annual report 2013-2014
Transcription
annual report 2013-2014
Moving with the Nation NATIONAL INSTITUTE OF MENTAL HEALTH AND NEURO SCIENCES An Institute of National Importance BANGALORE - 560 029 ANNUAL REPORT 2013-2014 NIMHANS An Institute of National Importance T he National Institute of Mental Health and Neuro Sciences (NIMHANS) is a multidisciplinary Institute for patient care and academic pursuit in the field of mental health and neurosciences. NIMHANS is synonymous with providing high standards of clinical care, quality training and cutting-edge research in frontier areas of the brain and mind. The Institute, with its philosophical underpinning of an integrated and multidisciplinary approach and its cognizance of societal needs, has prioritised its objectives as providing comprehensive patient care, manpower development and research. At the institute, advances in genomics, computational neuroscience, mathematical modelling, neuroimaging, molecular biology and a host of new disciplines including public health are being translated to help society and also promote the growth of knowledge. Ever since its inception, a special feature of this Institute is combining research and training with promotive, preventive and curative aspects of clinical services in Mental Health and Neurosciences. This ethos continues to the present day. NIMHANS represents a unique model of a successful partnership between the Union and State Governments (Ministry of Health and Family Welfare, Prof. M.V. Govindaswamy Founder Director 1954 - 1961 Government of India and the Government of Karnataka). The manpower development programmes at NIMHANS reflect the extent to which the Institute has succeeded in integrating and nurturing disciplines such as behavioural sciences, neurosciences, basic biological sciences and ancient health systems under one roof. The Institute frequently provides advice to the Central and State Governments in the matter of policies and strategies for mental health care, evolving the national programme for mental health and improving psychiatric facilities in the country. The Institute has also emerged as the nodal centre for evolving national policies in the field of mental health, neurosciences and injury. NIMHANS is today a centre for excellence in the country for mental health and neuroscience. The institute has produced more than 1,000 Psychiatrists, about 600 Clinical Psychologists and Psychiatric Nurses so far. Alumni from NIMHANS are spread across the country and the world. Recognising its eminent academic position, and the growth in size and stature, the central government declared NIMHANS a ‘Deemed University’ in 1994 and in 2012 NIMHANS has become an ‘Institute of National Importance’. Vision To be a world leader in The area of MenTal healTh and neurosciences and evolve sTaTe-of-The-arT approaches To paTienT care Through TranslaTional research Mission Establish the highest standards of evidence-based care for psychiatric and neurological disorders and rehabilitation Develop expertise and set standards of care for diseases of public health relevance in the developing world Work with the government and provide consultancy services for policy planning and monitoring strategies in the field of Mental Health and Neurosciences and facilitate execution of national health programme. Human resource capacity building by training in diverse fields related to Mental Health and Neurosciences. Develop and strengthen inter-disciplinary, interinstitutional and international collaboration with universities and research institutes across the globe to foster scientific research, training in advanced technology and exchange of ideas in the areas of Mental Health and Neurosciences. Strive to enhance equitable accessibility of primary care in Mental Health and Neurological Disorders to all sections of society and ages including the vulnerable population Evolve and monitor the strategies for disaster management and psycho-social rehabilitation in different cultural and ethnic groups. Promote Mental Health literacy and eliminate the stigma attached to the Mental and Neurological illnesses by taking the measures and the delivery system to the centres of primary health care honouring the human rights and dignity Integrate allopathic and oriental medicine into health care delivery and promote evidence-based research Integrate physical and metaphysical aspects of Neuroscience research to promote yoga and its application to positive mental health. Participate in broad field of Neuroscience and Behavioral Research applicable to human ethics, organ transplantation, stem cell research, space science, and nuclear science. Special Officer Biostatistics Neurophysiology Biophysics Neuromicrobiology Psychopharmacology Psychiatric Social Work Psychiatry Health Education Clinical Psychology Neurovirology AAO (DP&NR) Neurosurgery Child & Adolescent Psychiatry Nursing Psychiatric & Neurological Rehabilitation Neuropathology Neurology Casualty Medical Officer Speech Pathology & Audiology NI & IR AAO (OPD) AAO (Hospital) Medical Superintendent Hospital Services Resident Medical Officer Neuroanaesthesia Neuro Sciences Epidemiology Behavioural Sciences Deans Academics Neurochemistry Basic Sciences Human Genetics AAO AAO AAO AAO (Stores) (Personnel) (Coordination) (Projects) Administrative Officer Registrar Administration DIRECTOR / VICE-CHANCELLOR Organogram AAO AAO (Accounts) (Claims) Accounts Officer DFA FA & CAO Finance & Accounts National Institute of Mental Health and Neuro Sciences Internal Audit The members of the new Institute body during their first meeting on 5 February 2014 From the Director’s Desk........................................................................................................... 9 Awards, Honours and Key Assignments ............................................................................. 29 Visitors to NIMHANS................................................................................................................ 39 Patient Care Activities............................................................................................................... 45 Human Resource Development.............................................................................................. 64 Conference /Symposia/Workshops I. Scientific Programs Organised at NIMHANS ............................................................... 74 A. International.......................................................................................................... 74 B. National ................................................................................................................. 74 II. Scientific Programs Organised Outside NIMHANS...................................................... 83 A. International..........................................................................................................83 B. National .................................................................................................................83 III. Specific Training Underwent by Faculty / Staff.............................................................89 Central Facilities..........................................................................................................................91 Research Activities Biophysics............................................................................................................................. 106 Biostatistics............................................................................................................................110 Child and Adolescent Psychiatry ...........................................................................................111 Clinical Neurosciences........................................................................................................... 113 Clinical Psychology................................................................................................................114 Epidemiology.........................................................................................................................133 Human Genetics ....................................................................................................................136 Neuroanaesthesia...................................................................................................................137 Neurochemistry......................................................................................................................139 Neuro Imaging and Interventional Radiology (NIIR)..........................................................146 Neurological Rehabilitation.................................................................................................. 148 Neurology...............................................................................................................................149 Neuromicrobiology................................................................................................................154 Neuropathology.....................................................................................................................154 Neurophysiology ...................................................................................................................161 Neurosurgery.........................................................................................................................177 Neurovirology........................................................................................................................179 Nursing ............................................................................................................................. 182 Psychiatry ..............................................................................................................................185 PsychiatricSocialWork ........................................................................................................195 Psychopharmacology ............................................................................................................197 SpeechPathologyandAudiology ........................................................................................ 198 Ayurveda ............................................................................................................................. 198 Publications A. InternationalJournals ................................................................................................. 201 B. NationalJournals .........................................................................................................217 C. BookChapters/ConferenceProceedings..................................................................... 226 D. Monographs/Manuals/Reports .................................................................................. 233 E. Newsletters/Souvenirs ................................................................................................ 234 F. ArticlesforGeneralPublic/IECMaterials ................................................................ 235 G. BooksPublished .......................................................................................................... 237 Contributions to Scientific Deliberations A. PresentationsinInternationalConferences ............................................................... 239 B. PresentationsinNationalConferences .......................................................................248 C. ResourcePersons ......................................................................................................... 277 D. Radio/TV/Phone-inProgrammes ...............................................................................282 Public Lectures .........................................................................................................................284 Statutory Bodies .......................................................................................................................288 Faculty and Staff ......................................................................................................................302 Finance and Accounts..............................................................................................................311 Homage ............................................................................................................................. 345 From The Director’s Desk NIMHANS, as a multidisciplinary Institute in the field of mental health and neurosciences, has three guiding principles±p atient care, manpower development and research, and we have been following these with commitment and passion. The Institute continues to figure prominently in public discourse and policy advice at the national and international levels. NIMHANS was declared an Institute of National Importance by an act of Parliament. After Presidential assent, the NIMHANS bill was gazetted in September 2012. The first Institute Body meeting was convened on 5 February 2014 and was presided over by Shri. Ghulam Nabi Azad, Hon’ble Union Minister for Health and Family Welfare, Government of India. With the formation of the Institute Body and other statutory committees, NIMHANS is making sincere efforts to live up to the mandate given to it. With high standards of clinical care, quality training and cutting-edge research, NIMHANS is poised to deliver a more vibrant healthcare delivery system in the years to come. I am glad to present the Annual Report of NIMHANS and the audited statement of accounts for the year 2013±2014. Dr. P. Satish Chandra Director/Vice-Chancellor Annual Report 2013-14 1. PATIENT CARE SERVICES NIMHANScontinuedtoprovidecomprehensivequalitypatient care services, guided by knowledge and enabled by skill, in thefieldsofmentalhealthandneurosciences.Duringtheyear 2013-14, nearly 4.7 lakh patients from various parts of the countryandacrossthe globereceivedmedicalcare. The patient care services primarily reach out to the needy (Below Poverty Line) and under-privileged sections of our society.Aboutthree-fourthsofthepatientswereprovidedwith qualityservicesatnocostorathighlysubsidizedrate.Specialist clinics and various rehabilitation services and programmes were offered to render focused and targeted specialty care duringtheyearunderreview. Particulars Screening Registrations Follow-ups Admissions Discharges Casualty&EmergencyCare Deaths Extension Services* Total 2012-13 1,01,816 54,850 2,08,978 15,397 13,877 28,368 720 27,394 436,803 2013-14 1,06,227 56,606 2,18,596 16,631 15,048 38,516 741 30,041 466,617 *= Gunjur – 2185, Gowribidanur – 5876, Maddur- 2937, Kanakapura- 2831, Madhugiri3431, Sakalawara- 12232, Turuvekere- 549 2. HUMAN RESOURCES DEVELOPMENT 2.1 Academic programmes NIMHANS has always been known for its academic zeal, innovations in training in the fields of mental health and neuroscienceanditsresearchoutput.Duringtheyear,16medical professionalscompletedPost-DoctoralFellowshipindifferent specialities (Child & Adolescent Psychiatry-1, Acute Care and Emergency Psychiatry-1, Addiction Medicine-3, Clinical Neurosciences&TherapeuticsinSchizophrenia-1,Community MentalHealth-1,ConsultationLiaisonPsychiatry-2,Obsessive CompulsiveDisorder&RelatedDisorders-1,Neuroinfections-1, Neurology (Movement Disorders)-1, Neurological Rehabilitation-2, Neuropathology-2), and 36 completed PhD (Clinical Psychology-9, Neurochemistry-4, Neurological Rehabilitation-1, Neurophysiology-6, Neurovirology-2, Nursing-2, Psychiatric Social Work-8, Psychiatry-3, Speech Pathology & Audiology-1); 160 candidates were declared qualified to receive degrees in various specialties: DM (Neurology),MCh(Neurosurgery),DM(Neuroradiology),MD/ Diploma(Psychiatry),MPhil,MSc,BScDegreesandDiplomain Nursing.Atotalof3795studentsfromvariousotherinstitutes - from India and abroad - visited NIMHANS and underwent trainingduringtheyear. Sl. No. Course Postgraduate degree/diploma and undergraduate a) Joined the Institute during the year 2013-14 b) Completed and declared qualified duringtheyear2013-14 Ph.D. a) Joined the Institute during the year 2013-14 b) Completed and declared qualified duringtheyear2013-14 Post-Doctoral Fellows Short-term training (from outside institutions) Total No. of Students 247 160 42 36 16 3795 NIMHANS has signed a Memorandum of Understanding with UniversityofLiverpoolfordualPh.Dprogramme.Tobeginwith, acandidatefromtheUniversityofLiverpoolhasbeenselected andregisteredunderthenewprogramme.Toincreasethepublic healthcompetenciesofmedicalofficers,atwo-year‘Mastersin PublicHealth’(MPH)hasbeenstartedfromtheacademicyear 2013-14andFellowshipinDisasterManagement&Psychosocial Rehabilitation—a first of its kind in the country—has been initiated,inwhicheightcandidatesfromalloverthecountrywill betrainedeveryyear. 2.2 Capacity building and strengthening human resource development The mandate of NIMHANS is to catalyse, facilitate capacity building and strengthen human resource development in different health care delivery systems. NIMHANS is actively committed to imparting advanced technical knowledge to medical, para-medical and nursing professionals to promote skills and evolve employable manpower to meet the needs of thenation.Inadditiontotheshort-termtrainingprogrammes, facultyandstaffatNIMHANSroutinelyparticipateinseminars, workshops, conferences and other academic endeavours both withinandoutsidetheInstitute. During the year, NIMHANS hosted several international and national scientific conferences. The faculty of the Institute 10 / National Institute of Mental Health and Neuro Sciences Annual Report organised 339 educational/ resourceful events (workshops / symposia / conferences: 212 at NIMHANS and 127 outside the Institute). A total of 24 faculty members have undergone focusedtrainingtoexpandtheirknowledgehorizon.NIMHANS hosted various international and national scientific events including7thCongressofAsianSocietyforChildandAdolescent Psychiatry & Allied Professions and 12th Biennial Conference ofIndianAssociationforChildandAdolescentMentalHealth (27 September 2013), 3rd International Annual Conference of the Society for Mitochondrial Research and Medicine- MitochondriainHealthandMedicine(19-20December2013), International Colloquium on Drug Resistant Epilepsy (16-18 August2013),MDS-sponsoredParkinson’sDiseaseEducation Program 2014 on Understanding Parkinson’s Disease: From Clinics to Basics (5-7 March 2014). The details of the other scientific deliberations and conferences organised by the Instituteareprovidedseparatelyintherespectivesection. Several of the research initiatives at NIMHANS have been inter-institutionalandmulti-disciplinaryinnature.Thethrust areas of research continue to be: a) unraveling the molecular and sub-cellular mechanisms for disease process, b) linking clinicalstatuswithstructural,biochemical,immunologicaland serologicalabnormalitiessearchingforbiomarkers,c)exploring genetic basis for disease causation, d) developing prognostic andclinicalpredictorsanddiagnosticinventory/checklists. 4. NEW INITIATIVES – NEW FACILITIES 4.1 Memorandum of Understanding (MoU) 1. NIMHANSrenewedtheMemorandumofUnderstanding with ‘Institute of Bioinformatics’, Bangalore, on 12 July 2013topromotejointresearchandacademicactivitiesin theareasofmutualinterestbetweentheinstitutionsfora furtherperiodofthreeyears. 2. Led by Prof. P. Satish Chandra, Director/ViceChancellor, the NIMHANS team consisting of Dr. V. Ravi, Registrar, Dr. Vivek Benegal, Prof of Psychiatry andDr.AnitaDesai,Addl.Prof.ofNeurovirologyvisited the University of Liverpool (3-7 September 2013) and signed a Memorandum of Understanding for dual PhD programme. 3. The Memorandum of Understanding with Richmond Fellowship Society (RFS) India has been renewed. Dr. Kalyanasundaram, Chief Executive Officer, RFS - India visited NIMHANS and signed the document on 15 October2013. 4. TheDirectorofCBIandtheDIGvisitedNIMHANSand signedaMOUwiththeInstituteon26November2013. TheMOUenvisagesprovidingtrainingtothestaffofCBI bytheDepartmentofClinicalPsychology,NIMHANSin the process of interrogating the accused and witnesses usingpsychologicalprinciples. 