIHUHQWLDO KHDOWKDQGFDQPLPLF GLDJQRVHVEDVHGRQ QHXURPXVFXORVNHOHWDO DZDUHQHVV FRQGLWLRQV 'HWHUPLQHDGLDJQRVLV RIGLVHDVHVGLVRUGHUV WKDWJXLGHVIXWXUH DQGFRQGLWLRQVWKDW SDWLHQWFOLHQW DIIHFWJHULDWULF PDQDJHPHQW SDWLHQWV (VWDEOLVKLQJGLIIHUHQWLDO &RQVLGHUKRUPRQDO LQIOXHQFHVDQG GLDJQRVHVEDVHGRQ SK\VLRORJLFDOFKDQJHV DZDUHQHVV ZLWKDJLQJWKDWDUH RIGLVHDVHVGLVRUGHUV VSHFLILFWRWKHGLDJQRVWLF DQGFRQGLWLRQVWKDWFDQ SURFHVV PLPLF 'LIIHUHQWLDWH SUHYDOHQWSUDFWLFH LPSDLUPHQWVIXQFWLRQDO SDWWHUQVLQJHULDWULF OLPLWDWLRQVGLVDELOLWLHV FOLHQWVDQGGHWHUPLQH 7KHSHGLDWULFVSHFLDOLVW GHPRQVWUDWHVGLDJQRVLV E\ ,QWHUSUHWLQJGDWDIURP WKHH[DPLQDWLRQWR GHYHORSD GLIIHUHQWLDOGLDJQRVLV ,GHQWLI\LQJ LPSDLUPHQWVIXQFWLRQDO OLPLWDWLRQVGLVDELOLWLHV WKDWDUHDPHQDEOHWR LQWHUYHQWLRQ 5HIHUULQJ SDWLHQWFOLHQWIDPLO\WR RWKHUSURIHVVLRQDOVIRU ILQGLQJVWKDWDUHRXWVLGH WKHVFRSHRIWKH SK\VLFDOWKHUDSLVW¶V NQRZOHGJHH[SHULHQFH RUH[SHUWLVH 4 WKDWPD\LPSDFWWKH SODQRIFDUH ā(VWDEOLVKLQJGLIIHUHQWLDO WKHUDSLVW¶VNQRZOHGJH H[SHULHQFHRU GLDJQRVLVEDVHGRQWKH H[SHUWLVH VSHFLDOL]HGVNLOOVHWRI WKH RQFRORJLFSK\VLFDO WKHUDSLVWWKDWUHFRJQL]HV WKHDJJUHJDWHEXUGHQRI PXOWLSOHLPSDLUPHQWV DQGPXOWLSOHV\VWHP LQYROYHPHQWDVVRFLDWHG ZLWKWKHFDQFHU GLVHDVHSURFHVVDQG FDQFHUWUHDWPHQW ā'HWHUPLQLQJGLDJQRVWLF SUDFWLFHSDWWHUQVWKDW JXLGHIXWXUH SDWLHQWFOLHQW PDQDJHPHQWDQGDUH DPHQDEOHWRSK\VLFDO WKHUDS\LQWHUYHQWLRQV ā&RQVLGHULQJ SK\VLRORJLFDOFKDQJHV DQGDW\SLFDO SUHVHQWDWLRQVZLWKWKH FDQFHU GLVHDVHSURFHVVWKDWDUH VSHFLILFWRWKHGLDJQRVWLF SURFHVVHV WKHQHHGWRUHIHUWKHVH FOLHQWVWRRWKHUKHDOWK FDUH SURYLGHUV 'HWHUPLQLQJGLDJQRVWLF SUDFWLFHSDWWHUQVWKDW JXLGH IXWXUHSDWLHQWFOLHQW PDQDJHPHQWDQGDUH DPHQDEOHWR SK\VLFDOWKHUDS\ LQWHUYHQWLRQV &RQVLGHULQJ SK\VLRORJLFDOFKDQJHV DQGDW\SLFDO SUHVHQWDWLRQV ZLWKDJLQJWKDWDUH VSHFLILFWRWKHGLDJQRVWLF SURFHVV WKDWFDQEHDGGUHVVHG ZLWKSK\VLFDOWKHUDS\ LQWHUYHQWLRQ (VWDEOLVKDGLDJQRVLV IRUSDWLHQWVFOLHQWVRI DQ\DJHFRQVLGHULQJ SDWKRORJ\LPSDLUPHQW RUIXQFWLRQDOOLPLWDWLRQV DVVRFLDWHGZLWKEXWQRW OLPLWHGWRWKHIROORZLQJ D3HGLDWULFYRLGLQJ GLVRUGHUV E3HOYLFIORRU G\VIXQFWLRQHJ VXSSRUWLYH LQFRRUGLQDWLRQ K\SHUWRQXVGLVXVH VWUHVVLQFRQWLQHQFH XUJHLQFRQWLQHQFH FRQVWLSDWLRQ F0XVFXORVNHOHWDO GLVRUGHUVDVVRFLDWHG ZLWKJ\QHFRORJLFDO FRQGLWLRQVHJ HQGRPHWULRVLV DPHQRUUKHD G\VPHQRUUKHD G3HOYLFIORRUVFDU WLVVXHDGKHVLRQV (1HXURPXVFXORVNHOHWDO DQGFDUGLRSXOPRQDU\ G\VIXQFWLRQVDVVRFLDWHG ZLWKWHHQHDWLQJ GLVRUGHUV I&KLOGEHDULQJ SUHQDWDOSRVWSDUWXP PXVFXORVNHOHWDOSDLQ J0XVFXORVNHOHWDO G\VIXQFWLRQDVVRFLDWHG ZLWKGLDVWDVLVUHFWL K0XVFXORVNHOHWDO G\VIXQFWLRQDVVRFLDWHG ZLWKFHVDUHDQVHFWLRQRU YDJLQDOGHOLYHU\ 5 3K\VLFDO7KHUDS\ 3URJQRVLV 7KHRQFRORJ\ VSHFLDOLVWXWLOL]HVDOO DYDLODEOHLQIRUPDWLRQ UHJDUGLQJWKHNQRZQ WUHDWPHQWVLGHHIIHFWV DQGODWHHIIHFWVDVZHOO DVWKHLUH[SHUW NQRZOHGJHRIWKH GLVHDVHWUDMHFWRU\WR SURJQRVWLFDWH DFFXUDWHO\7KHXQLTXH NQRZOHGJHRIFDQFHU 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDQ RQFRORJLFVSHFLDOLVW GHPRQVWUDWHV SURJQRVWLFDWLRQE\ ā8WLOL]LQJNQRZOHGJHRI H[DPLQDWLRQHYDOXDWLRQ DQGGLDJQRVLVWR GHWHUPLQH SDWLHQWFOLHQWSURJQRVLV ā&RQVLGHULQJWKHORQJ WHUPSURJQRVWLFHIIHFWRI WKHFDQFHUGLVHDVH SURFHVV 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVD FDUGLRYDVFXODU DQGSXOPRQDU\FOLQLFDO VSHFLDOLVWGHPRQVWUDWHV SURJQRVWLFDWLRQ E\ 3UHGLFWLQJRSWLPDOOHYHO RILPSURYHPHQWLQ IXQFWLRQ LQFOXGLQJWLPHWR DFKLHYHWKDWOHYHOZLWKD KLJKOHYHORIDFFXUDF\ 'HWHUPLQHWKHOHYHORI RSWLPDOLPSURYHPHQW WKDWPD\ EHDWWDLQHGWKURXJK LQWHUYHQWLRQDQGWKH DPRXQWRIWLPH UHTXLUHGWRUHDFKWKDW OHYHO$OVRLQFOXGHVSODQ RIFDUH 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDJHULDWULF FOLQLFDOVSHFLDOLVW GHPRQVWUDWHV SURJQRVWLFDWLRQE\ L0XVFXORVNHOHWDO G\VIXQFWLRQDVVRFLDWHG ZLWKILEURP\DOJLD M6RIWWLVVXHDQG PXVFXORVNHOHWDO G\VIXQFWLRQIROORZLQJ J\QHFRORJLFVXUJHU\HJ EODGGHUVXUJHU\ K\VWHUHFWRP\ FDXWHUL]DWLRQ N1HXURPXVFXORVNHOHWDO G\VIXQFWLRQDVVRFLDWHG ZLWKEUHDVWFDQFHU WUHDWPHQWPHGLFDORU VXUJLFDO O0XVFXORVNHOHWDO G\VIXQFWLRQDVVRFLDWHG ZLWKO\PSKHGHPD P9LVFHUDOG\VIXQFWLRQ DVVRFLDWHGZLWK GLVHDVHVGLVRUGHUVRU FRQGLWLRQVPDQDJHGE\ SK\VLFDOWKHUDSLVWV R+RUPRQDOLQIOXHQFHV UHODWHGWRJHQGHU GLIIHUHQFHV S'\VIXQFWLRQV DVVRFLDWHGZLWK DGYDQFHGRUFRPSOH[ FDVHVRIRVWHRSRURVLV &RQVLGHUWKHLPSDFWRI GHSUHVVLRQDQGRWKHU SV\FKRVRFLDOLVVXHV ZKHQGHWHUPLQLQJ SURJQRVLVHJLQWKH FDVHRIG\VSDUHXQLDDQG YXOYDUSDLQV\QGURPHV FDQFHUO\PSKHGHPD &RQVLGHUWKHLPSDFWRI DGLVDELOLW\RULOOQHVV VXFKDVVSLQDOFRUG LQMXU\RUGLDEHWHVRQ ZRPHQ¶VKHDOWKZKHQ GHWHUPLQLQJD SURJQRVLV 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDSHGLDWULF FOLQLFDOVSHFLDOLVW GHPRQVWUDWHV SURJQRVWLFDWLRQE\ 3UHGLFWLQJRSWLPDOOHYHO RILPSURYHPHQWLQ IXQFWLRQ 3UHGLFWLQJDPRXQWRI WLPHWRDFKLHYHRSWLPDO OHYHORI LPSURYHPHQWLQIXQFWLRQ &ROODERUDWLQJZLWK SDWLHQWFOLHQWIDPLO\LQ VHWWLQJJRDOV 6 DQGWKHNQRZQHIIHFWV DQGWUDMHFWRU\RIFDUH FDXVHWKHVSHFLDOLVWWR IXQFWLRQGLIIHUHQWO\LQ WKHGHWHUPLQDWLRQRID WUHDWPHQWSODQDQGWKH GHYHORSPHQWRIDQ RQJRLQJSODQRIFDUH WKURXJKRXWDOODVSHFWV RIWKHFDQFHU WUHDWPHQW FDQFHUWUHDWPHQWVLGH HIIHFWVDQGODWHHIIHFWV DQGFRPRUELGLWLHV ā&RQVLGHULQJWKH SURJQRVWLFHIIHFWRI PHGLFDOVRFLDODQG RFFXSDWLRQDOKLVWRU\ ā&RQVLGHULQJWKH SURJQRVWLFLPSDFWRI RWKHUPHGLFDO LQWHUYHQWLRQVHJ LPSODQWHGGHYLFHV SXPSVUDGLDWLRQ WKHUDS\FKHPRWKHUDS\ ā&RQVLGHULQJWKH SURJQRVWLFLPSDFWRI GHSUHVVLRQGHPHQWLD DQGRWKHU SV\FKRVRFLDOLVVXHVHJ IHDUDQ[LHW\ZKHQ GHWHUPLQLQJSURJQRVLV ā&RQVLGHULQJWKH SURJQRVWLFHIIHFWRI SKDUPDFRORJLFDO LQWHUYHQWLRQVHJ FKHPRWKHUDSHXWLF WR[LFLWLHVVXSSRUWLYH WDUJHWHGDJHQWVSDLQ PHGLFDWLRQ VWHURLGVRWKHU SUHVFULEHGPHGLFDWLRQV RYHUWKHFRXQWHU PHGLFDWLRQVKHUEDO VXSSOHPHQWV ā&RQVLGHUDWLRQRIWKH SURJQRVWLFHIIHFWRI FXOWXUDOFRQVLGHUDWLRQV HJYDOXHV EHOLHIVHWKQLFLW\ UHOLJLRQVSLULWXDOLW\ VH[XDORULHQWDWLRQDQG VSHFLDO SRSXODWLRQV ā&RQVLGHULQJWKH SDWLHQW¶VSHUVRQDOJRDOV 'HYHORSLQJDSODQRI FDUHWKDWSULRULWL]HV LQWHUYHQWLRQV UHODWHGWRWKHUHFRYHU\ SURFHVVSDWLHQWFOLHQW JRDOVUHVRXUFHVULVN IDFWRUVKHDOWKDQG ZHOOQHVV 8WLOL]LQJNQRZOHGJHRI H[DPLQDWLRQHYDOXDWLRQ DQG GLDJQRVLVWRGHWHUPLQH SDWLHQWFOLHQWSURJQRVLV &RQVLGHULQJWKHORQJ WHUPSURJQRVWLFHIIHFWRI QRUPDO DJHUHODWHGFKDQJHV DQGFRPRUELGLWLHV &RQVLGHULQJWKH SURJQRVWLFHIIHFWRI PHGLFDOVRFLDO DQGRFFXSDWLRQDOKLVWRU\ &RQVLGHULQJWKH SURJQRVWLFLPSDFWRI RWKHUPHGLFDO LQWHUYHQWLRQVHJ LPSODQWHGGHYLFHV SXPSVUDGLDWLRQ WKHUDS\FKHPRWKHUDS\ &RQVLGHULQJWKH SURJQRVWLFLPSDFWRI GHSUHVVLRQ GHPHQWLDDQGRWKHU SV\FKRVRFLDOLVVXHVHJ JULHYLQJ UHFHQWORVVZKHQ GHWHUPLQLQJSURJQRVLV &RQVLGHULQJWKH SURJQRVWLFHIIHFWRI SKDUPDFRORJLFDO LQWHUYHQWLRQVHJ SUHVFULEHGPHGLFDWLRQV RYHUWKH FRXQWHUPHGLFDWLRQV KHUEDOVXSSOHPHQWV &RQVLGHUDWLRQRIWKH SURJQRVWLFHIIHFWRI FXOWXUDO FRQVLGHUDWLRQVHJ YDOXHVEHOLHIVHWKQLFLW\ UHOLJLRQ )RUPXODWHDSODQRI FDUHIRUDSDWLHQWFOLHQW ZLWKDZRPHQ¶VKHDOWK GLDJQRVLVUHIOHFWLQJ ZRPHQ¶VOLIHF\FOHDQG QHHGV 'HYHORSDSODQRI FDUHWKDWSULRULWL]HV LQWHUYHQWLRQVUHODWHGWR WKHGLDJQRVLVUHFRYHU\ SURFHVVSDWLHQWFOLHQW JRDOVUHVRXUFHVKHDOWK DQGZHOOQHVV 'HYHORSDSODQRI FDUHWKDWWDNHVXQLTXH VDIHW\FRQFHUQVLQWR FRQVLGHUDWLRQHJKLJK ULVNSUHJQDQF\ SRVWSDUWXPFDUHDQG RSHUDWLYHFDUHVXFKDV SRVW PDVWHFWRP\D[LOODU\ GLVVHFWLRQDQGSHOYLF IORRUVXUJHU\ 'HWHUPLQHWKHPRVW HIIHFWLYHSODQRIFDUH EDVHGRQOLPLWDWLRQVLQ VHUYLFHDYDLODELOLW\ HLWKHUGXHWRSD\PHQW OLPLWVRUDFFHVVWRFDUH DQGGRFXPHQWZKDW ZRXOGEHH[SHFWHGZLWK IHZHUOLPLWDWLRQV 'HYHORSLQJDSODQRI FDUHWKDWSULRULWL]HV LQWHUYHQWLRQV UHODWHGWRWKHUHFRYHU\ SURFHVV SDWLHQWFOLHQWIDPLO\ JRDOVUHVRXUFHVKHDOWK DQGZHOOQHVVDQGWR IHGHUDO JXLGHOLQHV 7 DVWKH\UHODWHWRWKH SURJQRVLV ā'HYHORSLQJDSODQRI FDUHWKDW R3ULRULWL]HV LQWHUYHQWLRQVUHODWHGWR WKHGLDJQRVLVUHFRYHU\ SURFHVV SDWLHQWFOLHQWJRDOV RXWFRPHVGDWDDQG UHVRXUFHV 7DNHVVDIHW\DQG SDWLHQWIDPLO\FDUHJLYHU FRQFHUQVOLYLQJ DUUDQJHPHQWVDQG ILQDQFLDOVLWXDWLRQLQWR FRQVLGHUDWLRQ R,QFOXGHVDFKLHYDEOH SDWLHQWFOLHQWRXWFRPHV ZLWKLQDYDLODEOH UHVRXUFHV DQGDFFRUGLQJWRWKH DGPLQLVWUDWLYHSROLFLHV DQGSURFHGXUHVRIWKH SUDFWLFHHQYLURQPHQW R&RQVLGHUVTXDOLW\RI OLIHLQUHJDUGWRHQGRI OLIHZLVKHVWUDQVLWLRQV DQG DGYDQFHGGLUHFWLYHVHJ TXDOLW\RIOLIHVFDOHV VSLULWXDOLW\VH[XDO RULHQWDWLRQDQGVSHFLDO SRSXODWLRQV &RQVLGHULQJWKH SDWLHQW¶VSHUVRQDOJRDOV DVWKH\UHODWHWR WKHSURJQRVLV 'HYHORSLQJDSODQRI FDUHWKDW 3ULRULWL]HV LQWHUYHQWLRQVUHODWHGWR WKHGLDJQRVLV UHFRYHU\SURFHVV SDWLHQWFOLHQWJRDOV RXWFRPHVGDWD DQGUHVRXUFHV 7DNHVVDIHW\DQG SDWLHQWIDPLO\FDUHJLYHU FRQFHUQV OLYLQJDUUDQJHPHQWVDQG ILQDQFLDOVLWXDWLRQLQWR FRQVLGHUDWLRQ ,QFOXGHVDFKLHYDEOH SDWLHQWFOLHQWRXWFRPHV ZLWKLQ DYDLODEOHUHVRXUFHVDQG DFFRUGLQJWRWKH DGPLQLVWUDWLYH SROLFLHVDQGSURFHGXUHV RIWKHSUDFWLFH HQYLURQPHQW &RQVLGHUVTXDOLW\RI OLIHLQUHJDUGWRHQGRI OLIH ZLVKHVWUDQVLWLRQVDQG DGYDQFHGGLUHFWLYHVHJ TXDOLW\RIOLIHVFDOHV 8 ,QWHUYHQWLRQV LQFOXGLQJ &OLHQW&DUHJLYHUDQG SDWLHQWLQVWUXFWLRQ 3HUKDSVRQHRIWKH PRVWLPSRUWDQW IXQFWLRQVRIWKH RQFRORJ\VSHFLDOLVWLV WKHLUDELOLW\WR WUDQVODWHWKHLUH[SHUW NQRZOHGJHRIWKH RQFRORJLFGLVHDVHDQG WUHDWPHQWSURFHVVWR WKHSDWLHQWDQGWKHLU FDUHJLYHU1RRWKHU SK\VLFDOWKHUDSLVWQRU SK\VLFDOWKHUDS\ VSHFLDOW\SURYLGHUQRU RIWHQRWKHUPHGLFDO SURYLGHUFDQFRDOHVFH WKHLQIRUPDWLRQUHODWHG WRIXQFWLRQ LPSDLUPHQWSK\VLFDO SK\VLRORJLFDODQG SV\FKRVRFLDOQHHGV UHODWHGWRFDQFHUDQG LW¶VWUHDWPHQWWR SURYLGHWKHSDWLHQW ZLWKFRPSUHKHQVLYH HGXFDWLRQDQG LQVWUXFWLRQDERXWWKHLU XQLTXHSK\VLFDO PRELOLW\QHHGV ,QWHUYHQWLRQVXVHGWR WUHDWWKHSDWLHQWZLWK FDQFHUDUHRIWHQ VWDQGDUGRQHVVXFKDV JDLWWUDLQLQJDQG SK\VLFDOH[HUFLVHWKH LQWHUYHQWLRQVDUH XQLTXHLQWKHFRQWH[W RIFDQFHUVLQFHWKH FOLQLFLDQPXVWWDNHWKH 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDQ RQFRORJLFFOLQLFDO VSHFLDOLVWGHPRQVWUDWHV LQWHUYHQWLRQE\ āCoordination, Communication, and Documentation ,QWHUDFWLQJZLWK SDWLHQWVFOLHQWVIDPLO\ PHPEHUVRWKHUKHDOWK FDUH SURYLGHUVFDQFHU VXUYLYRUVKLSJURXSV VXSSRUWJURXSVDQG FRPPXQLW\EDVHG RUJDQL]DWLRQVIRUWKH SXUSRVHRIFRRUGLQDWLQJ DFWLYLWLHVWR IDFLOLWDWHHIILFLHQWDQG HIIHFWLYHSDWLHQWRUFOLHQW FDUH &RRUGLQDWLQJWKH SK\VLFDOWKHUDS\SDWLHQW PDQDJHPHQWSURFHVVWR LQFOXGHFRPPXQLW\ UHVRXUFHVGLVFKDUJH SODQQLQJWLPHO\GDWD WUDQVPLVVLRQDQG GHOLYHU\RIVHUYLFH 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVD FDUGLRYDVFXODU DQGSXOPRQDU\FOLQLFDO VSHFLDOLVWGHPRQVWUDWHV LQWHUYHQWLRQE\ 1. Coordination, Communication, and Documentation ,QGLFDWLQJWKHSODQRI FDUHLVEDVHGRQVRXQG SK\VLRORJLFSULQFLSOHV WKHDELOLW\RIWKHSDWLHQW FOLHQWWRSDUWLFLSDWHDQG WKHUHVRXUFHVDYDLODEOH &RQVXOWLQJDQG FRPPXQLFDWLQJ UHJDUGLQJ FULWLFDODQGSRWHQWLDOO\ OLIHWKUHDWHQLQJ FRQGLWLRQV DQGFKDQJHVLQ SDWLHQWFOLHQWVWDWXVWR PHPEHUVRIWKHKHDOWK FDUHWHDPLQDWLPHO\ DQGDSSURSULDWH PDQQHU 'HPRQVWUDWLQJ OHDGHUVKLSVNLOOVLQ FDUGLRYDVFXODU DQGSXOPRQDU\VSHFLDOW\ SUDFWLFHE\OHDGLQJ SDWLHQWURXQGV FRQIHUHQFHVDQGWHDP PHHWLQJV $FWLYHO\VHHNLQJWR LQFUHDVHXWLOL]DWLRQRI FDUGLRYDVFXODU DQGSXOPRQDU\VSHFLDOW\ VHUYLFHVE\ UHIHUULQJSUDFWLWLRQHUV ,PSOHPHQWLQJ SURJUDPVRUVHUYLFHV GHVLJQHGWR 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDJHULDWULF FOLQLFDOVSHFLDOLVW GHPRQVWUDWHV LQWHUYHQWLRQE\ • Coordination, Communication, and Documentation ,QWHUDFWLQJZLWK SDWLHQWVFOLHQWVIDPLO\ PHPEHUV RWKHUKHDOWKFDUH SURYLGHUVDQG FRPPXQLW\EDVHG RUJDQL]DWLRQVIRUWKH SXUSRVHRIFRRUGLQDWLQJ DFWLYLWLHV WRIDFLOLWDWHHIILFLHQWDQG HIIHFWLYHSDWLHQWRUFOLHQW FDUH &RRUGLQDWLQJWKH SK\VLFDOWKHUDS\SDWLHQW PDQDJHPHQW SURFHVVWRLQFOXGH FRPPXQLW\UHVRXUFHV GLVFKDUJHSODQQLQJ WLPHO\GDWD WUDQVPLVVLRQDQG GHOLYHU\RIVHUYLFH &RPPXQLFDWLQJ HIIHFWLYHO\ZLWKSDWLHQWV FOLHQWV IDPLO\PHPEHUV FDUHJLYHUVSUDFWLWLRQHUV FRQVXPHUV SD\HUVDQG SROLF\PDNHUVDERXW JHULDWULFLVVXHV 'LVFXVVLQJ UDWLRQDOHIRUSK\VLFDO WKHUDS\ H[DPLQDWLRQH[DPLQDWLRQ DQGLQWHUYHQWLRQ SURFHGXUHVLQFOXGLQJ XVHRI &RRUGLQDWLRQ &RPPXQLFDWLRQ D&RPPXQLFDWH HIIHFWLYHO\ZLWK SDWLHQWVFOLHQWVIDPLO\ PHPEHUVFDUHJLYHUV SUDFWLWLRQHUV FRQVXPHUVSD\HUVDQG SROLF\PDNHUVDERXW ZRPHQ¶VKHDOWKLVVXHV E'LVFXVVUDWLRQDOHIRU SK\VLFDOWKHUDS\ H[DPLQDWLRQDQG LQWHUYHQWLRQSURFHGXUHV LQFOXGLQJXVHRIFXUUHQW EHVWHYLGHQFHZLWK SDWLHQWVFOLHQWVSHHU SURIHVVLRQDOVDQG SD\HUV F&ROODERUDWHDVD KHDOWKFDUHWHDP PHPEHUDQGOHDGHUWR HQVXUHWKDWSK\VLFDO WKHUDS\LVDSDUWRIDQ DSSURSULDWHFXOWXUDOO\ FRPSHWHQW FRPSUHKHQVLYHSODQLQ WKHFDUHRIZRPHQ G$GDSWFRPPXQLFDWLRQ WRDSSURSULDWH HGXFDWLRQDOOHYHO 3DWLHQW&OLHQW 5HODWHG,QVWUXFWLRQ 3URYLGHSDWLHQWFOLHQW LQVWUXFWLRQDERXW GLDJQRVLVSURJQRVLV DQGLQWHUYHQWLRQ VWUDWHJLHV 3URYLGHSDWLHQWFOLHQW UHODWHGLQVWUXFWLRQWR LQFUHDVHSDWLHQWFOLHQW XQGHUVWDQGLQJRI LQGLYLGXDOLPSDLUPHQWV IXQFWLRQDOOLPLWDWLRQVRU GLVDELOLWLHV 7KHSK\VLFDOWKHUDSLVW SUDFWLFLQJDVDSHGLDWULF FOLQLFDOVSHFLDOLVW GHPRQVWUDWHV LQWHUYHQWLRQE\ Coordination, Communication, and Documentation ,QWHJUDWLQJ FRPPXQLFDWLRQ VWUDWHJLHVZLWK WKHUDSHXWLF LQWHUYHQWLRQ $GDSWLQJ FRPPXQLFDWLRQWRPHHW WKHHGXFDWLRQDO FRJQLWLYHOHYHORIWKH SDWLHQWFOLHQWIDPLO\FDUH JLYHU $VNLQJTXHVWLRQVWKDW KHOSWRGHWHUPLQH SDWLHQWFOLHQW IDPLO\SUREOHPV $SSO\LQJFRQIOLFW UHVROXWLRQVWUDWHJLHVLQD WLPHO\PDQQHU (IIHFWLYHO\DGDSWLQJ FRPPXQLFDWLRQ VWUDWHJLHVDFURVVWKH OLIHVSDQ 0HHWLQJWKH UHTXLUHPHQWVRIIHGHUDO JXLGHOLQHVHJ +,3$$ Patient/Client/FamilyRelated Instruction (GXFDWLQJ SDWLHQWFOLHQWIDPLO\FDUH JLYHURQGLDJQRVLV WUHDWPHQWUHVSRQVLELOLW\ DQGVHOIPDQDJHPHQW ZLWKLQ SODQRIFDUH 9 HQWLUHWUDMHFWRU\RIWKH GLVHDVHLQWRDFFRXQW DVZHOODVFRQVLGHUWKH LPSDFWRIVXFKWKLQJV DVFKHPRWKHUDS\ ELRORJLFDOWKHUDS\DQG UDGLDWLRQRQH[HUFLVH WROHUDQFHDVZHOODV KHDUWIXQFWLRQZKLOH GHVLJQLQJWKHH[HUFLVH SUHVFULSWLRQ SUHYHQWFDUGLRYDVFXODU DQGSXOPRQDU\GLVHDVH LQFROODERUDWLRQZLWKRQH RUPRUHRIWKHIROORZLQJ &RPPXQLFDWLQJ HIIHFWLYHO\ZLWKSDWLHQWV SDWLHQWVIDPLOLHVFDUH SURYLGHUVRUJDQL]DWLRQV FOLHQWVIDPLO\PHPEHUV DQGWKHSXEOLF 3URYLGLQJFRQVXOWDWLRQ FDUHJLYHUVSUDFWLWLRQHUV VHUYLFHVWRSHHU FRQVXPHUVSD\HUVDQG SURIHVVLRQDOV SROLF\PDNHUVDERXW LQPXOWLSOHSUDFWLFH VHWWLQJVUHJDUGLQJ SDWLHQWVDQGFOLHQWVZLWK FDQFHUUHODWHGLVVXHV FDUGLRYDVFXODUDQG SXOPRQDU\ULVNIDFWRUV &RPPXQLFDWLQJ LPSDLUPHQWVIXQFWLRQDO IXQFWLRQDOLPSDLUPHQWV OLPLWDWLRQVDQG DQGGLVDELOLWLHVDORQJ GLVDELOLWLHV ZLWKWKH 2. Patient/Client-Related Instruction SK\VLFDOWKHUDS\SODQRI (GXFDWLQJ FDUHWRWKHPXOWL SDWLHQWFOLHQWVDERXW GLDJQRVLV GLVFLSOLQDU\RQFRORJ\ SURJQRVLVWUHDWPHQW WHDP LQWHUYHQWLRQV UHVSRQVLELOLW\ WKURXJKWXPRUERDUG IRUKHDOWKPDLQWHQDQFH UHSRUWVDQGVXUYLYRUVKLS DQGVHOIPDQDJHPHQW FDUHSODQXSGDWHV ZLWKLQSODQRIFDUH² DGHSWO\WUDQVODWLQJ 'LVFXVVLQJUDWLRQDOH FRPSOH[FRQFHSWVLQWR IRUSK\VLFDOWKHUDS\ OD\WHUPV (IIHFWLYHO\LQVWUXFWLQJ H[DPLQDWLRQDQG FDUHJLYHUVLQWKHUDSHXWLF LQWHUYHQWLRQ LQWHUYHQWLRQVWKDW LQWHJUDWHVSHFLDOW\ SURFHGXUHVLQFOXGLQJ WHFKQLTXHV XVHRIFXUUHQWEHVW HJDLUZD\FOHDUDQFH HYLGHQFHZLWK VXFWLRQLQJH[HUFLVHV SDWLHQWVFOLHQWV LQWR WKHSDWLHQWFOLHQWSODQRI DQGIDPLOLHVRWKHU FDUH ,QVWUXFWLQJ KHDOWKFDUH SDWLHQWFOLHQWLQVHOI PRQLWRULQJHJ DFURVVDOOVHWWLQJVRI FDUH FXUUHQWEHVWHYLGHQFH ZLWKSDWLHQWVFOLHQWVDQG IDPLOLHVRWKHUKHDOWK FDUHSURIHVVLRQDOVDQG SD\HUV &ROODERUDWLQJ DVDKHDOWKFDUHWHDP PHPEHUDQG OHDGHUWRHQVXUHWKDW SK\VLFDOWKHUDS\LVD SDUWRIDQ DSSURSULDWHFXOWXUDOO\ FRPSHWHQW FRPSUHKHQVLYH SODQLQWKHFDUHRI JHULDWULFSDWLHQWV $GDSWLQJ FRPPXQLFDWLRQWR DSSURSULDWHKHDOWK OLWHUDF\ OHYHOV &RPSOHWLQJ WKRURXJKDFFXUDWH DQDO\WLFDOO\VRXQG FRQFLVHDQGWLPHO\ GRFXPHQWDWLRQWKDW IROORZV JXLGHOLQHVDQGVSHFLILF GRFXPHQWDWLRQIRUPDWV UHTXLUHGE\WKHSUDFWLFH VHWWLQJHJ FRPPXQLFDWLRQ ZLWKSD\HUVRXUFHVIRU PD[LPL]LQJWUHDWPHQW VHUYLFHV DQGUHVRXUFHVOHJDO SURWHFWLRQRIVWDII SDWLHQWDQG RUIDFLOLW\ • Patient/Client-Related Instruction 3URYLGLQJ SDWLHQWFOLHQWLQVWUXFWLRQ DERXWGLDJQRVLV F 3URYLGH SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQDLPHGDWULVN UHGXFWLRQSUHYHQWLRQDV ZHOODVZRPHQ¶VKHDOWK ZHOOQHVVDQGILWQHVV SURJQRVLVDQG LQWHUYHQWLRQ G 3URYLGH SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQLQWKH IROORZLQJDUHDVRI ZRPHQ¶VKHDOWK H 3UHQDWDOSRVWS DUWXPH[HUFLVH I 3RVWXUHDQG ERG\PHFKDQLFVGXULQJ WKHFKLOGEHDULQJ\HDU J 3URJUHVVLYH SHOYLFIORRUWKHUDSHXWLF H[HUFLVHV K %UHDVW VXUJHU\UHFRYHU\HJ ZRXQGFDUHERG\ PHFKDQLFVH[HUFLVH L %ODGGHU WUDLQLQJ M 3HOYLF IORRUPXVFOH G\VIXQFWLRQ N 3HOYLF SDLQVHOIFDUHHJ K\JLHQHWRLOHWLQJKDELWV GLHW O (IIHFWVRIGDLO\ KDELWVRQEODGGHU FRQWURO Procedural Interventions (chosen and administered to minimize impact of the environment on the efficacy of the intervention and to maximize the patient’s/client’s ability to function in the environment) 7KHUDSHXWLF H[HUFLVHLQFOXGLQJEXW QRWOLPLWHGWR D $HURELF HQGXUDQFHDFWLYLWLHV E $TXDWLF H[HUFLVHV F 3RVLWLRQLQJ G %DODQFHDQG FRRUGLQDWLRQWUDLQLQJ H %UHDWKLQJ H[HUFLVHVDQG YHQWLODWRU\PXVFOH WUDLQLQJ I &RQGLWLRQLQJ DQGUHFRQGLWLRQLQJ DFWLYLWLHV J 'HYHORSPHQWDO DFWLYLWLHV K B*DLW ORFRPRWLRQRUHOHYDWLRQ WUDLQLQJZLWKRU ZLWKRXWDVVLVWLYH GHYLFHVRUHTXLSPHQW L B0RWRUIXQFWLRQ PRWRUFRQWURODQG PRWRUOHDUQLQJ WUDLQLQJDQGUHWUDLQLQJ M 1HXURPXVFXODU HGXFDWLRQRU UHHGXFDWLRQ 50 SURIHVVLRQDOVDQG SD\HUV &ROODERUDWLQJDVD KHDOWKFDUHWHDP PHPEHUDQGOHDGHUWR HQVXUHWKDW SK\VLFDOWKHUDS\LVD SDUWRIDQDSSURSULDWH FXOWXUDOO\FRPSHWHQW FRPSUHKHQVLYHSODQLQ WKHFDUHRISDWLHQWVZLWK FDQFHU $GDSWLQJ FRPPXQLFDWLRQWR DSSURSULDWHKHDOWK OLWHUDF\OHYHOV &RPSOHWLQJWKRURXJK DFFXUDWHDQDO\WLFDOO\ VRXQGFRQFLVHDQG WLPHO\ GRFXPHQWDWLRQWKDW IROORZVJXLGHOLQHVDQG VSHFLILFGRFXPHQWDWLRQ IRUPDWVUHTXLUHGE\WKH SUDFWLFHVHWWLQJHJ FRPPXQLFDWLRQZLWK SD\HUVRXUFHVIRU PD[LPL]LQJWUHDWPHQW VHUYLFHVDQGUHVRXUFHV OHJDO SXOVHEORRGSUHVVXUH SXOVHR[LPHWU\G\VSQHD VFDOHSHUFHLYHG H[HUWLRQVFDOHDQJLQD FODXGLFDWLRQ RURWKHUSDLQVFDOHV WKURXJKWKHUDSHXWLF LQWHUYHQWLRQDQG DFWLYLWLHVRIGDLO\OLYLQJ ,QVWUXFWLQJ SDWLHQWFOLHQWLQ IXQFWLRQDODFWLYLWLHV DQGGLVDELOLW\ PDQDJHPHQWWKDW FRUUHVSRQG DSSURSULDWHO\WR SDWLHQWFOLHQW FDUGLRYDVFXODU DQGSXOPRQDU\ GLDJQRVLVVWDWXVDQG DYDLODEOH UHVRXUFHVDQGVXSSRUW V\VWHP ,QVWUXFWLQJ SDWLHQWVFOLHQWVLQKHDOWK SURPRWLRQ DQGZHOOQHVVULVNIDFWRU PRGLILFDWLRQVFUHHQLQJ IRUFDUGLRYDVFXODUDQG SXOPRQDU\GLVHDVH SUHVHQFHSURJUHVVLRQRU LPSDLUPHQWVQXWULWLRQ HQHUJ\FRQVHUYDWLRQ DQGVWUHVV PDQDJHPHQW &RQVLVWHQWO\ HYDOXDWLQJWKHUHVXOWRI LQVWUXFWLRQDO HIIRUWVE\REVHUYLQJD OHDUQHU¶VDELOLW\ WRSHUIRUPWKHVNLOOVWKDW ZHUHWDXJKWDQGE\ UHVSRQGLQJWRGHILFLWV 3. Procedural Interventions SURJQRVLVDQG LQWHUYHQWLRQVWUDWHJLHV 3URYLGLQJ SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQWR LQFUHDVHSDWLHQWFOLHQW XQGHUVWDQGLQJRI LQGLYLGXDO DELOLWLHVIXQFWLRQDO OLPLWDWLRQVRUGLVDELOLWLHV 3URYLGLQJ SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQDLPHGDW ULVNUHGXFWLRQSUHYHQWLRQ DVZHOODVKHDOWK SURPRWLRQ $VVLVWLQJ SDWLHQWFOLHQWLQFULWLFDOO\ ORRNLQJDW ,QWHUQHWDQGRWKHU LQIRUPDWLRQWKDWLV DYDLODEOHLQ WKHFRPPXQLW\ $GDSWLQJ LQVWUXFWLRQIRUWKH VLWXDWLRQHJOHDUQLQJ VW\OHVDFWXDOSUDFWLFHE\ WKHSDWLHQWRUFDUHJLYHU XVHRIDXGLRDQGYLVXDO DLGVYHUEDOZULWWHQ SLFWRULDO LQVWUXFWLRQFXOWXUDOO\ VHQVLWLYHLQVWUXFWLRQ 3URYLGH SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQLQWKH IROORZLQJ VSHFLDOL]HGDUHDVRI JHULDWULFSK\VLFDO WKHUDS\ HJIDOOVSUHYHQWLRQ ERQHKHDOWKJHULDWULF DWKOHWH DELOLW\HQKDQFHPHQW IRRWFDUH P %HKDYLRUDO WHFKQLTXHVIRUSHOYLF IORRUG\VIXQFWLRQ Q %HKDYLRUDO WHFKQLTXHVIRU O\PSKHGHPD PDQDJHPHQWDQG SUHYHQWLRQ R 3RVLWLRQLQJ RSWLRQVIRUVH[XDO LQWHUFRXUVHWKDWPLJKW PLQLPL]HSHOYLFSDLQ G\VSDUHXQLDRUEDFN SDLQ S *XLGHOLQHVIRU SRVLWLRQLQJIRUODERUDQG GHOLYHU\IRUDFOLHQWZLWK SUHH[LVWLQJVSLQDO G\VIXQFWLRQ 3URFHGXUDO ,QWHUYHQWLRQV D 7KHUDSHXWLF H[HUFLVHLQFOXGLQJEXW QRWOLPLWHGWRWKH IROORZLQJ E 6WUHQJWK SRZHUDQGHQGXUDQFH PXVFOHWUDLQLQJIRU SHOYLFIORRUPXVFXODWXUH F $VVLVWLYH² PDQXDOIDFLOLWDWLRQ RYHUIORZIURP DVVRFLDWHGPXVFOHV G$FWLYH²ZLWKDQG ZLWKRXWIHHGEDFNHJ V(0*PDQRPHWU\ ELRIHHGEDFN N 1HXURPXVFXODU UHOD[DWLRQLQKLELWLRQ DQGIDFLOLWDWLRQ O 3HUFHSWXDO WUDLQLQJ P B3RVWXUHDQG ERG\PHFKDQLFVWUDLQLQJ IRUSDWLHQW FOLHQWIDPLO\FDUHJLYHUV Q 6WUHQJWKHQLQJ DFWLYLWLHVDFWLYH DVVLVWLYHUHVLVWLYH R 6WUHWFKLQJ S 6WUXFWXUHGSOD\ DFWLYLWLHV B)XQFWLRQDO WUDLQLQJVHOIFDUH VFKRROFRPPXQLW\ WRLQFOXGH D B$'/WUDLQLQJ LQPRELOLW\EHGDQG EDWKURRP PRELOLW\WUDQVIHU E B$'/WUDLQLQJ LQVHOIFDUHHDWLQJ JURRPLQJGUHVVLQJ F B7UDLQLQJRI IDPLO\FDUHJLYHUVLQ VXSSRUWQHRQDWDO DQGLQIDQW$'/DFWLYLWLHV LHIHHGLQJVWUDWHJLHV DQGIHHGLQJ DLGVHTXLSPHQW G (QYLURQPHQWDO DGDSWDWLRQV H B,QVWUXPHQWDO $'/WUDLQLQJVKRSSLQJ GULYLQJ SOD\JURXQGRUSHHU DFWLYLWLHVKRPH I2UWKRWLFGHYLFHWUDLQLQJ J3URVWKHWLFGHYLFH WUDLQLQJ 0DQXDOWKHUDS\ 51 SURWHFWLRQRIVWDII SDWLHQWDQGRUIDFLOLW\ āPatient/Client-Related Instruction 3URYLGLQJ SDWLHQWFOLHQWLQVWUXFWLRQ DERXWGLDJQRVLV SURJQRVLVDQG LQWHUYHQWLRQVWUDWHJLHV 3URYLGLQJ SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQWRLQFUHDVH SDWLHQWFOLHQW XQGHUVWDQGLQJRI LQGLYLGXDODELOLWLHV IXQFWLRQDOOLPLWDWLRQVRU GLVDELOLWLHV 3URYLGHSDWLHQWFOLHQW UHODWHGLQVWUXFWLRQ UHJDUGLQJFDQFHU GLVHDVH VFUHHQLQJ UHFRPPHQGDWLRQV 3URYLGLQJ SDWLHQWFOLHQWUHODWHG LQVWUXFWLRQDLPHGDWULVN UHGXFWLRQSUHYHQWLRQDV ZHOODVKHDOWKSURPRWLRQ 0RGLI\LQJRU FRQWLQXLQJLQWHUYHQWLRQ EDVHGRQ RQJRLQJHYDOXDWLRQDQG EHVWDYDLODEOHHYLGHQFH 6HOHFWLQJDQG VSHFLILFDOO\SUHVFULELQJ RUPRGLI\LQJ LQWHUYHQWLRQVEDVHGRQ WKHSDWLHQW¶VFOLHQW¶V DQDWRPLFDQG SK\VLRORJLFDOFKDQJHV DFURVVWKH OLIHVSDQDQGWKHFXUUHQW PHGLFDOVWDWXVVWDELOLW\ 6HOHFWLQJDQG VSHFLILFDOO\SUHVFULELQJ RUPRGLI\LQJ LQWHUYHQWLRQVEDVHGRQ W\SHDQGVHYHULW\RI WKHFDUGLRYDVFXODUDQG SXOPRQDU\SDWKRORJ\ LPSDLUPHQWIXQFWLRQDO OLPLWDWLRQRUGLVDELOLW\ 1HJRWLDWLQJEDUULHUVWR LQWHUYHQWLRQVZLWKWKH SDWLHQWFOLHQWLQFOXGLQJ FRJQLWLRQOLWHUDF\ ODQJXDJHHPRWLRQDO VWDWHVRFLRHFRQRPLF VWDWXV DQGVFDUFLW\RI UHVRXUFHVUHVXOWLQJLQ LPSURYHGRSWLPL]HG DGKHUHQFH Specific Intervention Techniques Therapeutic Exercise 3UHVFULSWLRQDQG SHUIRUPDQFHRIWUDLQLQJ WHFKQLTXHV WRLPSURYHVWUHQJWKRU HQGXUDQFHRI YHQWLODWRU\PXVFOHVDQG WRGHYHORSEUHDWKLQJ 0DLQWDLQLQJDFXUUHQW NQRZOHGJHEDVH UHJDUGLQJ FXUUHQWKHDOWKLQGLFDWRUV DVLGHQWLILHGE\WKH 'HSDUWPHQWRI+HDOWK DQG&HQWHUIRU'LVHDVH &RQWURODQG3UHYHQWLRQ LQRUWRSURYLGH HGXFDWLRQ WRWKHSDWLHQW FDUHJLYHUVKHDOWK SURIHVVLRQDOVDQG WKHSXEOLFRQWKHUROHRI SK\VLFDOWKHUDS\ LQWHUYHQWLRQV • Procedural Interventions 7KHUDSHXWLFH[HUFLVH LQFOXGLQJEXWQRWOLPLWHG WR D$HURELF FDSDFLW\HQGXUDQFH FRQGLWLRQLQJRU UHFRQGLWLRQLQJHJ JDLWORFRPRWLRQWUDLQLQJ F\FOHVLQFUHDVHG ZRUNORDGRYHUWLPH WUHDGPLOOV PRYHPHQWHIILFLHQF\ DQGHQHUJ\ FRQVHUYDWLRQ LQVWUXFWLRQRUWUDLQLQJ E%DODQFH FRRUGLQDWLRQDQGDJLOLW\ WUDLQLQJHJ IDOOULVNUHGXFWLRQDQG HGXFDWLRQ QHXURPXVFXODU HGXFDWLRQRU UHHGXFDWLRQSHUFHSWXDO WUDLQLQJSRVWXUH DZDUHQHVVWUDLQLQJ VHQVRU\WUDLQLQJRU H5HVLVWLYH²YDJLQDO ZHLJKWV I%RG\PHFKDQLFV J3RVWXUDOVWDELOL]DWLRQ DFWLYLWLHV K6WUHQJWKHQLQJRI LGHQWLILHGZHDN PXVFXODWXUH L*HQHUDODQGDHURELF FRQGLWLRQLQJ M5HOD[DWLRQ VWUDWHJLHVWHFKQLTXHV N&RRUGLQDWLRQWUDLQLQJ O1HXURPXVFXODU HGXFDWLRQRU UHHGXFDWLRQ P$FWLYLWLHVRIGDLO\ OLYLQJ$'/WUDLQLQJ LQFOXGLQJWRLOHWLQJ LQFOXGLQJEXWQRWOLPLWHG WRDYRLGDQFHRI YDOVDOYDPDQHXYHU GUHVVLQJXQGUHVVLQJDQG FORWKLQJRSWLRQV K\JLHQHVNLQDQGQDLO FDUHERZHODQGEODGGHU WUDLQLQJWHFKQLTXHV VHQVRULPRWRU SHUIRUPDQFHZDONLQJ WUDQVIHUVEHGPRELOLW\ HWFEDVLFQXWULWLRQDO DQGIOXLGLQWDNH HGXFDWLRQDQGDVVLVWLYH RUDGDSWLYHGHYLFHVRU HTXLSPHQWWUDLQLQJ Q 0DQXDOWKHUDS\ WHFKQLTXHVLQFOXGLQJ EXWQRWOLPLWHGWR R&RQQHFWLYHWLVVXH PDVVDJHHJLQWHUQDO YDJLQDOUHFWDODQG H[WHUQDOP\RIDVFLDO UHOHDVHYLVFHUDO PRELOL]DWLRQ WHFKQLTXHVZKLFKPD\ LQFOXGH D&RQQHFWLYHWLVVXH PDVVDJH ERLQWPRELOL]DWLRQ F6RIWWLVVXH PRELOL]DWLRQ 3UHVFULSWLRQ DSSOLFDWLRQDQGDV DSSURSULDWHIDEULFDWLRQ RIGHYLFHVDQG HTXLSPHQWWRLQFOXGH D$GDSWLYHGHYLFHVRU HTXLSPHQWHJDGDSWHG WRLOHW VHDWVVLGHO\HUVVHDWLQJ V\VWHPVHQYLURQPHQWDO FRQWUROV E$VVLVWLYHGHYLFHVRU HTXLSPHQWHJFDQHV FUXWFKHV ZDONHUVJDLWWUDLQHUV ZKHHOFKDLUV F3UHIDEULFDWHGRU RUWKRWLVWIDEULFDWHG HTXLSPHQW RUWKRWLFGHYLFHVVKRH LQVHUWV G)DEULFDWLRQVRIVHULDO FDVWV H)DEULFDWLRQRIVSOLQWV ORZWHPSHUDWXUH PDWHULDOV I&DVWLQJRUPROGLQJIRU G\QDPLFDQNOHIRRW RUWKRVHV J3URWHFWLYHGHYLFHV KHOPHWVWDSLQJ FXVKLRQV K6XSSRUWLYHGHYLFHV WDSLQJSUHVVXUH JDUPHQWV HODVWLFZUDSV 2 $VVLVWLQJ SDWLHQWFOLHQWLQFULWLFDOO\ ORRNLQJDW,QWHUQHWDQG RWKHU LQIRUPDWLRQWKDWLV DYDLODEOHLQWKH FRPPXQLW\ $GDSWLQJLQVWUXFWLRQ IRUWKHVLWXDWLRQHJ OHDUQLQJVW\OHVDFWXDO SUDFWLFHE\WKHSDWLHQW