3. RESEARCH Facilitatinghigh-qualityandtranslatableresearchandproviding leadership for national policy have been the hallmarks of NIMHANS.Duringtheyear2013-14,NIMHANSsteppedupits researchactivitieswithvariousnewprojectsandinitiatives.A totalof767scientificarticles/communicationswerepublished (357articlesinInternationalJournals,216inNationalJournals, and 194 other publications including monographs, manuals, chaptersinbooks,articlesinnewspapers,etc.). 900 Other Publicaons Naonal Journals 800 Internaonal Journals 700 600 566 534 500 457 214 400 300 142 626 582 118 119 203 197 199 227 2007-08 2008-09 2009-10 2010-11 216 183 200 100 194 208 194 164 117 767 174 191 248 Total 742 PUBLICATIONS 340 357 2012-13 2013-14 269 0 80 Total amount (INR crores) 70 2011-12 Amount Per annum (INR crores) Total no. of projects 289 RESEARCH PROJECTS 60 30 128 57 0 32 93 48 42 200 199 136 137 20 10 300 250 50 40 350 115 150 69 60 100 9 10 10 14 16 21 26 07-08 08-09 09-10 10-11 11-12 12-13 13-14 25 50 0 2013-14 4.2 Enhanced Patient Care Services 1. NIMHANShassuccessfullyimplementedacomprehensive computerizedon-linee-HospitalSolutionincollaboration with National Informatics Centre, Bangalore. Apart from online activities (like ordering of investigations, generation of laboratory reports, generation of case summary,etc.),thee-Hospitalofferspatientregistration andbillingmodules(integratedwithprescriptionmodule National Institute of Mental Health and Neuro Sciences / 11 Annual Report 2013-14 on26December2013.Prof.P.SatishChandra,Director/ Vice-Chancellor,NIMHANS,inauguratedtheoutlet.This outletisforsellingtheconsumablesusedinthevarious DepartmentsofClinicalNeurosciences.Theoutletwould provide these items at affordable price to the needy patients. andpharmacyoperations)makingitthefirstofitskindin amedicalinstitutioninthepublicsector. 2. 3. 4. The Department of Neurovirology and the Department of Neurochemistry have successfully obtained the NABL accreditation (ISO 15189) for the scope of their variousdiagnosticservicesin2013.TheDepartmentsof NeuromicrobiologyandNeuropathologyhavecompleted theprocessofapplicationandassessmentbyNABLandare awaitingaccreditation.Thisisasignificantachievement forNIMHANSasthese aretheonlylaboratoriesamong the other Institutes of National Importance to have securedtheNABLaccreditation. To cater to elderly CGHS beneficiaries with cognitive deficits and for further evaluation and intervention, NIMHANShasstartedascreeningprogrammeatthe10 CGHSWellnessCentresacrossBangalore. New premises of the Department of Speech Pathology & Audiology (approximately 9200 sq.ft. in area) was inauguratedbyShri.S.K.Srivastav,AdditionalSecretary and Financial Advisor, Ministry of Health & Family Welfare, Government of India, on 20 June 2013. The Department now has two sound-proof rooms for audiometric evaluation and separate labs for Evoked Potential,OtoacousticEmissionandImpedanceStudies. Thisisinadditiontoindividualofficespaceforeachofthe facultymembers.Thisfacilityhas14roomsforevaluation and management services. Group-therapy Program for stutterers has been initiated from 1 March 2014 and is heldoneverySaturday(intheafternoon). 5. A new ‘Step-Down Ward’ with 12 beds on the first floor of Ashwini Block, NIMHANS was inaugurated by Dr. Sharanaprakash R. Patil, Honourable Minister of State for Medical Education, Govt. of Karnataka and VicePresident,NIMHANS,Bangalore,on8October2013. 6. The Community Psychiatry Team started the TelePsychiatry/Tele-MedicineservicesalongwiththeCentral Relief Committee (CRC), Bangalore from October 2013. The CRC is primarily a protected shelter home for the homeless people. With Tele-Psychiatry services, the Community Psychiatry Team attends to about 20-25 patients/week. So far, about 250 patients have received mentalhealthcarethroughthisportal. 7. 8. Thestate-of-the-artMagneto-Encephalo-Graphy(MEG), suppliedbyMs.ElectaofSweden,hasbeeninstalledand isreadyforinauguration. Thisisthe firstofitskindin thecountry,withaprovisionforco-registrationofMRI, CT,PETScandataalongwithEEG/VideoEEGdataand the MEG data. This would significantly facilitate the comprehensiveepilepsysurgeryprogrammeandresearch inNeuroPsychiatryatNIMHANS. 9. To improve the quality of services to the patients, the Department of Neuroimaging and Interventional Radiology has acquired 16 Slice CT scanner GE Optima 540 and is being effectively utilised for increasing the diagnostic throughput of the department. Molecular imaging simultaneously with structural imaging is being increasingly utilised for the diagnosis of various neurologicalconditionsinitsearlystages.Thedepartment in collaboration with Department of Neurosurgery is involved in carrying out spinal injection procedures for back ache and trigeminal rhizotomy procedures for patientswithtrigeminalneuralgia. 10. The Sakalwara Community Mental Health Centre remodelled and renovated completely as ‘Centre for Community Mental Health’ was inaugurated on 29 January 2014 by Ms. Sujaya Krishnan, Joint Secretary, Ministry of Health and Family Welfare, Government of India. The Centre has 22 cottages with kitchenette and bathrooms,OPD,andtrainingandrehabilitationcentres (wherechronicmentallyillpatientsandtheircaregivers couldstayfor2-3months—prolongedstay—andundergo rehabilitation). 11. TheDepartmentofPsychiatricSocialWorkhasinitiated individualandgroupservicesintheInfosysDharmasala forthefamiliesofthepatientsadmittedtothehospital. TheDepartmentcoordinatestheFreeLegalAidServices for the Neurological, Neurosurgical and Psychiatric patientsandtheirfamiliestoaddresstheirlegalproblems. 12. Electric Drills, Portable CT, Leica OH5 Microscope have been added to improve the intraoperative surgical servicesoftheDepartmentofNeurosurgery.TheGamma HLLLifeCareLtd(AGovt.ofIndiaEnterprise)opened aretailoutletaboveJanathaBazaarintheOPDpremises 12 / National Institute of Mental Health and Neuro Sciences Annual Report 13. Knifehasbeenre-loadedoftheCobaltsourcetofacilitate treatmentofbraintumours. 19. Automated Immunohematology Analyzer with high throughput has been obtained for the Transfusion MedicineCentreforrapidandaccurateBloodGrouping andCrossMatchingofseveralsamplessimultaneously.A newhigh-endHematologyAnalyzer(5partdifferential)is beingintroducedwhichhashigherthroughputandgives reliableautomateddifferentialWBCcountinadditionto otherregularhematologicalparameters.AutomatedESR testing, which avoids direct handling of infected blood samplesandreduceshumanerror,hasalsobeenaddedto theClinicalHaematologyFacility. 4.3 Outreach / Public Education and Extension Activities / Awareness Programmes 14. Real Time PCR machine has been installed in the Department of Human Genetics, which helps in rapid gene expression analysis, genotyping and HRM studies forbothresearchanddiagnosisofgeneticdisorders. 15. Hydrocollator Unit and Height Adjustable Couch have beeninstalledatthePhysiotherapySection,andRobotic Hand Rehabilitation equipment in the Occupational TherapySectionoftheInstitute. 16. Noninvasivecardiacoutputmonitors(NICOM)havebeen installedatOTandICUtoevaluatethechangesinvarious neurological disorders. Portable ultrasound machine is being used in the operation theatre and neurointensive care for diagnostic procedures especially central venous cannulation, transthoracic echocardiography, transcranial doppler, peripheral vascular doppler and abdominal ultrasound. Heart rate variability (HRV) monitors for autonomic nervous system are also being used in the OT and ICU. Near infrared spectroscopy (NIRS)forcerebraloxygenationisusedasamonitoring device in carotid endarterectomy and other surgical procedures. 17. DigitalslidescannerhasbeeninstalledinHistopathology sectionoftheDepartmentofNeuropathology.Thismajor developmentwillfacilitatedigitizingthewholemicroscopic slideandmakingitaccessibledigitallytoseveralusersin far off places also. The intended use is for teaching and trainingofpathologists,andforsharingofcasestudies. 18. 2013-14 AComputerlaboratorywith30computersystems,LAN andinternetfacilityhasbeensetupattheDepartmentof Biostatisticsduringtheyear. Mother Dairy’s ‘Safal’ fruits and vegetable outlet was inauguratedon21June2013. 1. Centre for Public Health (CPH): One of the key activitiesundertakenthisyearbytheCentreisthestartof apublichealthobservatoryinKolardistrict(Government of Karnataka circular ref:N.HFW30CGE2013 dated 30/1/2013) to field test public health approaches and strategies for strengthening response to Mental, Neurological, and Substance Use Disorders (MNSUDs), Traumatic Injuries and other Non-Communicable Diseases. A baseline assessment of health and human resources for mental health, health management informationsystems,mentalhealtheducationandhealth caresystemsformanagementofMNSUDswasconducted atKolarbytheCPHteam.Training,systemdevelopment and health promotion initiatives are being developed to integrate mental health components in various health programmes. Further, the Karnataka State component of the National Mental Health survey is being currently undertakeninKolardistrict. 2. NIMHANS Centre for Well-Being (NCWB): ‘TraumaRecoveryClinic’wasinauguratedon11December 2013 at NCWB, to provide brief psychological and social interventions to adolescents (>16 years of age) and adult survivors of psychological trauma through one-to-one and/or group counseling and psychotherapy formats to alleviatesymptomsandpavethewayforholistichealingand psychologicalrecovery.Theclinichasbeenstartedtoprovide a platform to enhance awareness about psychological trauma, discuss its consequences and thus overcome the trauma through effective strategies like workshops in groups for subjects and caregivers. A workshop to teach skillstoreduceburnoutandsecondarytraumaamongthe counselorswasconductedaspartoftheclinicactivities. Thecentrealsoinitiatedtwoothernewclinics:Awakeclinic andSHUT(ServiceforHealthyUseofTechnology)clinic. Awake clinic offers counseling and support to address psychologicalproblems,particularlyrelatedtoabuseand violenceathomefront.SHUTclinicprovidesscreeningfor problematicusageoftechnologyandconductsawareness and skill building and training workshops for counselors attheCentreaswellasinthecommunity(school,colleges, corporateoffices,etc). National Institute of Mental Health and Neuro Sciences / 13 Annual Report 3. 2013-14 Neuropathology Brain Museum:TheNeuropathology Brain Museum (Human Brain Museum), the only one of its kind in the country, is located in the Neurobiology ResearchCentre.Thisuniquefacilityhasbecomeacentre ofattractionforschoolandcollegestudents,servingasa valuablesourceofNeuroscienceeducation.Thenumberof visitors to the museum has increased significantly (3208 visitors)duringtheyear. in the field of Mental Health and Neurosciences, Department of Health Research (DHR and ICMR) decidedtoestablishtheCentreforAdvancedResearch for Innovation of Mental Health and Neurosciences and it was inaugurated on 26th March 2014 by Dr. V.M. Katoch, Director General of Indian Council of MedicalResearch,NewDelhi.ThevisionoftheCentre is “to be a leader in the field of mental health and neuroscienceandevolvethestate-of-the-arttechnology and innovation for translational research and develop criticalmassofmanpowertomeetthenationalneedsby scientific collaboration and co-operation”. The centre has a dual component of manpower development to achieveacriticalmassoftechnicalpersonnelandpropel translationalresearchtotakescientificinvestigationto thebedsidemedicine. 4.4 Academic 1. To enhance the public health competencies of medical officers,atwo-year‘MastersinPublicHealth’(MPH)has beeninitiatedwithfiveseatsfromtheacademicyear201314.TheMPHcourseisconductedinaseriesofconcurrent modules covering general public health concepts. During thefirstyear,thetraineesgaincorecompetency,followed byfocusedtrainingonMental,Neurological,andSubstance UseDisorders(MNSUDs)andinjuriesinthesecondyear. Attheendofthecourse,thecapacitytomanageMNSUDs and accidental injuries from a public health perspective will be strengthened, thus enhancing the availability of trainedmanpowerintime. 2. A one-month full time Certificate Course for postgraduates of Clinical and Social Psychology called “Positive Psychology Perspective: Research, Education and Communication for Health” (P3Reach) has been launched. It aims at strengthening skills in conceptualizing and conducting research grounded in positive psychological perspective and building capacity tocarryouteducationalandcommunicationactivitiesfor mental health promotion in the community. The course announcementhasreceivedanenthusiasticresponseand thefirstbatchwouldbecompletingthecourseinAugust 2014. 3. A six-month certificate course in Cognitive Behavioural Therapy (CBT) has been started, from December 2013. Three candidates have joined the course and are undergoing training. The course is designed to equip clinical psychologists with skills in the practice of CBT usinghandsontrainingintheBehaviouralMedicineUnit oftheDepartmentofClinicalPsychology. Inauguration of Centre for Advanced Research for Innovation of Mental Health and Neurosciences by Dr. V.M. Katoch, Director General of Indian Council of Medical Research, New Delhi 2. 5. AWARDS AND RECOGNITIONS 5.1 Awards 1. 4.5 New Initiatives 1. Complete automation of Library Circulation Services (includingOPAC)andtherenovatedcirculationcounter wasinauguratedbytheDirector,NIMHANSon3March 2014.Bar-codedlibrarymembershipcards(smartcards) werealsoissuedontheoccasion. In January 2011, realizing the leadership potential shown and the rapid progress made by NIMHANS 14 / National Institute of Mental Health and Neuro Sciences Dr. Sailaxmi Gandhi, Assistant Professor of Nursing, received the prestigious National Florence Nightingale Award for the year 2014 from the Hon’ble President of India at the Rashtrapati Bhavan, New Delhi for meritorious service in the field of nursing. Annual Report Dr. Sailaxmi Gandhi, Assistant Professor of Nursing, receiving the National Florence Nightingale Award for the year 2014 from the Hon’ble President of India Shri. Pranab Mukherjee 2. Mrs. H. Dorothy Paripoornam, Staff Nurse, received the State Florence Nightingale Award from the Hon’ble Chief Minister of Karnataka at Vidhana Soudha, Bangalore on the occasion of Nurses Day 2014. 5. Dr. T.R. Raju, Professor & Head of Neurophysiology, received Fellowship Award at the Annual Meeting of IndianAcademyofNeurosciences(IAN),Allahabad,2527October2013. 6. Dr. G. Venkatasubramanian, Additional Professor of Psychiatryreceived(a)VidyaSagarAward(byICMR)for theyear2010,24September2013(b)ProfessorRaguram Distinguished Young Teacher Award from the Indian PsychiatricSociety(KarnatakaChapter)fortheyear2013. 7. Dr.SriganeshK.,AssociateProfessor,Neuroanaesthesia receivedBestMetroBranchAwardforIndianSocietyof Anaesthesiologists(ISA),BangaloreattheISACON2013 (alsoelectedasSecretaryofISA,BangaloreBranch). 8. Dr. Subasree R., Assistant Professor, Neurology received YoungInvestigators/ScientistBursaryattheWorldCongress ofNeurology,Vienna,Austria,21-26September2013. 9. Dr. B.S. Shankaranarayana Rao, Additional Professor, Neurophysiology, (i) Best Cited Paper: Dölen G, Osterweil E, Shankaranarayana Rao BS, Smith GB, AuerbachBDChattarjiSandBearMF(2007)Correction of fragile X syndrome in mice. Neuron 56 (6):955-962. (ii) Most popular article: Veena J, Shankaranarayana Rao BS and Srikumar BN (2011) Regulation of adult neurogenesisinthehippocampusbystress,acetylcholine and dopamine. Journal of Natural Science, Biology and Medicine. 2(1): 26-37. (iii) Most-read Paper. Hayashi ML,ShankaranarayanaRaoBS,SeoJS,ChoiHS,Dolan BM,ChoiSY,ChattarjiS,TonegawaS(2007).Inhibition of p21-activated kinase rescues symptoms of fragile X syndrome in mice. Proceedings of National Academy of Sciences(USA)104(27):11489-94. 10. Dr.MehulModi,M.Ch.,NeurosurgeryResident,received the“BestPosterAward”,for“ValueofIndocyaninegreen dyevideoangiographyinintracranialaneurysmsurgery– Aperspectivefromatertiarymedicalcentreinadeveloping country”, Neurovascon – 2013, Cerebrovascular Society ofIndia,Hyderabad,September2013. 11. Dr.PraveenkumarSaligoudar,SeniorResident,Department of Neurosurgery, received The Best Paper Award in Neurosurgery for “Cortical Reorganisation in Patients with Cervical Spondylotic Myelopathy Following Surgery— An fMRI Study”, at the 62nd Annual Conference of the NeurologicalSocietyofIndia,Mumbai,12-15December2013 Mrs. H. Dorothy Paripoornam, Staff Nurse, receiving the State Florence Nightingale Award from the Hon’ble Chief Minister of Karnataka Shri. Siddaramaiah 3. 4. Dr. P. Satish Chandra, Director/Vice-Chancellor, NIMHANS, & Sr. Professor of Neurology received (a) the Distinguished Alumnus of BMC Award, Bangalore Medical College Alumnus Association, Bangalore, on 15 August2013(b)theprestigious‘BasantiDeviAmirChand PrizeforBiomedicalScientistfortheyear2010’,during theICMR(theIndianCouncilofMedicalResearch)held inNewDelhi,24September2013. Dr. V. Ravi, Registrar, NIMHANS, and Professor & Head of Neurovirology received Excellence in Virology AwardfromtheIndianVirologySocietyforoutstanding contributions to Medical Virology at the Asia Pacific CongressofVirologyheldatAmityUniversity,NewDelhi, 16-20December2013. 2013-14 National Institute of Mental Health and Neuro Sciences / 15 Annual Report 12. 13. 2013-14 Dr. Raman Mohan Sharma, Senior Resident, Department of Neurosurgery, received The Best Poster Award for “Tubercular meningitis with hydrocephalus with HIV co-infection –Role of CSF diversion procedure” at the 62nd Annual Conference of the Neurological Society of India, Mumbai, 12-15 December2013 Dr. Anisya Vasanth Memorial Oration Dr. Giriraj Ratan Chandak, Principal Scientist and Group Leader,CentreforCellularandMolecularBiology,Hyderabad, deliveredDr.AnisyaVasanthMemorialOrationon11September 2013. The topic of the oration was “Journey from Simple to Complex Genetic Disorders: Neuromuscular Disorders as Model”. Dr. H.S. Arun, PhD Scholar in Clinical Neurosciences, Department of Neuropathology, received Herbet Krause Award for the paper in Neuro-oncology titled ‘ImmunohistochemicalExpressionofNovelAstrocytoma Moleculart Markers—Value in Aiding Histopathological Grading and Prognosis’ at the 62nd Annual Conference of the Neurological Society of India, Mumbai, 12-15 December2013. 5.2 Oration by NIMHANS Faculty Dr.ShankarSK,EmeritusProfessorofNeuropathology,delivered (i) Shobha Arjundas Oration, “Pathology of Epilepsy – Does it giveakeytopathogenesis?”,ECON2014,Kolkata,February2014 (ii)TropicalNeurologyOration,“BiologyofNeurocysticercosis”, Tropicon2014,Chennai,March2014. 6. ACTIVITIES AND EVENTS AT NIMHANS 6.1 Orations Dr. D.N. Prasad Oration Dr.D.N.PrasadOrationwasdeliveredbyProf.SubrataSinha, Director, National Brain Research Centre (NBRC), Manesar, Gurgaon, on 20 April 2013 at NIMHANS. The topic of the orationwas“InflammationandGlioma:ANewLink”. Dr. Giriraj Ratan Chandak, Principal Scientist and Group Leader, Centre for Cellular and Molecular Biology, Hyderabad being felicitated after delivering Dr. Anisya Vasanth Memorial Oration Dr. Ramachandra N Moorthy Oration 2014 The 11th Dr. Ramachandra N Moorthy Oration 2014 was heldon9January2014.TheOrationon“MentalHealthfor Changing India” was delivered by Professor R. Srinivasa Murthy, Patron Member, Association for the Mentally Challenged (AMC), Ex Dean & Head Department of PsychiatryNIMHANS. 6.2 Events World Parkinson’s Day TheDepartmentsofNeurologyandNeurosurgery,NIMHANS in collaboration with the Parkinsons Disease Society of Karnataka organised a programme for patients with Parkinson’s disease to commemorate the World Parkinson’s Dayon7April2013. Prof. Subrata Sinha, Director, National Brain Research Centre (NBRC), Gurgaon delivered Dr. D.N. Prasad Oration Topics covering various aspects of Parkinson’s disease— medical,surgicalandneuro-rehabilitation—werediscussedat the event. A panel of experts answered individual questions fromtheaudienceonaone-to-onebasisaftertheprogramme. 16 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 World Parkinson’s Day International Nurses Day 2013 celebrations Dr. B.R. Ambedkar Jayanti BharatRatnaDr.B.R.AmbedkarJayantiwascelebratedon23 April2013atNIMHANS. Dr. Mudnakudu Chinnaswamy, noted litterateur and Chief AccountsOfficer-cum-FinancialAdvisor,BMTC,wasthechief guest. Venerable Bhante Vinayarakhita Thero, Vipassana Acharya, Chief Abbot, Spoorthi Dhama Vihara, Bangalore, wastheGuestofHonour.Buddhavandana,Yakshaganadance performancebyatroupefromKarnatakaKalakshetra,andskits on untouchability, right to education and domestic violence markedDr.Ambedkar’s122ndbirthanniversarycelebrations. Awards for Best Staff Nurse and Best Wards (Psychiatric and Neuro Centre) were presented on the occasion. Staff nurses Smt.AVimalaMonicaandSri.PrasannaKumarGfromStroke Ward&CentreforAddictionMedicinebaggedtheBestNurses Awardfor2012-13.TheBestWardAwardwassecuredbyPV.III andEICU.BestNurseAwardinstitutedbyC.KrishnaiahChetty &SonsFoundation,BangalorewasgiventoMrs.M.R.Bhanu, StaffNurseatCasualty.Mrs.FloraThangam,WardSupervisor, whoreceivedtheprestigiousFlorenceNightingaleAwardfrom the President of India Shri. Pranabh Mukherjee, was also honoured. SPICMACAY – NIMHANS - Santoor Recital SPICMACAY-NIMHANSchapterinassociationwithNIMHANS Gymkhana organised a santoor recital by Padma Vibhushan Pandit Shivkumar Sharma at NIMHANS Convention Centre on22July2013.Theaudiencewereenthralledandtreatedto the best of santoor performance at the 90-minute concert by the maestro. Pandit Shivkumar Sharma was accompanied by Shri. Ramkumar Mishra on the tabla and Shri Takahiro Arai ontanpura. Dr. B.R. Ambedkar’s 122nd birth anniversary celebrations International Nurses Day 2013 TheInternationalNursesDaywascelebratedon15May2013 under the theme “Closing the Gap: Millennium Development Goals—CountdownStarts”. Dr.A.Chandramukhi,formerProfessor&Head,Departmentof Neuromicrobiology,NIMHANSwastheChiefGuest. Santoor exponent Pandit Shivkumar Sharma performing at a concert organised by SPICMACAY-NIMHANS chapter National Institute of Mental Health and Neuro Sciences / 17 Annual Report 2013-14 Independence Day Colourful cultural programmes marked Independence Day celebrations Independence Day was celebrated with patriotic fervour at NIMHANS on 15 August 2013. The unfurling of the National Flag by Dr. P. Satish Chandra, Director/Vice-Chancellor was followed by colourful cultural programmes by the students of NIMHANSCollegeofNursingandinmatesofvariouswardsof thehospital. Teacher’s Day Teacher’sDaywascelebratedon10September2013.Keeping with the Teacher’s Day tradition, senior faculty members of NIMHANSwerehonouredfortheirsignificantachievementsin their respective specializations and outstanding contributions tothegrowthoftheInstitute. TheChiefGuestofthefunction,Dr.B.V.Subbarayappa,former president, International Union of History and Philosophy of Science (an affiliate of UNESCO) delivered a special talk on ‘Science, Spirituality and Humanism: The Vital Tripod for SustainableCivilisation’. Dr. Sharanprakash R. Patil, Hon’ble Minister of State for Medical Education, Government of Karnataka releasing mental health awareness and educational materials at an event organised to celebrate World Mental Health Day Dr. Sharanprakash R. Patil, Hon’ble Minister of State for Medical Education, Government of Karnataka was the Chief Guest. The minister, in his special address, highlighted the importanceoflookingatthementalhealthissuesexperienced byseniorcitizensintheircommunitiesandprovidingnecessary support and services. He released various mental health awareness and educational materials. Prof. Srikala Bharath, DepartmentofPsychiatryandConsultant–GeriatricClinic& Services,NIMHANSpresentedthereportofvariousactivities conductedbythemultidisciplinaryteamoftheGeriatricClinic toaddressmentalhealthissuesintheelderly. Vigilance Awareness Week The Vigilance Awareness Week was observed by NIMHANS under the theme “ Promoting Good Governance—Positive ContributionofVigilance”from28October2013to2November 2013. Valedictory function of the week-long programme was heldon4November2013. Teacher’s Day celebrations World Mental Health Day WorldMentalHealthDaycelebration,underthetheme“Mental HealthandOlderAdults”,washeldon8October2013. Shri. P.S. Rajagopal, Senior Advocate, Karnataka High Court, at the valedictory function of the Vigilance Awareness Week 18 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 AspartoftheVigilanceAwarenessWeek,NIMHANSorganised variousactivitiesincludingworkshopsanddisplayofbanners andpostersatprimelocationsintheInstitute. Shri. P.S Rajagopal, Senior Advocate, Karnataka High Court, wasthechiefguestattheevent. Prof. V. Ravi, Registrar, NIMHANS, administered pledge to the faculty and staff of NIMHANS for eradication of corruption in accordance with the instructions of the GovernmentofIndia. Children’s Day Schoolchildren at the exhibition held as part of the National Epilepsy Day celebrations Karnataka Rajyotsava Children’s Day was celebrated with enthusiasm by the DepartmentofChildandAdolescentPsychiatryon13November 2013.Variousculturaleventswereheldinwhichchildrenfrom Psychiatrywardshowcasedtheirtalent. Kannada Rajyotsava was celebrated with great zeal on 30 November 2013. Noted poet and humourist Shri. H Dundiraj, was the Chief Guest. He enthralled the audience withhismeaningfulhumourandcaptivatingspeech.Cultural programmeattheeventturnedouttobeaspellbindingshow withthelightmusicbyVinay,SupriyaAcharyaandteam.The eventgeneratedasenseofprideinthemindsoftheaudience forbeingapartofaculturethatissorichandvibrant. Children’s Day celebrations NIMHANS Gymkhana celebrated Children’s Day on 14 November2013.Prizestothewinnersofvariouscompetitions held as part of the Children’s Day celebrations were handed over by Prof. P. Satish Chandra, Director/Vice-Chancellor, NIMHANS and Prof. V. Ravi, Registrar, NIMHANS on the occasion. National Epilepsy Day Noted poet and humourist Shri. H. Dundiraj at Karnataka Rajyotsava celebrations. NIMHANS in association with Indian Epilepsy Association (IEA), Bangalore Chapter jointly organised Epilepsy Day celebrationson16-17November2013attheNIMHANSCollege ofNursing. Lamp Lighting Ceremony Dr.V.B.Patil,Commissioner,DepartmentofHealthandFamily Welfare,GovernmentofKarnatakawastheChiefGuest.Mr.S. Venkateshwar,AdditionalDirectorGeneral,PressInformation BureauwastheGuestofHonour.Morethan700studentsfrom various schools visited the exhibition held to raise awareness aboutepilepsy. The College of Nursing, NIMHANS, celebrated its 8th Lamp Lighting Ceremony on 4 December 2013. Shri. CK Mishra, Additional Secretary, Ministry of Health & Family Welfare, Government of India was the Chief Guest. Dr. K Reddemma, former dean and HoD, Nursing, NIMHANS was the Guest of Honour.MeritoriousstudentsreceivedawardsfromtheChief Guestandotherdignitaries.Studentsandtraineeslitthelamp symbolisingtheirdedicationtotheprofession,andtookanoath toservehumanitywithcompassionandempathy. National Institute of Mental Health and Neuro Sciences / 19 Annual Report 2013-14 AposterexhibitiontomarktheobservanceofWorldAIDSDay wasalsoorganisedontheoccasion. Prof.P.SatishChandra,Director/Vice-Chancellor,NIMHANS, presented a detailed report highlighting the various developmentsandachievementsoftheInstituteduringthepast year. Institute Day Celebrations Shri. C.K. Mishra, Additional Secretary, Ministry of Health & Family Welfare, Government of India at the 8th Lamp Lighting Ceremony NIMHANS celebrated its 40th Institute Day, the first after securingthestatusofanInstituteofNationalImportance(INI) on 14 February, 2014. The Chief Guest for the event was Mr. Nandan Nilekani, Chairman, Unique Identification Authority ofIndia[UIDAI],PlanningCommission,GovernmentofIndia. Director P. Satish Chandra announced on the occasion the launchofonlineregistrationserviceswiththeaimofreducing thewaitingtimeforout-patientsontheoccasion. Republic Day The65thRepublicDaywascelebratedwithgaietyandfervour on 26 January 2014. Flag hoisting by the Director/ViceChancellor, NIMHANS was followed by colourful cultural eventsandprizedistribution. 18th Convocation of NIMHANS Mr. Nandan Nilekani, Chairman, Unique Identification Authority of India [UIDAI], Planning Commission, Government of India at the 40th Institute Day celebrations 7. INFRASTRUCTURE/BUILDINGS Shri. Ghulam Nabi Azad, Honourable Union Minister for Health & Family Welfare, Government of India and Mrs. Kiran Mazumdar Shaw, Chairman & Managing Director, Biocon Limited, Bangalore and Dr. Sharanprakash R. Patil, Hon’ble Minister of State for Medical Education, Government of Karnataka at the 18th Convocation of NIMHANS 1. Existing Nursing Student Hostel and Cauvery Ladies Hostel have been expanded by adding one more floor to accommodate the increased intake of nurses and postgraduatestudents. 2. Livinguptothephilosophyofagreenenvironmentand conservationofwater,treatedandpurifiedwaterfromthe sewageplantisbeingprovidedtothehostelsforflushing toilets apart from using it for gardening. Similarly, a one-tonbiodegradableorganicwasteconverterhasbeen installedintheInstitutetohandlealltheorganicwaste, excluding biomedical waste, to convert it in to compost manureforgardeningpurposes. 3. Old heritage building earlier named as ‘Children’s Pavilion’ in 1940’s has been modified retaining its The18thConvocationofNIMHANSwasheldon5February2013 at the Convention Centre of the Institute. Shri. Ghulam Nabi Azad,HonourableUnionMinisterforHealth&familyWelfare, Government of India and President, NIMHANS declared the convocationopenandaddressedthegathering. ChiefGuestMrs.KiranMazumdarShaw,Chairman&Managing Director,BioconLimited,Bangalore,deliveredtheconvocation address. 20 / National Institute of Mental Health and Neuro Sciences Annual Report heritage architecture to house the NIMHANS History Museum on the ground floor. First floor of the same buildingwouldhousea‘ScienceGallery’onmentalhealth and neurosciences to create awareness among school and college students and general public. The interior of this building has been remodeled to depict the history andevolutionofNIMHANSfromtheMentalAsylumof 1868 under the British,to the present day NIMHANS. Thebuildingwillbeinauguratedandthrownopentothe public,thenextyear. 4. AnofficeforthePresidentoftheInstituteBodyhasbeen constructed with a scenic view of eucalyptus trees. This spacewillalsobeusedforvideoconferencingwhenever itisavailable 5. BhoomiPoojafortheconstructionofthenewAdolescent PsychiatryBlockwasperformedon17February2014. 2013-14 8.2 Government of India Reservation Policy NIMHANSfunctionsundertheMinistryofHealthandFamily Welfare,GovernmentofIndiaandfollowsthereservationpolicy aslaiddownbytheCentralGovernmentforfacultyrecruitment andstudentadmission. 8.3 Persons with Disabilities Act Reservation to Persons with Disabilities is provided by NIMHANS in line with the provisions of the Persons with Disabilities (Equal Opportunities, Protection of Rights and Full Participation) Act, 1995 in various posts and services of the Institute. NIMHANS is also involved in various activities initiated to remedy the exclusion of persons with disabilities byfocusingonpromotingtheaccessibility,aswellasremoving differenttypesofbarriersintheInstitute. 8.4 Official Language Policy 8. POLICY IMPLEMENTATION 8.1 Implementation of Right to Information Act NIMHANS has implemented the Right to Information Act 2005 as per the directions of Central Information Commission, Government of India, and the Ministry of Health and Family Welfare, Government of India. A team of Central Public Information Officers headed by the Registrar of the Institute— who is the Appellate Authority—is responsible for providing information to a person who seeks information under the RTI Act. The Public Relations Officer serves as the liaison officer andhandlescorrespondencewiththeauthoritiesconcerned.On average,theInstitutereceives15-20RTIapplications,andreplies tothequeriesaresentwithinthestipulatedtime.Quarterlyreturns pertainingtoRTIarefiledandsubmittedtoCentralInformation Commissiononlineaspertheprescribedguidelines. The Official Language Implementation policies and Constitutionalprovisions(OfficialLanguagesAct,1963andthe OfficialLanguagesRule,1976)arebeingstrictlyimplemented atNIMHANSundertheguidanceoftheDepartmentofOfficial Language, Union Ministry of Health and Family Welfare, Government of India. Advertisements, notifications, name boards, and sign boards are in Hindi and English. Hindi courses/classes, Hindi typing and stenography training are offeredregularly. 8.5 Results Framework Document NIMHANS received excellent rating from the Union Ministry ofHealthandFamilyWelfare,GovernmentofIndiafortimely submission of the Results Framework Document (RFD). NIMHANSisthefirstmedicalinstitutiontodrafttheRFD. National Institute of Mental Health and Neuro Sciences / 21 Annual Report 2013-14 NIMHANS The way forward... F ollowing the declaration of our National Institute of Mental Health and Neurosciences (NIMHANS) as an ‘Institute of National Importance’, the institute has moved one more step forward with the gazette notification on 29th November 2013, by the Ministry of Health and Family Welfare. Various administrative and academic bodies have been constituted and thus completing the procedure for the parliamentary act implementation. NIMHANS has made a name for excellent patient care and uncompromising academic standards and is looked up to be a trend setter in all domains.To facilitate efficient and advanced diagnostic facilities, a new and state-of-the-art Digital Subtraction Angiographic facility has been commissioned. The construction work for establishing a synchronous, state-of-the-art PETMRI facility along with a cyclotron to develop much needed ultra short acting radio-pharmaceuticals for the PET has been going on in full swing. We expect the PET-MRI to be ready by March 2015. Once commissioned, NIMHANS will be able to collaborate and share the materials and technology with the sister institutions in the state and thus evolve a network with the hospitals for patient care. A new and relatively comprehensive Subspecialty Block for Neurosciences is envisaged and planned next to the Neuro Centre of the Institute with 125 hospital beds, special diagnostic facilities and two OTs along with Helipad. Expected to be operational in the later part of 2015 or early 2016, this optimises the use of facilities by proximity and planned logistics. In the field of Academics, NIMHANS has planned to start two super speciality courses, DM in Neuropathology and DM in Addiction Medicine, from the next academic year.These new and specialised courses will augment the manpower of pre-existing Post Doctoral Fellows in various subspecialties in both clinical and preclinical branches and develop highly trained medical specialists for the country. Our Institute has extended the MOU with Maastricht University, Netherland and University of Liverpool (UK) for exchange of scientific knowledge and pursuit of Dual PhD courses for medical graduates and non-medical students. We are actively pursuing the process of networking with various other foreign universities across the globe in the field of Mental Health and Neurosciences. Recognising the leadership shown by NIMHANS, Department of Health Research (DHR-ICMR) has established the ‘Centre for Advanced Research’ for innovations in Mental Health and Neurosciences: Manpower Development and Translational Research. This was inaugurated on 26th March 2014. NIMHANS has been given the onerous responsibility to plan and conduct a National Mental Health Survey to arrive at a nationally representative estimate of mental health problems in the country. The pilot study has been completed in the district of Kolar, Karnataka, at the Public Health Observatory of the Centre for Public Health at NIMHANS. These estimates,the first of its kind in post-independent India, will guide in better implementation of the National Mental health programme (NMHP) and the District Mental Health programme. The Centre for Public Health (CPH) will continue to play a prominent role in policy planning for the government in the field of mental health with special emphasis on substance use disorders, neuro trauma and non-communicable diseases, which is the need of the hour. The unique and proactive initiative with long-term implications to the affected and their family is the ‘Trauma Recovery Clinic’ at the NIMHANS Centre for Well Being (NCWB) which provides psychotherapy and counselling, facilitating holistic healing. In addition, the NCWB has started two special clinics relevant to 22 / National Institute of Mental Health and Neuro Sciences Annual Report the present day social problems like violence and abuse of women and a SHUT Clinic (Service for Healthy Use of Technology). SHUT Clinic is envisaged to moderate the use or avoid addiction to the present day gadgets and technology. All these issues addressed by NIMHANS have futuristic implications in social psychology and mental health as advocated by the Government of India. The construction work of the ‘Northern Campus of NIMHANS’, located at the junction of three highways to establish a state-of-the-art ‘Poly Trauma Centre’ with ‘air ambulance’ facility to lift the injured is going to be initiated shortly. 