RUFDUHJLYHUXVHRI DXGLRDQGYLVXDODLGV YHUEDOZULWWHQSLFWRULDO LQVWUXFWLRQFXOWXUDOO\ VHQVLWLYHLQVWUXFWLRQ 3URYLGHSDWLHQWFOLHQW UHODWHGLQVWUXFWLRQLQ VSHFLDOL]HGDUHDVRI RQFRORJLFSK\VLFDO WKHUDS\HJULVNIRUODWH HIIHFWVRIFDQFHU WUHDWPHQWUDGLDWLRQ UHODWHGVNLQDQGWLVVXH FKDQJHV FKHPRWKHUDSHXWLF WR[LFLWLHVDQGWKHLU LPSDFWRQFDUGLDF QHXURORJLFDO UHWUDLQLQJVWUDWHJLHV 3UHVFULSWLRQDQG SHUIRUPDQFHRIWUDLQLQJ PHWKRGV IRUSDWLHQWVFOLHQWVXVLQJ HOHFWURFDUGLRJUDP (&*YHQWLODWRU\ YROXPHSDWWHUQ R[LPHWU\ DQGRWKHUPRQLWRULQJ GHYLFHVWRWLWUDWH LQWHQVLW\ GXUDWLRQIUHTXHQF\DQG QHHGIRUVXSSRUWLYH GHYLFHVHJR[\JHQ $SSURSULDWH SUHVFULSWLRQDQG SHUIRUPDQFH RIWUDLQLQJPHWKRGVIRU SDWLHQWVFOLHQWVZLWK KHPRG\QDPLF VXSSRUWPRQLWRULQJ GHYLFHVHJ YHQWULFXODUDVVLVWGHYLFH >9$'@SXOPRQDU\ DUWHULDO>3$@FDWKHWHUV HWF 8WLOL]DWLRQRI PHFKDQLFDOYHQWLODWLRQ PHWKRGV WRVXSSRUWSK\VLFDO WKHUDS\LQWHUYHQWLRQV HJ ELOHYHOSRVLWLYHDLUZD\ SUHVVXUH>%L3$3@ SRVLWLYH SUHVVXUHYHQWLODWRU $SSURSULDWH SUHVFULSWLRQDQG SHUIRUPDQFHRI WUDLQLQJWHFKQLTXHVIRU SDWLHQWVFOLHQWVUHTXLULQJ FDUGLRYDVFXODUDVVLVW GHYLFHV9$' LQWUDDRUWLF UHWUDLQLQJVWDQGDUGL]HG SURJUDPPDWLF FRPSOHPHQWDU\ H[HUFLVHDSSURDFKHV WDVNVSHFLILF SHUIRUPDQFH WUDLQLQJ F9HVWLEXODUWUDLQLQJ G%RG\PHFKDQLFVDQG SRVWXUDOVWDELOL]DWLRQ HJ ]HUROLIWLQJWHFKQLTXHV IRUFDUHJLYHUVSRVWXUDO VWDELOL]DWLRQ DFWLYLWLHVSRVWXUH DZDUHQHVVWUDLQLQJ H*DLWDQGORFRPRWLRQ WUDLQLQJHJJDLW WUDLQLQJ LPSOHPHQWDQGGHYLFH WUDLQLQJSHUFHSWXDO WUDLQLQJVWDQGDUGL]HG SURJUDPPDWLFDQG FRPSOHPHQWDU\H[HUFLVH DSSURDFKHVSRZHUHG DQGQRQSRZHUHG ZKHHOFKDLUPRELOLW\ WUDLQLQJ IDOOSUHYHQWLRQ I1HXURPRWRU GHYHORSPHQWWUDLQLQJ HJPRWRU WUDLQLQJPRYHPHQW SDWWHUQWUDLQLQJ FRQVWUDLQW LQGXFHGPRYHPHQW WKHUDS\QHXURPXVFXODU HGXFDWLRQ RUUHHGXFDWLRQ J6WUHQJWKSRZHUDQG HQGXUDQFHWUDLQLQJIRU KHDGQHFNOLPESHOYLF IORRUWUXQNDQG YHQWLODWRU\ S6RIWWLVVXH PRELOL]DWLRQPDQLSXODWLR Q T7KHUDSHXWLFPDVVDJH U-RLQW PRELOL]DWLRQPDQLSXODWLR QLQFOXGLQJPXVFOH HQHUJ\DQGGLUHFWMRLQW PRELOL]DWLRQ V3DVVLYHUDQJHRI PRWLRQ W0DQXDOWUDFWLRQ X0DQXDOO\PSKDWLF GUDLQDJH Y(OHFWURWKHUDSHXWLF PRGDOLWLHV Z%LRIHHGEDFN²V(0* PDQRPHWU\ [1HXURPXVFXODU HOHFWULFDOVWLPXODWLRQ HJ VWUHQJWKHQLQJLQIOXHQFLQ JVDFUDOPLFWXULWLRQ UHIOH[DUFSDLQ PDQDJHPHQW \3K\VLFDODJHQWVDQG PHFKDQLFDOPRGDOLWLHV ]1RQWKHUPDOPRGDOLWLHV HJSXOVHGXOWUDVRXQG SXOVHGHOHFWURPDJQHWLF ILHOGV DD&U\RWKHUDS\ EE7KHUPRWKHUDS\HJ GHHSKHDWVXFKDV XOWUDVRXQG SKRQRSKRUHVLVDQG GLDWKHUP\DQG VXSHUILFLDOKHDWVXFKDV KRWSDFNV FF9DJLQDODQGUHFWDO GLODWRUV GG&RPSUHVVLRQ EDQGDJLQJDQG JDUPHQWV LB$VVLVWLQJZLWK REWDLQLQJIXQGLQJIRU UHFRPPHQGHG HTXLSPHQWLQFOXGLQJ SURYLGLQJDUDWLRQDOHIRU VHOHFWLRQDQGXVH $LUZD\FOHDUDQFH WHFKQLTXHVLQFOXGLQJ D$VVLVWLYHFRXJK WHFKQLTXHV E8VHRIPHFKDQLFDO GHYLFHV F&KHVWSHUFXVVLRQ YLEUDWLRQDQGSRVWXUDO GUDLQDJH G7HFKQLTXHVWR PD[LPL]HYHQWLODWLRQ HJPD[LPDOLQVSLUDWLRQ :RXQGPDQDJHPHQW D7UHDWPHQWRI SDWLHQWVFOLHQWVZLWK EXUQV E7UHDWPHQWRI SDWLHQWVFOLHQWVZLWK GHFXELWL FB7UHDWPHQWRI SDWLHQWVFOLHQWVZLWK RSHQZRXQGV VHFRQGDU\WRWUDXPD LQIHFWLRQHWF (OHFWURWKHUDSHXWLF PRGDOLWLHV D8VHRIELRIHHGEDFN E8VHRIIXQFWLRQDO HOHFWULFDOVWLPXODWLRQ )(6 FB8VHRI QHXURPXVFXODUHOHFWULFDO VWLPXODWLRQ 10(6 0HFKDQLFDO 0RGDOLWLHV D8VHRIWLOWWDEOHRU VWDQGLQJGHYLFHV 3 FDUGLRSXOPRQDU\DQG LQWHJXPHQWDU\IXQFWLRQ IDOOVSUHYHQWLRQERQH KHDOWKVDIHW\ZLWK H[HUFLVH 0DLQWDLQLQJDFXUUHQW NQRZOHGJHEDVH UHJDUGLQJFXUUHQWKHDOWK LQGLFDWRUVDVLGHQWLILHG E\SROLF\ERGLHV LQFOXGLQJ7KH86 +HDOWKDQG 3UHYHQWLYH7DVNIRUFH &HQWHUIRU'LVHDVH &RQWURODQG3UHYHQWLRQ WKH 1DWLRQDO&DQFHU ,QVWLWXWHHWFLQRUWR SURYLGHHGXFDWLRQWRWKH SDWLHQW FDUHJLYHUVKHDOWK SURIHVVLRQDOVDQGWKH SXEOLFRQWKHUROHRI SK\VLFDO WKHUDS\LQWHUYHQWLRQV āProcedural Interventions 7KHUDSHXWLFH[HUFLVH LQFOXGLQJEXWQRWOLPLWHG WR EDOORRQSXPS>,$%3@ 3UHVFULEHWKHUDSHXWLF H[HUFLVHLQWHUYHQWLRQV DQG DSSURSULDWHO\LPSOHPHQW DQGPRQLWRUUHVSRQVHV RISDWLHQWVFOLHQWVRQ YHQWLODWRU\DVVLVW GHYLFHV PHFKDQLFDOYHQWLODWRUV %L3$3FRQWLQXRXV SRVLWLYHDLUZD\SUHVVXUH >&3$3@ Airway Clearance Techniques 3HUIRUPQDVRWUDFKHDO VXFWLRQLQJ 3HUIRUPHQGRWUDFKHDO YLDDUWLILFLDODLUZD\RUDO RUWUDFKHDOVXFWLRQLQJ 5HFRPPHQGVHOHFW DQGDSSURSULDWHO\ PDQDJH R[\JHQGHOLYHU\V\VWHPV IRUSXUSRVHRI WUHDWPHQW $SSURSULDWHO\PDQDJH YHQWLODWRU\VXSSRUW V\VWHPV GXULQJSK\VLFDOWKHUDS\ LQWHUYHQWLRQDQG UHFRPPHQGWKHXVHRI YHQWLODWRU\VXSSRUW V\VWHPV WRPD[LPL]HYHQWLODWLRQ GXULQJIXQFWLRQDO PRYHPHQW 3URYLGHPDQXDO YHQWLODWLRQGXULQJ LQWHUYHQWLRQ 3HUIRUPDVVLVWLYH FRXJKWHFKQLTXHV² PDQXDO DQGPHFKDQLFDO PXVFOHVHJDFWLYH DVVLVWLYHDFWLYHDQG UHVLVWLYHH[HUFLVHV DTXDWLFSURJUDPV VWDQGDUGL]HG SURJUDPPDWLF FRPSOHPHQWDU\H[HUFLVH DSSURDFKHVWDVN VSHFLILFSHUIRUPDQFH WUDLQLQJ )XQFWLRQDO 7UDLQLQJLQ6HOI&DUH DQG+RPH 0DQDJHPHQWWRLQFOXGH D%DUULHU DFFRPPRGDWLRQVRU PRGLILFDWLRQVHJ HQYLURQPHQWDO PRGLILFDWLRQ E'HYLFHDQG HTXLSPHQWXVHDQG WUDLQLQJHJIULFWLRQ UHGXFWLRQGHYLFHVOLIWV DVVLVWLYHDQGDGDSWLYH GHYLFHRUHTXLSPHQW WUDLQLQJGXULQJ$'/DQG ,$'/RUWKRWLF SURWHFWLYHRUVXSSRUWLYH GHYLFH RUHTXLSPHQWWUDLQLQJ GXULQJVHOIFDUHDQG KRPH PDQDJHPHQWSURVWKHWLF GHYLFHRUHTXLSPHQW WUDLQLQJGXULQJ$'/DQG ,$'/ F)XQFWLRQDOWUDLQLQJ SURJUDPVHJVLPXODWHG HQYLURQPHQWVDQGWDVNV WUDQVIHUWUDLQLQJEHG PRELOLW\XSIURPIORRU WDVNDGDSWDWLRQ G,QMXU\SUHYHQWLRQRU UHGXFWLRQHJVHOIFDUH DQG HH3UHVFULSWLRQ DSSOLFDWLRQDQGDV DSSURSULDWHIDEULFDWLRQ RIDVVLVWLYHRUWKRWLF SURVWKHWLFSURWHFWLYH DQGVXSSRUWLYHGHYLFHV DQGHTXLSPHQWHJ FUXWFKHVZDONHUV VSOLQWVSHVVDULHV VDFURLOLDFMRLQWEHOWV FRPSUHVVLRQJDUPHQWV HODVWLFZUDSV 4 D$HURELF FDSDFLW\HQGXUDQFH FRQGLWLRQLQJRU UHFRQGLWLRQLQJHJ JDLWORFRPRWLRQWUDLQLQJ F\FOHVLQFUHDVHG ZRUNORDGRYHUWLPH WUHDGPLOOVPRYHPHQW HIILFLHQF\DQGHQHUJ\ FRQVHUYDWLRQ LQVWUXFWLRQRUWUDLQLQJ E%DODQFH FRRUGLQDWLRQDQGDJLOLW\ WUDLQLQJHJIDOOULVN UHGXFWLRQ DQGHGXFDWLRQ QHXURPXVFXODU HGXFDWLRQRU UHHGXFDWLRQ LQWHJUDWLRQRIFRUH VWUHQJWKDQGVWDELOLW\WR EDODQFHSHUFHSWXDO WUDLQLQJSRVWXUH DZDUHQHVVWUDLQLQJ VHQVRU\WUDLQLQJRU 5HFRPPHQGDQG DSSURSULDWHO\PDQDJH PHFKDQLFDODLUZD\ FOHDUDQFHGHYLFHVVXFK DV KLJKIUHTXHQF\FKHVW ZDOORVFLOODWRUVHJ 9HVW SRVLWLYHH[SLUDWRU\ SUHVVXUH3(3GHYLFHV DQG RVFLOODWLQJ3(3HJ $FDSHOOD)OXWWHU LQWUDSXOPRQDU\ SHUFXVVLYHYHQWLODWLRQ ,QVWUXFWDQGGLUHFW SDWLHQWFOLHQWGULYHQDQG LQGHSHQGHQWVHOI PDQDJHPHQW LQWHUYHQWLRQ WHFKQLTXHVVXFKDV DXWRJHQLFGUDLQDJH DFWLYH F\FOHRIEUHDWKLQJDQG VHOIVXFWLRQLQJ KRPHPDQDJHPHQWXVH RIGHYLFHVDQG HTXLSPHQW VDIHW\DZDUHQHVV WUDLQLQJGXULQJVHOIFDUH DQGKRPHPDQDJHPHQW ]HUROLIWKRPHVDIHW\ DQGHQHUJ\ FRQVHUYDWLRQIDOO SUHYHQWLRQDQG HGXFDWLRQXVHRI GHYLFHVWRGHFUHDVH LQMXULRXV IDOOV )XQFWLRQDOWUDLQLQJLQ ZRUNSXUSRVHIXO DFWLYLW\ FRPPXQLW\DQGOHLVXUH LQWHJUDWLRQRU UHLQWHJUDWLRQ LQFOXGLQJEXWQRWOLPLWHG WR D)XQFWLRQDOWUDLQLQJ SURJUDPVHJVLPXODWHG HQYLURQPHQWDQGWDVNV WDVNDGDSWDWLRQWDVN WUDLQLQJ FDUGLRSXOPRQDU\ UHKDELOLWDWLRQGH[WHULW\ FRRUGLQDWLRQ FRQGLWLRQLQJUHFRQGLWLRQL QJ WUDLQLQJ E,QMXU\SUHYHQWLRQRU UHGXFWLRQHJLQMXU\ SUHYHQWLRQ UHWUDLQLQJVWDQGDUGL]HG SURJUDPPDWLF FRPSOHPHQWDU\ 5 H[HUFLVHDSSURDFKHV WDVNVSHFLILF SHUIRUPDQFHWUDLQLQJ F9HVWLEXODUWUDLQLQJ G%RG\PHFKDQLFVDQG SRVWXUDOVWDELOL]DWLRQ HJOLIWLQJWHFKQLTXHV IRUFDUHJLYHUVSRVWXUDO VWDELOL]DWLRQDFWLYLWLHV SRVWXUH DZDUHQHVVWUDLQLQJ H*DLWDQGORFRPRWLRQ WUDLQLQJHJJDLW WUDLQLQJLPSOHPHQWDQG GHYLFHWUDLQLQJ SHUFHSWXDOWUDLQLQJ VWDQGDUGL]HG SURJUDPPDWLFDQG FRPSOHPHQWDU\H[HUFLVH DSSURDFKHV ZKHHOFKDLUPRELOLW\ WUDLQLQJIDOOSUHYHQWLRQ I1HXURPRWRU GHYHORSPHQWWUDLQLQJ HJPRWRUWUDLQLQJ PRYHPHQWSDWWHUQ WUDLQLQJFRQVWUDLQW LQGXFHGPRYHPHQW 6 WKHUDS\QHXURPXVFXODU HGXFDWLRQRU UHHGXFDWLRQ J6WUHQJWKSRZHUDQG HQGXUDQFHWUDLQLQJIRU KHDGQHFNOLPE SHOYLFIORRUWUXQNDQG YHQWLODWRUPXVFOHVHJ DFWLYHDVVLVWLYH DFWLYHDQGUHVLVWLYH H[HUFLVHVDTXDWLF SURJUDPVVWDQGDUGL]HG SURJUDPPDWLF FRPSOHPHQWDU\H[HUFLVH DSSURDFKHV WDVNVSHFLILF SHUIRUPDQFHWUDLQLQJ )XQFWLRQDO7UDLQLQJLQ 6HOI&DUHDQG+RPH 0DQDJHPHQWWRLQFOXGH D%DUULHU DFFRPPRGDWLRQVRU PRGLILFDWLRQVHJ HQYLURQPHQWDO PRGLILFDWLRQ E'HYLFHDQG HTXLSPHQWXVHDQG WUDLQLQJHJDVVLVWLYH DQG 7 DGDSWLYHGHYLFHRU HTXLSPHQWWUDLQLQJ GXULQJ$'/DQG,$'/ RUWKRWLFSURWHFWLYHRU VXSSRUWLYHGHYLFHRU HTXLSPHQWWUDLQLQJ GXULQJVHOIFDUHDQG KRPHPDQDJHPHQW SURVWKHWLFGHYLFHRU HTXLSPHQWWUDLQLQJ GXULQJ$'/DQG,$'/ F)XQFWLRQDOWUDLQLQJ SURJUDPVHJVLPXODWHG HQYLURQPHQWVDQG WDVNVWUDQVIHUWUDLQLQJ EHGPRELOLW\XSIURP IORRUWDVN DGDSWDWLRQ G,QMXU\SUHYHQWLRQRU UHGXFWLRQHJVHOIFDUH DQGKRPH PDQDJHPHQWXVHRI GHYLFHVDQGHTXLSPHQW VDIHW\DZDUHQHVV WUDLQLQJGXULQJVHOIFDUH DQGKRPHPDQDJHPHQW KRPHVDIHW\ DQGHQHUJ\ FRQVHUYDWLRQIDOO 8 SUHYHQWLRQDQG HGXFDWLRQXVHRI GHYLFHVWRGHFUHDVH LQMXULRXVIDOOV )XQFWLRQDOWUDLQLQJLQ ZRUNSXUSRVHIXO DFWLYLW\FRPPXQLW\ DQG OHLVXUHLQWHJUDWLRQRU UHLQWHJUDWLRQLQFOXGLQJ EXWQRWOLPLWHGWR D)XQFWLRQDOWUDLQLQJ SURJUDPVHJVLPXODWHG HQYLURQPHQWDQG WDVNVWDVNDGDSWDWLRQ WDVNWUDLQLQJ FDUGLRSXOPRQDU\ UHKDELOLWDWLRQGH[WHULW\ FRRUGLQDWLRQ FRQGLWLRQLQJUHFRQGLWLRQL QJWUDLQLQJ E,QMXU\SUHYHQWLRQRU UHGXFWLRQHJLQMXU\ SUHYHQWLRQHGXFDWLRQ GXULQJZRUNFRPPXQLW\ DQGOHLVXUHLQWHJUDWLRQ RU 9 UHLQWHJUDWLRQLQMXU\ SUHYHQWLRQHGXFDWLRQ ZLWKXVHRIGHYLFHV DQGHTXLSPHQWVDIHW\ DZDUHQHVVWUDLQLQJ GXULQJZRUN FRPPXQLW\DQGOHLVXUH LQWHJUDWLRQRU UHLQWHJUDWLRQ 0DQXDOWKHUDS\ WHFKQLTXHVZKLFKPD\ LQFOXGH D0DQXDOO\PSKDWLF GUDLQDJH E 0RELOL]DWLRQPDQLSXODWLR QHJVRIWWLVVXHVSLQDO DQGSHULSKHUDO MRLQWV F6FDUWLVVXH PRELOL]DWLRQ 3UHVFULSWLRQ DSSOLFDWLRQDQGDV DSSURSULDWHIDEULFDWLRQ RIGHYLFHV DQGHTXLSPHQWWR LQFOXGH 60 D$GDSWLYHGHYLFHVHJ HQYLURQPHQWDOFRQWUROV KRVSLWDOEHGV UDLVHGWRLOHWVHDWV VHDWLQJV\VWHPVUDPSV OLIWV E$VVLVWLYHGHYLFHVHJ FDQHVFUXWFKHVORQJ KDQGOHGUHDFKHUV SRZHUGHYLFHVVWDWLF DQGG\QDPLFVSOLQWV ZDONHUVZKHHOFKDLUV F2UWKRWLFGHYLFHVHJ EUDFHVFDVWVVKRH LQVHUWVVSOLQWVJUDGHG FRPSUHVVLRQJDUPHQWV G3URVWKHWLFGHYLFHV ORZHUH[WUHPLW\DQG XSSHUH[WUHPLW\ H3URWHFWLYHGHYLFHV HJEUDFHVFXVKLRQV KHOPHWVSURWHFWLYH WDSLQJ I6XSSRUWLYHGHYLFHV HJFRPSUHVVLRQ JDUPHQWVFRUVHWV HODVWLF 61 ZUDSVPHFKDQLFDO YHQWLODWRUVQHFNFROODUV VHULDOFDVWVVOLQJV VXSSOHPHQWDOR[\JHQ VXSSRUWLYHWDSLQJ J8WLOL]DWLRQRIILQDQFLDO LQGLYLGXDODQG FRPPXQLW\UHVRXUFHV WR DVVLVWLQREWDLQLQJ DSSURSULDWHGHYLFHV $LUZD\FOHDUDQFH WHFKQLTXHVLQFOXGLQJ D%UHDWKLQJVWUDWHJLHV HJDVVLVWHGFRXJKKXII WHFKQLTXHV SRVWXUDOGUDLQDJH SDFHGEUHDWKLQJSXUVHG OLSEUHDWKLQJ WHFKQLTXHVWRPD[LPL]H YHQWLODWLRQ E0DQXDOPHFKDQLFDO WHFKQLTXHVHJ DVVLVWLYHGHYLFHVFKHVW SHUFXVVLRQYLEUDWLRQ DQGVKDNLQJFKHVWZDOO PDQLSXODWLRQ 2 F3RVLWLRQLQJHJ SRVLWLRQLQJWRDOWHUZRUN RIEUHDWKLQJ SRVLWLRQLQJWRPD[LPL]H YHQWLODWLRQDQG SHUIXVLRQSXOPRQDU\ SRVWXUDOGUDLQDJHOLPE HOHYDWLRQWRDOOHYLDWH HDUO\VZHOOLQJ ,QWHJXPHQWDU\UHSDLU DQGSURWHFWLRQ WHFKQLTXHV D'HEULGHPHQW± QRQVHOHFWLYHHJ SXOVDWLOHODYDJH DXWRO\WLF HQ]\PDWLFRUFKHPLFDO GHEULGHPHQW E'HEULGHPHQW± VHOHFWLYHHJVKDUS GHEULGHPHQW F'UHVVLQJVSULPDU\ DQGVHFRQGDU\HJ K\GURJHOVDOJLQDWHV FRPSUHVVLRQZUDSV G1HJDWLYHSUHVVXUH ZRXQGWKHUDS\ H7RSLFDODQWLELRWLFV 3 I7RSLFDODJHQWVHJ FOHDQVHUVFUHDPV PRLVWXUL]HUVRLQWPHQWV VHDODQWV J&RRUGLQDWLRQZLWK RWKHUVHUYLFHV K\SHUEDULFWUHDWPHQW IRU UDGLDWLRQILEURVLV GLDO\VLVHQWHURVWRPDO WKHUDSLVWGLHWLWLDQ K3RVLWLRQLQJSRVW LQWHUYHQWLRQIRUVDIHW\ L$GKHUHQFHWRSRVW RSHUDWLYHSRVLWLRQLQJ UHVWULFWLRQVWRSURPRWH KHDOLQJVRIWWLVVXHDQG PXVFOHIODSEUHDVWDQG KHDGDQGQHFN UHFRQVWUXFWLRQOLPE VDOYDJHSURFHGXUHV VNLQJUDIWV M$GGLWLRQDOKHDOLQJ WHFKQLTXHVDQGWRROV SUHVVXUHUHOLHYLQJ FXVKLRQVVKRHLQVHUWV HWF 4 N0RGDOLWLHVORZOHYHO OLJKWODVHUHOHFWULF VWLPXODWLRQSXOVDWLOH ODYDJH 5 Criterion 6: Education & Training ABPTS Feedback: 6.1 Describe in detail the nature of recognized education and training programs including their length, content, and objectives. {Decision: Did Not Adequately Meet Requirement} Sufficient detail on the available education and training programs was not provided. As noted in this criterion description, the petitioner must describe in detail the nature of recognized education and training programs, including their length, content, and objectives. Although pages 173 to 202 were referenced, ABPTS requests that the pertinent information be extracted and appropriately placed within this section of the petition. It was suggested that providing this information in a table format may be beneficial to the petitioner. 6.2 Provide a complete listing of such programs, detailing sponsoring organizations or institutions, locations, and individuals in charge. {Decision: Did Not Adequately Meet Requirement} As with section 6.1, insufficient detail was provided to meet the requirement for section 6.2. A complete listing of programs should be included, detailing sponsoring organizations or institutions, locations, and individuals in charge. Although pages 173 to 202 were referenced, ABPTS requests that the pertinent information be extracted and appropriately placed within this section of the petition. Revised Sections: 6.1 Describe in detail the nature of recognized education and training programs including their length, content and objectives Table 1 provides detailed information about the education and training programs that are available for the oncologic specialist. These include: x Annual specialty conferences in Oncology Rehabilitation – taken on by the larger academic and specialty cancer hospitals and centers, these aim to promote and highlight evidence-based emerging trends in oncology rehab. (details in Table 1) x Oncology Section educational programming at APTA Conferences- The Oncology Section has a long-standing history of offering robust, relevant and well-attended programming at: (details in table 1) o Combined Sections Meeting o Annual Conference o Vision 2020 Regional Conferences o National Student Conclave x Oncology Section regional continuing education – The section offers 4-6 courses throughout the year that cover broad regional areas to provide educational opportunities outside of major conferences and courses. (details in table 1) x APTA Chapter-sponsored Cancer Rehabilitation courses – A number of APTA Chapters have conducted courses focused in oncology as a part of their educational track programming at yearly conferences. (details in table 1) x Private Continuing Education Unit courses specific to Cancer Rehabilitation – Several private companies, recognizing the need for specialty education, have created CEU courses specific to oncology. These courses further expand the geography of where oncology rehab courses are offered. x Local oncology community courses – many academic medical centers, cancer centers and community hospitals have recognized x x x the need to have physical therapists among their community of care who have advanced education and training in Cancer Rehabilitation and have provided unique courses to promote the growth of specialty practice among their communities. (details in table 1) Lymphedema Training Courses- Cancer is the leading cause of lymphedema in the United States. There are several courses that teach content specific to lymphedema management; a critical skill set to the oncologic specialist. (details in table 1) On-line oncology courses – Offering continuing education in an on-line format enables timely access to relevant, advanced curricula for persons unable to travel to attend courses or conferences. (details in table 1) Additional annual interdisciplinary conferences for oncologic specialists to receive education and training o American Society of Clinical Oncology (ASCO) Annual Conference – held in June each hear. o ASCO Specialty Conferences: ASCO Breast ASCO Colorectal ASCO Lung ASCO Prostate o San Antonio Breast Symposium – annual conference held in December each year. o American Society of Therapeutic Radiation Oncology (ASTRO) – yearly conference held in October o Biennial Cancer Survivorship Conference – a bi-annual conference, co-sponsored by the Lance Armstrong Foundation and the American Cancer Society held in June. o The National Lymphedema Network Biennial Conference – a bi-annual conference held in September 6.2 Provide a complete listing of such programs detailing sponsoring organizations or institutions, locations and individuals in charge Table 1 provides a comprehensive listing of the programs outlined in 6.1, offerings are described below by category. Education and Training Program April 1997 Cancer Rehabilitation at the Forefront (9 hr) Content Faculty Objectives Topics: Outpatient mastectomy care and lymphedema, radiation fibrosis, wound and skin care. Presenters: Douglas Arthur MD, Lisa Bomar PT, Valerie Cauthern MSW, Patrick Coyne RN CRN, Margaret Denvil BA CSG, Ken Faulkner M Div, Stephen Gudas PT PhD, Jane Hays PT, Kathleen Hudson RN CETN, Bobby Johnson OTR, Laurel Participant Objectives: o Identify design components of an effective cancer rehabilitation team o Examine role responsibilities of the interdisciplinary team o Explores health care, economic and reimbursement issues impacting patient care o Discuss advocacy, decision making and clinical management of the cancer patient during diagnosis, treatment, recurrence and preparation for death 2 October 1999 Cancer Rehabilitation: Facilitating Quality of Life (12 hr) Topics: General physical rehabilitation, lymphedema treatment, fatigue, palliative care, oncologic emergencies Lyckholm MD, Elaine Naumann RC MS, Kathleen Orme RN, Susan Scheer PT, James Shaw MD, Thomas Smith MD, Kathleen Speigel RN MS OCN, Jeanne Walter RN MS AOCN, Ashby Watson RN MS OCN, Patricia Whanger MSW, Corrine Boucher-Carpenter OTR, Linda Smith Burns OTR, Lawrence Colley MD, Terry Cyr MS SLP, Cathy Gould RD MS, Phyllis Katz Esq, Sandra Kirchner PT, Charles McGarvey PT, Jane Woods Presenters: Lisa Bomar PT, Ken Faulkner M Div, Sherry Fox, RN MS CNRN, Stephen Gudas PT PhD, Mary Helen Hackney MD, Kate Humphrey PT, Bobby Johnson OTR, Catherine Lantz RN MS AOCN, Laurel Lyckholm MD, James Parrot BS, John Roberts MD, James Shaw MD, Cynthia Simonson RN MS AOCN, Thomas Smith MD, Wade Smith MD, William Tatu PT, Ashby Watson RN MS OCN, Jo Lynne Wheeler RN MS, Kristine Willis RN MS OCN, Participant Objectives: o Recognize issues affecting quality of life in cancer patients o Describe the impact of fatigues on the individual and family dealing with cancer o Identify contemporary ethical issues impacting end of life decisions by and for cancer patients o Describe factors affecting sexuality and sexual adjustments in cancer patients o Recognize the range of issues that affect managed o Recognize new trends in metastatic disease o Identify trends that will impact cancer care in the 21st century 3 October 2001 Cancer Rehabilitation: An Interdisciplinary Approach (12 hr) Topics: Epidural compression, brain tumors, musculoskeletal tumors, metastatic bone disease, pediatric malignancies, head and neck cancer October 2003 Cancer & Rehabilitation: Past, Present and Future (12 hr) Topics: Bone marrow transplantation, lung cancer, general physical rehabilitation, colon cancer, palliative care Dina Boettcher MS PT LMFT, Bernice Harper MSW MSCPH LLD, Phyllis Katz Esq, Sandra Kirchner PT, Lillian Nail RN PhD FAAN, Jane Woods Presenters: Peggy Bishop RN MS OCN, Jim Bonomo MDiv, William Broaddus MD, Brenda Early MS OTR, Chris Foster MD, Stephen Gudas PT PhD. Mark Huang MD. Walter Lawrence MD, Laurel Lyckholm MD, John McCarty MD, William McKinley MD, William Perkins CTRS, Seam Powell MSW, Andrea Pozez MD, Thomas Smith MD, William Tatu PT, Ashby Watson RN MS OCN, John Barsanti MD, Lora Packel PT, Rebecca Byrd MD, Lynn Gerber MD, Mikel Gray RN PhD Presenters: Sherman Baker MD, Harry Bear, MD PhD, Harold Chung MD, Neri Cohen MD, Stephen Gudas PT PHD, Brian Kaplan MD, James Shaw MD, Danny Song MD, Thomas Smith MD, William Tatu PT, Andrea Cheville MD, John Densmore MD Participant Objectives: o Recognize the interdisciplinary team approach on the management of cancer patients o Identify current evidence abed on research in cancer rehabilitation o Describe management strategies ion the rehabilitation of patients with breast, bone, and/or brain cancer o Discuss the role of alternative therapies in the management of cancer o Recognize the range of issues that affects survivors of childhood cancer o Describe current approaches for invasive pain management and erectile dysfunction in cancer patients. o Identify the major principles of management in epidural spinal cord compression, and head and neck cancer, and the psychosocial ramifications of a new cancer diagnosis Participant Objectives: o Describe the history of cancer rehabilitation, current rehabilitation problems, and future trends in the rehabilitation of cancer patients o Describe the past accomplishments, current concepts, and future trends for the following cancer sites: lymphoma, lung, breast, and colorectal o Discuss past, current, and future issues of stereotaxic radiation, and bone marrow transplantation o Describe past, present and future issues on palliative care 4 October 2005 Cancer Rehabilitation: Evidence Based Practice (12 hr) Topics: Fatigue management, peripheral neuropathy, genitourinary tract cancer, breast cancer, lymphedema September 2007 Cancer Rehabilitation Dimensions of Care: Mind, Body and Spirit (12 hr) Topics: Survivorship, innovative collaboration and partnerships, exercise guidelines, chemotherapy induced disabilities, holistic care Presenters: Harry Bear MD PhD, Cecelia Boardman MD, Lisa Bomar PT CLT-LANA, Kevin Brigle RN PhD, Debbie Cadet MSW, David Cifu MD, Patrick Coyne RN MS APRN FAAN, Mary Helen Hackney MD, Debra Lyon RN PhD, Noreen Rossi PT, Mary Saunders RN MS OCN, Haidee Waters RN DNSc ANP, Diane Wilson RD EdD, Mary Ann Dalzell PT, Eileen Donovan PT, Lillian Nail RN PhD FAAN Presenters: Anika Alvaron MD, Sandra Barker PhD, Woodward Beach SLP PhD, James Bonomo MDiv, JoAnn Bodurtha MD, Karin Bryant RN, Debbie Cadet MSW, Ken Faulkner MDiv, Timothy Ford MA MS CT, Mary Helen Faulkner MD, Stephanie Hamilton MDiv, Alton Hart MD, David Hess PhD ABPP, Bobby Johnson OTR, Tamara Orr RN PhD, Malcolm Sydnor MD, William Tatu PT, Haidee Waters RN PhD, Kristie Willis RN MS OCN, Mary Lou Galantino PT PhD, Georgianne Ginder MSc CHWC, Rebecca Massey BS, Participant Objectives: o Define evidence based practice and how it relates to cancer rehabilitation o Describe current evidence based practice for the following cancer sites: gynecologic, prostate, testes, lung o Discuss evidence based practice as it embodies the following cancer related topics: invasive pain management techniques, fatigue and anemia, alternative therapies, lymphedema management, and nutrition and exercise o Outline the principles of a multidisciplinary approach in a patient with breast cancer as presented by a panel of cancer clinicians Participant objectives: o Define dimensions of care: mind, body and spirit and how it integrates into cancer rehabilitation practice o Outline methods of incorporating holistic aspects of care into the cancer experience o Discuss complementary therapies and their role in treating the whole patient o Explores the importance of survivorship issues on followup cancer care 5 April 2010 Cancer Rehabilitation: Future Directions in Specialized Care (6 hr) Topics: Bony metastases, shoulder impairment, pediatric oncology, leukemia rehab concerns, supportive care May 5, 2012 Integrative Medicine in Cancer Rehabilitation (6 hr) Topics: Integrative Medicine in Cancer Rehabilitation such as Tai chi, Yoga, ball and falls in patients with cancer, exercise training for geriatric patients with cancer, etc… CSM 2012 Preconference course (1 day): Topic: Management of Balance Impairments Margaret Rinehart-Ayres PT PhD, Patricia Schmitt RN MS Presenters: Matthew Bitsko, PhD, Kevin Brigle RN ANP PhD, Stephen Gudas PT PhD, Andrea Leiserowitz PT CLT, Charles McGarvey PT FAPTA, Cindy Pfalzer PT PhD FAPTA, Rick Wilson PT PhD Presenters: G. Stephen Morris, PT, PhD, Cindy Pfalzer, PT, PhD, FAPTA, Stephen Gudas, PT, PhD, Mary Ann Hager, MSN, RN, Mary Helen Hackney MD, Mary Shall, PT, PhD, Jo Lynne Robins RN, PhD, ANR, AHNC, CHJP, Suzanne Fleming, OTR, MBA/HCM. Presenters: Jennifer Blackwood, PT, MPT, GCS, Participant Objectives: o Define specialized practice and how it relates to cancer rehabilitation o Describes specialized cancer rehabilitation care for the following areas: breast cancer, bony metastases, childhood cancer, cancer related shoulder dysfunction, leukemia and related disorders o Outline and describe physical activity as it relates to the supportive care of the cancer patient o Describe the importance of involving parents and other family members in the rehabilitation of the pediatric cancer patient o Explore the role of the rehabilitation therapist in palliative care o Participant Objectives: o Define integrative medicine and how it relates to cancer care and specifically to cancer rehabilitation. o Describe the role of yoga in cancer rehabilitation and continuing care. o Describe the role and use of Tai chi in cancer rehabilitation and continuing care. o Explore the impairment of balance and the significance of falls in adult cancer survivors. o Outline exercise training guidelines for individuals experiencing cancer. o Describe how the roles in patient-family relationships can be sustained throughout the cancer experience. Participant Objectives: o Describe the unique and diverse local and systemic effects of 6 Evidence in Action: A Comprehensive Management of Balance Impairments and Falls For Adult Cancer Survivors and Falls For Adult Cancer Survivors Min-Hui Huang, PT, PhD, NCS, Lucinda Pfalzer, PT, PhD, FAPTA, Amy Yorke, PT, MPT, NCS x Exercise Guidelines for Patients with Cancer: Where Are We? Where Would We Like to Be? Where's the Physical Therapy? Part 1 (2 hr) and Part II (1hr) Presenters: G. Stephen Morris, PT, PhD, Ann Flores, PT, PhD, MS, MA, CLT, Lucinda Pfalzer, PT, PhD, FAPTA, Elizabeth Hile, PT, PhD, NCS x Peripheral Edema: Diagnosis and Treatment Strategies Across All Patient Populations, Part I (2 hr) and Part II (1 hr) Presenters: Marisa Perdomo, PT, DPT, Antoinette P. Sander, PT, DPT, MS, CPT-LANA, Kimiko A. Yamada PT, DPT, OCS, CSCS, ATC, Dawn Franceschina, PT, DPT, Michael Simpson, PT, DPT x Preventive Rehabilitation: A Presenters: Keren PalgiBornstein PT, DPT, Jean M. cancer that impact balance. Describe the local and systemic effects of cancer treatment that impact balance. o Apply the appropriate screening tools with the ICF model to manage balance impairment in a patient with cancer. o Apply evidence based examination strategies to assess balance in a patient with cancer. o Apply evidence based intervention strategies to treat balance dysfunction in a patient with cancer. Participant Objectives: o Discuss acute and adaptive changes brought about in the oncology population by participating in an exercise training program. o Explain why participation in an exercise training program should be considered a treatment option for most oncology patients. o Describe common methods of exercise testing. o Generally understand the basics of exercise prescriptions. o Discuss currently available exercise guidelines available for use in the oncology population. o Apply these recommendations to an oncology patient population. Participant Objectives: o Utilize the pathophysiology of edema in the differential diagnosis process to determine if physical therapy is appropriate for the patient or if referral for medical consult is warranted. o Examine a variety of edema interventions that can be used across patient populations. o Select edema interventions based on the etiology of the edema and best evidence available. Participant Objectives: o Describe Memorial Sloan Kettering Cancer Center’s (MSKCC) o 7 Novel Approach to the Hospitalized Oncology Patient (2 hr) x Diagnosis Dialog for Oncology Physical Therapists (2 hr) Kotkiewicz PT, DPT comprehensive post-operative pulmonary program for eligible surgical patients and be familiar with the guidelines of care and relevant supporting research. o Discuss MSKCC’s wellness program for inpatients receiving allogenic BMT and a typical treatment plan for this not-sotypical patient population. o Educate PTs about MSKCC’s Early Mobility Program for intubated ICU patients and the techniques and methods for minimizing functional decline during this tenuous period. o Explain MSKCC’s comprehensive treatment approach for medically complicated lymphedema and edema patients and discuss MSKCC’S lower extremity lymphedema prevention group and its benefits to the targeted postoperative population. o Describe MSKCC’s breast surgery rehabilitation group for all immediate post operative breast surgery patients, including all reconstructive and non-reconstructive procedures. o Describe MSKCC’s developing program targeting patients with planned removal of large vessels and ways to most effectively manage postoperative lymphedema and vascular insufficiency. o Apply this new prevention method using a pre-operative team approach for compression garment fitting. Presenters: Catherine Participant Objectives: o Relate the history of diagnosis in PT, the diagnosis dialog Goodman PT, MBA, CBP, discussions, and the dilemmas related to the development of Barbara Norton PT, PhD, movement system-based diagnoses. FAPTA, Lisa Massa PT, WCS, o Discuss the need for widespread, consistent use of commonly Molly Reynolds PT, Stacie Larkin PT, DPT, Med, Jean understood terminology for diagnosing dysfunction of the O’Toole PT, MPH human movement system. Explain how the use of a common o diagnostic scheme will impact clinical practice of physical therapists working with oncology patients. 8 o x Diagnosis Dialog for Oncology Physical Therapists (2 hr) x Cancer in Children: A CaseBased Approach Part 1 (2 hr) and Part II (1hr) x Oncology Section Task Force on Breast Cancer Outcomes (2 hr) Introduce a process for developing a diagnosis for patients with movement problems related to cancer or the treatment of cancer. Presenters: Catherine Participant Objectives: o Relate the history of diagnosis in PT, the diagnosis dialog Goodman PT, MBA, CBP, discussions, and the dilemmas related to the development of Barbara Norton PT, PhD, FAPTA, Lisa Massa PT, WCS, movement system-based diagnoses. Molly Reynolds PT, Stacie o Discuss the need for widespread, consistent use of commonly understood terminology for diagnosing dysfunction of the Larkin PT, DPT, Med, Jean human movement system. O’Toole PT, MPH o Explain how the use of a common diagnostic scheme will impact clinical practice of physical therapists working with oncology patients. o Introduce a process for developing a diagnosis for patients with movement problems related to cancer or the treatment of cancer. Presenters: Lynn Tanner Participant Objectives: o Describe the process of screening and differential PT, MPT, Colleen Coulter diagnosis/red flags for children with signs and symptoms that PT, PhD, Shawn Israel PT, may indicate the presence of a hematological, nervous DPT, Angela M. Corr PT, system, or bone/soft tissue malignancy. DPT, Denise Cortes PT, o Review the pathophysiology for selected cancer diagnoses MBA, PCS o Establish a medical and therapeutic management plan for selected cancer diagnoses o Discuss potential lifelong challenges and late effects of treatment that face children who were treated for cancer. Ask questions about the cases and openly o discuss issues relating to the diagnosis, treatment, and longterm management of children with cancer. Presenters: Pamela K. Participant Objectives: o Briefly describe the most common impairments of body Levangie PT, DSc, DPT, structure and activity limitations in individuals treated for FAPTA, Mary I Fisher PT, breast cancer. MSPT, OCS, Marisa Perdomo PT, DPT, Tiffany o Describe the role of consistency in outcomes assessment to 9 Kendig PT, MSPT, MPH x Orthopedic Manual Therapy for the Individual with Movement Impairments Resulting from Radiation Therapy (2 hr) x Oncology Physiotherapists: Preventing Cancer and Treating the Metastatic Sequel (1.5 hr) x Physical Therapy Management of Individuals with HIV: An Overview monitor patient status and demonstrate intervention effectiveness in both individuals and patient groups. Identify selected outcome measures that o can appropriately be used for individuals about to undergo treatment or who have been treated for breast cancer. Discuss the relative merits of presented o outcome tools based on psychometric properties, administration issues, and limitations. Presenters: Marisa Participant Objectives: Perdomo, PT, DPT, Chris A. o Select the appropriate examination tests and measures for Sebelski PT, DPT, OCS, CSCS the shoulder complex and hip-pelvis complex which include: accessory mobility, muscle length, and assessment of end-feel for the patient with complications from radiation therapy. o Create a plan of care that integrates a progression of soft tissue mobilizations and joint mobilizations (grade I-V) with appropriate follow-up of therapeutic exercise. List the contraindications and indications o for manual therapy for tissues affected by radiation therapy. Presenter: Oren Cheifetz Participant Objectives: o Describe the strengths and weaknesses of the evidence PT, MSc supporting the role of physiotherapists In the prevention of cancer. o Describe strategies to engage patients with cancer in exercise programs. o State the indications for the use of exercise for patients with cancer. o Relate to the challenges of using exercise for patients with cancer. o Demonstrate an understanding of safety considerations relevant to exercise for patients with cancer. Presenters: David Kietrys Participant Objectives: PT, MS, OCS, Mary Lou o Describe the neuromusculoskeletal features of HIV and Galantino PT, PhD, MSCE discuss their effects on function. o Design safe exercise programs based on the stage of the 10 and Update (2 hr) disease for HIV-positive individuals. Describe the role of the PT or PTA in the management of common impairments associated with HIV and its comorbidities, and integrate physical therapy interventions into a multidisciplinary model. Apply recommendations for social issues, o such as working with HIV-positive athletes and occupational exposure. Participant Objectives: o Create a template for oncology rehab education for PT generalists in a large health network. o List disease-specific, PT-related impairments and interventions according to primary cancer and side effects of cancer intervention. o Discuss assessment tools, including the use of electronic learning modules to measure PT competency versus direct inservice with written competency. o x Oncology PT Intervention Performed by a Physical Therapist Generalist: Educational Strategies to Improve Safety and Outcomes (1.5 hr) CSM 2011 x Preconference course (2 day): Upper Extremity Lymphdema: The Art and Science of Physical Therapy Interventions Presenter: Linda McGrath Boyle PT, DPT, OCS, CLTLANA Presenters: Elizabeth Augustine PT, DPT, MS, Marisa Perdomo PT, DPT, MS, Antoinette Sandler PT, DPT, MS, CLT-LANA, Lisa VanHoose PT, CLT-LANA, WCC Participant Objectives: x Evaluate individuals with UE lymphedema, determine if PT is appropriate or refer to another health care provider for further differential diagnostic testing. x Design an individualized intervention program that is based on the anatomy and physiology of the lymphatic system and is supported by best available evidence. x Perform manual lymphatic drainage mobilizations (LD) and modify the technique based on the quality and nature of the edema. x Apply appropriate UE compression short stretch bandaging techniques and adapt the technique to maximize therapeutic response from tissues with fibrosis. 11 x x x x Measuring Outcomes in Physical Therapy Note: This course has been implemented as a repurposed online course in the new APTA Learning Center (3 hr) A Framework for Treating Patients with Oncological Diagnoses Using a Systems-Based Approach (1.5 hr) Presenters: G. Stephen Morris PT, PhD, Mary Lou Galantino PT, PhD, MSCE, Kirsten Ness PT, PhD, MA, MPH, Laura Gilchrist PT, PhD, Meredith WamplerKuhn PT, DPTSc, Victoria Marchese PT, PhD Oncology Exercise Issues in Outpatient Physical Therapy: Beyond Range of Motion and Presenter: Mary Lou Galantino PT, PhD. MSCE, Matthew Taylor PT, PhD Presenter: Stephanie Cramme PT, DPT, Diane Heislein PT, DPT, MS, OCS Develop an appropriate physical therapy based lymphedema home program x Recommend the appropriate compression garment Participant Objectives: o Describe common impairments, limitations, and participation restrictions found in the oncology rehabilitation population. o Describe issues related to the selection of appropriate outcome measures. o Select appropriate outcome measurements for various issues related to oncology rehabilitation. o Illustrate, through the use of case studies, the appropriate selection of outcome measures in oncology rehabilitation. Participant Objectives: x Describe a comprehensive systems-based approach to the physical therapy examination and treatment of patients with cancer. x Identify potential impairments and functional limitations that may result as a direct consequence of chemotherapy and/or radiation therapy treatment for patients with cancer. x Outline comprehensive evidence based interventions to address integumentary issues in a patient with leukemia, neuromuscular and cardiopulmonary issues in a patient with metastatic lung cancer, and musculoskeletal issues in a patient with metastatic prostate cancer. Participant Objectives: o Describe what is meant by full-spectrum movement prescription contrasted with traditional therapeutic exercise prescription. o Describe how full-spectrum movement prescription addresses the most common effects of cancer and its 12 Fitness Prescription (2.75 hr) treatment. Evaluate outpatients with oncological disease for fullspectrum movement prescriptions beyond traditional exercise prescription. o Analyze a case report of an outpatient prescription for a patient with oncological disease. o Access resources for oncological patients within their community as well develop niche programming within their clinics. Participant Objectives: o Describe the pathophysiology of CIPN. o Describe medical management of CIPN, both for prevention and symptom control. o Describe the signs and symptoms of acute CIPN, and the long-term structural and functional impairments and associated performance limitations in individuals with persistent CIPN. o Develop an appropriate physical therapy management plan for individuals with acute or chronic CIPN. Participant Objectives: o Identify and describe the most common forms of malignancy in childhood. o Briefly describe the typical medical treatments for childhood cancers. o Identify the adverse effects of cancer and cancer treatment that necessitate physical rehabilitation. o Demonstrate a basic knowledge of how to effectively screen patients to determine the need for occupational and/or physical therapy services in the acute pediatric oncology setting. o Recognize the psychosocial issues that are common in families of a child with cancer and determine strategies to assist with coping o Understand the benefits of physical therapy intervention o x Medical and Physical Therapy Management of ChemotherapyInduced Peripheral Neuropathy (CIPN)( 1.5 hr) Presenters: Laura Gilchrist PT, PhD, Kirsten Ness PT, PhD, MA, MPH, Lynn Tanner PT x Improving the Quality of Life of Children with Cancer: The Role of Rehabilitation (2.75 hr) Presenter: Susan Miale PT, DPT, PCS 13 x Comfort Care Only-Therapy Discontinued: Can One Last Visit Impact Quality of Life? (1.5 hr) Presenters: Mary-Jean Paulitz PT, MS, Jo-Ellen Thomson PT x Exercise and the Athlete with Cancer (2 hr) Presenter: Alison DeLeo PT, DPT x An EvidenceBased Approach Presenters: Min-Hui Huang PT, PhD, Lucinda Pfalzer PT, PhD, in children with cancer from an evidence-based perspective. Participant Objectives: o Identify the dilemma of comfort care in physical therapy. o Discuss the areas of focus for hospice physical therapy. o Identify the safety needs of patients who are transitioning to hospice. o Describe ways that a PT can impact a patient’s comfort. o Discuss family and caregiver training opportunities that could positively impact a patient’s quality of life at the time of discharge. Participant Objectives: o Define the “athlete cancer survivor” o Describe current guidelines for exercise in athlete patients with cancer. o Identify the potential physiologic changes to exercise response related to treatment modalities for cancer, including surgery, chemotherapy, radiation therapy, hormone therapy, immunotherapy and bone marrow transplantation. o Identify indications and contraindications for exercise in an athlete patient with cancer. o Apply and modify the general principles of exercise prescription to meet the needs of physically active patients with cancer. o Formulate safe and effective exercise programs for athlete cancer survivors before, during and after medical management of cancer. o Generate hypotheses regarding expected outcomes for physically active patients with cancer participating in exercise programs. o Identify and respond to oncological emergencies. Participant Objectives: x Describe the unique and diverse local and systemic 14 x x x to the Identification and Screening of Balance for Patients with Cancer (1.5 hr) An EvidenceBased Approach to the Examination and Intervention of Balance for Patients with Cancer (1.5 hr) Successes and Pitfalls: Developing a Sustainable Comprehensive Oncology Treatment Program (2.5 hr) Breast Cancer Physical Restoration Using the Pilates Method (2.75 hr) FACSM, FAPTA effects of cancer that impact balance. Describe the local and systemic effects of cancer treatment that impact balance. x Apply the appropriate screening tools with the ICF model to manage a balance impairment in a patient with cancer. Participant Objectives: x Apply evidence based examination strategies to assess balance in a patient with cancer. x Apply evidence based intervention strategies to treat balance dysfunction in a patient with cancer. x Apply evidence based adaptation strategies for balance dysfunction. x Presenters: Jennifer Blackwood MPT, GCS, Amy Yorke MPT, NCS Presenters: Teresa Fitzpatrick PT, MBA, Mary Ann Calys PT, DPT, MS, Andrea Leiserowitz MPT,CLT, Kathie Hummel-Berry, PT, PhD Presenter: Suzanne Clements Martin PT, DPT Participant Objectives: o Outline a plan for establishing a comprehensive oncology clinical service within the community o Describe at least two strategies for marketing the practice to referral sources o Explain the rationale for structure of the necessary rehabilitation team. o Describe a strategy for appropriate staff training o Analyze the benefits of automatic referral protocols o List at least three possible pitfalls that could impede success in program development Participant Objectives: o Explain the short and long-term physical and psychosocial impacts of breast cancer. o Compare and contrast the physical and psychosocial impacts on pre-menopausal and post-menopausal populations afflicted with breast cancer. o Apply an evidence-based rationale for physical therapy intervention in the rehabilitation and post-rehabilitation phases for survivors. 