2013-14 NIMHANS has moved forward with its declared vision in sight and mission in mind, to actively serve the people, enhance public awareness about preventable social and medical maladies and pursue translational research. We are prioritising the areas to be addressed and striving to achieve the stated goals within the stipulated timelines. Let us develop a human network involving the public, the technocrats and politicians with mutual respect, in our vision for a brighter, pragmatic tomorrow. Come let us all join hands and work together for this glorious institute and our country. Prof. P. Satish Chandra Director/Vice-Chancellor, NIMHANS EXPRESS-ION: A piece of artwork made by a child for a drawing competition organised by the Department of Psychiatric Rehabilitation Services. National Institute of Mental Health and Neuro Sciences / 23 Annual Report Smt. P Chandra AAO DOJ:04.10.1980 DOR:30-04-2013 (VRS) 2013-14 Sri. Nataraja A PhotoCopying Operator DOJ:15.03.1979 DOR:30-04-2013 Smt. BV Geetha Devi WardSupervisor DOJ:06.09.1979 DOR:31-05-2013 Sri. C Sathya Prasad Manager DOJ:18.12.1981 DOR:31-05-2013 Sri. Perumal M MultiTaskingStaff DOJ:20.02.1989 DOR:31-05-2013 Staff who served NIMHANS (Retired / Superannuated) Sri. Danial Y HospitalAssistant DOJ:16.02.1983 DOR:31-05-2013 Dr. KV Kishore Kumar Psychiatrist (SpecialGrade) DOJ:21.10.1986 DOR:06-05-2013 (VRS) Ms. Kantha Manager DOJ:25.09.1982 DOR:05-06-2013 (VRS) Smt. Ramanamma HospitalAssistant DOJ:30.11.1983 DOR:06-06-2013 (VRS) Dr. K Reddemma Sr.Prof.ofNursing DOJ:11.04.1974 DOR:30-06-2013 Dr. CR Chandrashekar Sr.Prof.ofPsychiatry DOJ:01.08.1979 DOR:30-06-2013 DOJ:DateofJoining,DOR:DateofRetirement 24 / National Institute of Mental Health and Neuro Sciences Sri. Shambappa S OfficeAssistant DOJ:15.03.1979 DOR:30-06-2013 Annual Report Sri. Hanumanthappa MultiTaskingStaff DOJ:21.02.1989 DOR:30-06-2013 Sri. Jayaramu TM OfficeAssistant DOJ:29.05.1986 DOR:30-06-2013 Dr. HS Siddamallaiah PL&IO DOJ:15.02.1985 DOR:31-07-2013 Smt. Jayalakshmi HospitalAssistant DOJ:17.12.1981 DOR:31-07-2013 Sri. Loghanathan R HospitalAssistant DOJ:12.02.1982 DOR:30-06-2013 Smt. Rangamma H HospitalAssistant DOJ:21.11.1980 DOR:31-07-2013 Dr. TS Devaragudi Addl.Prof.of Neuroanaesthesia DOJ:08.10.1997 DOR:01.08.2013 (VRS) Smt. Sharada Vasudev Hervatta StaffNurse DOJ:01.06.1983 DOR:31-08-2013 Smt. SD Joy Chandra Manager DOJ:02.05.1984 DOR:31-08-2013 DOJ:DateofJoining,DOR:DateofRetirement 2013-14 Sri. SP Meshram Sr.OccupationalTherapist DOJ:26.02.1979 DOR:31.08.2013 Sri. V Shekar Manager DOJ:06.10.1982 DOR:31-08-2013 Sri. Gopinath Prabhu UDC DOJ:16.09.1994 DOR:31-08-2013 Sri. Kempanna KV HospitalAssistant DOJ:01.02.1982 DOR:31-08-2013 National Institute of Mental Health and Neuro Sciences / 25 Annual Report 2013-14 Smt. Natarajan V OfficeAssistant DOJ:10.10.1983 DOR:31-08-2013 Sri. KN Vishwanath AAO DOJ:07.11.1979 DOR:30-09-2013 Smt. Yeshodha HospitalAssistant DOJ:28.10.1980 DOR:30-09-2013 Sri. Narasimhaiah N HospitalAssistant DOJ:15.03.1979 DOR:31-10-2013 Smt. G Vanaja Devi Manager DOJ:29.08.1985 DOR:31-10-2013 Sri. OS Santhosh InstructorGr–I DOJ:12.09.1980 DOR:30-11-2013 Dr. Nagarajaiah Addl.Prof.ofNursing DOJ:06.09.1976 DOR:30-11-2013 Sri. Hemanna HospitalAssistant DOJ:10.10.1983 DOR:31-10-2013 Smt. Sampath Kumari A HospitalAssistant DOJ:11.01.1982 DOR:30-11-2013 Sri. M A Irudaya Raj Asst.Inst,(Fitter) DOJ:21.05.1982 DOR:30-11-2013 Smt. Sampathkumari G HospitalAssistant DOJ:25.03.1982 DOR:30-11-2013 DOJ:DateofJoining,DOR:DateofRetirement Smt. Lakshmamma B HospitalAssistant DOJ:05.11.1980 DOR:31-12-2013 26 / National Institute of Mental Health and Neuro Sciences Sri. Chandran G HospitalAssistant DOJ:27.07.1981 DOR:31-12-2013 Annual Report Dr. M Venkataswamy Reddy Addl.Prof.ofBiostatistics DOJ:15.03.1973 DOR:31-01-2014 Sri. HC Venkateshaiah AAO DOJ:12.03.1979 DOR:31-01-2014 Sri. Suryanarayana UDC DOJ:22.01.1982 DOR:31-01-2014 Smt. SR Suvarna Bai AAO DOJ:21.01.1974 DOR:28-02-2014 Sri. K Mannulingam Manager DOJ:15.03.1979 DOR:31-01-2014 Smt. Shanthamma HospitalAssistant DOJ:13.07.1981 DOR:31-01-2014 Sri. R Chandrashekar Manager DOJ:29.09.1982 DOR:28-02-2014 Sri. JS Xavier Manager DOJ:08.04.1983 DOR:28-02-2014 Sri. Venkataramana OfficeAssistant DOJ:22.09.1981 DOR:28-02-2014 Sri. Lakshmana N OfficeAssistant DOJ:31.10.1983 DOR:28-02-2014 DOJ:DateofJoining,DOR:DateofRetirement 2013-14 Sri. Paneer Selvam V HospitalAssistant DOJ:05.10.1983 DOR:28-02-2014 Smt. Velliamma HospitalAssistant DOJ:22.03.1989 DOR:28-02-2014 Smt. VA Rani Manager DOJ:29.01.1981 DOR:31-03-2014 National Institute of Mental Health and Neuro Sciences / 27 Annual Report 2013-14 Research Collaborations National International Lifting The Burden in Official Relation with the World Health Organization The Global Campaign against Headache 28 / National Institute of Mental Health and Neuro Sciences Awards, Honours and Annual Report 2013-14 Key Assignments Biophysics Dr. Preeti Joshi, Professor & Head, Member, Department of BiotechnologyTaskforceonNeuroscience. Child&LawNLSIU,Delhi,UNICEFandNationalCommission for protection of right as of the child (iii) Secretary General, RichmondFellowship,NationalBoard(iv)Chairperson,House CommitteeandAdmissionCommittee,AshaHouseRichmond Fellowship,Bangalore. Biostatistics Dr.DK Subbakrishna,Professor & Head (i) President,Indian Society for Medical Statistics (ii) Member, Executive Council, InternationalBiometricSocietyIndianRegion. Dr. K Thennarasu, Professor, Member, Executive Council, IndianSocietyforMedicalStatistics. Dr. P Marimuthu, Additional Professor, General Secretary, InternationalBiometricSocietyIndianRegion. Child and Adolescent Psychiatry Dr. Satish Chandra Girimaji, Professor & Head, Member, NationalTrusttaskgrouponearlyinterventioninautism. Dr.ShobaSrinath,Professor,(i)Member(a)GoverningCouncil, Dr.SRCInstituteofSpeechandHearing,Bangalore,14August 2013 (ii) Temporary Advisor, WHO Consultation on Autism Spectrum Disorders and other Development Disorders: From awareness raising to capacity building, Geneva, Switzerland, 16-18September. Dr.ShekharSeshadri,Professor,(i)Member(a)Committeeto draft sexual assault assessment protocol, Ministry of Health & Family Welfare, Govt. of India (b) Technical Resource Group, NUHM, Ministry of Health & Family Welfare, Govt. of India (c) UGC Committee against ragging (d) Advisory Boardonemotionalsafetyatschools,TeachersFoundation(e) ManagementCommitteeRichmondFellowship-PGCollege(f) Governing Council, Richmond Fellowship Bangalore Branch (g) Adoption Recommendation Committee, Department of Women and Child Development, Govt. of Karnataka (h) Working Group on Railway Children, National Commission for Protection of Child Rights (i) Selection Panel for Juvenile JusticeBoard,DepartmentofWomenandChildDevelopment, Govt. of Karnataka (j) Board of Directors, Christel House Learning Centre, Bangalore (k) Advisory Board, Cambridge School,HSRLayout,Bangalore(l)AdvisoryBoard,RAHIDelhi (ii)Invitee,NationalconsultationonJuvenileJusticeCentrefor Dr.JohnVijaySagar,AssociateProfessor,(i)AssociateEditor of Frontiers in Child and Neurodevelopmental Psychiatry (ii) Member, Editorial Board, Andhra Pradesh Journal of PsychologicalMedicine(APJPsycholMed). Clinical Neurosciences Dr.VikasDhiman,PhDScholar(i)received(a)ICGEBAward to attend 2nd Post EURASNET symposium on Alternate RNA splicing, Trieste, Italy, 18-20 November 2013 (b) ILAE Educational Bursary Award to attend online VIREPA course on Genetics of Epilepsy, October 2013 - April 2014 (c) ICMR Travel Award to attend 30th International Epilepsy Congress, Montréal,Canada,23-27June2013(ii)selectedastheStudent Ambassador of International Journal of Medical Students (IJMS)fortheAsia-Pacificregion. Dr.AshokMunivenkatappa,PhDScholar,received(i)Travel Grant Scholarship, Council of Scientific and Industrial Research (CSIR), July 2013 (ii) Travel Grant Award, World FederationofNeurosurgicalSocieties(WFNS)TrustofIndia (iii) Travel Award, International Neuro Trauma Society (INTS)2014. Dr. Ketaki Swapnil Bhalsing, PhD Scholar, received Travel Grant for 17th International Congress on Parkinson’s Disease andMovementdisorders,MovementDisorderSociety(MDS). Dr. Shivkumar, PhD Scholar, received Travel Grant to attend SIRS 2014, Schizophrenia International Research Society, Florence,Italy,5-9April2014. Dr. Rakesh Balachandar, PhD Scholar, received International Travel Award from Department of Bio-Technology to attend 28th International Conference of Alzheimer’s Disease, 18-20 April2013. Dr. Velmurugan J, PhD Scholar, received International Federation of Clinical Neurophysiology (IFCN) Award and Fellowship-2014. National Institute of Mental Health and Neuro Sciences / 29 Annual Report 2013-14 Clinical Psychology Dr.AnishaShah,Professor&Head,(i)NationalBoardMember, RichmondFellowshipSocietyofIndia(ii)Inviteddiscussantfor biannualseminaronmaritalargumentsandchallengesofdual career Institute of Social and Economic Change, Bangalore, July2013(iii)EditorialBoardMember,InternationalJournal of Applied Psychology and Psychotherapy February 2014 (iv) Mentor, International Family Therapy Association Training Division(SkypePals)January2014. Dr. Uma Hirisave, Professor, (i) Guest Editor, International JournalofPsychologicalStudies(ii)Member(a)Rehabilitation Council of India (b) BOS of NIMH, Secunderabad (c) BOS, Dept. of Psychology, Kuvempu University, Shimoga (d) BOS, Dept. of Psychology, JN College, Bangalore (iii) Honorary Consultant-IMRC(JHMRC). Dr. MP Sharma, Professor, Hon. President, Karnataka AssociationofClinicalPsychologists. Dr. LN Suman, Professor, (i) Coordinator for developing and implementing a training programme for CBI Investigating Officers(IOs)on‘ScientificInterviewingMethods’(ii)Honorary Consultant, ‘Abalashrama’, a home for destitute women (iii) Member (a) House Committee of ‘Asha House’, a RFS halfwayhomeforchronicpsychiatricpatients(b)EditorialBoard, International Journal of Biosciences and Technology (iv) Reviewer (a) Journal of Addictive Behaviors, Therapy and Rehabilitation(b)InternationalResearchJournalofPublicand EnvironmentalHealth. Dr. Seema Mehrotra, Additional Professor, (i) Reviewer for International and national journals: Journal of Community and Applied Social Psychology, Psychology and Developing Societies,AsianJournalofPsychiatry,SocialScienceIndicators, Psychological Studies, Journal of Indian Academy of Applied Psychology (ii) Social Scientist External Member, Institute EthicsCommittee,OxfordCollegeofPhysiotherapy. Dr. Jamuna Rajeswaran, Additional Professor, (i) Article Rajeswaran J, Nalini A (2013) Neuropsychological deficits in amyotrophiclateralsclerosis(ALS):ASouthIndiaexperience, Neuropsychological Trends 13/2013, was selected as the most significant research paper in all areas of Psychology (ii) Member(a)ICMRTaskGroup,Vascularcognitiveimpairment (iii) Member, Editorial Board for International Journal of PsychosocialResearch. Dr. Paulomi M Sudhir, Additional Professor, (i) Member (a) Regional Advisory Board, Kendriya Vidyalaya Sanghathan (KVS) (b) Data Monitoring and Safety Committee (DMSC), Premium randomized controlled trials of lay counsellor delivered psychological treatments for depressive disorders andharmfuldrinkinginprimarycare. Dr.KeshavKumar,AdditionalProfessor,(i)Member,Boardof Studies(a)BangaloreUniversity(b)UniversityofMysore. Dr.PoornimaBhola,AssociateProfessor,(i)EditorialCommittee Member, The Journal of Psychosocial Rehabilitation and Mental Health (ii) Reviewer: (a) Asian Journal of Psychiatry, (b)InternationalJournalofSocialPsychiatry(c)Psychological Studies(iii)FellowofIndianAssociationofClinicalPsychology andtheIndianAssociationofSocialPsychiatry(iv)Honorary Positions in Professional Organisations: (a) International - Coordinator of the All-India CRN Study Group of the InternationalSocietyforPsychotherapyResearchCollaborative Research Network, U.S.A. (b) National - Member of the Ethics Sub-committee of the Indian Association of Clinical Psychologists. Dr. BN Roopesh, Assistant Professor, (i) Treasurer, Indian Association of Clinical Psychologists (ii) Executive Member, NeuropsychologicalSocietyofIndia. Dr. Shantala Hegde, Assistant Professor, (i) Reviewer of scientificpapers14thInternationalSocietyforMusicInformation RetrievalConference,Curitiba,PR,Brazil,4-8November2013 (ii) Reviewer (ad-hoc) for Journals (a) Neuroscience Letters (b) Music Perception (c) Asian Journal of Psychiatry (d) InternationalJournalofYoga. Epidemiology Dr.GururajG,Professor&Head,(i)ExpertAdvisor(a)Road Safety 10, monitoring and evaluation meeting of 10 country investigators, Baltimore, USA, 8-11 April 2013 (b) Road Safety 10 partners meeting, New Delhi, 8-9 May 2013 (c) World International Summit on Health, Doha, Qatar, 10-11 December 2013 (ii) Resource person (a) Technical Advisory Group meeting for Establishing Burns Registries in India, Ministry of Health & Family Welfare and Centres for Disease Controls, USA, 20 November 2013 (b) World Health day celebrations,WorldHealthOrganisation,IndiaCountryOffice, New Delhi 4 April 2013 (iii) Member, Technical Advisory Group meeting of Research Advisory Council of the George InstituteofHealth,Hyderabad,18May2013(iv)Member(a) 30 / National Institute of Mental Health and Neuro Sciences Annual Report Expert Review Committee for Mid Term Review of Country Cooperation Strategy (CCS) on Road Safety, Report entitled ‘MidTermReviewofRoadSafetycomponentsunderThailand Country Cooperation Strategy’, Ministry of Health and WHO country Office, Thailand, 24 June-July 5 2013 (b) World Health Organization, Global Road Safety Status Report 2013, Geneva(c)SteeringCommittee,ICMRTaskForcemeetingon DisabilityinIndia,NewDelhi,23July2013(v)Expertforthe Internationalworkinggrouponspinalcordinjurydatasystems (vi)TechnicaladvisorfortheKSHDRPprojectsonPrevention andControlofNon-communicableDiseasesandRoadTraffic Injuries(vii)MonitoringandEvaluationconsultationmeeting to review progress of data collection activities under RS-10 Project,India,Hyderabad,4March2013(viii)Expertmember: (a)TaskForceMeetingforInjury,ShockandEmergenciesby ICMR,NewDelhi,5April2013(b)NationalNon-communicable DiseaseTechnicalAdvisoryGroupMeetingonPreventionand Control of Life Style Diseases, Ministry of Health and Family Welfare, New Delhi, 7 May 2013 (c) RS-10 Stakeholders Meetingonmonitoringandevaluationtoreviewprogresssofar andthewayforward,NewDelhi,29May2013. Dr. Girish N Rao, Additional Professor (i) Founder-member, GeriatricHealthForum,IndiaunderHelpageIndia(ii)Invitee, KarnatakaStateMentalHealthAuthority. 2013-14 Development Reforms Project (KHSDRP), Government of Karnataka(b)SpecificationVettingCommitteeforFunctional Infrared Brain Imaging with High Density Optical Mapping, JIPMER,Puducherry(ii)ExpertforAppraisalofPost-Doctoral FellowshipinNeuroanaesthesia,KIMS,Hyderabad. Dr. Sriganesh K, Associate Professor, received Best Metro Branch Award for ISA, Bangalore during ISACON 2013 (acceptedasSecretaryofISA,Bangalore). Neurochemistry Dr. Rita Christopher, Professor & Head, (i) Member (a) Peer Review Committee, XII Five Year Plan Programme on Facilitating Performance in Military Environment by System Biology Approach, Defence Institute of Physiology and Allied Sciences, Delhi (b) ICMR National task force on ‘Inborn Metabolic Disorders’ (c) Editorial Board, (i) Journal of Basic Medical and Allied Sciences (ii) International Journal of BioEngineeringandTechnology(iii)InternationalJournalofBioEngineering, (iv) Cardio-Pulmonary Sciences and Technology (v) International Journal of Bio-Sciences (vi) Psychiatry and Technology (e) Advisory Board, International Journal of Innovation. Dr. Sarada Subramanian, Additional Professor, Member (a) Executive Committee, Society for Neurochemists of India (SNCI)(b)DoctoralCommittee,VITUniversity,Vellore. Human Genetics Dr. GK Chetan, Additional Professor, Member, European SocietyofHumanGenetics2013. Mental Health Education Dr.JayashreeRamakrishna,Professor,(i)Chairperson,Ethics Committee of the Foundation of Health Systems Research (ii) Member, Team 2013 of Swiss Tropical and Public Health Institute, Basel, Switzerland (iii) Senior Research Consultant, QualitativeResearchfortheProjecttheDELIVER(Delivering mEntalheaLthcareinIndiaVianon-spEcialisthEalthwoRkers) study for Sangath/ London School of Tropical Medicine and Hygiene (iv) Member, Ethics Committee, Rajeev Gandhi UniversityofHealthSciences,Bangalore. Neuroanaesthesia Dr. V Bhadrinarayan, Professor, (i) Member (a) Core Group for establishing Guidelines for Essential Trauma Care in Karnataka under the aegis of Karnataka Health System Dr. Srinivas Bharath, Additional Professor, Member (a) Institutional Biosafety Committee (IBSC), Kemwell Pharma, Nelamangala, Bangalore (b) Board of Studies (BOS), Dept. of Biochemistry, University of Mysore (c) Ethics Committee, RangadoraiMemorialHospital,Bangalore. Neurological Rehabilitation Dr.AnupamGupta,AdditionalProfessor,Member(a)National ExecutiveCommittee,IndianAssociationofPhysicalMedicine and Rehabilitation (b) National Executive Committee, IFNR- IndianFederationofNeuro-Rehabilitation. Neurology Dr. P Satish Chandra, Professor, Director/Vice-Chancellor (i) received(a)DistinguishedAlumnusofBMCAward,Bangalore Medical College Alumnus Association, Bangalore, 15 August 2013 (b) Saadaka Ratna Award, by Saheli Foundation, Bangalore, 15 October 2013 (ii) Chairman (a) South East National Institute of Mental Health and Neuro Sciences / 31 Annual Report 2013-14 Regional Committee, International Bureau for Epilepsy (IBE) (b) Zonal Coordination Committee, Organ Transplantation, Government of Karnataka (c) Academic Committee, AIIMS, Bhubaneshwar (d) Colloquium of Epilepsy Conference on Drug Resistant Epilepsy Classification in Psychiatry DSM-V, 16-18 April 2013 (iii) Member (a) Board of Management, MGMInstituteofHealthSciences,Navi,Mumbai(b)Working Group on Equivalence, Medical Council of India, Delhi (c) Finance Committee, Jayadeva Institute of Cardiology, Bangalore (d) Scientific Advisory Group (SAG), Division of Non-communicable Disease, ICMR, New Delhi (e) Governing Council, Sri. Venkateshwara Institute of Medical Sciences, Tirupathi(f)TaskForce,IndianCouncilforMedicalResearch (ICMR)(g)AdvisoryBoardfortheNationalDementiaSummit, New Delhi 2010 (h) Selection Committee for the post of Director, Postgraduate Institute of Medical Education and Research,Chandigarh(i)StandingCommitteeonScienceand Technology and related matters, constituted by the Ministry ofHomeAffairs,Govt.ofIndiafromNovember2011forthree years(j)AdvisoryCommittee,GulbenkianGlobalMentalHealth Platform, Lisboa, Portugal (k) Scientific Advisory Committee, National Centre for Disease Informatics and Research, National Cancer Registry Programme, Department of Health Research,MinistryofHealthandFamilyWelfare,Government ofIndia(l)ResearchAdvisoryCouncil,AIIMS,NewDelhi(m) NationalAdvisoryBoard,JAPI(n)ExecutiveCouncil,Institute ofHumanBehaviourandAlliedSciences,NewDelhi(o)Indian CouncilforCulturalRelations(ICCR),NewDelhi(p)Academic Council,SwamiVivekanandaYogaAnusandhanaSamasthana, Bangalore (q) Advisory Committee, Bhopal Memorial Hospital and Research Centre, Bhopal (r) National Advisory Group, Ministry of Health and Family Welfare, Government of India, New Delhi (s) MGM Journal of Medical Sciences, MGM Institute of Health Sciences, Navi Mumbai (t) Genetics Commission, International League Against Epilepsy, (ILAE) USA (u) Advisory Committee, Bhopal Memorial Hospital and ResearchCentre,Bhopal(v)NationalAdvisoryGroup,Ministry of Health and Family Welfare, Government of India, New Delhi (w) Special Expert Committee, Department of Health Research,Delhi(x)ScientificAdvisoryCommittee-Partnership Programme established by DBT, New Delhi for Advance Research in Biological Science & Engineering, Department of Biological Sciences (DBS), IISc,Bangalore (y) NationalThink Tank (India Backbone Implementation Network–IBIN)- Planning Commission, Government of India (Secretariat, Bangalore Baptist Hospital) (z) Standing Finance Committee, All India Institute of Medical Sciences, Bhubaneswar (iv) Member(a)AdvisoryCommitteeandInternationalForumon Innovation on Mental Health. Lisbon. Annual Meeting of the GulbenkianPlatform’s,Portugal,2-5October2013(b)Editorial Board,InternationalJournalofEpilepsy(IJEP)(c)HighLevel AdvisoryCommitteeonNationalPolicyonUniversalElectronic accessibility constituted by Government of India, Ministry of Communications and Information Technology, New Delhi, March2014(c)GoverningBody,JSSMedicalCollege,Mysore (v) Expert Member, Advisory Panel, National Academy of Medical Sciences, New Delhi (vi) Co-Chairman, Screening Committee on Initiative of Neuroclinical Research Education (INCRE),DepartmentofBiotechnology,GovernmentofIndia, NewDelhi. Dr. Veerendra Kumar M, Professor, National Delegate representing Indian Academy of Neurology to International FederationofClinicalNeurophysiology. Dr.SRChandra,Professor,(i)Sectioneditor,Neurologysection of the sixth edition of Prof. KVK textbook of Medicine (ii) Reviewer and programme committee member, International Conference on Neurosciences and Neurobiology Research, Singapore18-19November2013. Dr. Pramod K Pal, Professor, (i) Nominated and elected as a member (a) Education Committee for World Federation of Neurology-AssociationofParkinsonismandRelatedDisorders (WFN-APRD) (b) Education Committee, The Movement DisorderSociety-AsianandOceanianSection(MDS-AOS). Dr. Subasree R, Assistant Professor, received Young Investigators/Scientistbursary,WorldCongressofNeurology, Austria,Vienna,21-26September2013. Neuromicrobiology Dr. R. Ravikumar, Professor & Head, (i) External Expert (a) Institutional Bio-safety Committee Meeting, Institute of Bioinformatics, Bangalore, 30 May 2013 (b) DBT Nominated, Institutional Bio-safety Committee Meeting, Institute of Bioinformatics, Bangalore, 19 November 2013 (c) to review the progress of JRF, Institute of Bioinformatics, Bangalore, 23 December 2013 (ii) Master Trainer, Karnataka State AIDS Prevention Society – Training for Staff Nurses on RTI/STI, SIHFW, Leprosy Hospital, Bangalore, 16-17 July 2013 (iii) Mentors for Supportive Supervision-2013, Karnataka State AIDS Prevention Society, Inspection of KC General Hospital, Bangalore,3September2013andBangaloreUrbanandRural, 20September2013(iv)Won1stPrizeinQuiz,SEPSISCongress 2013,NewDelhi,4-5December2013(v)Won1stprizeinQuiz, BalajiInstituteofTropicalMedicine,18January2014. 32 / National Institute of Mental Health and Neuro Sciences Annual Report Dr. Shripad A Patil, Professor, (i) Executive Member, Indian Immunology Society, 2012-2014. (ii) Scientific expert (a) Microbiology Department, Gulbarga University, Gulbarga, 2013-14 (b) Microbiology Department, Karnataka University, Dharwad,2013-14. Dr. Veenakumari HB, Additional Professor, MCI Assessor, Govt.MedicalCollege,Azamgarh,2-3May2013. Neuropathology Dr.VaniSantosh,Professor,(i)Member,ExecutiveCommittee for Neurological Society of India (NSI) (ii) External Board Member, Academic Council and Board of Studies, SCTIMST, Trivandrum(iii)ExpertMember,VisionGroup-Departmentof ScienceandTechnology,Govt.ofKarnataka(iv)Externalexpert, SeniorStaffSelectionCommittee,Sree.ChitraTirunalInstitute for Medical Sciences and Technology, Thiruvananthapuram, 2013-2014. Dr.SundarPeriyavan,Professor,(i)Member,TechnicalResource Group,NACO(ii)Expertmember(a)KarnatakaStateDrugLogistics and Warehouse Society (b) Karnataka State Blood Transfusion Council (iii) Co-ordinator, training for blood bank officers, blood banktechniciansandnursingstaffofbloodbanksinKarnataka. Dr.GayathriN,Professor(i)Member(a)DoctoralCommittee, VIT, Vellore (b) Board of Studies, Mount Carmel College, Bangalore. Neurophysiology Dr. TR Raju, Sr. Professor & Head, (i) Elected as Fellow of Indian Academy of Neurosciences and awarded fellowship, 31st Annual Meeting of Indian Academy of Neurosciences, Allahabad,25-27October2013(ii)Member(a)ProjectReview Committee Meeting National Institute of Medical Statistics (NIMS), Ansari Nagar, ICMR, New Delhi, 8-9 April 2013 (b) ProjectReviewCommitteeMeeting,ICMRHeadquarters,New Delhi, 12 November 2013 (c) ICMR – BMBF Meeting, ICMR Headquarters,NewDelhi,10January2014(d)ExpertGroup, LawCommissiononJuvenileJusticeSystem,LawCommission ofIndia,NewDelhiMinistryofLawandJuvenile,Government of India, New Delhi, 24 January 2014 (iii) Chairman, PRC Committee, ICMR Headquarters, New Delhi, 26 August 2013 (iv) Chaired (a) ICMR Mentor-Mentee Workshop,Agartala Government Medical College, Agartala, 3-5 June 2013 (b) ScientificSessions,3rdICAPSWorkshopAIIMS,NewDelhi,2224December2013(v)InvitedMembertoattendtheTeachings 2013-14 oftheFoundationonThirtySevenpracticesofaBodhisattvaand Eight verses for training the Mind, Foundation for Universal ResponsibilityofHHTheDalaiLama,LodiRoad,NewDelhi, 21-23March2014. Dr. BS Shankaranarayana Rao, Additional Professor, (i) received(a)ValmikiAwardfortheoutstandingcontributions and excellence in the field of Medical Sciences, 20 October 2013 (b) Karnataka Padmabhushana Award for outstanding contributionsandexcellenceinthefieldofNeuromedicineand forextraordinaryachievementandyeomanservicesrendered to the country, Karnataka State Mandahaasa Organization, Bangalore,28April2013(ii)ChairpersonandJudgeforbest oral and poster presentation competitive session for young scientists, International Conference on Neurochemistry of Ageing Brain, CSIR-Indian Institute of Chemical Biology, Kolkata, 31 January - 1 February 2014 (iii) Resource Person and Panellist, The Third Bangalore Cognition Workshop: Where minds meet the brain. Centre for Neuroscience, Indian Institute of Science, Bangalore, 8-21 December 2013 (iv)ChairpersonofPlenaryLecturesSession,Symposiumon Medical Physiology and Molecular Genetics, Judge for best oral presentation competitive session for young scientists. 5th Congress of Federation of Indian Physiological Societies (FIPS)onPhysiology,Ethnopharmacology,Biotechnologyand HealthTherapeutics.SriVenkateshwaraUniversity,Tirupati, India.17-19December2013(v)MemberandResourcePerson, Indian National Node for Neuroinformatics (INNI) (vi) MemberofInternationalAdvisoryCommittee,Chairpersonof PlenaryLecture,andJudge,YoungInvestigatorscompetitive session. International Conference on Neurosciences: Brain PlasticityandNeurologicalDisorders.RevenshawUniversity, Cuttack, 9-11 November 2013 (vii) Member, Conference Organizing Committee, Chairperson of Symposium (a) Analytical, Pharmaceutical and Medical Biotechnology and (b) Nanobiotechnology, Bioinformatics and Bioengineering, First International and Third National Conference of Biotechnology, Bioinformatics and Bioengineering. Tirupati, India, 28-29 June 2013 (viii) Subject expert, Selection of Researchstaff,DepartmentofZoology,BangaloreUniversity, Bangalore (ix) Expert member, Peer Review meeting of DIPAS 12th Five Year Plan on Facilitating Performance in Military Environment: Systems Biology Approach. Defence Institute of Physiology and Allied Sciences (DIPAS), Govt. of India, Ministry of Defence, Research and Development Organization, Delhi, India (x) Member (a) Board of Studies, Dr. Ambedkar Institute of Technology, Bangalore, India (b) Planning Committee, DST-SERB Neuroscience Schools, DepartmentofScienceandTechnology,GovernmentofIndia National Institute of Mental Health and Neuro Sciences / 33 Annual Report 2013-14 (2012–tilldate) (c)InstitutionalEthics Committee, Institute of Ayurveda and Integrative Medicine (I-AIM), Bangalore (xi) Secretary, Indian Academy of Neurosciences (IAN) – Bangalore Branch (xii) Treasurer, Society for Neuroscience (SFN)–Bangalorebranch(2008–tilldate)(xiii)Reviewer(a) CSIR,ICMR,DBT,IUSSTFandDSTprojects(b)theAnnual review of Neuroscience and Pearson’s Biopsychology Book (xiv)Reviewerforjournals(a)Neuroscience(b)Neuroscience Letters (c) Pharmacological Research (d) Pharmaceutical Biology (e) Indian Journal of Medical Research (f) Journal of Neuroscience Research (g) Neurochemistry International (h) Brain Research (i) Neurochemical Research (j) Psychopharmacology(k)MolecularCellularBiochemistry(l) Physiology and Behavior (m) Pharmacology and Pharmacy (n)LearningandMemoryand(o)TheInternationalJournal of Neuropsychopharmacology (xv) Editorial Board Member, (a) and Editor, Prudence Journal of Medicine and Medical Sciences (b) Metabolic Brain Disease (c) Journal of Natural Science Biology and Medicine (d) International Journal of ModernandAlternativeMedicineResearch(e)Neuroscience Research Letters (f) Journal of Pharmaceutical and BiologicalSciences(g)TrendsinBiotechnologyResearch(h) InternationalJournalofMolecularBiologyandBiochemistry. Dr. Bindu M Kutty Professor, (i) Member (a) PAC, Health Sciences, SERB, New Delhi (b) Indian Board for certification of Sleep Medicine (c) Expert Committee Translational Neurosciences, ICMR (d) Expert committee of DST- Cognitive ScienceResearchInitiative(CSI-PDF)forpostdoctoralfellowship (ii)EditorialBoardMember(a)InternationalJournalofClinical ExperimentalPhysiology(b)NationalJournalofBasicMedical Sciences (c) Journal of clinical and Biological Sciences (iii) TeachingFaculty,NSMC(NationalSleepMedicineCourse–An IndoUSVenturetopropagatesleepeducation)since2006(iv) GeneralSecretary,ISSR(IndianSocietyforSleepResearch)(v) Mentor, ICMR mentor-mentee workshop, ICAP (vi) Reviewer, CSIR,ICMR,DBT,IJMR,IJEBandDSTprojects. Dr. TN Sathyaprabha, Additional Professor (i) Member (a) Doctoral Committee, JIPMER, Pondicherry (b) Ethics CommitteeatNationalInstituteofUnaniMedicine(c)Scientific AdvisoryCommitteeandEthicCommittee,JNI,Bangalore(ii) Secretary, SfN, Bangalore Chapter (iii) Reviewer of Journals: Hypertension, Acta Scandinavia Neurolgia, Indian Journal of PhysiologistandPharmacologistofIndia. Dr.LaxmiTRao,AssociateProfessor(i)Nominatedmember, University Grant Commission (UGC) for the advisory committee of Center with Potential for Excellence in a ParticularArea(CPEPA)ofUniversity ofCalcutta (ii)Elected ExecutiveMember(a)IndianAcademyofNeuroscience(IAN) (b)IndianSocietyforSleepResearch(ISSR),India(c)Society for Neuroscience (SfN) – Bangalore Chapter (iii) Member, Society for Neuroscience (SfN), USA (iv) Reviewer, Journal of Neuroscience Research, Brain Research Bulletin, Medical Hypothesis, J. Bioscience, Brain Research, J Neuroscience Research,CurrentScience,Ind.JExp.Biology(v)Chairperson, Symposium on Environment, Nutrition and Brain Function, 31st International Annual Conference of Indian Academy of Neurosciences (IAN) on Emerging trends and Challenges in Neuroscience,Allahabad,UttarPradesh,India,25-27October 2013. Dr. Phalguni Anand Alladi, Sr. Scientific Officer, received funding of US$5000 from the International Parkinson and MovementDisordersSociety(USA)toconducttheParkinson’s Disease Education Program titled Understanding Parkinson’s Disease: From Clinics to Basics, 5-7 March 2014 under the DWEPScheme. Mr.VidyadharaDJandMr.VijayakumarKreceived2ndPrize in Quiz competition, 59th Annual National Conference of Association of Physiologists and Pharmacologists of India on Decades of Research in Physiology and Pharmacology: Reminderstorememberandfocus. Mr. Vidyadhara DJ and Mr. Vijayakumar K Neurovirology Dr.VRavi,Professor&Head,(i)receivedExcellenceinVirology Award,IndianVirologySociety,foroutstandingcontributions to Medical Virology, Asia Pacific Congress of Virology, Amity University, New Delhi, 16-20 December 2013. (ii) Member, InstituteBody,AcademicCouncil,StandingFinanceCommittee, StandingSectionCommitteeofAIIMS,Raipur. 34 / National Institute of Mental Health and Neuro Sciences Annual Report Dr. V Ravi, receiving the “Excellence in Virology” Award from the Chancellor of Amity University Dr. Anita Desai, Additional Professor, (i) invited by (a) Department of Communicable Diseases, World Health Organization,andRegionalOfficeforSouthEastAsiatoassess the Public Health Laboratories, Male, Maldives, 11-17 August 2013 (b) WHO SEARO as faculty on the HIV - Point of Care Diagnosticsworkshop,NARI,Pune,20-24August2013. Nursing Dr. K Lalitha, Professor & Head, (i) Chief Guest (a) Nurses’ Week Valedictory Function, St. John’s National Academy of Health Sciences, College of Nursing, Bangalore, 10 May 2013 (b) International Conference on Group Dynamics, Krishna Institute of Nursing Sciences, Nellore, Andhra Pradesh, 26 July2013(c)NationalNursingConference,GangaInstituteof HealthSciences,Coimbatore,14September2013(d)National Conference, Dhanalakshmi Srinivasan College of Nursing, Perambalur, Tamil Nadu, 12 October 2013 (e) Lamp Lighting Ceremonyof12thBatchofGNMStudentsand11thBatchofBSc Nursing Students, Narayana Hrudayalaya College of Nursing, Bangalore, 20 December 2013 (f) Lamp Lighting Ceremony, Kempegowda Institute of Nursing Sciences, Bangalore, 6 March2014(ii)GuestofHonour,National-levelWorkshopon BuildingontheBest:AccentuatingYourExpertiseinResearch andStatisticsforthebenefitofnursingpersonnel,Continuing EducationDepartment,JSSCollegeofNursing,MysoreandI and II year M.Sc. students, 16 December 2013 (iii) Member, SchoolofHealthSciences,IGNOU,NewDelhi(iv)Member(a) SNEHProject,ShareIndia(b)GoverningBodyofRVSInstitute of Health Sciences, Coimbatore, (c) Board of Studies Mother Theresa Post Graduate and Research Institute of Health Sciences, Puducherry (d) PhD Committee, School of Health Sciences,IGNOU,NewDelhi(e)WorkingCommitteeKHSDRP HealthandFamilyWelfareDepartmentGovt.ofKarnataka,(f) GoverningCouncilforNursing,PIMS,Pondicherry(g)Boardof StudiesofPIMS,PondicherryforUG/PG(h)GoverningCouncil Member of R.V.S Educational Trust, Coimbatore (i) Advisory BoardofGoverningBody,InstituteofNursingScienceStudies andResearch(INSSR),Gwalior,MadhyaPradesh(j)Boardof 2013-14 StudiesinNursingforframingofsyllabusforvariousNursing CoursesofSri.BalajiVidyapeethUniversity,Pillaiyarkuppam, Pondicherry (k) Peer Review Committee, TNAI Editorial Advisory Board (EAB) (l) Reviewer, NITTE Nursing Journal (m) Editorial Board, Journal of Krishna Institute of Medical Sciences University (n) Editorial Board, Nursing Journal of India(o)EditorialBoard,Prism’sNursingPracticeJournalof ClinicalNursingEducation,TrainingandCareerDevelopment. (iv) Chaired session on ‘Innovation in Psychiatric Nursing Rehabilitation Services’, National Conference on Psychiatric Rehabilitation: Focus on Recovery, NIMHANS, Bangalore, 8 March,2014. Dr.K.Reddemma,SeniorProfessor,(i)invitee(a)Emergency General Body Meeting, Indian Nursing Council, New Delhi, 22 June 2013 (b) Third Meeting of the National Council for ClinicalEstablishment,MinistryofHealthandFamilyWelfare (MHWF), Resource Centre, Nirman Bhavan, New Delhi, 24 June2013. Dr. Ramachandra, Additional Professor, (i) Guest of Honour (a) “Deepaloka” and “Padavidharotsava”, IKON Nursing College, Bidadi, 12 July 2013 (b) Annual Day Function, Jupiter College of Nursing, Bangalore, 28 February 2014 (ii) Chief Guest (a) Inaugural Programme, Session on Glance on Complementary and Alternative Therapies, State-level Conference on Complementary and Alternative Therapies in Psychiatry, Nursing Delegates, Laxmi Memorial College of Nursing, Mangalore, 28 November 2013 (b) Lamp Lighting CeremonyfortheBScNursing2013Batchstudents,JIPMER, Pondicherry, 31 January 2014 (iii) Member, Core Group Committee, Core Group of National Consortium for PhD in Nursing,IndianNursingCouncil,NewDelhi. Dr. Sailaxmi Gandhi, Assistant Professor, receiving the prestigious National Florence Nightingale Award from the Hon’ble President of India Shri. Pranab Mukherjee at the Rashtrapati Bhavan, New Delhi Dr. Sailaxmi Gandhi, Assistant Professor, (i) received the prestigious National Florence Nightingale Award from the Hon’ble President of India attheRashtrapatiBhavan, National Institute of Mental Health and Neuro Sciences / 35 Annual Report 2013-14 NewDelhiontheoccasionofNursesDay2014 (ii)ChiefGuest, Valedictory Function, Workshop on Nursing Informatics, Narayana Hrudayalaya College of Nursing, Bangalore, 27 November 2013 (iii) Associate Editor, Journal of RGUHS NursingsciencespublishedbyRGUHS,Bangalore(iv)Specialty fieldeditor,IndianJournalofPsychiatricNursing(v)Member (a)AdvisoryBoardfortheIndianJournalofContinuingNursing Education published by CMC College of Nursing, Vellore (b) Local Editorial Board, Journal of Psychosocial Rehabilitation andMentalHealth(vi)Reviewer,SageOpenJournals. Dr. Prasanthi Nattala, Assistant Professor, Winner of ‘Teach OutoftheBox’CompetitiononInnovativeTeachingMethods, 2ndJointConferenceoftheNationalInstituteofMentalHealth andNeuroSciences,India,andRoyalCollegeofPsychiatrists, UK(NIMRCPSYCON),TeachingMethodpresented:Integrated audio visual aided interactive relapse prevention intervention forindividualswithalcoholdependence,8March2014. Mr. S Shankaraiah, Sr. Nursing Tutor, felicitated at the 12thNationalConferenceofISPN,St.John’sCollegeofNursing, Bangalore. Smt.AVimalaMonicaandSri.PrasannaKumarG,StaffNurses, awarded‘BestNurses’fortheyear2012-13ontheoccasionof InternationalNursesDay,15May2013. Psychiatry Dr. Mathew Varghese, Professor & Head, (i) Member (a) Technical Advisory Committee, Longitudinal Ageing Study in India (LASI), International Institute for Population Studies, Mumbai(b)WHOConsultationGroupontheClassificationof Behavioural and Psychological Symptoms in Neurocognitive Disorders for ICD-11, WHO, Geneva (c) Executive Board, InternationalNeuropsychiatricAssociation. Dr. SK Chaturvedi, Professor, (i) Member (a) Committee constituted to look into the structure and system of CIP Ranchi, under the Chairmanship of Ms. Sujaya Krishnan, Joint Secretary, Ministry of Health & Family Welfare, Govt. of India, New Delhi (b) International Advisory Board, International Journal of Social Psychiatry, UK (c) Editorial Board,InternationalPsychiatry,RoyalCollegeofPsychiatrists, UK (ii) Expert Core Group member, MOHFW, IPS and PHFI on Training Programme for Primary Care Doctors on Mental Disorders (iii) Chairperson, PG Training Taskforce, Indian PsychiatricSociety(iv)Editor-in-Chief,JournalofPsychosocial Rehabilitation&MentalHealth,SpringerVerlag,2014. Dr. Prabha S Chandra, Professor, Fellow of the National AcademyofMedicalSciences–FAMSawardedin2013. Mrs. H. Dorothy Paripoornam, Staff Nurse, receiving the State Florence Nightingale Award from the Hon’ble Chief Minister of Karnataka Shri. Siddaramaiah Dr. Pratima Murthy, Professor, (i) Member (a) IRB, Karuna Trust(b)ICMRtaskforceondrugabuseinPunjab,ICMR,New Delhi (c) Local Editorial Board, the Journal of Psychosocial RehabilitationandMentalHealth(ii)Adhocreviewer:IndianJ Psychiatry;SubstanceAbuseTreatment,Prevention,andPolicy; IndianJMedicalResearch,JournalforIndianAssociationfor ChildandAdolescentPsychiatry. Mrs.H.DorothyParipoornam,StaffNurse,receivedthe State Florence Nightingale Award from the Hon’ble Chief Minister of Karnataka at VidhanaSoudha,Bangaloreonthe occasionofNursesDay2014 Dr. YC Janardhan Reddy, Professor, Member, WHO International Advisory Group for Revision of ICD-10 Mental andBehavioralDisorders:WorkingGroupontheClassification ofObsessive-CompulsiveandRelatedDisorders. Smt. Bhanu MR, Staff Nurse, received ‘Florence Nightingale Award’,institutedbyC.KrishniahChetty&SonsFoundation, Bangalore,ontheoccasionofInternationalNursesDay2013, 15May2013. Dr.VivekBenegal,Professor,(i)Member(a)TechnicalAdvisory Group on Alcohol Control, Government of India, (2013–till date)(b)NationalCommitteeofExpertsonHarmReduction, MinistryofFinance,GovernmentofIndia(c)FacultySelection 36 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 Committee,LGBRegionalInstituteofMentalHealth,Tezpur, Assam, (2012–till date) (d) Screening Committee, National AwardsforOutstandingServicesinPreventionofAlcoholand DrugAbuse,2013. (iii) Felicitated by School of Social Work, Roshni Nilaya, Mangalore and Roshini Alumini Association, in recognition ofhisprofessionalcontributioninSocialWork,CenturyClub, Bangalore,19October2013. Dr. G Venkatasubramanian, Additional Professor, received Professor Raguram Distinguished Young Teacher Award, IndianPsychiatricSociety(KarnatakaChapter). Dr. R Dhanashekara Pandian, Additional Professor, (i) Honorary Board Member (a) International Alcohol and Drug Counselor’sCertificationTrustforIndia(IADCC)(b)Academic Council, Madurai Institute of Social Sciences, Madurai (ii) Honorary Treasurer, Indian Society of Professional Social Work(ISPSW),22January2014 Dr. CN Janardhanan, Assistant Professor, Editorial Board Member,WorldJournalofClinicalCaseReports. Psychiatric Social Work Dr. K Sekar, Professor & Head, (i) President, Indian Society ofProfessionalSocialWork(ii)Treasurer,IndianAssociation of Social Work Educators, TISS, Mumbai (iii) Member (a) Board of Exam in Punjab University, Patiala (b) Board of Appointment, Examination, Central University of Karnataka, Gulburga (c) Board of Studies and Examination, LGBRIMH, GauhatiUniversity,Tezpur(iv) Coregroupmember,National Guidelines on Minimal Standards in provision of relief for women and children in disaster. NDMA, Ministry of Home Affairs, Govt. of India (v) Board Member, Institute for Youth Development,Bangalore. Dr. N Krishna Reddy, Additional Professor, (i) Honoured for special contribution in De-Addiction services in Bangalore, People’s Awareness programme, Federation of De-Addiction and Rehabilitation Centres for Chemical Substance Abuses (FEDRCSA), Ravindra Kalakshethra, Bangalore, 8 January 2014 (ii) Re-elected as Vice President, ISPSW, 2014-2015 Dr. Ameer Hamza, Associate Professor, (i) Chairperson, 32nd ANC, ISPSW Conference, Bijapur, Karnataka (ii) General Secretary,IndianSocietyofProfessionalSocialWork(iii)Ethics CommitteeMember,NationalInstituteofUnaniMedicine. Psychopharmacology Dr. Chittaranjan Andrade, Professor, (i) Chairperson, Indian PsychiatricSocietyTaskForceonPositionStatements(ii)Member, EditorialBoard,JournalofClinicalPsychiatry(iii)AdvisoryBoard Member,IndianAssociationofPrivatePsychiatry. Speech Pathology and Audiology Dr.NShivashankar,Professor&Head,Chairperson,Seva-inAction,Bangalore. Dr.MJayaram,Sr.Professor,(i)Member(a)AcademicCouncil, AYJNationalInstitutefortheHearingHandicapped,Mumbai (b)ExpertCommittee,RCIInspections. National Institute of Mental Health and Neuro Sciences / 37 Annual Report 2013-14 Photo:Dr.GautamK,Prof.BNGangadhar,Dept.ofPsychiatry,NIMHANS 38 / National Institute of Mental Health and Neuro Sciences Visitors to NIMHANS 1. Prof. Narinder Kapur, Visiting Professor of Neuropsychology,ResearchDept.ofClinical,Educational and Health Psychology, University College London, visited the Dept. of Clinical Psychology, and spoke on ‘Penetratingheadinjuryandmemory’,4April2013. 2. Dr. Thomas H Bak, Lecturer, Human Cognitive Neuroscience(HCN)andCenterforCognitiveAgingand CognitiveEpidemiology(CCACE),SchoolofPhilosophy, Psychology and Language (PPLS), University of Edinburgh,visitedtheDept.ofClinicalPsychologyand spoke on ‘Impact of linguistic diversity on aphasia and cognition’,4April2013. 