15 o x x Newer Technologies Advance the Evaluation and Treatment of Peripheral Edema and Lymphedema (2.75 hr) CSM 2010 Preconference course (1 day): Presenters: Lesli Bell PT, Elizabeth Campione PT, Marisa Perdomo PT, DPT, Kathryn Ryans PT, DPT Presenter: Richard Briggs PT, MA Perform a functional evaluation to identify core/trunk strength as well as weight-bearing (pelvic and lower extremity) movement dysfunctions. o Define the Pilates Method; explain, and demonstrate the qualitative benefits and differences between the popular Classic conditioning Method and the therapeutic application of the Method, focusing on the Upper Core. o Identify contraindications for Pilates/ exercise and plan appropriate treatments in the therapeutic application of the Pilates Method. o Set up a home well-being program for managing the chronic condition of breast cancer survivorship. Participant Objectives: o Upon completion of this course, you will be able to: Understand and discuss the physiological rationale for utilizing laser therapy, bioelectrical impedance and compression pumps for individuals with lymphedema. o Perform an evidence based decision making thought process to determine if laser therapy, bioelectrical impedance and compression pumps are appropriate for individuals with lymphedema. o Develop a PT intervention plan of care that includes laser therapy and compression pumps for individuals with lymphedema. Develop a PT intervention utilizing o laser therapy for those individuals who are at risk for developing lymphedema. Understand the role of these o modalities in the overall plan of care for individuals with lymphedema and determine when and how to optimize outcomes with the use of these modalities. Participant Objectives: o Identify signs and symptoms of terminal disease 16 End of Life Care: Issues of Living and Dying in Clinical Practice x Medical Screening for Oncology Issues in Outpatient Physical Therapy (1.5 hr) Presenters: Mary Lou Galantino PT, PhD, MSCE, Laura Gilchrist PT, PhD, Victoria Marchese PT, PhD, G. Stephen Morris PT, PhD, Kirsten Ness PT, PhD, MA, MPH, Meredith Wampler PT, DPTSc x The Role of Presenters: Carol M Davis DPT, processes. o Problem-solve clinical issues of life limiting conditions. o Identify common syndromes and barriers to adequate pain relief at the end of life o Discuss both pharmacological and non-pharmacological approaches to symptom control. o Differentiate 5 clinical practice patterns in palliative and hospice care. o Explain cultural differences in dying rituals and grief responses. o Identify normal pediatric response behaviors to death. o Demonstrate the integration of spiritual care during the end of life. o Discuss legal, ethical and physiologic concerns around palliative sedation, withdrawal of food and fluid, and assisted suicide. o Describe advanced directives and their related components (power of attorney, living will, do not resuscitate orders. o Identify healthy personal and professional coping skills useful while working with the terminally ill. Participant Objectives: o Screen general outpatients for potential oncological disease. o Analyze a case report of an outpatient assessment for potential oncology “red flags”. o Describe the most common late-effects of cancer and its treatment. o Screen patients with a previous history of cancer for lateeffects of cancer and its treatment. o Determine appropriate referrals for oncology-related issues in both patients with and without a previous cancer diagnosis. Participant Objectives: 17 Integrative Medicine in Physical Therapy for the Oncology Patient (3.5 hr) EdD, MS, FAPTA, Catherine Goodman PT, MBA, CBP x New Opportunities in Physical Therapy: Creating a Hospice Based Physical Therapy Practice (3 hr) Presenters: Ilene Decker RN, PhD, Karen Mueller PT, PhD, JoEllen Thomson BS x Movement System Impairment Diagnoses Applied to the Breast Cancer Patient (2 hr) Presenter: Renee Ivens PT, DPT, MHS o Give examples of body work, mind/body work, and energy work used with cancer patients. o Participants will gain an introductory understanding of BodyTalk and how it is used with cancer patients. o Participants will learn 4 basic BodyTalk techniques to use with anyone. o Participants will observe a BodyTalk session. Participant Objectives: o Discuss current and emerging trends in hospice care. o Discuss the interdisciplinary structure of a typical hospice setting. o Discuss the benefits of physical therapy participation in the hospice interdisciplinary team. o Discuss opportunities for physical therapy practice in a hospice setting. o Discuss and apply strategies for creating a physical therapy based hospice practice. o Describe the types of physical therapy interventions that can benefit patients in a hospice setting. o Discuss appropriate physical therapy outcome measure for use in a hospice setting. o Discuss evidence regarding physical utilization in a hospice setting. o Discuss research findings related to physical therapy outcomes in a hospice setting Participant Objectives: o Identify which tissues are involved in a patient’s movement dysfunction: soft tissue (muscle or joint capsule), neural structures, lymphatic system and how this assists in optimizing treatment o Discuss the Physical Stress Theory as related to postsurgical or radiated tissues o Describe the most common impairments in the movement patterns of the shoulder girdle in this 18 population Discuss the most common MSI Scapular and Humeral Diagnoses affecting patients who have received treatment for breast cancer o Describe intervention strategies for MSI Diagnoses of the scapula and humerus Participant Objectives: o Understand the medical diagnostic process and treatment of Head and neck cancers. o Evaluate and treat the complex musculoskeletal impairments and functional limitations most commonly experienced by this population. o Understand the musculoskeletal function of the head and neck during speech and swallowing activities and how PT interventions can compliment the speech and swallowing therapy. o Review and discuss appropriate orthopedic manual therapy techniques for individuals recovering from Head and Neck cancer. o Develop a short-term and long -term comprehensive multidisciplinary treatment approach for the individual recovering from Head and neck cancer treatments. o Develop and foster relationships with other rehabilitative health care professionals in order to optimize outcomes for individuals recovering from Head and Neck Cancer. Educate and instruct the individual o with Head and neck cancer in an appropriate manual lymphatic drainage home program for lymphedema. o x Multidisciplinary Rehabilitation Approach for the Treatment of Head and Neck Cancer-Related Impairments (3 hr) CSM 2009 x Preconference course (2 day): Physical Therapy Examination and Presenters: Melody OuYoung MS, CCC-SLP, Marisa Perdomo PT, DPT Presenters: Jacquelin Drouin PT, PhD, Charles McGarvey PT, DPT, MS, FAPTA, Lucinda Pfalzer PT, PhD, FACSM, FAPTA, Margaret Participant Objectives o Describe sequelae of breast cancer treatment that may lead to impairments and functional limitations. o Assess patients for breast cancer specific impairments 19 Intervention for Breast Cancer Survivors Rinehart-Ayres PT, PhD, Nicole Stout MPT, CLT-LANA x Being Present with Suffering, Loss, or Dying (2hr) Presenter: Richard Briggs PT, MA x Physical Therapy and Prostate Cancer (2 hr) Presenter: Jacquelyn Drouin, PT, PhD including; lymphedema, shoulder dysfunction, postural deviations, strength and ROM loss o Develop a treatment plan specific to breast cancerrelated impairments with consideration for treatment side effects. o Understand the indications, precautions and contraindication related to physical therapy interventions with patients who have a history of cancer. o Develop an understanding of the role of the physical therapist in pre-operative assessment and ongoing surveillance screening of patients with breast cancer in the absence of impairment. Participant Objectives: o Identify personal issues of loss related to end of life care. o Integrate issues of dignity and independence into their practice with declining patients. o Practice awareness of body sense, thoughts and emotions during clinical interactions o Describe three methods to enhance their growth while caring for the dying. o Recognize language of spiritual concerns voiced in patient care. Participant Objectives: o Describe and appreciate factors of prevention, screening, treatment, and rehabilitation of prostate cancer including differences across cultures. o Learn, reflect, and discuss current evidence on the use of exercise training in prevention and management of prostate cancer. o Evaluate and apply safe, effective exercise training guidelines for individuals with or at risk for prostate cancer. 20 x Guiding the Clinical Physical Therapist into a New Role as Researcher (4 hr) Presenters: Mary Lou Galantino PT, PhD, MSCE, Loraine LovejoyEvans PT, DPT, CLT-Foldi, Lucinda Pfalzer PT, PhD, FACSM, FAPTA, David Scalzitti PT, PhD, OCS x Physical Therapy Care Across the Practice Continuum for Patients with Colorectal Cancer (2 hr) Presenters: Meryl Roth Gersh PT, Robert Gersh MD x State of the Art Measurement Methodology for Evaluating Lymphedema (3 Presenters: Minal Jain PT, DSc, PCS, Ellen Levy PT, BGS, OCS, Nicole Stout MPT, CLT-LANA Participant Objectives: o Demonstrate confidence in performing a literature review on the computer including Hooked on Evidence and Open Door APTA’s portal to Evidenced-Based Practice o Demonstrate improved confidence in reading the literature using critical thinking o Understand the basics of research design, data collection, and analysis o Maximize the ability to partner with an academic facility in their local area to promote outstanding research in the field of specialty in PT o Identify possible sources to secure funding Participant Objectives: o Review the current medical practice for the examination, evaluation, and comprehensive treatment of patients experiencing colo-rectal cancer. o Identify methods of prevention, early detection, and early medical management of colo-rectal cancer. o Describe the implications that the medical management of patients with colo-rectal cancer, including surgery, chemotherapy, and radiation, have for physical therapy care. o Explore the application of comprehensive physical therapy care across the practice continuum for a patient diagnosed with colo-rectal cancer. o Integrate the Guide to Physical Therapist Practice as one considers the comprehensive management of this patient. Participant Objectives: o Demonstrate an understanding of the pathophysiology of lymphedema. o Understand and identify the methods available for assessing lymphedema 21 o hr) x Orthopedic Rehabilitation: Improving Outcomes Using Lymphatic System Treatments and Home Program Instruction (3 hr) Presenter: Loraine LovejoyEvans PT, DPT, CLT-Foldi x Will I Be Able to Wear Heels to the Prom? Physical Therapy Assessment and Rehabilitation of Children with Osteosarcoma (2 hr) Presenters: Minal Jain PT, DSc, PCS, Michael Smith PT, MEd, Kieu-Phuong Thi Vu PT x Hemophilia 101 for Physical Presenters: Alice Anderson PT, MS, PCS, Sara Elizabeth Strawn Recognize novel evaluation tools available including perometry and bioelectrical spectroscopy as well as the science behind these technologies Participant Objectives: o Understand the anatomy, physiology, and pathophysiology of the lymphatic system o Describe the relationship between the circulatory and lymphatic system o Identify varying types of edema disorders and establish a treatment program to minimize swelling o Understand the benefits of reducing swelling in orthopedic disorders to enhance function and to decrease pain o Understand the philosophy and manual techniques of Lymphatic Mobilization and the relationship to improving function o Identify when it is appropriate to utilize lymphatic mobilization in the rehabilitation program o Maximize treatment sessions by instructing patients in a comprehensive self-care program. Participant Objectives: o Participants will gain knowledge in the diagnostic methods and medical management of children with osteosarcoma. o Participants will understand and identify the physical therapy needs of this population. o Participants will be exposed to assessments and therapeutic strategies to maximize a child’s functional outcome and quality of life. o Participants will understand how to use the “Guide to Physical Therapist Practice” when working with a child with osteosarcoma. Participant Objectives: o Define hemophilia and be knowledgeable of its 22 Therapists (1.5 hr) x linical Update and Interdisciplinary Care: Rehabilitation Following Breast Cancer Surgery (3 hr) PT, MSPT, OCS inheritance, incidence and hematological values. Describe the coagulation cascade in normal and hemophilic patients. o Know the red bleeding complications (red flags) of central nervous system, gastrointestinal system and musculoskeletal system. o Know the key factors to identify and treat acute, subacute and chronic hemathrosis/hemarthropathy and its sequelae. o Know the in key factors to identify and treat muscle bleeds and its complications. o Be knowledgeable in the history and current hemophilic factor replacement therapies. o Understand the role of exercise, fitness, and sportsin the hemophilic patient. o Be knowledgeable in the radiologic assessment of the Arnold-Hilgartner and Pettersson Classification of Hemophilic Arthropathy. o Describe the orthopedic surgical interventions for the hemophilic population arthroscopic synovectomy, radionuclide synovectomy, radial head resection and total joint replacements) and their outcomes. o Be knowledgeable of the comprehensive model of treatment for hemophilic patients and hemophilic treatment centers. Participant Objectives: o Demonstrate an understanding of the medical and surgical management for breast cancer treatment. o Identify common dysfunction following breast cancer surgery and adjuvant treatment. o Articulate the efficacy for exercise and therapy following breast cancer surgery. o Appreciate the potentially complex patient presentation following breast cancer surgery and the need for an o Presenters: Stephanie Caterson PT, Roya Ghazinouri PT, MS, Daniel Ovitt PT, Rebecca Stephenson PT, DPT, MS, Reginald Burns Wilcox III DPT, MS, OCS 23 interdisciplinary postoperative rehabilitation plan. Illustrate why abnormal shoulder girdle mechanics occur following surgery for breast cancer. o Describe the rehabilitation principles for the shoulder girdle following breast cancer surgery and treatment. Design a comprehensive rehabilitation program for a patient following breast cancer surgery. o Regional Courses Offered by Oncology Section Courses scheduled for 2012 x Breast Cancer Rehabilitation (16 hr) Scheduled for: o March 31April 1, 2012 in Chapel Hill, North Carolina o May 19-20, 2012 in Iron Mountain, Michigan o September 29-30, 2012 in Edgewood, Kentucky Varies 2008 Oncology Section Sponsored Courses Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Frequency: Annually, often more than once a year; Typically average of six courses offered per year Average attendance: 16-18 therapists per course, with six courses per year is approximately 96-108 therapists Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast cancer o Discuss the need for physical therapist and patient advocacy in this population 24 x Exercise Training Guidelines for Individuals with Cancer: Endurance, Strength, Flexibility, and Adherence (8 hr) Scheduled for: o March 24, 2012 in Jefferson City, Missouri o April 14, 2012 in Rockford, Illinois o October 13, 2012 in Tulsa, Oklahoma Courses in 2011: x Breast Cancer Rehabilitation Richland, Washington October 1-2, 2011 (16 hr) Presenter: G. Stephen Morris, PT, PhD, FACSM Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum Describe the role of exercise in treating the cancer survivor Presenters: Barbara Nicholson MSPT, CLT-LANA Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast 25 cancer Discuss the need for physical therapist and patient advocacy in this population Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Design and implement evidence based physical therapy oncology management methods for individuals in cancer survivorship across the continuum of care. o Incorporate effective functional training, manual techniques, lymphedema management, and aerobic exercise throughout the continuum of care. o Identify and manage symptoms and side effects of cancer and its treatments across the continuum of care. o Effectively communicate with multidisciplinary oncology rehabilitation team members including patients and caregivers, physicians, and nurses. o x Exercise Training for Cancer Survivors: Endurance, Strength, Flexibility, and Adherence Concord, New Hampshire October 1, 2011 (8 hr) Presenter: G. Stephen Morris, PT, PhD x Second Annual Oncology Rehabilitation Symposium, Oakland University: Rehabilitation Across the Continuum of Care. Rochester, Michigan, August Presenters: Deborah Doherty PT, PhD, CEAS, Jacquelin Drouin PT, PhD, Janet Seidell PT, Reyna Colombo PT, MA, Marie-Eve Pepin PT, DPT, OMPT, Adhil Akhtar MD 26 x x x 23 and 25, 2011 (Online presentations) and August 27, 2011 (oncampus laboratory session, 17.5 hr total) Walk, Run, Jump, and Thrive: Physical Therapy Assessment and Intervention for Children and Adolescents with Cancer Minneapolis, Minnesota May 13-14, 2011 (10 hr) Breast Cancer Rehabilitation, Farmingdale, New York April 2-3, 2011 (16 hr) Breast Cancer Rehabilitation, Richland, WA, October 1-2, 2011 (16 hr) o o o Presenters: Laura Gilchrist PT, PhD, Lynn Tanner PT Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Evaluate and integrate effective administration practices across varied oncology settings. Identify patient self-advocacy resources. Critically appraise current evidence for practice. Participant Objectives: o Describe the typical treatment regimen for children with leukemia, lymphoma, and solid tumors, including CNS tumors o Describe the current literature on CIPN in children and adolescents with non-CNS cancer o Describe the current literature on physical impairments and motor performance deficits in children with leukemia, lymphoma, and solid tumors o Discuss the pros and cons of different outcome measurements to use in these populations o Describe and demonstrate assessment and intervention techniques to address common physical impairments and motor performance deficits in children with leukemia, lymphoma, and solid tumors Participant Objectives: See same course above Participant Objectives: See same course above 27 x Exercise Training for Patients Across the Cancer Spectrum: Testing, Prescription, and Outcomes Assessment St. Joseph, Michigan January 16, 2011 (8 hr) Courses in 2010: x Breast Cancer Rehabilitation Exeter, New Hampshire November 13, 2010 (8 hr) Presenter: G. Stephen Morris, PT, PhD Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, Med Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Describe cancer diagnoses, cancer treatments, and side effects particularly as they relate to impairments o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast 28 cancer Discuss the need for physical therapist and patient advocacy in this population. Participant Objectives: See same course above. o x x x Exercise Guidelines for Individuals with Cancer Charlotte, North Carolina September 18, 2010 (7.5 hr) Exercise Guidelines for Individuals with Cancer, Concord, NH, October 1, 2011 (7.5 hr) First Annual Rehabilitation Symposium of Oakland University: Focus on Breast Cancer and Prostate Cancer Rochester, Michigan, August 26-28, 2010 (3 day conference) Courses in 2009: Presenter: G. Stephen Morris PT, PhD Presenter: G. Stephen Morris PT, PhD Presenters: Deborah Doherty PT, PhD, CEAS, Jacquelin Drouin PT, PhD, Janet Seidell PT, Reyna Colombo PT, MA, John Maltese MD Presenters: G. Stephen Morris Participant Objectives: See same course above. Participant Objectives: o Design and implement evidence based physical therapy oncology management methods for individuals in cancer survivorship across the continuum of care. o Incorporate effective functional training, manual techniques, lymphedema management, and aerobic exercise throughout the continuum of care. o Identify and manage symptoms and side effects of cancer and its treatments across the continuum of care. o Effectively communicate with multidisciplinary oncology rehabilitation team members including patients and caregivers, physicians, and nurses. o Evaluate and integrate effective administration practices across varied oncology settings. o Identify patient self-advocacy resources. o Critically appraise current evidence for practice. Participant Objectives: 29 x Interventions for Cancer Patients and Cancer Survivors Portland, Oregon November 14-15, 2009 (11 hr) PT, PhD, Andrea Leiserowitz MPT, CLT x Breast Cancer Rehabilitation: Implications in Physical Therapy Atlanta, Georgia April 4-5, 2009 (15.5 hr) Presenters: Charles McGarvey PT, DPT, MS, FAPTA, Nicole Stout MPT, CLT-LANA o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Describe cancer diagnoses, cancer treatments, and side effects particularly as they relate to impairments o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient and survivor o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Discuss exercise interventions in the context of lymphedema and treatment-associated peripheral edema o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Describe the basic cancer diagnosis, pathology and staging o Describe medical and surgical management commonly used in treating breast cancer o Choose and perform appropriate screening/systems review and tests and measures o Describe and choose interventions for common impairments seen in individuals at various stages of the disease process 30 o o Oncology Courses Sponsored by APTA Chapters PA x Courses Washington Projected for DC 2013 (10-16 hr) Presenter: Nicole Stout MPT, CLT-LANA x Courses Offered in 2012 (10-16 hr) Alabama South Dakota Presenter: Nicole Stout MPT, CLT-LANA x Courses Offered in 2012 (8 hr) Colorado Presenter: Andrea Leiserowitz MPT,CLT Understand the need for appropriate modality selection and use based on the cancer history and/or treatment Understand the importance of physical therapy intervention in a palliative care setting Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise Participant Objectives: o Describe the cancer diagnosis, pathology, and staging 31 o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment Order and describe precautions and contraindications for exercise Private Continuing Education Courses Specific to Cancer Rehabilitation Presenter: Nicole Stout MPT, x Cancer CLT-LANA Rehabilitation: An EvidenceBased Course for All Clinicians (20 hours, intermediate level course) Offered by: Great Seminars and Books, Inc. Frequency: The course is scheduled to be offered five times in 2012, in Winston-Salem, Louisville, Green Bay, Nashville, and Portland, Oregon. It was also offered five times in 2011, in Palos Heights, Illinois, Oklahoma City, Dallas, Napa, California, and Richmond Virginia. Average attendance: 40-50, mostly physical therapists and some PTAs. Assuming 40 physical therapists at each of five courses, that would lead to a total attendance of 200 per year. Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise 32 Physical Therapy for the Patient with Breast Cancer (16) Offered by programs, a company founded by the presenter to offer evidence-based programs for health care professionals and survivors of cancer. Presenter: Leslie Waltke PT Advanced Oncology Rehabilitation for Successful Outcomes (15-18 hours) Offered by: North American Seminars Presenter: Julia Osborne, PT, CMLDT Frequency: Three times per year Attendance: Ranges from 10 to 40, primarily physical therapists for a total attendance of between 30 and 120 over the course of a year. Participant Objectives: o Describe basic cancer pathophysiology o Describe cancer treatments including mechanisms of action and side effects o Perform a comprehensive evaluation of the cancer patient o Recognize and treat musculoskeletal dysfunctions of surgery, radiation, and reconstruction o Differentially diagnose and treat pain syndromes o Set up a comprehensive post operative home exercise program o Develop a rehabilitation program to combat side effects of chemotherapy and radiation o Teach infection and lymphedema risk reduction techniques Frequency: Course is scheduled for five offerings in 2012. The course comes with an optional software program designed for professionals who are starting a lymphedema program. Average attendance: 30, 80-90% physical therapists, for a total yearly attendance of approximately 150. Participant Objectives: o Describe cancer pathogenesis and how it is shaping environmental awareness and changing cancer management globally. o Discuss the clinical management of breast cancer, head and neck cancer, prostate cancer, ovarian cancer, melanoma, leukemia, and lymphoma. o Understand new advancements in cancer treatment: chemotherapy, targeted therapy, radiation therapy, 33 immunotherapy and hormone therapy. Discuss the clinical implications of myelosuppression, cancer related fatigue, cardiotoxicity, hormone changes and cognitive changes in patients undergoing cancer treatment. o Develop safe and appropriate oncology exercise programs according to the guidelines, clinical tests and screening systems presented in the course. o Perform specialized manual therapy skills for the post surgery and radiation management of patients with cancer (upper extremities, trunk, and lower extremities). o Utilize the appropriate modalities based on cancer history and areas of treatment. o Design appropriate inpatient and outpatient programs with the consideration of program goals, referral and intake processes and discharge criteria. Frequency: Course is scheduled for six offerings in 2012. Average attendance: 30, 80-90% physical therapists, for a total yearly attendance of approximately 180. Participant Objectives: o Understand the anatomy of breast cancer cells, their functional capabilities, and how modern medicine is responding in its design to treat breast cancer effectively. o Expand clinical knowledge about differential diagnoses, treatment side effects, and physical sequelae of chemotherapy, radiation therapy, and targeted hormone therapies. o Advance understanding of the biology and physiology of the acute trauma that occurs to the lymphatic system after surgery and radiation therapy, and how this affects the normal healing processes in the body. o Understand the difference between treating “lymphedema” as a condition, and the advanced o Advanced Management of Breast Cancer Rehabilitation (15 hours) Offered by: North American Seminars Presenter: Julia Osborne, PT, CLT-LANA 34 o o o o o Local Community Courses UMDNJ, Newark, NJ Cancer Rehabilitation (16 hours) 2013 Presenter: Nicole Stout MPT, CLT-LANA o o o o concepts of treating acute trauma of the “lymphatic system” as it relates to other body systems in the healing processes of surgery, radiation, and chemotherapy. Advance and integrate manual lymphatic drainage skills with orthopedic manual therapy skills to include system management of the musculoskeletal system, the nervous system, the vascular system, the lymphatic system, and the endocrine system during and post breast cancer treatment. Understand complex co-morbidities and adverse treatment complications of breast cancer, how they affect the healing capacity of patients, and how treatment can be structured to minimize their effect. Identify clearly the specific clinical goals of specialized manual therapy skills and targeted exercise protocols for patients undergoing advanced forms of breast surgery, new chemotherapy treatments, and/or targeted radiation therapy so as to achieve optimal function, as well as sustainable treatment results. Have increased knowledge about advances in breast cancer diagnoses, advances in breast cancer management, and advances in breast cancer research. Gain and advance leadership skills in the continuum of care and mulit-disciplined approach to the management of patients with breast cancer. Describe the cancer diagnosis, pathology, and staging Explain medical and surgical management of common cancer diagnoses Choose and perform appropriate screening/ systems review and tests and measures Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. 35 o o University of Pittsburgh Medical Center, Pittsburgh, PA Cancer Rehabilitation 12 hours 2013 Presenter: Nicole Stout MPT, CLT-LANA , G. Stephen Morris PT, PhD, Elizabeth Hile PT, PhD o o o o o o ST Barnabas Health System, NJ Rehabilitation (16 hours) 2012 Presenter: Nicole Stout MPT, CLT-LANA o o o o o Providence/ST. Peter Hospital, Olympia, WA Cancer Rehabilitation (16 hours) 2012 Presenter: Nicole Stout MPT, CLT-LANA Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment Order and describe precautions and contraindications for exercise Describe the cancer diagnosis, pathology, and staging Explain medical and surgical management of common cancer diagnoses Choose and perform appropriate screening/ systems review and tests and measures Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment Order and describe precautions and contraindications for exercise Describe the cancer diagnosis, pathology, and staging Explain medical and surgical management of common cancer diagnoses Choose and perform appropriate screening/ systems review and tests and measures Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise 1. Explain the nature, risk factors, and course of common adult cancers. 2. Discuss common toxicities and adverse events related to cancer and its treatment in adults. 3. Apply the necessary diagnostic screening strategies to manage patients during or after cancer treatment, including acute, subacute, and late effects of treatment on the various body systems. 4. Select treatment strategies to improve upper and 36 lower quadrant dysfunction and impairments and mange symptom distress based on the evidence. 5. Describe the current outcome measurement tools used in oncology rehabilitation. Lymphedema Management Courses/ Training programs Complete Presenters: Steve Norton CLTFrequency: Course is scheduled for 20 offerings in 2012. Decongestive LANA, Andrea Cheville MD, Average Attendance: 18-20 therapists Therapy Certification Nicole Stout MPT, CLT-LANA, Participant Objectives: course (135 hr; John Beckwith PT, CLT-LANA, Joy o Differentiate between a variety of peripheral edemas participants receive a Cohn, PT, CLT-LANA o Understand the applications, medical indications, and 5 DVD set) contraindications of MLD and CDT. Offered by: Norton o Establish a CDT treatment plan for individuals with School of Lymphatic primary or secondary lymphedema and perform the Therapy indicated treatment. Perform the four components of o CDT (manual lymph drainage, compression therapy, exercise, skin care) e – Integrative Presenters: Guenter Klose, Frequency: The course is scheduled for 12 offerings in 2012. Lymphedema Kathleen Francis MD, Linda Average Attendance: 18-20 therapists Certification Course Roherty PT, CLT-LANA, Jody Participant Objectives: (135 hr, 45 hr of Winicour PT, CLT-LANA, Jan o Demonstrate four components of Complete which is an internetWeiss PT, DHS, CLT-LANA, Julia Decongestive Therapy. based home study Rodrick OTR/L, WCC, CLT-LANA, o Differentiate between a variety of peripheral edemas course. Participants Joanne McGillicuddy PT, CLTo Understand the application, medical indications and receive DVDs, LANA, Chris Cobb PT, CLT-LANA, contra-indications for MLD and CDT. software, and a Leslyn Keith MS, OTR/L, CLTo Establish a CDT treatment plan for individuals with manual.) LANA, Heidi Miranda-Walsh primary and secondary lymphedema and perform the Offered by: Klose OTR/L, CHT, CLT-LANA, Elizabeth treatment for lymphedema accordingly. Training and Camp PT, MHS, CWS, CLT-LANA, Consulting Rene Janiece LMT, CLT, Ruth Coopee, OTR, CLT. Basic MLD Presenters: Steve Norton CLTFrequency: 2012 schedule is not available on line at this time Certification course LANA, Andrea Cheville MD, John Average Attendance: 20-25 therapists (48 hr; participants Beckwith PT, CLT-LANA, Joy Participant Objectives: 37 receive a manual) Offered by: Norton School of Lymphatic Therapy Basic MLD Certification course (45 hr) Offered by: Klose Training and Consulting Cohn, PT, CLT-LANA o Demonstrate an understanding of the anatomical features and terminology of the functional lymphatic system o Demonstrate comprehension of information related to normal lymphatic physiology and the differences encountered in a diseased state o Demonstrate an understanding of the proper clinical applications of MLD (indications) o Demonstrate an understanding of the improper clinical applications of MLD (contraindications) o Demonstrate an understanding of clinical applications where caution should be exercised (precautions) o Perform techniques consistent with proper Vodder-style MLD and memorize the sequences for all body areas of the intact lymphatic system o Demonstrate the ability to customize treatment strategies for various pathologies where MLD is indicated o Demonstrate the ability to employ MLD on primary and secondary lymphedema patients (medicallyuncomplicated, physician prescribed treatment) Presenters: Guenter Klose, Frequency: The course is scheduled for 6 offerings in 2012. Kathleen Francis MD, Linda Average Attendance: 18-20 therapists Participant Objectives: Roherty PT, CLT-LANA, Jody Winicour PT, CLT-LANA, Jan o Demonstrate an understanding of the anatomy and the Weiss PT, DHS, CLT-LANA, Julia relevant scientific terminology related to the lymphatic system Rodrick OTR/L, WCC, CLT-LANA, Joanne McGillicuddy PT, CLTo Demonstrate an understanding of the differentiation LANA, Chris Cobb PT, CLT-LANA, between the normal and diseased states of the Leslyn Keith MS, OTR/L, CLTlymphatic system (physiology and pathophysiology of the lymphatic system) LANA, Heidi Miranda-Walsh OTR/L, CHT, CLT-LANA, Elizabeth o Demonstrate an understanding of the indications and Camp PT, MHS, CWS, CLT-LANA, contraindications related to the use of MLD Rene Janiece LMT, CLT, Ruth o Competently perform the techniques of MLD for all body Coopee, OTR, CLT. areas 38 o Lymphedema Management of the Upper and Lower Extremities (23 hr) Offered by: North American Seminars Presenter: Elizabeth Augustine PT, DPT or Julia Osborne PT, CLT-LANA Develop appropriate treatment strategies for indications such as post-surgical edema, post-traumatic edema, fibromyalgia, general detoxification and other conditions o Competently perform MLD on clients after breast surgery for cancer (clients at risk to develop lymphedema) o Competently perform MLD on clients with mild, medically uncomplicated, primary or secondary lymphedema Frequency: This course is scheduled to be offered three times in 2012. Average attendance: 30, primarily physical therapists for a total yearly attendance of 90. Participant Objectives: o Demonstrate an understanding of the anatomy and physiology of the lymph system o Describe the pathophysiology of lymphedema and pathogenesis of common upper extremity and lower extremity lymphedema. o Understand the common diagnostic procedures for lymphedema. o Recognize, assess, and treat the different classifications of upper extremity and lower extremity lymphedema o Perform proper massage techniques to enhance lymphatic flow and explain the physiologic rationale for lymph drainage massage. o Correctly apply short stretch compression bandages in the treatment of upper extremity and lower extremity lymphedema. o Perform limb measurements that provide acceptable documentation of outcome measures. o Instruct patients and health care professionals in precautions and skin care. o Choose the appropriate compression garments and 39 instruct patients in correct application. Develop appropriate individualized treatment programs for successful functional outcomes. Frequency: Course is scheduled for six offerings in 2012. Average attendance: 30, 80-90% physical therapists, for a yearly total of 180. Participant Objectives: o Understand the anatomy and physiology of the lymphatic system and how to use the anatomy to its best advantage in performing effective lymphatic drainage in complex patients with aggressive and advanced lymphedema, lipedema, and primary lymphedemas. o Advance and integrate lymphatic drainage skills with neuro-musculo-skeletal orthopedic skills to create increased efficiency and greater success in treating patients with UE complications, LE complications, head and neck complications, groin and genital complications, and abdominal and trunk complications. o Demonstrate the ability to use the hands-on advanced techniques taught in this seminar to treat patients with co-morbidities such as chronic thrombosis, diabetes, CHF, auto-immune diseases; and patients with complications of lymphedema such as seromas, hematomas, severe fibrosis, axillary web syndrome, and Mondor’s syndrome. o Have a more in-depth understanding of the acute trauma that occurs to the lymphatic system after surgery and radiation therapy so as to broaden treatment protocols and implement early intervention. o Have the knowledge and tools necessary to shift mindset from treating “lymphedema” as a condition to treating the “lymphatic system” as it relates to other body systems during periods of acute trauma – a necessary step towards progressive thinking in twentieth century o Advanced Management of Lymphedema (15 hr) Offered by: North American Seminars Presenter: Julia Osborne, PT, CLT-LANA 40 o o o On-Line Courses, Other Media-based Courses Educata: Foundation of Oncology for Physical Therapists (2.5 hr. This is a beginner level course designed to provide a solid foundation for oncology practice.) APTA Learning Center: CSM10: Medical Screening for Oncology Issues in Author/Presenter: Marisa Perdomo, PT, MSPT, DPT, CLTFoldi, CES Author/Presenters: Mary Lou Galantino, PT, PhD, MSCE, Laura Gilchrist, PT, PhD, Victoria Marchese, PT, PhD, G. Stephen Morris, PT, PhD, Kirsten Ness, medicine, and in the future development of evidencebased research. Develop advanced critical thinking skills and clinical decision-making skills in the management of patients with lymphedema and all associated co-morbidities and complications. Expand knowledge base about bandaging, compression, kinesiotape, and additional products on the market; and know how and when to apply advanced management products to patients. Gain and advance leadership skills in the continuum of care and multi-disciplined approach to the management of complex patients Participant Objectives: o Understand, define, discuss and educate others in the scientific foundational principles regarding: o The pathogenesis of cancer o The diagnosis and prognosis of cancer o The growth or spread of cancer o Medical intervention strategies for the treatment of cancer Search medical Web sites regarding o specific cancer diagnoses and treatments to obtain the specific information needed for a physical therapist to perform an initial evaluation. Utilize the scientific principles o regarding cancer to determine the role of physical therapy for individuals with cancer. Participant Objectives: o Screen general outpatients for potential oncological disease o Analyze a case report of an outpatient assessment for potential oncology 'red flags 41 Outpatient Physical Therapy (2 hr) PT, MA, MPH, PhD, Meredith Wampler, PT, DPTSc o o o CSM11: Measuring Outcomes in Oncology Rehabilitation (3 hr) Authors/Presenters: Mary Lou Galantino, PT, PhD, MSCE, Laura Gilchrist, PT, PhD, Victoria Marchese, PT, PhD, G Stephen Morris, PT, PhD, Kirsten Ness, PT, MA, MPH, PhD, Meredith Wampler, PT, DPTSc PT 2011: Manual Therapy for the Oncology Patient (3 hr) Author/ Presenter: Lisa Massa, PT, WCS, CLT-LANA Describe the most common late-effects of cancer and its treatment Screen patients with a previous history of cancer for lateeffects of cancer and its treatment. Determine appropriate referrals for oncology-related issues in both patients with and without a previous cancer diagnosis. Participant Objectives: o Describe common impairments, limitations, and participation restrictions found in the oncology rehabilitation population. o Describe issues related to the selection of appropriate outcome measures. o Select appropriate outcome measurements for various issues related to oncology rehabilitation. o Illustrate, through the use of case studies, the appropriate selection of outcome measures in oncology rehabilitation. Participant Objectives: o Review, discuss, and apply the proper indications and contraindications for manual therapy for the patient with cancer. o Discuss the impact of surgery, chemotherapy, and radiation treatments on the musculoskeletal and lymphatic systems. o Synthesize the relevant literature associated with manual therapy and individuals with cancer, with emphasis on mobilization/manipulation techniques and therapeutic exercise of the musculoskeletal and lymphatic systems. 42 o o PT10: Physical Therapy Management of Children With Cancer (3 hr) Authors/ Presenters: Colleen Coulter-O'Berry, PT, DPT, PhD, MS, PCS, Kirsten Ness, PT, MA, MPH, PhD, Durga Aman Shah, PT, DPT, PCS, Claire F. McCarthy, PT CD-ROM: Audio-Plus Home-Study Course: Cancer Rehabilitation: Principles and Practice Author/ Presenter: Charles L. McGarvey, PT, DPT, MS, FAPTA Integrate relevant dysfunctional biomechanical and neurophysiologic findings with appropriate manual therapy interventions for patients with breast cancer and/or head and neck cancer. Identify oncologic emergencies that may initially appear as musculoskeletal problems. Participant Objectives: o Consider the process of screening and differential diagnosis for children with signs and symptoms related to brain tumors, leukemia, bone marrow transplants, and solid bone tumors. o Review the pathophysiology of selected diagnoses. o Establish the patient/client management plan for various pediatric diagnoses. o Discuss practice management across the continuum of care available in pediatric settings. o Develop discharge plans and referrals to other practice settings as appropriate. Participant Objectives: o Define terminology associated with Cancer o List statistics related to incidence, mortality, and morbidity o Identify basic metastatic process o List primary antineoplastic strategies and their sequelae o Identify general principles of cancer rehabilitation o Describe the purpose of the physical therapy impairment diagnosis o Name the most common risk factors for cancer o Identify the systems most often affected by cancer metastasis o Describe the corresponding clinical 43 o manifestations of each system affected by cancer metastasis List clinical signs and symptoms corresponding to paraneoplastic syndromes 44 Criterion 7: Transmission of Knowledge ABPTS Feedback: 7.5 Describe methods of knowledge transmission through symposia, seminar, workshops, etc, and enclose representative programs concerning these activities. {Decision: Did Not Adequately Meet Requirement} ABPTS requests that the petitioner separate information appropriately between sections 7.5 and 7.6, providing introductory and summary comments, to allow for an easier review of relevant information by section. 7.6 Provides number of such events described in #5 above that occur annually and estimate the average and total attendance at such programs. {Decision: Did Not Adequately Meet Requirement} ABPTS requests that the petitioner separate information appropriately between sections 7.5 and 7.6, providing introductory and summary comments, to allow for an easier review of relevant information by section. In addition, it was noted that attendance data was not consistently documented. REVISED SECTIONS: 7.5 Describe methods of knowledge transmission through symposia, seminars, workshops, etc, and enclose representative programs concerning these activities. Multidisciplinary conferences The availability of continuing education offerings in oncologic physical therapy has grown as the practice area itself has grown, initially beginning with multidisciplinary conferences offered by the institutions that pioneered the area of practice. MD Anderson offered annual conferences on cancer rehabilitation after beginning its oncology rehabilitation program. They published a proceedings document from the 1970 conference, (which was their fifteenth annual conference) on the topic of Rehabilitation of the Cancer Patient, bringing together physicians, nurses, therapists, and other non-medical rehabilitation leaders in the country. Legacy Good Samaritan Hospital in Portland, Oregon, one of the early NCI cancer rehabilitation grant recipients, also sponsored cancer rehabilitation conferences, incepted by John Stanwood. The conference started in 1976 and was held every two years. Topics featuring the role of physical therapy in various types of cancer related disability were prominent in every conference, although we do not have records of the titles, presenters and objectives from these historical events. According to current Specialization Task Force members who attended these conferences, physical therapists typically made up the largest group in attendance among multidisciplinary participants. The James Cancer Center of Ohio State University School of Medicine conducted annual cancer rehabilitation conferences, offering basic multidisciplinary information to a diverse audience, the majority of whom were physical therapists involved in cancer care. Attendance was always strong as an increasing number of physical therapists became cognizant that a considerable percentage of the patient population they were seeing in the general hospital setting were patients with cancer or cancer related disability. This conference was last held in 2006. The most sustained of the continuing educational conferences in cancer rehabilitation began at the Virginia Commonwealth University’s Medical College of Virginia under the directorship of Susan Mellette, MD, one of the early leaders in the cancer rehabilitation milieu. In the 1970’s she began crafting a novel and unique approach to the patient with cancer which emphasized, among other areas, physical rehabilitation, hence involving the physical therapy profession from the very beginning. This biennial conference is still being held, sponsored by the Department of Physical Medicine and Rehabilitation and the Massey Cancer Center of the university, and held in Richmond, Virginia. To compliment the west coast Stanwood conference, it is generally held in the odd numbered years, though it was most recently held in 2010 and is scheduled next for May 5, 2012. Physical therapists have typically made up 75% of the attendees at these conferences and topics relevant to physical therapy have been prominent in the programming, titles, topics, presenters, hours, and objectives are found in Table 7.5-7.6 above. In the 2007 MCV conference, Patricia Schmidt of the James Cancer Center at Ohio State University gave a visionary presentation outlining the new models of cancer rehabilitation service delivery, stressing survivorship and involving partnerships and collaborations with other disciplines. These models supported the concept of the multidisciplinary approach, but at the same time emphasized strongly that each of 2 the disciplines, e.g. physical therapy, develop their own expertise in treating the cancer problems they encounter. This in itself lends strong support for the specialization in oncology physical therapy. Her predictions were prescient: survivorship issues drive much cancer care at the present time; each discipline has its own course network. As physical therapists reached critical mass in knowledge and practice base, regional courses specific to physical therapists grew in number. Combined Sections Meeting (CSM): Oncology Section Sponsored Courses Since its inauguration almost 30 years ago, the Oncology Section of the APTA has organized, sponsored and conducted extensive programming at the Combined Sections Meeting. The number, variety, and quality of the courses have grown along with the growth of the specialty. The Section, led by Program Chair Amy Litterini PT, DPT, makes an effort to provide courses at basic as well as intermediate or advanced levels in order to provide offerings that serve the needs of the diversity of attendees at CSM. Courses offered at CSM over the last four years are listed here. We do not have session by session attendance data, although all sessions were well-attended. Regional Courses Sponsored by Oncology Section The Oncology Section is responding to membership need for courses at the regional level that provide members an opportunity to receive quality instruction and laboratory experiences where appropriate in order to develop knowledge and skills for oncologic physical therapy practice. The Oncology