3. Dr.JNathan,Neurophysician,Mumbai,visitedtheDept. ofNeurologyanddeliveredaguestlectureon‘Ketogenic dietindifficulttotreatepilepsy’,27April2013. 4. Dr. Bontha V Babu, Scientist-E (Deputy Director General), ICMR, New Delhi, visited the Dept. of PsychiatricSocialWork,andspokeon‘Writingproposal forResearchGrants’,4May2013. 5. Prof. S Prasad, Biochemistry and Molecular Biology Laboratory, Department of Zoology, Banaras Hindu University, Varanasi, visited the Dept. of Neurophysiology,andspokeon‘Cellularandmolecular basisofdiabetesmellitusinducedlearningandmemory impairmentandneuro-protectiveroleofbrahmiextract inmice’,13May2013. 6. Dr. Devashish Sengupta, Assistant Professor, Dept. of Organic Chemistry, Assam University, Silchar, Assam, visitedtheDept.ofNeurochemistry,andspokeon‘Nanoassistedorganicphotosensitizers:Theirdesign,synthesis, characterizationandbothlightactivatedand/ornon-light activatedbiologicalapplications’,29May2013. 7. Dr. Mohan Issac, Professor of Psychiatry, University of Western Australia, visited the Dept. of Epidemiology, andspokeon(a)‘IntegrationofNMHP&DHPatdistrict levelDHPBellarymodel’,31May2013(b)‘Community MentalHealthProgramme’,19December2013. 8. Dr. Arthi Kanthasamy, Associate Professor, Dept. of BiomedicalSciences,IowaStateUniversity,Ames,USA Annual Report 2013-14 visited the Dept. of Neurochemistry, and delivered a lecture on ‘Histone modification and dopaminergic neurodegeneration: Relevance to etiopathogenesis of Parkinson’sdisease’,24June2013. 9. Dr.AnumanthaKanthasamy,Professor&Chair,Dept.of BiomedicalSciences,IowaStateUniversity,Ames,USA visitedtheDept.ofNeurochemistry,24June2013. 10. Dr. Monica Vavilala, Professor of Anesthesiology and Pediatrics, University of Washington, Seattle, WA, USA visitedtheDept.ofNeuroanaesthesia,anddeliveredalecture on‘Managementofthepediatricheadinjuries’,29June2013. 11. Prof.MKUnnikrishnan,ManipalCollegeofPharmaSciences, Manipal University, visited the Dept. of Neurophysiology, andspokeon‘Theexceptionreportmodeloffacerecognition: Theevolutionarylinkbetweenperceptionofbeautyandthe recognitionofindividuality’,29June2013. 12. Dr. C Shamasundar, Retd. Professor of Psychiatry, NIMHANS, Bangalore, visited the Dept. of Neurophysiology, and spoke on ‘Science & Religion in India:AHistoricalPerspective’,1July2013. 13. Dr. Aravindan Natarajan, Assistant Professor of Social Work,UniversityofToledo,Ohio,USA,visitedtheDept. ofPsychiatricSocialWork,andspokeon‘Exploringuse ofartsinqualitativeresearch’,3July2013. Dr. Robert D Stevens and Dr. Akhilesh Pandey from Johns Hopkins University with the Director/Vice-Chancellor, NIMHANS 14. AdelegationfromJohnsHopkinsUniversity,USAledby Dr.RobertDStevens,AssociateProfessor,Departments of Anesthesiology/Critical Care Medicine, Neurology, National Institute of Mental Health and Neuro Sciences / 39 Annual Report 2013-14 Neurosurgery and Radiology, Dr. Akhilesh Pandey, Professor of Biological Chemistry and Mr. Dominic SeraphinvisitedNIMHANS,11-12July2013. 15. Dr.PruthvishS,ProfessorofCommunityMedicine,MS Ramaiah Medical College, Bangalore, visited the Dept. ofEpidemiologyanddeliveredalectureon‘Community based rehabilitation of persons with disability’, 30 July 2013. 16. Dr.ArunAngeloPatil,Prof.ofSurgery,NebraskaMedical Centre, Omaha, NE visited the Dept. of Neurology, and spoke on ‘Long term outcome of Hippocampal transactionforrefractoryepilepsy’,8August2013. 17. A delegation of Government Officials from Sri Lanka: Mr. Sanjeev Tanpatta, National Hospital of Sri Lanka, Colombo;Dr.SriromiMDeSilvaMaduwage,Consultant, Community Practice, Ministry of Health, Colombo, Mr. Subhabrata Samal, Rehabilitation Coordinator, Handicap International; Dr. P Karthikeyan, Regional Director of Health, Kilinochchi; Dr. SHM De Silva, HeadofRehabilitationDepartment,NationalChildren’s Hospital, Colombo; Ms. SC Koralagama, Manager, P&O Dept., National Children’s Hospital, Colombo; Dr. WLLUC Kumarathilake, Director, Disability and DisplacedPersons,MinistryofHealth,Colombo;Dr.LM Navaratnarajah, Deputy Director, Teaching Hospital, Batticaloa;Mr.RSSelvaretnam,Manager,Rehabilitation Centre, Teaching Hospital, Batticaloa; Mr. Nadaraj Thileepan, General Secretary, National Occupational Therapy Association; Mr. HPU Mihiran, Executive Member, National P&O Society; Mr. TMU Sanjeewa Tunpattu, General Secretary, National Physiotherapy Association,visitedtheDept.ofPsychiatricRehabilitation Service,8August2013. 18. Prof. Tom Solomon and his team of faculty from the UniversityofLiverpool,UKvisitedNIMHANSon12-14 August2013. A team of faculty from the University of Liverpool led by Prof. Tom Solomon 19. Prof. Shu Leong HO, Henry G Leong Professor in Neurology and Chief of Division in Neurology, DepartmentofMedicine,TheUniversityofHongKong, delivered a lecture on ‘Disease progress modification in Parkinson’s disease’. Prof. LEE Tatia Mei-chun, May Professor in Neuropsychology and Chair Prof. of Psychology, Honorary Professor, Department of Psychiatry and Department of Medicine, The University of Hong Kong delivered a lecture on ‘SocialAffectiveNeuroscience:Emotionrecognitation and regulation’. Prof. Li-Hai TAN, Professor of Linguistics and Brain and Cognitive Sciences, School of Humanities (Linguistics), Founder and Director, StateKeyLaboratoryofBrainandCognitiveSciences, ‘The University of Hong Kong delivered a lecture on Brain mechanism of language: Universal or culture– specific?’,20August2013. 20. Prof. Dinesh Bhugra, Professor of Mental Health and CulturalDiversity,InstituteofPsychiatry(KCL),London, President–Elect, World Psychiatric Association, visited theDepartmentofPsychiatry,NIMHANS,anddelivered a lecture on “Prevention of Mental Disorders” on 23 August2013. 21. Dr. David Clifford, Professor of Neurology, St Louis School of Medicine, Washington University, USA, and Dr. Avindra Nath, Clinical Director of NINDS, Chief, Section of Infections of Nervous System, NIH, USA visitedNIMHANSon29August2013. A delegation of Government Officials from Sri Lanka 40 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 Transitions in Potassium Channels during Gating’, 24 September2013. 28. Dr. Tanya Machado, Professor of Clinical Psychology, and Dr. Vijaya Raman, Associate Professor of Clinical Psychology, Dr. Vidya Sathyanarayanan, Associate Professor of Clinical Psychology, St. John’s Medical College & Hospital, Bangalore, visited the Dept. of ClinicalPsychology,andspokeon‘ClinicalPsychologyin ConsultationLiasonSetting’,29September2013. 29. Dr. Meenakshi Venkataraman, USA, visited the Dept. of Psychiatric Social Work, and spoke on ‘Social work theories: positives, problems and specified’, 10 and 17 October2013. 30. Ms. Stuti Kacker, Secretary to GOI, Dept. of Disability Affairs, Ministry of Social Justice and Empowerment and Mr. KVS Rao, Director, Dept. of Disability Affairs, MinistryofSocialJusticeandEmpowermentvisitedthe Dept. of Psychiatric Rehabilitation Service, 24 October 2013. Dr. David Clifford, Professor of Neurology, St Louis School of Medicine, Washington University, USA 22. Dr. Sudhakar Subramani, Associate Professor of Anaesthesiology, Iowa State University, Ames, USA, visited the Dept. of Neuroanaesthesia, and spoke on ‘Hemodynamic assessment using echocardiography’, 2 September2013. 23. Dr. Chetan Rao, Assistant Professor of Neurocritical Care, and Director of Neurocritical Care, Bayer College of Medicine, Houston, Texas, USA visited the Dept. of Neuroanaesthesia, and spoke on ‘Evidence based acute managementofischemicstrokeandneurocriticalcare’, 3September2013. 24. Dr. Rajasekaran, San Diego Healthcare System, CA, US,visitedtheDept.ofNeurophysiology,andspokeon ‘Experimental models for evaluation of genito-urinary andpelvicfloordisorders’,3September2013. 25. Dr.RajanGurukkalSoundararajan,Chairperson,Centre for Contemporary Studies, IISc, Bangalore, visited the Dept. of Psychiatric Social Work, and spoke on ‘Social theoryofknowledgeproduction’,18September2013. 26. 27. Prof. Waltraud Ernst, Professor, History of Medicine, Oxford Brookes University, visited NIMHANS and presented a paper on History of Psychiatry in India at a seminar on “Institutional mortality rates, long-term confinement and causes of death in an Indian Mental Hospitalduringtheearlytwentiethcentury”,Department ofPsychiatry,12September2013. Raghuraman H, Scientist, Department of Biochemistry andMolecularBiology,TheUniversityofChicago,USA, visitedtheDept.ofBiophysicsandspokeon‘Dynamics Ms. Stuti Kacker, Secretary to GOI, Dept. of Disability Affairs, Ministry of Social Justice and Empowerment and Mr. KVS Rao, Director, Dept. of Disability Affairs, Ministry of Social Justice and Empowerment 31. Dr. Narendranath, Professor & Head of Hospital Administration, MS Ramaiah Medical College, Bangalore, visited the Dept. of Epidemiology, and spokeon‘Introductiontomanagementofinventoryand HumanResourcemanagement’,29October2013. 32. Mr.ParassinrajTS,SeniorExecutivePWD;Ms.Nelufer B,CenterCo-OrdinatorPWD;Reddy’sFoundation;Ms. Sangeeta K, Assistant Manager/Operations, Dr. Reddy FoundationvisitedtheDept.ofPsychiatricRehabilitation Service,30October2013. National Institute of Mental Health and Neuro Sciences / 41 Annual Report 2013-14 33. Prof.NancyReynolds,YaleUniversity,visitedtheDept. of Psychiatry, and spoke on ‘Medication Adherence in themedicallyill’,31October2013. 34. A team of faculty from Deakin University, Melbourne, Australia visited NIMHANS and discussed possible collaborations with the Department of Clinical Psychologyon18-19November2013. 37. Prof. Thomas Metzinger, Professor of Theoretical Philosophy, Johannes Gutenberg University Mainz, visitedtheDept.ofPsychiatry,anddeliveredalectureon thetopic‘FromNeuroethicstoConsciousnessEthics’,3 December2013. 38. Mr.CKMishra,AdditionalSecretary,MinistryofHealth & Family Welfare, GOI, visited the Dept. of Psychiatric RehabilitationService,4December2013. 39. Dr.RobertK.Shepherd,Director,BionicsInstituteand Professor of Medical Bionics, University of Melbourne, AustraliavisitedNBRCandtheDept.ofNeurophysiology, and delivered a lecture on ‘Medical bionics: Neural interfacesfordamagednerves’,5December2013. 40. Dr. DM McLaughlin, TCD, Ireland, visited the Dept. of PsychiatricRehabilitationservice,6December2013 41. Prof. Harry Steinbusch, Director of Clinical Neurosciences, Maastricht University, Netherlands, visitedNIMHANSanddeliveredalectureon“Brainstem DysfunctioninNeurodevelopmentandNeuropsychiatric Disorders—MovingfromForebraintotheBrainstem”,7 December2013. A team of faculty from Deakin University, Melbourne, Australia 35. Dr.UpendraBhojani,Faculty,InstituteofPublicHealth, BangalorevisitedtheDept.ofEpidemiology,andspoke on‘Healthpromotion’,16November2013. 36. Prof.Dr.HabilUlrikeM.Ludtke,DepartmentofSpeech and Language Pedagogy & Therapy, Leibniz University of Hannover, Germany visited the Dept. of Speech Pathology and Audiology, and spoke on ‘Early child languagedevelopmentlab’,19November2013. Prof. Harry Steinbusch, Director of Clinical Neurosciences, Maastricht University, Netherlands 42. Dr.JogiVPattisapu,PaediatricNeurosurgeon,Flordia, USAvisitedtheDept.ofNeurosurgeryandgavealecture demonstration,9December2013. 43. Dr. Jean Louis Lamboray, Founder & Chairperson, Constellation for Community Life Competence, visited the Dept. of Psychiatric Social Work, and spoke on Prof. Thomas Metzinger, Professor of Theoretical Philosophy, Johannes Gutenberg University Mainz 42 / National Institute of Mental Health and Neuro Sciences Annual Report ‘Strengthbasedapproachtocommunitydevelopment’,9 December2013. 44. Dr.SiyaramPandey,Professor,DepartmentofChemistry and Biochemistry, University of Windsor Essex Hall, Ontario, Canada, visited the Dept. of Neurochemistry, and delivered a lecture on ‘Halting Progression of Neurodegeneration by Water-Soluble CoQ10 in Rat andMouseModelsofSporadicandGeneticParkision’s Disease’,11December2013. 45. Dr. Anita Jain, Editor (India), British Medical Journal India visited the Dept. of Epidemiology, and spoke on ‘Ethics and quality of medical research in India’, 18 December2013. 46. Ms. Achla Singh, Director (SW), Department of Social Welfare, Govt. of NCT of Delhi with Mr. N Agarwal, Dr. BS Banerjee, Mr. V Kapur, Govt. of NCT of Delhi, visitedtheDept.ofPsychiatricRehabilitationService,18 December2013. 47. 2013-14 50. Dr.RMubarakAli,Faculty,Dept.ofSocialWork,Flinder’s University, Adelaide, visited to the Dept. of Psychiatric Social Work, and spoke on ‘Internet technology – use and abuse: role of mental health professionals’, 13 January2014. 51. Prof. Mathias Berger. Director of Psychiatry and Psychotherapy,UniversityHospitalFreiburg,Germany, visited the Dept. of Clinical Psychology and spoke on ‘Cognitivetherapyfordepression’,15January2014. 52. Prof. Lakshmi N Yatham, Director, Mood Disorders Clinical Research Unit, The University of British Columbia, visited the Dept. of Psychiatry, and spoke on ‘Recent advances in diagnosis and management of bipolardisorder’,16January2014. 53. Dr.AntonyGuyMarsonfromtheUniversityofLiverpool visitedtheDept.ofNeurology,andspokeon‘Predicting seizure outcome following a first seizure and new epilepsy’,17January2014. Dr. Finsterer J, Professor of Neurology, University of Vienna, Austria, visited the Dept. of Neurology, and delivered a lecture on Phenotypic Features of MitochondrialDisorders,on21December2013. Dr. Antony Guy Marson, University of Liverpool 54. Dr. T Hemanth, Professor of Community Medicine, MS Ramaiah Medical College, visited the Dept. of Epidemiology, and spoke on ‘Dioxins and furans from biomedical waste and its health impacts’, 20 January 2014. 55. Dr. Surendra VHH, Joint Director, Dept. of Factories, Boilers, Industrial Safety and Health, Government of KarnatakavisitedtheDept.ofEpidemiology,andspoke on‘TheIndianfactoriesactincontextofmentalhealth’, 21January2014. 56. Dr. Govindaiah, Scientist, University of Louisville, Kentucky, USA, visited the Dept. of Neurophysiology, andspokeon‘Optogeneticsapproachesinneuroscience’, 28January2014. Dr. Finsterer J, Professor of Neurology, University of Vienna, Austria 48. Dr. Mohan Issac, Professor of Psychiatry, University of Western Australia, visited the Dept. of Psychiatry, and spokeon‘CommunityPsychiatry’,16-23December2013. 49. Dr.ChitraDMandyam,AssociateProfessor,Committee on Neurobiuology of Addicitive Disorders, The Scripps ResearchInstitute,LaJolla,CA,USA,visitedtheDept. ofNeurophysiology,andspokeon‘Relationshipbetween hippocampal neurogenesis and methamphetamine dependence:HopeorHype?,on27December2013. National Institute of Mental Health and Neuro Sciences / 43 Annual Report 57. 2013-14 Prof.SanjeevArora,DirectorofProjectECHO(Extension for Community Healthcare Outcomes), University of New Mexico Health Sciences Center (UNMHSC), Albuquerque, USA visited the Dept. of Psychiatry and spoke on ‘Project ECHO (Extension of Community Healthcare Outcome) model and its replication efforts acrossdifferentpartsoftheworld’,10February2014. Prof. Sanjeev Arora, Director of Project ECHO (Extension for Community Healthcare Outcomes), University of New Mexico Health Sciences Center (UNMHSC), USA 58. Dr.BrigitteSebastia,Anthropologist,FrenchInstituteof Pondicherry,visitedtheDept.ofPsychiatryandspokeon ‘Filmscreeninganddiscussion’,18February2014. 59. Dr.MSKeshavan,StanleyCobbProfessorofPsychiatry,Beth Israel Deaconess Medical Center, Harvard, Boston, visited theDept.ofPsychiatryandspokeon‘Currentperspectives onPsychiatricclassification’,20February2014. 60. Bernadette Abela, Team leader, Neglected Zoonotic Diseases,WHO,Geneva,andGyanendraGongal,Disease Surveillance&Epidemiology,WHOSEARO,NewDelhi, visitedtheDept.ofNeurovirology,22February2014. 61. Prof. Dr. Be-Hazir Ahmed,Disease Control, DGHS, Bangladesh, visited the Dept. of Neurovirology, 22 February2014. 62. Dr. Plavi Mittal, President and CEO, Jain Foundation, USA, visited the Dept. of Neurology, and spoke on ‘EndingthediagnosticOdysseyforLGMDpatients’,28 February2014. 63. Dr.SrinivasBabu,ProfessorofClinicalNeurophysiology, CMC, Vellore, Tamil Nadu, visited the Dept. of Neuroanaesthesia and spoke on ‘Intraoperative neurophysiologymonitoring’,1March2014. 64. AteamoffacultyfromUniversityofLiverpoolheadedby Dr.RobertSHydermanvisitedtheDept.ofNeurovirology and the Dept. of Psychiatry, and spoke on ‘Bacterial MeningitisinAfrica:newinsightsintooldproblem’,14 March2014. 65. Prof. Neil French, Dept. of Clinical Infection, Royal Liverpool & Broadgreen University Hospital Trust, visitedtheDept.ofPsychiatry,andspokeon‘Adjuvant therapiesandVaccinesinbacterialmeningitis’,14March 2014 66. Dr. Lisa FP, University of Liverpool, visited the Dept. of Neurovirology, and spoke on Chikungunya virus infections-immunologicalaspects’,17March2014. 67. Dr. Andrew Amos Channon, Senior Lecturer and Dr. ClaireBailey,Lecturer,DivisionofSocialStatistics and Demography, University of Southampton, UK with a groupofstudents(12)visitedtheDept.ofMentalHealth Education, and delivered a lecture on ‘Importance of qualitative methods in ethical research on culturally sensitivehealthissues’,25March2014. A team of faculty and students from Division of Social Statistics and Demography, University of Southampton, UK 44 / National Institute of Mental Health and Neuro Sciences 2013-14 Annual Report Patient Care Activities REGISTRATIONS PSYCHIATRY CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 25000 NO. OF PATIENTS 20000 SCREENING 15000 10000 120000 5000 08-09 09-10 10-11 11-12 12-13 NO. OF PATIENTS 0 100000 13-14 YEARS 80000 60000 40000 20000 0 08-09 09-10 10-11 11-12 12-13 13-14 YEARS EMERGENCIES (CASUALTY) PSYCHIATRY CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 20000 18000 16000 ADMISSIONS 12000 10000 PSYCHIATRY 8000 CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 7000 6000 4000 6000 2000 5000 0 08-09 09-10 10-11 11-12 YEARS 12-13 13-14 NO. OF PATIENTS NO. OF PATIENTS 14000 4000 3000 2000 1000 0 08-09 09-10 10-11 11-12 12-13 13-14 YEARS National Institute of Mental Health and Neuro Sciences / 45 Annual Report 2013-14 DISCHARGES PSYCHIATRY CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 6000 4000 FOLLOW-UPS 3000 PSYCHIATRY 2000 140000 1000 120000 0 08-09 09-10 10-11 11-12 12-13 13-14 YEARS NO. OF PATIENTS NO. OF PATIENTS 5000 CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 100000 80000 60000 40000 20000 0 09-10 10-11 11-12 12-13 13-14 YEARS DEATHS PSYCHIATRY CHILD PSYCHIATRY NEUROLOGY NEUROSURGERY 600 NO. OF PATIENTS 500 EXTENSION SERVICES 400 GUNJUR GOWRIBIDANUR MADDUR KANAKAPURA MADHUGIRI SAKALAWARA TURUVEKERE 300 14000 200 12000 100 08-09 09-10 10-11 11-12 YEARS 12-13 10000 13-14 NO. OF PEOPLE 0 8000 6000 4000 2000 0 08-09 09-10 10-11 11-12 YEARS 46 / National Institute of Mental Health and Neuro Sciences 12-13 13-14 Annual Report I. MENTAL HEALTH SERVICES Perinatal Psychiatry Clinic: Newregistrations Follow-ups Mother-BabyUnitinpatientadmissions PSYCHIATRY A. Clinical Services Facilities provided General Adult Psychiatry Services Screening Registrations EmergencyServices Follow-ups Admissions* Discharges Deaths Extension Services Sakalawara Gunjur Gowribidanur Maddur Kanakapura Madhugiri Thuruvekere Centre for Addiction Medicine Newcases Follow-ups Admissions Tele-consultations Psychiatric Rehabilitation Services Day-boarders-averagedailyattendanceto allsections In-patientreferralstoPRS SERWICEpatientsconsultations(outpatientservices) In-patientadmissions(Psychotherapy) Electro-Convulsive Therapy (ECT) services: Newcases Obsessive-Compulsive (OCD) Clinic: Newcases Follow-ups Schizophrenia Clinic Totalcases Geriatric Clinic No.ofelderlyscreened No.ofdetailedevaluation No. of patients / cases 2012-13 2013-14 101816 11883 2028 91240 5675 5234 07 217883 106227 12915 2330 95715 5850 5402 06 228445 5016 21564 12232 2185 5876 2937 2831 3431 549 30041 2516 9782 1107 8900 22305 2668 10218 1091 4837 18814 59 618 578 29 59 935 738 27 61 1345 44 1803 756 5779 6535 882 6512 7394 342 1536 430 1541 1878 1971 1521 1823 3200 375 3575 2986 517 3503 16548 Disorder 2013-14 Metabolic Clinic in Psychiatry Totalcases Telemedicine services: Grand Total B. 114 471 76 661 109 496 69 674 532 162 277961 469 671 295608 Diagnostic Services Facilities provided Toxicology services (Centre for Addiction Medicine) HPTLC-basedtests GC-MS-basedtests Cassette-basedtests C. Specialist Clinic Services 1. Centre for Addiction Medicine No. of patients / cases 2012-13 2013-14 4593 6083 The Centre for Addiction Medicine (CAM) has completed more than two decades of clinical service, training and research in the area of addiction. During the year 2013-14, the CAM registered 2668 new patients, and followed up 10218 patients face-to-face and 4837 via telephone. A total of 1091 patients were admitted to the CAM inpatient ward fortreatment. The Centre offers a comprehensive inpatient programme encompassing individual and family assessment, individually tailoredtreatmentswhichinvolvepharmacologicaltreatments forwithdrawalandlong-termpreventionofrelapse,individual and group counselling, family counselling and intensive aftercare. National Institute of Mental Health and Neuro Sciences / 47 Annual Report 2013-14 In response to the growing public demand for patient care, public awareness, community activity, research and policy, severalnewinitiativeswereinitiated,duringtheyearunder review.The20-beddedinpatientfacilityforsubstance-using women,thefirstofitskindinthe country,isalmostcomplete andtheservicesareexpectedtostartfromJune2014. Thedrug-toxicologylaboratory,whichtestedmorethan6083 samples for drugs and alcohol in urine and blood in the year 2013-14, has added one more e-machine for testing samples tokeepupwiththegrowingdemand.Thelaboratoryhasbeen receivingrequestsfromoutsideagenciesfortoxicologytests,as itistheonlylabwiththisfacilityintheregion. The CAM conducted several research studies on behavioral addictions such as pathological gambling, internet and cell phone addiction, etc. Various services for treating behavioral addictionshavebeenstarted,basedontheresearchfindings. Thegymfacility,startedlastyear,receivedgoodresponseand isusedbypatientsonaregularbasis. days. Facilities for altering the stimulus parameters are also available. EEG monitored ECT is done in select cases, where specificallyindicated. 