Section maintains a Regional Course Chair (currently Mary Ann Calys PT, DPT) to organize and manage these selfsupporting courses in collaboration with the Section Executive. The Section began offering such courses in 2005, with one to two offerings per year. In order to serve the educational needs of physical therapists the Section is engaged in continuing efforts to increase the number and geographical distribution of these offerings. Section-sponsored regional courses have now grown in number to six per year. Because of the 3 expense of mounting regional course offerings it is necessary for these courses to focus on areas of high demand among physical therapists who practice in a variety of settings. Currently there is reliable interest in courses dealing with physical therapy for the persons with breast cancer, and for exercise guidelines for persons with cancer. The Section now also has a course in pediatric oncology that was first offered in 2011. The Section has a special level of sponsorship for regional courses organized by section members who partner with the Section for some of the course organization and implementation while contributing much of the effort of the organization themselves. The Section has so far sponsored two such courses, the Oakland University Annual Symposia listed below in 2010 and 2011. We anticipate that with growth of the specialty and educational outreach on the part of Section leaders, broader interest in other aspects of oncologic physical therapy will follow. Courses scheduled for 2012, as well as courses offered in the past three years are described below. According to the Section Executive, the average attendance for Section regional courses is 16-18 therapists, which at six courses per year would lead to a total attendance of 96-108. Regional courses offered outside the sponsorship of the Oncology Section Interest among physical therapists in acquiring the skills and knowledge necessary for practice in oncology has grown in proportion to the growth of the practice area. In response to this growing demand, commercial continuing education providers offer courses relevant to this practice area. All of the courses described below are offered multiple times per year in various locations in the United States. The number of courses scheduled for 2012 is included in the descriptions; in each case the courses described have been offered at similar frequency for at least three years, typically longer. Lymphedema Management Courses/ Training programs 4 Lymphedema has a variety of causes not exclusive to cancer, but it is commonly seen in oncology rehabilitation since it can arise as a side-effect of any cancer treated with removal of lymph nodes. Physical therapists who specialize in rehabilitation of the person with cancer encounter lymphedema affecting the trunk, face, and any extremity among patients with breast cancer, melanoma, prostate cancer, head and neck cancers, and other cancers. A wide array of training programs for the management of lymphedema has existed for many years, first in Europe and then in the United States. These training programs sometimes lead to some form of certification but do not always, and vary in length from 15 to 135 hours. Section leaders have long held (consistent with the House of Delegates’ position on professional designations) that special certification derived from a particular continuing education course is not necessary for a physical therapist. Physical therapists can build on their entry-level foundation using self-study, colleague mentoring, and/or short courses to successfully add relevant understanding and skills and multiple continuing education certifications introduce unnecessary confusion into the professional title. Self-evaluation of the adequacy of skills and knowledge is a matter of professionalism. Factors that may influence training style choice may include previous exposure to the content and the amount of focus that an individual may want to place on lymphedema management in his or her practice. Lymphedema is just one impairment among many that affect persons with cancer, and focused lymphedema training is not, in and of itself, sufficient training for management of the continuum of cancer care. However, it is important content in that it is a common and functionally limiting impairment for patients, and a frequent source of referrals to physical therapy among persons with cancer. Exposure to lymphedema issues is also a relatively frequent pathway through which therapists become interested in more comprehensive oncologic physical therapy. Hence, a brief description of the most well-known courses in lymphedema management is included in the table listed in order of course duration beginning with the longest courses. 5 On-Line Courses, Other Media-based Courses The Oncology Section has just recently begun to develop offerings in on-line courses for oncologic physical therapy in recognition of the likelihood that this learning method will grow in importance and demand in the future. Courses are offered or planned that are either fully online, or hybrid. In hybrid courses participants complete a portion of the course on-line to learn the background material and other information that lends itself to that medium. Participants then take-part in a regional laboratory experience. The Section participates in both Educata and the APTA Learning Center with on-line course offerings (both of which are new ventures in and of themselves) and plans to further develop online offering in the coming years. Currently available offerings that directly deal with oncologic physical therapy are shown in the table. 7.6 Provide the number of such events described in #5 above that occur annually and estimate the average and total attendance at such programs. Current available continuing education offerings are described below by category. Annual frequency of offerings and average attendance is included with these descriptions, where known. Methods of knowledge transmission Multidisciplinary conferences ACMR (American Congress of Rehabilitation Medicine) Cancer Location Year established Last Held Conference Organizer *Frequency of Event *Estimated Avg. Attendance Varies 2013 is 90th annual conferenc 2012 ACMR Annually 2012 (over 700 from 20 countries); 2013 (27 countries represented to date) 6 Rehab. programming at conference MD Anderson Cancer Center James Cancer Center of Ohio State University School of Medicine Sloan Kettering e Houston, TX Columbus, OH 1955? NY, NY 2013 2013 Legacy Good Samaritan Hospital Portland, Oregon 1976 Virginia Commonwealth University’s Medical College of Virginia Richmond, VA 2011 (opposite year of VCU) 2012 (opposite year of Good Samaritan) Methods of knowledge transmission Combined Sections Meeting (CSM), APTA including PreCon Courses Location CSM 2012 Preconference course (1 day): Evidence in Action: A Varies with CSM ? 2006 Year established 30 years ago Topic: Management of Balance Impairments and Falls For Adult MD Anderson Cancer Center Annually 100-120 Annually 200 Michael Stubblefield MD Initially John Stanwood Biannual 80 Every other year 100-150 Initially Susan Mellette Every other year 100-150 Last Held Conference Organizer *Frequency of Event *Estimated Avg. Attendance 2013 Oncology Section Sponsored Courses Annually Since 2005, average attendance at oncology preconference courses = 25 Average attendance at conference symposia = 40150 topic dependent Presenters: Jennifer Blackwood, PT, MPT, GCS, Min-Hui Huang, PT, PhD, Participant Objectives: o Describe the unique and diverse local and systemic effects of cancer that impact balance. 7 Comprehensive Management of Balance Impairments and Falls For Adult Cancer Survivors Cancer Survivors NCS, Lucinda Pfalzer, PT, PhD, FAPTA, Amy Yorke, PT, MPT, NCS x Exercise Guidelines for Patients with Cancer: Where Are We? Where Would We Like to Be? Where's the Physical Therapy? Part 1 (2 hr) and Part II (1hr) Presenters: G. Stephen Morris, PT, PhD, Ann Flores, PT, PhD, MS, MA, CLT, Lucinda Pfalzer, PT, PhD, FAPTA, Elizabeth Hile, PT, PhD, NCS x Peripheral Edema: Diagnosis and Treatment Strategies Across All Patient Populations, Part I (2 hr) and Part II (1 hr) Presenters: Marisa Perdomo, PT, DPT, Antoinette P. Sander, PT, DPT, MS, CPT-LANA, Kimiko A. Yamada PT, DPT, OCS, CSCS, ATC, Dawn Franceschina, PT, DPT, Michael Simpson, PT, DPT x Preventive Rehabilitation: A Novel Approach to the Presenters: Keren PalgiBornstein PT, DPT, Jean M. Kotkiewicz PT, DPT o Describe the local and systemic effects of cancer treatment that impact balance. o Apply the appropriate screening tools with the ICF model to manage balance impairment in a patient with cancer. o Apply evidence based examination strategies to assess balance in a patient with cancer. o Apply evidence based intervention strategies to treat balance dysfunction in a patient with cancer. Participant Objectives: o Discuss acute and adaptive changes brought about in the oncology population by participating in an exercise training program. o Explain why participation in an exercise training program should be considered a treatment option for most oncology patients. o Describe common methods of exercise testing. o Generally understand the basics of exercise prescriptions. o Discuss currently available exercise guidelines available for use in the oncology population. o Apply these recommendations to an oncology patient population. Participant Objectives: o Utilize the pathophysiology of edema in the differential diagnosis process to determine if physical therapy is appropriate for the patient or if referral for medical consult is warranted. o Examine a variety of edema interventions that can be used across patient populations. o Select edema interventions based on the etiology of the edema and best evidence available. Participant Objectives: o Describe Memorial Sloan Kettering Cancer Center’s (MSKCC) comprehensive post-operative pulmonary program for eligible surgical patients and be familiar with the guidelines of care 8 Hospitalized Oncology Patient (2 hr) x Diagnosis Dialog for Oncology Physical Therapists (2 hr) and relevant supporting research. o Discuss MSKCC’s wellness program for inpatients receiving allogenic BMT and a typical treatment plan for this not-sotypical patient population. o Educate PTs about MSKCC’s Early Mobility Program for intubated ICU patients and the techniques and methods for minimizing functional decline during this tenuous period. o Explain MSKCC’s comprehensive treatment approach for medically complicated lymphedema and edema patients and discuss MSKCC’S lower extremity lymphedema prevention group and its benefits to the targeted postoperative population. o Describe MSKCC’s breast surgery rehabilitation group for all immediate post operative breast surgery patients, including all reconstructive and non-reconstructive procedures. o Describe MSKCC’s developing program targeting patients with planned removal of large vessels and ways to most effectively manage postoperative lymphedema and vascular insufficiency. o Apply this new prevention method using a pre-operative team approach for compression garment fitting. Presenters: Catherine Participant Objectives: o Relate the history of diagnosis in PT, the diagnosis dialog Goodman PT, MBA, CBP, discussions, and the dilemmas related to the development of Barbara Norton PT, PhD, movement system-based diagnoses. FAPTA, Lisa Massa PT, WCS, o Discuss the need for widespread, consistent use of commonly Molly Reynolds PT, Stacie understood terminology for diagnosing dysfunction of the Larkin PT, DPT, Med, Jean human movement system. O’Toole PT, MPH o Explain how the use of a common diagnostic scheme will impact clinical practice of physical therapists working with oncology patients. o Introduce a process for developing a diagnosis for patients with movement problems related to cancer or the treatment of cancer. 9 Participant Objectives: Relate the history of diagnosis in PT, the diagnosis dialog discussions, and the dilemmas related to the development of movement system-based diagnoses. Discuss the need for widespread, consistent use of commonly understood terminology for diagnosing dysfunction of the human movement system. Explain how the use of a common diagnostic scheme will impact clinical practice of physical therapists working with oncology patients. o Introduce a process for developing a diagnosis for patients with movement problems related to cancer or the treatment of cancer. Participant Objectives: o Describe the process of screening and differential diagnosis/red flags for children with signs and symptoms that may indicate the presence of a hematological, nervous system, or bone/soft tissue malignancy. o Review the pathophysiology for selected cancer diagnoses o Establish a medical and therapeutic management plan for selected cancer diagnoses o Discuss potential lifelong challenges and late effects of treatment that face children who were treated for cancer. o Ask questions about the cases and openly discuss issues relating to the diagnosis, treatment, and long-term management of children with cancer. Participant Objectives: o Briefly describe the most common impairments of body structure and activity limitations in individuals treated for breast cancer. o Describe the role of consistency in outcomes assessment to monitor patient status and demonstrate intervention effectiveness in both individuals and patient groups. o Identify selected outcome measures that can appropriately x Diagnosis Dialog for Oncology Physical Therapists (2 hr) Presenters: Catherine o Goodman PT, MBA, CBP, Barbara Norton PT, PhD, FAPTA, Lisa Massa PT, WCS, o Molly Reynolds PT, Stacie Larkin PT, DPT, Med, Jean O’Toole PT, MPH o x Cancer in Children: A CaseBased Approach Part 1 (2 hr) and Part II (1hr) Presenters: Lynn Tanner PT, MPT, Colleen Coulter PT, PhD, Shawn Israel PT, DPT, Angela M. Corr PT, DPT, Denise Cortes PT, MBA, PCS x Oncology Section Task Force on Breast Cancer Outcomes (2 hr) Presenters: Pamela K. Levangie PT, DSc, DPT, FAPTA, Mary I Fisher PT, MSPT, OCS, Marisa Perdomo PT, DPT, Tiffany Kendig PT, MSPT, MPH 10 x Orthopedic Manual Therapy for the Individual with Movement Impairments Resulting from Radiation Therapy (2 hr) x Oncology Physiotherapists: Preventing Cancer and Treating the Metastatic Sequel (1.5 hr) x Physical Therapy Management of Individuals with HIV: An Overview and Update (2 hr) be used for individuals about to undergo treatment or who have been treated for breast cancer. o Discuss the relative merits of presented outcome tools based on psychometric properties, administration issues, and limitations. Presenters: Marisa Participant Objectives: Perdomo, PT, DPT, Chris A. o Select the appropriate examination tests and measures for the shoulder complex and hip-pelvis complex which include: Sebelski PT, DPT, OCS, CSCS accessory mobility, muscle length, and assessment of end-feel for the patient with complications from radiation therapy. o Create a plan of care that integrates a progression of soft tissue mobilizations and joint mobilizations (grade I-V) with appropriate follow-up of therapeutic exercise. o List the contraindications and indications for manual therapy for tissues affected by radiation therapy. Presenter: Oren Cheifetz Participant Objectives: o Describe the strengths and weaknesses of the evidence PT, MSc supporting the role of physiotherapists In the prevention of cancer. o Describe strategies to engage patients with cancer in exercise programs. o State the indications for the use of exercise for patients with cancer. o Relate to the challenges of using exercise for patients with cancer. o Demonstrate an understanding of safety considerations relevant to exercise for patients with cancer. Presenters: David Kietrys Participant Objectives: PT, MS, OCS, Mary Lou o Describe the neuromusculoskeletal features of HIV and Galantino PT, PhD, MSCE discuss their effects on function. o Design safe exercise programs based on the stage of the disease for HIV-positive individuals. o Describe the role of the PT or PTA in the management of common impairments associated with HIV and its 11 x comorbidities, and integrate physical therapy interventions into a multidisciplinary model. o Apply recommendations for social issues, such as working with HIV-positive athletes and occupational exposure. Participant Objectives: o Create a template for oncology rehab education for PT generalists in a large health network. o List disease-specific, PT-related impairments and interventions according to primary cancer and side effects of cancer intervention. o Discuss assessment tools, including the use of electronic learning modules to measure PT competency versus direct inservice with written competency. Oncology PT Intervention Performed by a Physical Therapist Generalist: Educational Strategies to Improve Safety and Outcomes (1.5 hr) CSM 2011 x Preconference course (2 day): Upper Extremity Lymphdema: The Art and Science of Physical Therapy Interventions Presenter: Linda McGrath Boyle PT, DPT, OCS, CLTLANA x Presenters: G. Stephen Morris Measuring Presenters: Elizabeth Augustine PT, DPT, MS, Marisa Perdomo PT, DPT, MS, Antoinette Sandler PT, DPT, MS, CLT-LANA, Lisa VanHoose PT, CLT-LANA, WCC Participant Objectives: x Evaluate individuals with UE lymphedema, determine if PT is appropriate or refer to another health care provider for further differential diagnostic testing. x Design an individualized intervention program that is based on the anatomy and physiology of the lymphatic system and is supported by best available evidence. x Perform manual lymphatic drainage mobilizations (LD) and modify the technique based on the quality and nature of the edema. x Apply appropriate UE compression short stretch bandaging techniques and adapt the technique to maximize therapeutic response from tissues with fibrosis. x Develop an appropriate physical therapy based lymphedema home program x Recommend the appropriate compression garment Participant Objectives: 12 x x Outcomes in Physical Therapy Note: This course has been implemented as a repurposed online course in the new APTA Learning Center (3 hr) A Framework for Treating Patients with Oncological Diagnoses Using a Systems-Based Approach (1.5 hr) PT, PhD, Mary Lou Galantino PT, PhD, MSCE, Kirsten Ness PT, PhD, MA, MPH, Laura Gilchrist PT, PhD, Meredith WamplerKuhn PT, DPTSc, Victoria Marchese PT, PhD Oncology Exercise Issues in Outpatient Physical Therapy: Beyond Range of Motion and Fitness Prescription (2.75 hr) Presenter: Mary Lou Galantino PT, PhD. MSCE, Matthew Taylor PT, PhD Presenter: Stephanie Cramme PT, DPT, Diane Heislein PT, DPT, MS, OCS o Describe common impairments, limitations, and participation restrictions found in the oncology rehabilitation population. o Describe issues related to the selection of appropriate outcome measures. o Select appropriate outcome measurements for various issues related to oncology rehabilitation. o Illustrate, through the use of case studies, the appropriate selection of outcome measures in oncology rehabilitation. Participant Objectives: x Describe a comprehensive systems-based approach to the physical therapy examination and treatment of patients with cancer. x Identify potential impairments and functional limitations that may result as a direct consequence of chemotherapy and/or radiation therapy treatment for patients with cancer. x Outline comprehensive evidence based interventions to address integumentary issues in a patient with leukemia, neuromuscular and cardiopulmonary issues in a patient with metastatic lung cancer, and musculoskeletal issues in a patient with metastatic prostate cancer. Participant Objectives: o Describe what is meant by full-spectrum movement prescription contrasted with traditional therapeutic exercise prescription. o Describe how full-spectrum movement prescription addresses the most common effects of cancer and its treatment. o Evaluate outpatients with oncological disease for fullspectrum movement prescriptions beyond traditional exercise prescription. 13 o x Medical and Physical Therapy Management of ChemotherapyInduced Peripheral Neuropathy (CIPN)( 1.5 hr) Presenters: Laura Gilchrist PT, PhD, Kirsten Ness PT, PhD, MA, MPH, Lynn Tanner PT x Improving the Quality of Life of Children with Cancer: The Role of Rehabilitation (2.75 hr) Presenter: Susan Miale PT, DPT, PCS x Comfort Care Only-Therapy Presenters: Mary-Jean Paulitz PT, MS, Jo-Ellen Thomson PT Analyze a case report of an outpatient prescription for a patient with oncological disease. o Access resources for oncological patients within their community as well develop niche programming within their clinics. Participant Objectives: o Describe the pathophysiology of CIPN. o Describe medical management of CIPN, both for prevention and symptom control. o Describe the signs and symptoms of acute CIPN, and the long-term structural and functional impairments and associated performance limitations in individuals with persistent CIPN. o Develop an appropriate physical therapy management plan for individuals with acute or chronic CIPN. Participant Objectives: o Identify and describe the most common forms of malignancy in childhood. o Briefly describe the typical medical treatments for childhood cancers. o Identify the adverse effects of cancer and cancer treatment that necessitate physical rehabilitation. o Demonstrate a basic knowledge of how to effectively screen patients to determine the need for occupational and/or physical therapy services in the acute pediatric oncology setting. o Recognize the psychosocial issues that are common in families of a child with cancer and determine strategies to assist with coping o Understand the benefits of physical therapy intervention in children with cancer from an evidence-based perspective. Participant Objectives: o Identify the dilemma of comfort care in physical therapy. 