3. The Family Psychiatry Centre offers both outpatient and inpatient family therapy services. The major services include family therapy, marital therapy, and family intervention for different psychiatric disorders. The centre conducts training programmesfortraineesfromNIMHANSandotherinstitutes across the country in the field of psychiatry, psychology, psychiatry social work and nursing. Basic orientation course andadvancedcourseinfamilytherapyarealsoofferedbythe Centre. The faculty of the Centre were involved in organising variousprogrammesonfamilytherapyindifferentpartsofthe country. Duringtheyear2013-14,atotalof441newfamilieswereseen andmanymorecasesfromthepreviousyearwerefollowedup. 4. CommunitysocialworkersoftheCAMteamcontinuedtoplay avitalroleintheprocessofeducatingandbringingawareness about addiction and recovery in the community. They were alsoactivelyinvolvedinorganizingsubstanceabusecounselling programmesandprovidingtreatmentfortheneedy. “The Centre for Addiction Medicine, NIMHANS is doing extraordinary service to substance users, by way of combining knowledge with services, and research with action. The centre has not limited itself to deliver quality services, but also has developed into a centre of excellence, having components of research, trainings, advocacy, innovations and community outreach.” – External evaluation of the Centre for Addiction Medicine by Voluntary Health Association of India on behalf of the Ministry of Health and Family Welfare, Govt. of India. 2. Electroconvulsive Therapy (ECT) services NIMHANS has a state-of-the-art, purpose built Electroconvulsive Therapy (ECT) suite.The ECT multidisciplinaryteamconsistsofpsychiatrists,anesthetists,nurses, and other dedicated staff members. During the year 2013-14, a total of 882 new patients received ECTs. Total number of ECTs received stood at 6512. Each patient undergoes a preECTevaluation.ECTservicesareprovidedonallOPDworking Family Psychiatry Centre Geriatric Clinic & Services The elderly—above the age of 60 years—who register with the screening outpatient service unit are screened for neuropsychiatric disorders by the Geriatric Group of the Department of Psychiatry. This is mainly to enable the elderly to avail appropriate services and get referrals at a faster pace. Approximately 15 to 20 elderly are screened everyday. GeriatricClinicisrunasaspecialmultidisciplinaryclinicinthe DepartmentofPsychiatryonSaturdays,from2to5.30pm.The team includes psychiatrists, neurologists, neuropsychologists, social workers, residents, and trainees. On average, 8-10 new cases go through brief evaluation, and 4-5 elderly are evaluated in detail—and about 10-15 follow-up patients are seen—everyweek.Intheyearunderreview,272newcaseswere registeredintheGeriatricClinic.Caregiversareprovidedwith necessary support both as individual families and also as a groupdiscussioneveryweek. TheGeriatricGroupalongwiththeDepartmentofEpidemiology is actively engaged in the sensitization programmes and training of BBMP physicians in Bangalore. The Geriatric GroupcollaborateswiththeNIMHANSCentreforWellBeing to provide counselling for the needy elderly and necessary assistance through the Elderly Helpline that was initiated in 2012.TheGeriatricGroupalsoworksactivelywiththeSenior 48 / National Institute of Mental Health and Neuro Sciences Annual Report Citizen Forum in South Bangalore in promoting positive and healthyageing. 5. Obsessive-Compulsive Disorder (OCD) Clinic The OCD clinic was started in 1997 with the objectives of providing high quality clinical service, training mental health professionals and facilitating research in the area of OCD. Severely ill and/or treatment resistant patients with OCD are routinelyadmittedtothewardsforintensivepharmacological andpsychosocialintervention. In the year 2013-14, a total of 430 new cases were registered intheclinicandnumberoffollow-upvisitswas1541.Sixtysix patients were admitted for treatment. Patients from various parts of the country are often referred to the OCD clinic for expertopinionandtreatment. ThespecialtyOCDcliniciswidelyknowninthecountryforits researchactivities. 6. Schizophrenia Clinic SchizophreniaClinicaimsatprovidingcomprehensivecarefor schizophrenia patients. In addition to the ongoing services, a new programme– ORACLES – Objective Risk Assessment Care & Liaison for Early Schizophrenia has been initiated in Schizophrenia Clinic with the support from the Wellcome Trust / DBT India Alliance Senior Fellowship Grant with the following objectives: Focussed early intervention services; betterdelineationofcourseandprognosis;understandingthe clinicalmarkersofmedicationresponse;identifyingthefamily members at risk for close monitoring and care; identification ofprodromalsymptomsandinterventionstopreventpsychosis conversion; initiating early rehabilitation strategies and individualtherapy;involvementoffamiliesintothetreatment/ careinadditiontoreductionofstigmaandexpressedemotions byeducation/familybasedtherapies. Intheyear2013-14,atotalof1823patientswereassessedand treatedattheclinic. 7. 2013-14 Neurosurgery, Neuro-rehabilitation and other clinical departments) and outpatients (referred from Neurology and Neurosurgery departments) who availed the services stood at 265and252respectively. The CLP has initiated two new outpatient services to attend toreferralsandenhanceawarenessofmentalillnessamongst patients with chronic chest diseases and diabetes—one at the SDS Tuberculosis & Rajiv Gandhi Institute of Chest Disease, Bangalore(where117referralswereattendedto),andtheother attheNGO-fundedJnanaSanjeevaniMedicalCentre(Diabetes clinic, where 96 referrals were attended to). Psychiatric care wasalsoprovidedtopatientsfromNIMHANSCentreforWell BeingbytheCLPteam. CLPconductedseveraljointneuropsychiatriccasediscussions in collaboration with the Dept. of Neurology. Between April 2013 and March 2014, the CLP Team has been involved in various academic programs. Workshops were conducted to enhance awareness of Mental illness and its role in physical illness and well-being in SDS Tuberculosis & Rajiv Gandhi Institute of Chest Disease, Bangalore and Jnana Sanjeevani Medicalcentre.Additionally,aworkshopwasconductedbythe CLP team on Breaking Bad News and Communication Skills atNIMHANSforvariousMedicine,NeurologyandPsychiatry residentspostedtotheCLPservice. 8. Emergency Psychiatry and Acute Care (EPAC) Services TheEmergencyPsychiatryandAcuteCare(EPAC)servicesunit provides24-hourcareforpatientspresentingwithpsychiatric symptoms in emergencies. EPAC services were utilized by 6252patientsatanaverageof521patientspermonth,inthe year under review. Structural modifications to the ward were made to enhance patient care, safety and improve workplace conditions. Identifying the need for care for specific patients, EPAC has been involved in the planning, implementation and initiation of a Priority Wards—SAFER Ward (Safety and Facilitate Early Recovery) and ASIST Ward (Applied Suicide Intervention, Support and Treatment)—to manage patients withhighrisktoselfandothers. Consultation Liaison Psychiatry Services TheConsultationLiaisonPsychiatry(CLP)Serviceshaveseen a significant increase in referrals, indicative of the enhanced service and care offered by the CLP team to patients. In 2013-14, the number of inpatients (referred from Neurology, The EPAC team has developed two separate risk monitoring forms-RisktoSelfandRisktoothersandmodifiedtheCritical IncidentReportingFormandCriticalIncidentReportingSOP tofacilitateimprovementsinoverallqualitycareandminimize thelikelihoodofadverseevents. National Institute of Mental Health and Neuro Sciences / 49 Annual Report 9. 2013-14 Community Psychiatry Services The extension out-patient department/camp services of Community Psychiatry NIMHANS was first started in 1978 at Sakalawara (Bangalore Rural) with the primary goal of identifying mentalmorbidityandtreatingthemwiththehelp ofprimarycarephysiciansworkingatcommunityhealthcare centres.Itwasalsodonetoencouragecommunityparticipation whichinturnwouldhelpinthereductionofstigmaassociated withmentalillness. has initiated revised special clinical assessment protocols namely–METASCAN(METAbolicAssessmentinpsychoseS: ClinicalAssessment&Neurobiology)withbaselineandfollowup versions with further optimizations. These protocols add ontothetrainingandassessmentinputstotheresidentsand enhancethefocusofclinicalapproach. Number of patients assessed and treated at the Clinic during theyear2013-14was469. 11. In the decades that followed, many primary care physicians weretrainedbyNIMHANSwiththegoalofintegratingcareof thementallyillattheprimary/communitycarelevel.Extension camps/clinics were opened in eight other places of the State, takingthetotaltonine(Anekal,Gowribidanur,Gunjur,Jigani, Kanakapura,Marsur,Maddur,MadhugiriandSakalawara).At present, six extension camps are functioning with Jigani and Marsurhavingbeenwithdrawn. The team of Community Mental Health from NIMHANS, consistingofpsychiatrists,clinicalpsychologists,psychiatricsocial workersandnurses,havebeenprovidingthefollowingservices: 1. 2. 3. 4. 5. 6. 7. 8. Consultationformentallyillpatientstoprovidediagnosis, drug treatment and follow-up management of different mentaldisorders. Consultation for patients with epilepsy to provide diagnosis,drugtreatmentandfollow-upmanagementof differentseizuredisorders. Referralservicesfordifficulttotreatortreatmentresistant patientstoeitherNIMHANSoranyothernearbytertiary carehospital. IEC activities for the patient, family members and the generalpublic. Familyinterventionandhomevisits. Behaviouralinterventions. Disability assessment for mentally ill and mentally retarded individuals (IQ assessment & Disability Certification). Training of other medical and nursing professionals in theTalukhospitals About2000patientsattendedinallthesixextensionclinicsper month. 10. The Metabolic Clinic in Psychiatry: Continuing the focus on evaluating and treating metabolic abnormalitiesinpsychiatry,theMetabolicClinicinPsychiatry Genetic Counseling and Testing Clinic (GCAT) The diagnosis of Ataxias and Huntington’s disease has a major impact on people with the illness and on their families. An accurate diagnosis is important so that the patient can be given appropriate treatment. The GCAT team is involved in the pregeneticcounselling,genetictestingandpost-geneticcounsellingof the patients whose neurological examination has been done by a neurologistandconfirmedtoshowsymptomsofthedisease.Pre- Genetic Counselling involves educating and counselling about the implicationsofthetesting.Genetictestingundertakeninourlabis accurate and reliable. Most people get a result which is definitely normal or definitely abnormal. However, a small number of peoplefallintoa“greyarea”betweenthenormalandtheabnormal range.Post-geneticcounselinginvolvesdisclosureofresultsbythe cliniciankeepinginmindthesensitivenatureoftheissue.About100 individualsandtheirfamiliesavailedtheservicesduringtheyear. NIMHANS CENTRE FOR WELL BEING Facilities provided ConsultationLiaisonPsychiatry MaritalEnrichmentServices PreventiveServicesforAddiction Family Enrichment Services, Premarital Counselling,StressManagementforChildren andAdolescents,ParentingTraining StressManagementandLifestyleClinic PositiveMentalHealthClinic PsychologyClinic Asare(ParentSupportgroup) Grand Total No. of patients/ cases 2012-13 2013-14 186 223 34 42 24 35 102 74 49 40 62 10 507 55 41 80 57 607 A. Clinical Services i. FLOURISH Clinic TheClinicoffersone-to-oneconsultationservicetoadultsfor enhancingtheirwell-beingandself-development.Itisrunona 50 / National Institute of Mental Health and Neuro Sciences Annual Report weeklybasisbythePositivePsychologyUnitatNIMHANS.In theyearunderreview, 42newclientshavebeenregisteredfor receivingconsultationservices,andthenumberofsessionsper clientrangedbetweenthreeandsixasusual. ii. Marital Enrichment Services Atotalof57clientssoughtconsultationattheclinic. iii. Asare Services, NCWB GroupSessionsforparentswereorganizedatAsare.Intheyear underreview,62parentsparticipatedin18groupsessions. iv. Psychology Care Clinic, NCWB About80newclientssoughthelpandwereprovidedwiththe necessaryservicesattheclinic. CHILD & ADOLESCENT PSYCHIATRY A. Clinical Services Facilities provided ChildandAdolescentPsychiatrycases screened Newfilesregistered Follow-ups Admissions Causality&emergency Grand Total No. of patients/ cases 2012-13 2013-14 6489 7063 2453 15402 624 24968 2992 15240 509 57 25861 CLINICAL PSYCHOLOGY A. Clinical Services Behaviouralmedicineintake Behaviouralmedicinetherapy Mentalhandicapcounselling CAPcounseling,remediationandtherapy Adultpsychotherapyandcounseling Familyandmaritaltherapy Psychosocialrehabilitationtherapy CAMtherapies Neuropsychologicalrehabilitationcognitiveretraining Neurofeedbacktherapy New services Communitymentalhealthevaluation Community mental health evaluation (disabilitycertificate) Communitytherapy TBIevidenceinthecourt DPNRevaluation DPNRfollow-up Generalhospitalassessment Generalhospitalintake Generalhospitaltherapyandcounselling Grand Total B. Facilities provided Evaluationofadultcases Evaluationofaddictioncases Follow-upofaddictioncases AdultPsychiatryfollow-up Follow-up:ChildandAdolescentsandMR clinic EvaluationofCAPcases Evaluation of children and adolescents withmentalretardation Therapy/Interventions 997 89 380 5509 460 1100 175 410 7848 390 337 230 240 184 672 440 346 458 881 417 61 180 87 743 409 215 300 1159 382 69 195 105 140 86 153 - 321 195 108 9 290 112 5 231 86 12678 321 7 252 204 3 228 144 15685 Diagnostic Services Facilities provided 2012-13 2013-14 PsychoDiagnosticAssessment 506 854 CAMassessment 72 60 Evaluationofchildandadolescentscases 337 392 Childandadolescentsassessment 400 392 Evaluationofmentalhandicapscases 391 184 Psychological assessment of Mental 500 601 Handicapcases DPNRAssessment 34 27 Neuropsychologicalassessment 1803 1954 Communitymentalhealthassessment 187 354 AssessmentatJHMRC 16 15 Grand Total 4246 4833 C. No. of patients / cases 2012-13 2013-14 2013-14 Specialist Clinic Services Stress Management and Lifestyle ClinicattheNIMHANS Centre for Well Being (NCWB) began its services in 2011. The services are run by the Behavioural Medicine Unit and are operationalonallFridayafternoons.Itisaimedatofferingstress management services to people from different walks of life as well as for those who require help in maintaining or achieving healthier lifestyles. The services offered include suggestions for stressmanagementssuchasrelaxation,identifyingandhandling stressfulthoughts,lifestylechangeswithrespecttostress.Aseries of workshops were conducted on academic stress, managing interpersonal relationships, understanding social anxiety and National Institute of Mental Health and Neuro Sciences / 51 Annual Report 2013-14 work stress for the urban community at the NCWB. A total of 55clientssoughtconsultationattheclinicduringtheyearunder review. II. NEUROSCIENCES SERVICES NEUROLOGY A. PSYCHIATRIC SOCIAL WORK Specialist Clinic Services Facilities provided TheDepartmentinitiatedapilotprogrammeofpsychosocial services for the clients and families referred by the Child Welfare Committee, which has resulted in a long-term project with the Department of Women and Child Welfare as a specific service to be carried out by the Department of Psychiatric Social Work. About 67 clients were provided withtheservicesofcounsellingandfamilyinterventionand a few were referred back to the Department of Child and Adolescent Psychiatry for further management of mental healthproblems. Facilities provided No. of patients / cases 2012-13 2013-14 CasehistoriesandMSE 6431 7713 Follow-upservices 15418 18515 Individual 6321 7586 Family 7985 9588 Groupinterventions 1862 1862 Rehabilitationandplacementservices 987 1184 Home/Agencyvisits 229 198 14581 17497 501 613 Schoolvisits 6 8 Extensionservicesandcamps 50 60 Otherpsychosocialrehabilitationservices 197 237 Psycho-educationservices Correspondence Disabilityassessment 1408 1689 Pre-dischargecounseling 961 1153 Supportiveintervention 6001 7203 Psychosocialassessment 5495 9180 Collateralcontact 1297 1557 Activityscheduling 836 6557 Presurgicalcounseling 142 152 Postsurgicalcounseling 168 180 12 3 Psychiatricsocialworkservicesincasualty 295 303 NIMHANSCenterforWellBeing 102 185 Freelegalaidservices 155 180 Schoolmentalhealthprogramme Clinical Services Registration Follow-up Admission Discharge Casualty(Emergency) Deaths Grand Total B. Diagnostic Services Facilities provided DigitalElectroencephalography(EEG) VisualEvokedPotential(VEP) BrainStemAuditoryEvokedResponse (BAER) SomatoSensoryEvokedPotential(SSEP) VideoEEG(VEEG) Polysomnography(PSG) Electroneuromyography(ENMG) Electrocardiogram(ECG) Electrocorticography Grand Total C. No. of patients/ cases 2012-13 2013-14 18665 20356 63809 68193 3599 4102 3288 3731 12367 19026 200 195 101928 115603 No. of patients/ cases 2012-13 2013-14 2832 3386 1032 1232 985 1195 1042 352 45 2376 1976 28 10668 1206 450 106 2483 2103 36 12197 Specialist Clinic Services Facilities provided NeuroMuscular Epilepsy MovementDisorder Dementia(intheGeriatricOPD) Strokeward Grand Total No. of patients / cases 2012-13 2013-14 673 743 610 458 231 203 140 495 38 1654 1937 Neuromuscular Disorders Clinic is a multidisciplinary specialtyclinicrunonthefourthSaturdayofeverymonth.About 60-80patientswithvariousneuromusculardisordersvisitthis clinic.GeneticanalysisforDuchenneMusculardystrophyand SpinalmuscularatrophywithGeneticcounsellingisoffered. 