14 o o Discontinued: Can One Last Visit Impact Quality of Life? (1.5 hr) x Exercise and the Athlete with Cancer (2 hr) Presenter: Alison DeLeo PT, DPT x An EvidenceBased Approach to the Identification and Screening of Balance for Presenters: Min-Hui Huang PT, PhD, Lucinda Pfalzer PT, PhD, FACSM, FAPTA Discuss the areas of focus for hospice physical therapy. Identify the safety needs of patients who are transitioning to hospice. o Describe ways that a PT can impact a patient’s comfort. o Discuss family and caregiver training opportunities that could positively impact a patient’s quality of life at the time of discharge. Participant Objectives: o Define the “athlete cancer survivor” o Describe current guidelines for exercise in athlete patients with cancer. o Identify the potential physiologic changes to exercise response related to treatment modalities for cancer, including surgery, chemotherapy, radiation therapy, hormone therapy, immunotherapy and bone marrow transplantation. o Identify indications and contraindications for exercise in an athlete patient with cancer. o Apply and modify the general principles of exercise prescription to meet the needs of physically active patients with cancer. o Formulate safe and effective exercise programs for athlete cancer survivors before, during and after medical management of cancer. o Generate hypotheses regarding expected outcomes for physically active patients with cancer participating in exercise programs. o Identify and respond to oncological emergencies. Participant Objectives: x Describe the unique and diverse local and systemic effects of cancer that impact balance. x Describe the local and systemic effects of cancer treatment that impact balance. x Apply the appropriate screening tools with the ICF 15 x x x Patients with Cancer (1.5 hr) An EvidenceBased Approach to the Examination and Intervention of Balance for Patients with Cancer (1.5 hr) Successes and Pitfalls: Developing a Sustainable Comprehensive Oncology Treatment Program (2.5 hr) Breast Cancer Physical Restoration Using the Pilates Method (2.75 hr) Presenters: Jennifer Blackwood MPT, GCS, Amy Yorke MPT, NCS Presenters: Teresa Fitzpatrick PT, MBA, Mary Ann Calys PT, DPT, MS, Andrea Leiserowitz MPT,CLT, Kathie Hummel-Berry, PT, PhD Presenter: Suzanne Clements Martin PT, DPT model to manage a balance impairment in a patient with cancer. Participant Objectives: x Apply evidence based examination strategies to assess balance in a patient with cancer. x Apply evidence based intervention strategies to treat balance dysfunction in a patient with cancer. x Apply evidence based adaptation strategies for balance dysfunction. Participant Objectives: o Outline a plan for establishing a comprehensive oncology clinical service within the community o Describe at least two strategies for marketing the practice to referral sources o Explain the rationale for structure of the necessary rehabilitation team. o Describe a strategy for appropriate staff training o Analyze the benefits of automatic referral protocols o List at least three possible pitfalls that could impede success in program development Participant Objectives: o Explain the short and long-term physical and psychosocial impacts of breast cancer. o Compare and contrast the physical and psychosocial impacts on pre-menopausal and post-menopausal populations afflicted with breast cancer. o Apply an evidence-based rationale for physical therapy intervention in the rehabilitation and post-rehabilitation phases for survivors. o Perform a functional evaluation to identify core/trunk strength as well as weight-bearing (pelvic and lower extremity) movement dysfunctions. o Define the Pilates Method; explain, and demonstrate the 16 x x Newer Technologies Advance the Evaluation and Treatment of Peripheral Edema and Lymphedema (2.75 hr) CSM 2010 Preconference course (1 day): End of Life Care: Issues of Living and Dying in Clinical Practice Presenters: Lesli Bell PT, Elizabeth Campione PT, Marisa Perdomo PT, DPT, Kathryn Ryans PT, DPT Presenter: Richard Briggs PT, MA qualitative benefits and differences between the popular Classic conditioning Method and the therapeutic application of the Method, focusing on the Upper Core. o Identify contraindications for Pilates/ exercise and plan appropriate treatments in the therapeutic application of the Pilates Method. o Set up a home well-being program for managing the chronic condition of breast cancer survivorship. Participant Objectives: o Upon completion of this course, you will be able to: Understand and discuss the physiological rationale for utilizing laser therapy, bioelectrical impedance and compression pumps for individuals with lymphedema. o Perform an evidence based decision making thought process to determine if laser therapy, bioelectrical impedance and compression pumps are appropriate for individuals with lymphedema. o Develop a PT intervention plan of care that includes laser therapy and compression pumps for individuals with lymphedema. o Develop a PT intervention utilizing laser therapy for those individuals who are at risk for developing lymphedema. o Understand the role of these modalities in the overall plan of care for individuals with lymphedema and determine when and how to optimize outcomes with the use of these modalities. Participant Objectives: o Identify signs and symptoms of terminal disease processes. o Problem-solve clinical issues of life limiting conditions. o Identify common syndromes and barriers to adequate pain relief at the end of life 17 x Medical Screening for Oncology Issues in Outpatient Physical Therapy (1.5 hr) Presenters: Mary Lou Galantino PT, PhD, MSCE, Laura Gilchrist PT, PhD, Victoria Marchese PT, PhD, G. Stephen Morris PT, PhD, Kirsten Ness PT, PhD, MA, MPH, Meredith Wampler PT, DPTSc x The Role of Integrative Medicine in Physical Therapy for the Oncology Presenters: Carol M Davis DPT, EdD, MS, FAPTA, Catherine Goodman PT, MBA, CBP o Discuss both pharmacological and non-pharmacological approaches to symptom control. o Differentiate 5 clinical practice patterns in palliative and hospice care. o Explain cultural differences in dying rituals and grief responses. o Identify normal pediatric response behaviors to death. o Demonstrate the integration of spiritual care during the end of life. o Discuss legal, ethical and physiologic concerns around palliative sedation, withdrawal of food and fluid, and assisted suicide. o Describe advanced directives and their related components (power of attorney, living will, do not resuscitate orders. o Identify healthy personal and professional coping skills useful while working with the terminally ill. Participant Objectives: o Screen general outpatients for potential oncological disease. o Analyze a case report of an outpatient assessment for potential oncology “red flags”. o Describe the most common late-effects of cancer and its treatment. o Screen patients with a previous history of cancer for lateeffects of cancer and its treatment. o Determine appropriate referrals for oncology-related issues in both patients with and without a previous cancer diagnosis. Participant Objectives: o Give examples of body work, mind/body work, and energy work used with cancer patients. o Participants will gain an introductory understanding of BodyTalk and how it is used with cancer patients. 18 o Patient (3.5 hr) x New Opportunities in Physical Therapy: Creating a Hospice Based Physical Therapy Practice (3 hr) Presenters: Ilene Decker RN, PhD, Karen Mueller PT, PhD, JoEllen Thomson BS x Movement System Impairment Diagnoses Applied to the Breast Cancer Patient (2 hr) Presenter: Renee Ivens PT, DPT, MHS Participants will learn 4 basic BodyTalk techniques to use with anyone. o Participants will observe a BodyTalk session. Participant Objectives: o Discuss current and emerging trends in hospice care. o Discuss the interdisciplinary structure of a typical hospice setting. o Discuss the benefits of physical therapy participation in the hospice interdisciplinary team. o Discuss opportunities for physical therapy practice in a hospice setting. o Discuss and apply strategies for creating a physical therapy based hospice practice. o Describe the types of physical therapy interventions that can benefit patients in a hospice setting. o Discuss appropriate physical therapy outcome measure for use in a hospice setting. o Discuss evidence regarding physical utilization in a hospice setting. o Discuss research findings related to physical therapy outcomes in a hospice setting Participant Objectives: o Identify which tissues are involved in a patient’s movement dysfunction: soft tissue (muscle or joint capsule), neural structures, lymphatic system and how this assists in optimizing treatment o Discuss the Physical Stress Theory as related to postsurgical or radiated tissues o Describe the most common impairments in the movement patterns of the shoulder girdle in this population o Discuss the most common MSI Scapular and Humeral Diagnoses affecting patients who have received treatment for breast cancer 19 o x Multidisciplinary Rehabilitation Approach for the Treatment of Head and Neck Cancer-Related Impairments (3 hr) CSM 2009 x Preconference course (2 day): Physical Therapy Examination and Intervention for Breast Cancer Survivors Presenters: Melody OuYoung MS, CCC-SLP, Marisa Perdomo PT, DPT Presenters: Jacquelin Drouin PT, PhD, Charles McGarvey PT, DPT, MS, FAPTA, Lucinda Pfalzer PT, PhD, FACSM, FAPTA, Margaret Rinehart-Ayres PT, PhD, Nicole Stout MPT, CLT-LANA Describe intervention strategies for MSI Diagnoses of the scapula and humerus Participant Objectives: o Understand the medical diagnostic process and treatment of Head and neck cancers. o Evaluate and treat the complex musculoskeletal impairments and functional limitations most commonly experienced by this population. o Understand the musculoskeletal function of the head and neck during speech and swallowing activities and how PT interventions can compliment the speech and swallowing therapy. o Review and discuss appropriate orthopedic manual therapy techniques for individuals recovering from Head and Neck cancer. o Develop a short-term and long -term comprehensive multidisciplinary treatment approach for the individual recovering from Head and neck cancer treatments. o Develop and foster relationships with other rehabilitative health care professionals in order to optimize outcomes for individuals recovering from Head and Neck Cancer. o Educate and instruct the individual with Head and neck cancer in an appropriate manual lymphatic drainage home program for lymphedema. Participant Objectives o Describe sequelae of breast cancer treatment that may lead to impairments and functional limitations. o Assess patients for breast cancer specific impairments including; lymphedema, shoulder dysfunction, postural deviations, strength and ROM loss o Develop a treatment plan specific to breast cancerrelated impairments with consideration for treatment 20 side effects. Understand the indications, precautions and contraindication related to physical therapy interventions with patients who have a history of cancer. o Develop an understanding of the role of the physical therapist in pre-operative assessment and ongoing surveillance screening of patients with breast cancer in the absence of impairment. Participant Objectives: o Identify personal issues of loss related to end of life care. o Integrate issues of dignity and independence into their practice with declining patients. o Practice awareness of body sense, thoughts and emotions during clinical interactions o Describe three methods to enhance their growth while caring for the dying. o Recognize language of spiritual concerns voiced in patient care. Participant Objectives: o Describe and appreciate factors of prevention, screening, treatment, and rehabilitation of prostate cancer including differences across cultures. o Learn, reflect, and discuss current evidence on the use of exercise training in prevention and management of prostate cancer. o Evaluate and apply safe, effective exercise training guidelines for individuals with or at risk for prostate cancer. Participant Objectives: o Demonstrate confidence in performing a literature review on the computer including Hooked on Evidence and Open Door APTA’s portal to Evidenced-Based o x Being Present with Suffering, Loss, or Dying (2hr) Presenter: Richard Briggs PT, MA x Physical Therapy and Prostate Cancer (2 hr) Presenter: Jacquelyn Drouin, PT, PhD x Guiding the Clinical Physical Therapist into a New Role as Presenters: Mary Lou Galantino PT, PhD, MSCE, Loraine LovejoyEvans PT, DPT, CLT-Foldi, Lucinda Pfalzer PT, PhD, FACSM, 21 Researcher (4 hr) FAPTA, David Scalzitti PT, PhD, OCS x Physical Therapy Care Across the Practice Continuum for Patients with Colorectal Cancer (2 hr) Presenters: Meryl Roth Gersh PT, Robert Gersh MD x State of the Art Measurement Methodology for Evaluating Lymphedema (3 hr) Presenters: Minal Jain PT, DSc, PCS, Ellen Levy PT, BGS, OCS, Nicole Stout MPT, CLT-LANA x Orthopedic Presenter: Loraine Lovejoy- Practice Demonstrate improved confidence in reading the literature using critical thinking o Understand the basics of research design, data collection, and analysis o Maximize the ability to partner with an academic facility in their local area to promote outstanding research in the field of specialty in PT o Identify possible sources to secure funding Participant Objectives: o Review the current medical practice for the examination, evaluation, and comprehensive treatment of patients experiencing colo-rectal cancer. o Identify methods of prevention, early detection, and early medical management of colo-rectal cancer. o Describe the implications that the medical management of patients with colo-rectal cancer, including surgery, chemotherapy, and radiation, have for physical therapy care. o Explore the application of comprehensive physical therapy care across the practice continuum for a patient diagnosed with colo-rectal cancer. o Integrate the Guide to Physical Therapist Practice as one considers the comprehensive management of this patient. Participant Objectives: o Demonstrate an understanding of the pathophysiology of lymphedema. o Understand and identify the methods available for assessing lymphedema o Recognize novel evaluation tools available including perometry and bioelectrical spectroscopy as well as the science behind these technologies Participant Objectives: o 22 Rehabilitation: Improving Outcomes Using Lymphatic System Treatments and Home Program Instruction (3 hr) Evans PT, DPT, CLT-Foldi x Will I Be Able to Wear Heels to the Prom? Physical Therapy Assessment and Rehabilitation of Children with Osteosarcoma (2 hr) Presenters: Minal Jain PT, DSc, PCS, Michael Smith PT, MEd, Kieu-Phuong Thi Vu PT x Hemophilia 101 for Physical Therapists (1.5 hr) Presenters: Alice Anderson PT, MS, PCS, Sara Elizabeth Strawn PT, MSPT, OCS o Understand the anatomy, physiology, and pathophysiology of the lymphatic system o Describe the relationship between the circulatory and lymphatic system o Identify varying types of edema disorders and establish a treatment program to minimize swelling o Understand the benefits of reducing swelling in orthopedic disorders to enhance function and to decrease pain o Understand the philosophy and manual techniques of Lymphatic Mobilization and the relationship to improving function o Identify when it is appropriate to utilize lymphatic mobilization in the rehabilitation program o Maximize treatment sessions by instructing patients in a comprehensive self-care program. Participant Objectives: o Participants will gain knowledge in the diagnostic methods and medical management of children with osteosarcoma. o Participants will understand and identify the physical therapy needs of this population. o Participants will be exposed to assessments and therapeutic strategies to maximize a child’s functional outcome and quality of life. o Participants will understand how to use the “Guide to Physical Therapist Practice” when working with a child with osteosarcoma. Participant Objectives: o Define hemophilia and be knowledgeable of its inheritance, incidence and hematological values. o Describe the coagulation cascade in normal and hemophilic patients. o Know the red bleeding complications (red flags) of 23 x linical Update and Interdisciplinary Care: Rehabilitation Following Breast Cancer Surgery (3 hr) Presenters: Stephanie Caterson PT, Roya Ghazinouri PT, MS, Daniel Ovitt PT, Rebecca Stephenson PT, DPT, MS, Reginald Burns Wilcox III DPT, MS, OCS central nervous system, gastrointestinal system and musculoskeletal system. o Know the key factors to identify and treat acute, subacute and chronic hemathrosis/hemarthropathy and its sequelae. o Know the in key factors to identify and treat muscle bleeds and its complications. o Be knowledgeable in the history and current hemophilic factor replacement therapies. o Understand the role of exercise, fitness, and sportsin the hemophilic patient. o Be knowledgeable in the radiologic assessment of the Arnold-Hilgartner and Pettersson Classification of Hemophilic Arthropathy. o Describe the orthopedic surgical interventions for the hemophilic population arthroscopic synovectomy, radionuclide synovectomy, radial head resection and total joint replacements) and their outcomes. o Be knowledgeable of the comprehensive model of treatment for hemophilic patients and hemophilic treatment centers. Participant Objectives: o Demonstrate an understanding of the medical and surgical management for breast cancer treatment. o Identify common dysfunction following breast cancer surgery and adjuvant treatment. o Articulate the efficacy for exercise and therapy following breast cancer surgery. o Appreciate the potentially complex patient presentation following breast cancer surgery and the need for an interdisciplinary postoperative rehabilitation plan. o Illustrate why abnormal shoulder girdle mechanics occur following surgery for breast cancer. o Describe the rehabilitation principles for the shoulder 24 Regional Courses Offered by Oncology Section Courses scheduled for 2012 x Breast Cancer Rehabilitation (16 hr) Scheduled for: o March 31April 1, 2012 in Chapel Hill, North Carolina o May 19-20, 2012 in Iron Mountain, Michigan o September 29-30, 2012 in Edgewood, Kentucky x Exercise Training Guidelines for Individuals with Cancer: Endurance, Strength, Flexibility, and Varies 2008 Oncology Section Sponsored Courses Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Presenter: G. Stephen Morris, PT, PhD, FACSM girdle following breast cancer surgery and treatment. Design a comprehensive rehabilitation program for a patient following breast cancer surgery. Frequency: Annually, often Average attendance: 16-18 more than once a year; therapists per course, with Typically average of six six courses per year is approximately 96-108 courses offered per year therapists Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast cancer Discuss the need for physical therapist and patient advocacy in this population. Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise 25 Adherence (8 hr) Scheduled for: o March 24, 2012 in Jefferson City, Missouri o April 14, 2012 in Rockford, Illinois o October 13, 2012 in Tulsa, Oklahoma Courses in 2011: x Breast Cancer Rehabilitation Richland, Washington October 1-2, 2011 (16 hr) x Exercise Training for Cancer Survivors: Endurance, training Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum Describe the role of exercise in treating the cancer survivor o Presenters: Barbara Nicholson MSPT, CLT-LANA Presenter: G. Stephen Morris, PT, PhD Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast cancer o Discuss the need for physical therapist and patient advocacy in this population Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Understand how exercise training can improve functional 26 Strength, Flexibility, and Adherence Concord, New Hampshire October 1, 2011 (8 hr) x Second Annual Oncology Rehabilitation Symposium, Oakland University: Rehabilitation Across the Continuum of Care. Rochester, Michigan, August 23 and 25, 2011 (Online presentations) and August 27, 2011 (oncampus laboratory Presenters: Deborah Doherty PT, PhD, CEAS, Jacquelin Drouin PT, PhD, Janet Seidell PT, Reyna Colombo PT, MA, Marie-Eve Pepin PT, DPT, OMPT, Adhil Akhtar MD capacity, quality of life, and improve prognosis following a cancer diagnosis o Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Design and implement evidence based physical therapy oncology management methods for individuals in cancer survivorship across the continuum of care. o Incorporate effective functional training, manual techniques, lymphedema management, and aerobic exercise throughout the continuum of care. o Identify and manage symptoms and side effects of cancer and its treatments across the continuum of care. o Effectively communicate with multidisciplinary oncology rehabilitation team members including patients and caregivers, physicians, and nurses. o Evaluate and integrate effective administration practices across varied oncology settings. o Identify patient self-advocacy resources. o Critically appraise current evidence for practice. 27 x x x x session, 17.5 hr total) Walk, Run, Jump, and Thrive: Physical Therapy Assessment and Intervention for Children and Adolescents with Cancer Minneapolis, Minnesota May 13-14, 2011 (10 hr) Breast Cancer Rehabilitation, Farmingdale, New York April 2-3, 2011 (16 hr) Breast Cancer Rehabilitation, Richland, WA, October 1-2, 2011 (16 hr) Exercise Training for Patients Across the Cancer Spectrum: Testing, Prescription, and Presenters: Laura Gilchrist PT, PhD, Lynn Tanner PT Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Participant Objectives: o Describe the typical treatment regimen for children with leukemia, lymphoma, and solid tumors, including CNS tumors o Describe the current literature on CIPN in children and adolescents with non-CNS cancer o Describe the current literature on physical impairments and motor performance deficits in children with leukemia, lymphoma, and solid tumors o Discuss the pros and cons of different outcome measurements to use in these populations o Describe and demonstrate assessment and intervention techniques to address common physical impairments and motor performance deficits in children with leukemia, lymphoma, and solid tumors Participant Objectives: See same course above Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, MEd Participant Objectives: See same course above Presenter: G. Stephen Morris, PT, PhD Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Describe cancer diagnoses, cancer treatments, and side effects particularly as they relate to impairments o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following 28 Outcomes Assessment St. Joseph, Michigan January 16, 2011 (8 hr) Courses in 2010: x Breast Cancer Rehabilitation Exeter, New Hampshire November 13, 2010 (8 hr) Presenters: Barbara Nicholson MSPT, CLT-LANA, Nancy Roberge PT, DPT, Med x Presenter: G. Stephen Morris PT, PhD Exercise Guidelines for Individuals with Cancer a cancer diagnosis Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Describe techniques used to diagnose and surgically and medically treat cancer o Assess and treat the outcomes and impairments associated with treatment using an evidence-based approach o Discuss effective strategies for reducing the risk for lymphedema o Develop therapeutic treatment protocols, including patient education, manual therapy, and exercise program development o Develop strategies to include physical therapists in the critical pathway of treatment for the patient with breast cancer o Discuss the need for physical therapist and patient advocacy in this population. Participant Objectives: See same course above. o 29 x x Charlotte, North Carolina September 18, 2010 (7.5 hr) Exercise Guidelines for Individuals with Cancer, Concord, NH, October 1, 2011 (7.5 hr) First Annual Rehabilitation Symposium of Oakland University: Focus on Breast Cancer and Prostate Cancer Rochester, Michigan, August 26-28, 2010 (3 day conference) Courses in 2009: x Interventions for Cancer Patients and Cancer Survivors Portland, Oregon November 14-15, 2009 (11 hr) Presenter: G. Stephen Morris PT, PhD Presenters: Deborah Doherty PT, PhD, CEAS, Jacquelin Drouin PT, PhD, Janet Seidell PT, Reyna Colombo PT, MA, John Maltese MD Presenters: G. Stephen Morris PT, PhD, Andrea Leiserowitz MPT, CLT Participant Objectives: See same course above. Participant Objectives: o Design and implement evidence based physical therapy oncology management methods for individuals in cancer survivorship across the continuum of care. o Incorporate effective functional training, manual techniques, lymphedema management, and aerobic exercise throughout the continuum of care. o Identify and manage symptoms and side effects of cancer and its treatments across the continuum of care. o Effectively communicate with multidisciplinary oncology rehabilitation team members including patients and caregivers, physicians, and nurses. o Evaluate and integrate effective administration practices across varied oncology settings. o Identify patient self-advocacy resources. o Critically appraise current evidence for practice. Participant Objectives: o Explain the basic biology of exercise, cancer, and acute and adaptive responses to exercise o Describe cancer diagnoses, cancer treatments, and side effects particularly as they relate to impairments o Understand how exercise training can improve functional capacity, quality of life, and improve prognosis following a cancer diagnosis 30 o x Breast Cancer Rehabilitation: Implications in Physical Therapy Atlanta, Georgia April 4-5, 2009 (15.5 hr) Oncology Courses Sponsored by APTA Chapters PA x Courses DC Projected for Presenters: Charles McGarvey PT, DPT, MS, FAPTA, Nicole Stout MPT, CLT-LANA Presenter: Nicole Stout MPT, CLT-LANA Recognize and respond to adverse responses to exercise training o Appropriately modify exercise programs in response to acute patient status o Write exercise prescriptions for the oncology patient and survivor o Identify and use appropriate outcome measures in the oncology setting o Discuss safety concerns associated with exercising this patient population o Discuss the use of exercise training across the cancer spectrum o Discuss exercise interventions in the context of lymphedema and treatment-associated peripheral edema o Describe the role of exercise in treating the cancer survivor Participant Objectives: o Describe the basic cancer diagnosis, pathology and staging o Describe medical and surgical management commonly used in treating breast cancer o Choose and perform appropriate screening/systems review and tests and measures o Describe and choose interventions for common impairments seen in individuals at various stages of the disease process o Understand the need for appropriate modality selection and use based on the cancer history and/or treatment o Understand the importance of physical therapy intervention in a palliative care setting Participant Objectives: o Describe the cancer diagnosis, pathology, and staging 31 o 2013 (10-16 hr) x Courses Offered in 2012 (10-16 hr) AL SD Presenter: Nicole Stout MPT, CLT-LANA x Courses Offered in 2012 (10 hr) Colorado Presenter: Andrea Leiserowitz MPT,CLT Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise Attendance average: 30 Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise Attendance average: 40 Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various 32 stages of the disease process. Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment Order and describe precautions and contraindications for exercise o Regional courses offered outside the sponsorship of the Oncology Section Presenter: Nicole Stout MPT, x Cancer CLT-LANA Rehabilitation: An EvidenceBased Course for All Clinicians (20 hours, intermediate level course) Offered by: Great Seminars and Books, Inc. Physical Therapy for the Patient with Breast Cancer (16) Offered by programs, a company founded by the presenter to Presenter: Leslie Waltke PT Frequency: The course was offered 5 times in 2012, in Winston-Salem, Louisville, Green Bay, Nashville, and Portland, Oregon. It was also offered 5 times in 2011, in Palos Heights, Illinois, Oklahoma City, Dallas, Napa, California, and Richmond Virginia. Average attendance: 40-50, mostly physical therapists and some PTAs. Assuming 40 physical therapists at each of five courses, that would lead to a total attendance of 200 per year. Participant Objectives: o Describe the cancer diagnosis, pathology, and staging o Explain medical and surgical management of common cancer diagnoses o Choose and perform appropriate screening/ systems review and tests and measures o Design appropriate treatment interventions for common impairments seen in individuals at various stages of the disease process. o Discuss the need for appropriate modality selection and use based on the cancer history and/or treatment o Order and describe precautions and contraindications for exercise Frequency: Three times per year Attendance: Ranges from 10 to 40, primarily physical therapists for a total attendance of between 30 and 120 over the course of a year. Participant Objectives: o Describe basic cancer pathophysiology 33 offer evidence-based programs for health care professionals and survivors of cancer. Advanced Oncology Rehabilitation for Successful Outcomes (15-18 hours) Offered by: North American Seminars Presenter: Julia Osborne, PT, CMLDT o Describe cancer treatments including mechanisms of action and side effects o Perform a comprehensive evaluation of the cancer patient o Recognize and treat musculoskeletal dysfunctions of surgery, radiation, and reconstruction o Differentially diagnose and treat pain syndromes o Set up a comprehensive post operative home exercise program o Develop a rehabilitation program to combat side effects of chemotherapy and radiation o Teach infection and lymphedema risk reduction techniques Frequency: Course is scheduled for five offerings in 2012. The course comes with an optional software program designed for professionals who are starting a lymphedema program. Average attendance: 30, 80-90% physical therapists, for a total yearly attendance of approximately 150. Participant Objectives: o Describe cancer pathogenesis and how it is shaping environmental awareness and changing cancer management globally. o Discuss the clinical management of breast cancer, head and neck cancer, prostate cancer, ovarian cancer, melanoma, leukemia, and lymphoma. o Understand new advancements in cancer treatment: chemotherapy, targeted therapy, radiation therapy, immunotherapy and hormone therapy. o Discuss the clinical implications of myelosuppression, cancer related fatigue, cardiotoxicity, hormone changes and cognitive changes in patients undergoing cancer treatment. o Develop safe and appropriate oncology exercise 34 Advanced Management of Breast Cancer Rehabilitation (15 hours) Offered by: North American Seminars Presenter: Julia Osborne, PT, CLT-LANA programs according to the guidelines, clinical tests and screening systems presented in the course. o Perform specialized manual therapy skills for the post surgery and radiation management of patients with cancer (upper extremities, trunk, and lower extremities). o Utilize the appropriate modalities based on cancer history and areas of treatment. o Design appropriate inpatient and outpatient programs with the consideration of program goals, referral and intake processes and discharge criteria. Frequency: Course is scheduled for six offerings in 2012. Average attendance: 30, 80-90% physical therapists, for a total yearly attendance of approximately 180. Participant Objectives: o Understand the anatomy of breast cancer cells, their functional capabilities, and how modern medicine is responding in its design to treat breast cancer effectively. o Expand clinical knowledge about differential diagnoses, treatment side effects, and physical sequelae of chemotherapy, radiation therapy, and targeted hormone therapies. o Advance understanding of the biology and physiology of the acute trauma that occurs to the lymphatic system after surgery and radiation therapy, and how this affects the normal healing processes in the body. o Understand the difference between treating “lymphedema” as a condition, and the advanced concepts of treating acute trauma of the “lymphatic system” as it relates to other body systems in the healing processes of surgery, radiation, and chemotherapy. o Advance and integrate manual lymphatic drainage skills with orthopedic manual therapy skills to include system management of the musculoskeletal system, the nervous 35 o o o o system, the vascular system, the lymphatic system, and the endocrine system during and post breast cancer treatment. Understand complex co-morbidities and adverse treatment complications of breast cancer, how they affect the healing capacity of patients, and how treatment can be structured to minimize their effect. Identify clearly the specific clinical goals of specialized manual therapy skills and targeted exercise protocols for patients undergoing advanced forms of breast surgery, new chemotherapy treatments, and/or targeted radiation therapy so as to achieve optimal function, as well as sustainable treatment results. Have increased knowledge about advances in breast cancer diagnoses, advances in breast cancer management, and advances in breast cancer research. Gain and advance leadership skills in the continuum of care and mulit-disciplined approach to the management of patients with breast cancer. Lymphedema Management Courses/ Training programs Complete Presenters: Steve Norton CLTFrequency: Course is scheduled for 20 offerings in 2012. Decongestive LANA, Andrea Cheville MD, Average Attendance: 18-20 therapists Participant Objectives: Therapy Certification Nicole Stout MPT, CLT-LANA, John Beckwith PT, CLT-LANA, Joy o Differentiate between a variety of peripheral edemas course (135 hr; Cohn, PT, CLT-LANA o Understand the applications, medical indications, and participants receive a contraindications of MLD and CDT. 5 DVD set) Offered by: Norton o Establish a CDT treatment plan for individuals with School of Lymphatic primary or secondary lymphedema and perform the Therapy indicated treatment. o Perform the four components of CDT (manual lymph drainage, compression therapy, exercise, skin care) e – Integrative Presenters: Guenter Klose, Frequency: The course is scheduled for 12 offerings in 2012. Lymphedema Kathleen Francis MD, Linda Average Attendance: 18-20 therapists Certification Course Roherty PT, CLT-LANA, Jody Participant Objectives: 36 (135 hr, 45 hr of which is an internetbased home study course. Participants receive DVDs, software, and a manual.) Offered by: Klose Training and Consulting Basic MLD Certification course (48 hr; participants receive a manual) Offered by: Norton School of Lymphatic Therapy Winicour PT, CLT-LANA, Jan Weiss PT, DHS, CLT-LANA, Julia Rodrick OTR/L, WCC, CLT-LANA, Joanne McGillicuddy PT, CLTLANA, Chris Cobb PT, CLT-LANA, Leslyn Keith MS, OTR/L, CLTLANA, Heidi Miranda-Walsh OTR/L, CHT, CLT-LANA, Elizabeth Camp PT, MHS, CWS, CLT-LANA, Rene Janiece LMT, CLT, Ruth Coopee, OTR, CLT. Presenters: Steve Norton CLTLANA, Andrea Cheville MD, John Beckwith PT, CLT-LANA, Joy Cohn, PT, CLT-LANA o o o o Demonstrate four components of Complete Decongestive Therapy. Differentiate between a variety of peripheral edemas Understand the application, medical indications and contra-indications for MLD and CDT. Establish a CDT treatment plan for individuals with primary and secondary lymphedema and perform the treatment for lymphedema accordingly. Frequency: 2012 schedule is not available on line at this time Average Attendance: Participant Objectives: o Demonstrate an understanding of the anatomical features and terminology of the functional lymphatic system o Demonstrate comprehension of information related to normal lymphatic physiology and the differences encountered in a diseased state o Demonstrate an understanding of the proper clinical applications of MLD (indications) o Demonstrate an understanding of the improper clinical applications of MLD (contraindications) o Demonstrate an understanding of clinical applications where caution should be exercised (precautions) o Perform techniques consistent with proper Vodder-style MLD and memorize the sequences for all body areas of the intact lymphatic system o Demonstrate the ability to customize treatment strategies for various pathologies where MLD is indicated o Demonstrate the ability to employ MLD on primary and secondary lymphedema patients (medicallyuncomplicated, physician prescribed treatment) 37 Basic MLD Certification course (45 hr) Offered by: Klose Training and Consulting Presenters: Guenter Klose, Kathleen Francis MD, Linda Roherty PT, CLT-LANA, Jody Winicour PT, CLT-LANA, Jan Weiss PT, DHS, CLT-LANA, Julia Rodrick OTR/L, WCC, CLT-LANA, Joanne McGillicuddy PT, CLTLANA, Chris Cobb PT, CLT-LANA, Leslyn Keith MS, OTR/L, CLTLANA, Heidi Miranda-Walsh OTR/L, CHT, CLT-LANA, Elizabeth Camp PT, MHS, CWS, CLT-LANA, Rene Janiece LMT, CLT, Ruth Coopee, OTR, CLT. Lymphedema Management of the Upper and Lower Extremities (23 hr) Offered by: North American Seminars Presenter: Elizabeth Augustine PT, DPT or Julia Osborne PT, CLT-LANA Frequency: The course is scheduled for 6 offerings in 2012. Average Attendance: 18-20 therapists Participant Objectives: o Demonstrate an understanding of the anatomy and the relevant scientific terminology related to the lymphatic system o Demonstrate an understanding of the differentiation between the normal and diseased states of the lymphatic system (physiology and pathophysiology of the lymphatic system) o Demonstrate an understanding of the indications and contraindications related to the use of MLD o Competently perform the techniques of MLD for all body areas o Develop appropriate treatment strategies for indications such as post-surgical edema, post-traumatic edema, fibromyalgia, general detoxification and other conditions o Competently perform MLD on clients after breast surgery for cancer (clients at risk to develop lymphedema) o Competently perform MLD on clients with mild, medically uncomplicated, primary or secondary lymphedema Frequency: This course is scheduled to be offered three times in 2012. Average attendance: 30, primarily physical therapists for a total yearly attendance of 90. Participant Objectives: o Demonstrate an understanding of the anatomy and physiology of the lymph system o Describe the pathophysiology of lymphedema and pathogenesis of common upper extremity and lower extremity lymphedema. o Understand the common diagnostic procedures for 38 lymphedema. Recognize, assess, and treat the different classifications of upper extremity and lower extremity lymphedema o Perform proper massage techniques to enhance lymphatic flow and explain the physiologic rationale for lymph drainage massage. o Correctly apply short stretch compression bandages in the treatment of upper extremity and lower extremity lymphedema. o Perform limb measurements that provide acceptable documentation of outcome measures. o Instruct patients and health care professionals in precautions and skin care. o Choose the appropriate compression garments and instruct patients in correct application. o Develop appropriate individualized treatment programs for successful functional outcomes. Frequency: Course is scheduled for six offerings in 2012. Average attendance: 30, 80-90% physical therapists, for a yearly total of 180. Participant Objectives: o Understand the anatomy and physiology of the lymphatic system and how to use the anatomy to its best advantage in performing effective lymphatic drainage in complex patients with aggressive and advanced lymphedema, lipedema, and primary lymphedemas. o Advance and integrate lymphatic drainage skills with neuro-musculo-skeletal orthopedic skills to create increased efficiency and greater success in treating patients with UE complications, LE complications, head and neck complications, groin and genital complications, and abdominal and trunk complications. o Demonstrate the ability to use the hands-on advanced techniques taught in this seminar to treat patients with o Advanced Management of Lymphedema (15 hr) Offered by: North American Seminars Presenter: Julia Osborne, PT, CLT-LANA 39 o o o o o On-Line Courses, Other Media-based Courses Educata: Foundation of Oncology for Physical Therapists (2.5 hr. This is a beginner level course designed Author/Presenter: Marisa Perdomo, PT, MSPT, DPT, CLTFoldi, CES co-morbidities such as chronic thrombosis, diabetes, CHF, auto-immune diseases; and patients with complications of lymphedema such as seromas, hematomas, severe fibrosis, axillary web syndrome, and Mondor’s syndrome. Have a more in-depth understanding of the acute trauma that occurs to the lymphatic system after surgery and radiation therapy so as to broaden treatment protocols and implement early intervention. Have the knowledge and tools necessary to shift mindset from treating “lymphedema” as a condition to treating the “lymphatic system” as it relates to other body systems during periods of acute trauma – a necessary step towards progressive thinking in twentieth century medicine, and in the future development of evidencebased research. Develop advanced critical thinking skills and clinical decision-making skills in the management of patients with lymphedema and all associated co-morbidities and complications. Expand knowledge base about bandaging, compression, kinesiotape, and additional products on the market; and know how and when to apply advanced management products to patients. Gain and advance leadership skills in the continuum of care and multi-disciplined approach to the management of complex patients Attendance: Over 180 Individual users since inception Participant Objectives: o Understand, define, discuss and educate others in the scientific foundational principles regarding: o The pathogenesis of cancer o The diagnosis and prognosis of cancer 40 o o to provide a solid foundation for oncology practice.) APTA Learning Center: x CSM10: Medical Screening for Oncology Issues in Outpatient Physical Therapy (2 hr) Author/Presenters: Mary Lou Galantino, PT, PhD, MSCE, Laura Gilchrist, PT, PhD, Victoria Marchese, PT, PhD, G. Stephen Morris, PT, PhD, Kirsten Ness, PT, MA, MPH, PhD, Meredith Wampler, PT, DPTSc CSM11: Measuring Outcomes in Oncology Rehabilitation (3 hr) Authors/Presenters: Mary Lou Galantino, PT, PhD, MSCE, Laura Gilchrist, PT, PhD, Victoria Marchese, PT, PhD, G Stephen Morris, PT, PhD, Kirsten Ness, PT, MA, MPH, PhD, Meredith Wampler, PT, DPTSc The growth or spread of cancer Medical intervention strategies for the treatment of cancer o Search medical Web sites regarding specific cancer diagnoses and treatments to obtain the specific information needed for a physical therapist to perform an initial evaluation. o Utilize the scientific principles regarding cancer to determine the role of physical therapy for individuals with cancer. Attendance: Over 60 individual users since inception Participant Objectives: o Screen general outpatients for potential oncological disease o Analyze a case report of an outpatient assessment for potential oncology 'red flags o Describe the most common late-effects of cancer and its treatment o Screen patients with a previous history of cancer for lateeffects of cancer and its treatment. o Determine appropriate referrals for oncology-related issues in both patients with and without a previous cancer diagnosis. Attendance: Over 80 individual users since inception Participant Objectives: o Describe common impairments, limitations, and participation restrictions found in the oncology rehabilitation population. o Describe issues related to the selection of appropriate outcome measures. o Select appropriate outcome measurements for various issues related to oncology rehabilitation. o Illustrate, through the use of case studies, the 41 PT 2011: Manual Therapy for the Oncology Patient (3 hr) Author/ Presenter: Lisa Massa, PT, WCS, CLT-LANA PT10: Physical Therapy Management of Children With Cancer (3 hr) Authors/ Presenters: Colleen Coulter-O'Berry, PT, DPT, PhD, MS, PCS, Kirsten Ness, PT, MA, MPH, PhD, Durga Aman Shah, PT, DPT, PCS, Claire F. McCarthy, PT appropriate selection of outcome measures in oncology rehabilitation. Attendance: Over 30 individual users Participant Objectives: o Review, discuss, and apply the proper indications and contraindications for manual therapy for the patient with cancer. o Discuss the impact of surgery, chemotherapy, and radiation treatments on the musculoskeletal and lymphatic systems. o Synthesize the relevant literature associated with manual therapy and individuals with cancer, with emphasis on mobilization/manipulation techniques and therapeutic exercise of the musculoskeletal and lymphatic systems. o Integrate relevant dysfunctional biomechanical and neurophysiologic findings with appropriate manual therapy interventions for patients with breast cancer and/or head and neck cancer. o Identify oncologic emergencies that may initially appear as musculoskeletal problems. Attendence: Over 40 individual users Participant Objectives: o Consider the process of screening and differential diagnosis for children with signs and symptoms related to brain tumors, leukemia, bone marrow transplants, and solid bone tumors. o Review the pathophysiology of selected diagnoses. o Establish the patient/client management plan for various pediatric diagnoses. o Discuss practice management across the continuum of care available in pediatric settings. o Develop discharge plans and referrals to other practice settings as appropriate. 42 CD-ROM: Audio-Plus Home-Study Course: Cancer Rehabilitation: Principles and Practice Author/ Presenter: Charles L. McGarvey, PT, DPT, MS, FAPTA Average Attendance: over 150 individual users since inception Participant Objectives: o Define terminology associated with Cancer o List statistics related to incidence, mortality, and morbidity o Identify basic metastatic process o List primary antineoplastic strategies and their sequelae o Identify general principles of cancer rehabilitation o Describe the purpose of the physical therapy impairment diagnosis o Name the most common risk factors for cancer o Identify the systems most often affected by cancer metastasis o Describe the corresponding clinical manifestations of each system affected by cancer metastasis o List clinical signs and symptoms corresponding to paraneoplastic syndromes 43