52 / National Institute of Mental Health and Neuro Sciences Annual Report Movement Disorders Clinic is held on the first and the third Saturdaysofeverymonthandabout10to15patientsareseenon thesedays.Deepbrainstimulation(DBS)isalsoofferedbytheClinic. Geriatric ClinicisconductedonallSaturdaysexceptsecond Saturday and about 10 patients with dementias of varying aetiologyaswellastheircaregiversareseenandmanagedina multidisciplinaryway. CranialSupratentorial Infratentorial Spinal Peripheralnerve Cranial Spinal CranialAcute CranialDelayed CVJ Spinal Tumours Infections Trauma Stroke ward encompasses five ICUs, five step-down and three specialwards,whereasizeablenumberofpatientswitharterial, venousstrokeareadmittedandmanagedthroughthrombolysis, decompressivecraniotomyandotherprocedures. Functionalsurgery NEUROSURGERY A. Clinical Services Facilities provided Registration Follow-up Admission Discharge Casualty(Emergency) Deaths Grand Total No. of patients/ cases 2012-13 2013-14 21649 20343 38527 39448 5499 6170 4817 5445 *13973 17103 513 540 71005 89049 * Daily OPD started from July 2012 B. No. of cases Vascularsurgery Congenitalanomalies Cranial Spinal Cranial CVJ Spinal Peripheralnervesurgery Chronicsubduralhematoma DBS&Thalamotomy Epilepsysurgery MVDfortrigeminal neuralgia Radiofrequency lesioningfor trigeminalneuralgia Drez Endoscopicsurgery StereotacticBiopsy Brainbiopsy Biopsy Shunt Craniotomyforstroke Spinaldegenerativedisorder GKRS Miscellaneous(boneflap replacement,cranioplasty,etc) Emergencyproceduresdone onbedsidelike(external ventriculardrainage,twist drilltapping,tracheostomy) EpiduralSteroidInjection Grand Total 2013-14 358 7 7 87 36 2013-14 888 300 127 6 111 23 444 25 3 115 60 270 19 51 39 49 1 41 94 4 525 97 348 280 309 1621 45 6390 NEUROANAESTHESIA A. Clinical Services Facilities provided Diagnostic Services Type of surgery No. of cases Type of surgery Epilepsy Clinic: About 20 to 30 patients with refractory epilepsyareseenintheEpilepsyClinic,whichisheldonfirst andthirdSaturdayofeverymonth.Treatmentplansaremade for the patient; in addition, education regarding marriage, employment, and free legal aid is provided. Free drugs are distributedtodeservingpatients. Aprotocolforacuteischemicstrokethrombolysisandvenous stroke management has been prepared and is being utilized. Patienteducationrelatedactivitiesandtrainingofparamedical staffregardingtriageofacutestrokeisdone. 2013-14 Anaesthesiainoperationtheatres a)Electiveoperations b)Emergencyoperations Total Intensivecareunits MedicalICU SurgicalICU EmergencyICU Total Grand Total No. of patients/ cases 2012-13 2013-14 1892 2406 4298 1852 2996 4848 84 353 839 1276 5574 73 413 676 1162 6010 National Institute of Mental Health and Neuro Sciences / 53 Annual Report B. 2013-14 Diagnostic Services Facilities provided Neuroradiological procedure done under sedation/GA ModifiedECT Grand Total B. No. of patients/ cases 2012-13 2013-14 1375 5340 6715 1609 6512 8121 C. Specialist Clinic Services 1. Pre-anaesthetic check-up at the bedside for all elective surgeries Painclinicoffers: a) Anaesthesia/sedation for radiofrequency lesion in trigeminalneuralgia b) Epiduralsteroidinjectionsforbackache c) Lumbarpunctureindifficultcases. 2. Clinical Services: Facilities provided Neuro-interventions B. No. of patients/ cases 2012-13 2013-14 149 122 Diagnostic Services: Facilities provided RoutineX-rayexaminations Ultrasoundexaminations ComputedTomographyScans MagneticResonanceImaging DigitalSubtractionAngiography SPECTCT Grand Total No. of patients/ cases 2012-13 2013-14 21530 23467 3600 2411 38260 41114 10553 11099 1040 1236 144 265 75127 79592 SPEECH PATHOLOGY & AUDIOLOGY A. Therapysessions Follow-upevaluation SpeechLanguageEvaluation AudiologicalEvaluation No. of patients/ cases 2012-13 2013-14 4937 4314 1311 1389 III. REHABILITATION SERVICES ThePsychiatricRehabilitationServices(PRS)areprovidedby amultidisciplinaryteamcomprisingfacultyfromDepartment of Psychiatry, Clinical Psychology, Psychiatric Social Work, Nursing;juniorconsultants;seniorresidentsandpostgraduate studentsfrombothwithinandoutsidetheInstitute. PRS caters to rehabilitation needs of patients in various settings: Day-care, inpatient, outpatient and referrals from psychiatry inpatient units. PRS has various vocational sections including baking,printing,computer,candlemaking,weaving,crafts,plasticmoulding,carpentry,horticulture,tailoring,leather,etc.forpatients. A. No. of patients/ cases 2012-13 2013-14 3120 5140 2401 2323 Clinical Services Facilities provided Averagedailyattendancetoallsections In-patientreferralstoPRS SERWICEpatientsconsultations (out-patientservices) In-patientadmissionsspecificallyfor rehabilitationpurposes(unit4badmission) Psychotherapy Cognitiveretraining Socialskillstraining Otherinterventions Grand Total No. of patients/ cases 2012-13 2013-14 59 59 618 935 578 738 29 27 61 1345 44 14 5 20 1842 Clinical psychology trainees did detailed evaluation and file reviewsof252patients,andfollowedup204patients. B. Clinical Services Facilities provided Facilities provided PSYCHIATRIC REHABILITATION SERVICES NEURO IMAGING & INTERVENTIONAL RADIOLOGY A. Diagnostic Services Diagnostic Services Facilities provided IQAssessments NeuropsychologicalAssessments Others 54 / National Institute of Mental Health and Neuro Sciences No. of patients/ cases 2012-13 2013-14 33 22 12 15 1 5 Annual Report C. Specialist Clinic Services Home-based rehabilitation in collaboration with Hundred Hands;andBanyanTreeAdvisors. Services for Enhanced Recovery with Intensive and Comprehensive Engagement (SERWICE) SERWICE caters to the rehabilitation needs of patients with severe mental disorders (schizophrenia, bipolar disorder, severeobsessivecompulsivedisorder)andmentalretardation. The patients are first evaluated in detail using the SERWICE proforma (designed by the PRS team) keeping in mind their overall rehabilitation needs. Then each patient is allotted to one therapist (trainee). Under the supervision of PRS team members, the trainee would then provide comprehensive care for the patient till the time optimal functional recovery is reached. The therapist would be the main contact /liaison person for the patient. In addition to pharmacotherapy, the therapistwouldbepivotalinprovidingahostofotherservices including psycho-education, individual psychotherapy, family therapy, cognitive retraining, vocational training, social skills training, physiotherapy, training in self-help skills, learning skills, behavioural modification, vocational counselling, etc. Thetraineewouldliaisewiththerapistsfromvarioustreatment units so that smooth co-ordination exists. This would also ensure continuity of care. Support would be continued even after patients get into vocation. Active efforts would be made by the therapist to retain patients in follow-up. Sufficient timeforoutpatientpsychosocialinterventionswouldbegiven duringfollow-ups.TheadvantagesofSERWICEareasfollows: (a) Longer consultation with their therapist (b) wide range of evaluations important for their recovery (c) wide array of interventions would be provided (d) contact with the same mentalhealthprofessional(e)treatingteamtobecontactable through phone and email. In addition to the clinical services, theunitplanstoevaluateoutcomesofthefollowed-uppatients. Intheyear2013-14,therehavebeen738consultationsinthe SERWICE OPD. As on March 2014, 138 patients are being followed up by MD/DPM residents under SERWICE and the casesareperiodicallydiscussedwiththefacultyconcerned. D. 2013-14 Special Initiatives for Patients Active efforts are made to explore employment opportunities for adequately trained patients attending Psychiatric RehabilitationServices.Duringtheyear2013-14,atotalof13 candidates were placed in prominent organisations such as Shankar Eye Hospital; Sun IT; HCL; Abilities in Disabilities; CBR(settingupcomputers,photo-copying/Xeroxandprinting shops); APD for Training & CBR in Horticulture Nursery; Products from different vocational training sections like jute mats, bamboo basket and lamp shades, wire baskets, colorful candles, mats and bakery products were displayed and sold at exhibitions. The PRS calendar and information leaflets for patients and caregivers were also freely distributed at the followingexpos:(a)GaneshafestivalcelebrationsatL&TSouth City,Bangalore,on15September2013,organizedwithhelpof a volunteer Mrs. Seema Sharma (b) A Handmade Collective expoconductedbyAHundredHandsTrust,anon-profitTrust on 29 November, 2013 at Kochhan Institute, Sivan Chetty Gardens, Bangalore (c) 3rd Annual Conference of the Society for Mitochondrial Research and Medicine (SMRM - 2013) - “Mitochondria in Health and Disease, NIMHANS, 19-20 December2013. Products from different vocational training sections like jute mats, bamboo basket and lamp shades, wire baskets, colourful candles, mats and bakery products being displayed and sold at an exhibition. Special programmes for patients and family members: Classes for patients/family Healtheducation Laughtertherapy Mentalexercises Sensorystimulation Self-esteembuildingsession Independentlivingskillsession Skilldevelopmentprogram ExhibitionsconductedinDPNR Pooja-bhajansessions Storytellingsessions Craftsessions Readingactivity No. of sessions 53 48 47 47 47 128 34 7 37 42 36 34 National Institute of Mental Health and Neuro Sciences / 55 Annual Report 2013-14 Classes for patients/family Recreationalactivity Meditationsession Exercisesession Picnic Arts No. of sessions 89 251 243 1 94 SanjeevaniVedikediscussionsessionsontopicssuchasMental illnessanditsimplications;Cognitivedeficitinmentalillness; Problems of elderly caregivers of mentally ill; Dealing with stigma;Suicideprevention;Cognitiverehabilitation;Prevention and management of diabetes type 1 and 2; Importance of rehabilitationformentallyillperson;Managementofmentally ill in social situation; and Welfare benefits for patient and familymemberswereorganisedbyDPNR(thirdMonday,every monthatrecreationhall). Consultations and ward-admissions in Neuro-Rehabilitation division Grand Total ii. No. of patients / cases 2012-13 2013-14 11316 10457 Para-medical Services (Physiotherapy, Occupational Therapy and Orthotics) Out-patient services: Physiotherapy section Activities Total no. of patients/ treatment sessions 2012-13 2013-14 New Total New Total Referral treatment Referral treatment OPD NDT Balanceand gaittraining NeuromuscularClinic Total (OP patients) 4204 6228 3618 5922 1840 2640 1861 2446 107 - 1004 602 9 65 480 480 6151 10474 5959 8848 In-patient services: Physiotherapy section Total no. of patients/ sessions Stations Patients attending psychiatric rehabilitation services actively took part in various cultural events held as part of Independence Day, Republic Day, Ayudha Pooja and Christmas celebrations at the Institute. DEPARTMENT OF NEUROLOGICAL REHABILITATION A. Clinical Services i. Medical services: No. of patients / cases 2012-13 2013-14 Numberofnewreferrals 9644 8281 Numberoffollow-ups 933 1329 Numberofadmissions 186 223 Numberofdischarges 190 214 Number of health education sessions 70 70 conducted Classesfortrainees 18 12 Neuro-muscularClinic 275 328 Consultations and ward-admissions in Neuro-Rehabilitation division Rehabilitation MICU&SICU Strokeward EICU Otherwards Stepdown ward Total(IP patients) Grand total (IP &OP) 2012-13 2013-14 New Total New Total Referral treatments Referral treatments 132 3632 187 3866 120 6712 270 6692 68 1688 57 1707 444 7888 304 7797 1196 8544 1500 5841 - - 98 799 1960 28464 2416 26702 8111 38938 8375 35550 Services provided at occupational therapy section Total no. of Patients Sessions 2012-13 2013-14 No.ofNewPatients 2517 2922 - Follow-upsessions 10068 11688 - Treatmentsprovided 44100 46752 ADLsessions 1812 1416 - Treatmentprovided 3624 2832 MultisensoryTherapy - No.ofsessions 193 212 Neuro-muscularClinic 275 419 56 / National Institute of Mental Health and Neuro Sciences Annual Report Services provided at occupational therapy section Total no. of Patients Sessions 2012-13 2013-14 EducationalCD’ssold 4 Robotichandrehabilitation 16 Totalno.ofsessions 240 Grand Total 62589 66501 Services provided by orthotic section No. of Devices made Appliances 2012-13 2013-14 Totalnumberofbeneficiaries 224 177 Totalno.ofappliancesmade 414 359 Numberofrepairsandfollow-upsdone 06 06 No.offollow-ups 15 13 Grand Total 659 555 B. Diagnostic Services Facilities provided Uro-dynamicstudies C. No. of patients / cases 2012-13 2013-14 71 73 ii. Specialist Clinic Services The Department of Neurological Rehabilitation runs the Neuromuscular Clinic in association with the Department of NeurologyonfourthSaturdayofeverymonthinthemainOPD building.Ateamconsistingofconsultants,residentdoctorsand paramedical staff (physiotherapists, occupational therapists andorthotists)takecareofrehabilitationneedsofthepatients with neuromuscular disorders. More than 250 patients benefittedfromtheseservicesduring2013-14. IV. LABORATORY SERVICES NEUROCHEMISTRY Diagnostic Services i. Plasma, Serum and CSF investigations Parameters Albumin AlkalinePhosphatase Ammonia BilirubinTotal Calcium Chloride Cholesterol Creatinekinase Creatinine CSF-Sugar/Protein/Chloride Gammaglutamyltransferase Glucose HDL-Cholesterol Lactatedehydrogenase Lithium Osmolality Phosphorous,inorganic Potassium SGOT(AST) SGPT(ALT) Sodium Totalprotein Triglycerides Urea UricAcid RoutineBiochemistryfrom outsidereferral Total 2012-13 13609 45518 3341 45467 2013-14 25577 44829 3343 45578 2013-14 9244 76694 6994 5361 60009 7348 2447 73231 6948 3136 4906 4368 7546 69583 45551 45009 69583 13785 6850 59538 1005 8446 79215 7362 6329 58462 6730 2351 69566 7283 3005 4638 4193 6136 72239 44998 44969 72230 24145 7240 57369 1247 47 77 687148 707527 2012-13 355 32 NA NA 522 522 2 1875 253 407 410 422 43 818 735 354 1353 1852 6 6 76 320 2595 2013-14 515 42 42 49 589 589 13 1555 214 318 562 597 46 1277 1274 317 2063 2874 5 12 70 223 2414 Special investigations Parameters Angiotensinconvertingenzyme AnticardiolipinAntibodiesIgA AnticardiolipinAntibodiesIgG AnticardiolipinAntibodiesIgM AntiphospholipidAntibodiesIgG AntiphospholipidAntibodiesIgM AntiThrombin APTT ArylSulfataseA Carbamazepine Ceruloplasmin Copper Fibrinogen Folate HbA1c Hexosaminidase,total,A&B Homocysteine Lactate LupusAnticoagulant Microalbumin Phenobarbitone Phenytoin ProthrombinTime National Institute of Mental Health and Neuro Sciences / 57 Annual Report 2013-14 Parameters Protein-C Protein-S T3 T4 ScreeningforIEMbytandem massspectrometry TSH Valproate VitaminB12 SpecialInvestigationfromoutside referral Total iii. 2012-13 7 7 6141 6142 2663 6594 617 2371 102 37602 2013-14 24 24 7780 7787 3558 8160 851 4209 39 48092 Urine investigations Parameters 24HoursUrinaryProtein Abnormalmetabolitesscreeningtest BenceJonesprotein Copperin24hoursurine Homocystinuria MPSspottest Myoglobinuria Osmolality Porphobilinogen Urobilinogen AbnormalMetabolitesfrom outsidereferral Total 2012-13 37 1782 395 250 8 24 19 4448 402 2 90 2013-14 24 1903 601 304 11 11 30 4326 581 4 35 7457 7830 Summary Diagnostic facilities provided Totalnumbersofroutineinvestigations Totalnumbersofspecialinvestigations Total No. of Tests 2012-13 2013-14 687148 715397 45059 47811 739664 771038 NEUROMICROBIOLOGY Diagnostic Services Sl. No. 1 2 3 4 Facilities provided CSFcellcount CSFcytology CSFcultures Puscultures No. of patients/cases 2012-13 6290 828 3026 115 2013-14 6021 1440 2782 113 Sl. No. Facilities provided Routinecultures Fungalcultures AFBcultures SerumASLOdeterminations CRPdeterminations Serumwidaltest Serumrheumaticfactortest BloodVDRL CSFVDRL CSF–antimycobacterial antibodytestbyELISA(MTSE) 15 CSF-mycobacterialimmune complexofIgGtype 16 CSF–mycobacterialimmune complexofIgMtype 17 CSF-anticysticercalantibody usingAntigen-B 18 IndiainkforCryptococci 19 Mantouxtest 20 Serumantinuclearantibody test 21 CSFlatexagglutinationtestfor Cryptococcalantigen 23 Serum/CSFToxoplasmatestby latexagglutination 25 Koch’sspine 26 Bloodcultures 27 Oligoclonalbandand monoclonalgammopathy:IgG IgA IgM 28 Anti-acetylcholinereceptor antibodies:Direct 29 Vitek-2Compact-60 30 BACTECMGIT 31 BACTALERT Investigations – Hospital Infections Surveillance System 31 Bloodbanksterilitycheck– NIMHANS 32 CSSDsterilitycheck 33 OTsterility 34 Wateranalysis 36 Screeningofothersites: Throat,Axilla,Groin 38 MRSAscreening 39 MDRGNB 42 RedCrossBloodbagsterility Grand Total 5 6 7 8 9 10 11 12 13 14 58 / National Institute of Mental Health and Neuro Sciences No. of patients/cases 2012-13 2013-14 6431 2371 2076 47 103 334 2121 3507 2398 2538 6223 2733 2412 52 103 332 2731 4093 2638 2495 2538 2495 2538 2495 2538 2495 2416 192 2118 2648 123 2659 81 46 12 42 34 767 443 443 443 09 890 511 511 511 175 206 229 345 7934 591 878 1050 400 468 44 66 49 382 25 29 28 254 2289 40 712 59413 2138 920 56190 2013-14 Annual Report NEUROPATHOLOGY Diagnostic Work A. Clinical Services i. Transfusion Medicine Centre Neurology Facilities provided Bloodandbloodcomponentscollected Smallvolumeplasmapheresis Largevolumeplasmapheresis BloodgroupingRhtyping Blooddonationcampsheld Phlebotomy Grand Total ii. iii. B. i. 2012-13 2013-14 13642 14589 241 361 1297 2386 46073 50134 68 73 137 132 61458 67675 2012-13 2013-14 46,327 48,863 11,370 9,784 861 706 17,052 17,001 1,379 1,195 58 279 23 114 95 97 119 103 54 57 18 14 5,288 5,310 184 124 163 273 82,991 83,920 Autopsy service Autopsies ClinicalAutopsies MedicolegalAutopsies Grand Total 2012-13 2013-14 18 19 296 329 314 348 47 06 47 53 Muscle 458 916 1295 1374 Nerve 144 1169 1262 1313 Skin 91 132 197 223 Liver - 11 12 11 36 45 63 81 442 461 865 903 887 1362 1844 2249 181 63 298 244 Brainbiopsy Muscle- Histochemistry Immunohistochemistryfor TumourDiagnosis Muscle Immunohistochemistry Grand Total ii. Neuropathology No.ofBiopsies Neurosurgical 2013-2014 TOTAL 2012- 2013NIMHANS REFERRALS 13 14 2706 4630 7108 7336 1830 1986 4233 7698 13425 19872 21123 Electron Microscopy - Common Research Facility Facilities provided No. of cases 2012-13 Ultrastructural studies 2013-14 385 382 NIMHANS Referral NIMHANS Referral A. Diagnostic Electron Microscopy B. Research Samples submittedfor lightmicroscopic studies(Semithin) 96 112 100 130 90 87 102 50 30 26 Department of Neuropathology: Summary of tests done Diagnostic Services Diagnostic Work TOTAL 2012- 2013NIMHANS REFERRALS 13 14 876 2644 2648 3520 StereotacticBiopsy Clinical Pathology Investigations carried out Hemogram PeripheralSmear PeripheralSmearforMP ESR BT/CT AEC ANC ReticulocyteCount SicklingTest SalineDilutionTest BoneMarrowStudy UrineExamination StoolExamination ResearchProject Grand Total 2013-2014 1 2 3 4 Section Histopathology TransfusionmedicineCentre ClinicalPathology Electronmicroscopy Grand Total: Number 21,120 67,675 83,920 408 1,73,123 3816 National Institute of Mental Health and Neuro Sciences / 59 2013-14 Annual Report NEUROVIROLOGY Facilities provided Diagnostic Services Facilities provided No. of patients/cases 2012-13 2013-14 Laboratory diagnosis of JapaneseEncephalitis Dengue Chikungunya Rabies Measles HSV Enterovirus H1N1 HIV CD4 Earlyinfantilediagnosis(EID) HIVviralload HepatitisB Grand Total 213 919 219 213 173 821 24 3137 4605 11,053 4043 287 979 26686 260 781 301 266 249 408 25 542 4771 15,019 3868 938 1033 28461 NEUROPHYSIOLOGY B. Diagnostic Services Facilities provided Samplessenttodifferentlaboratoriesfor variousinvestigationsfromthefollowing areas: NeuroCentrewards PsychiatricwardsincludingCasualtyand EmergencyServices Grand Total C. Diagnostic Services No. of patients/ cases 2012-13 2013-14 54780 48482 211315 129866 103262 341181 Specialist Clinic Services Details of the services provided to the clients from April 2013 to March 2014 Facilities provided AutonomicFunction Evaluation PulmonaryFunction Evaluation Grand Total No. of patients/cases 2012-13 2013-14 714 857 474 388 1188 1245 V. SUPPORTIVE SERVICES NURSING A. Homevisits OPDServices,ExtensionClinics Grand Total No. of patients/ cases 2012-13 2013-14 98 110 24470 22486 148001 142515 Clinical Services Facilities provided Acutenursingcare Intensivenursingcare ECTs EmergencyNursingCare Neurology Neurosurgery Psychiatry Chronicpatientcare No.ofsurgeriesassisted CommunityMentalHealthServicesprovided Newcases Oldcases No. of patients/ cases 2012-13 2013-14 10229 11391 9183 12746 5775 6492 27600 25562 8847 7392 4375 28046 24516 9114 13830 4907 3167 21303 2557 6320 DropinenquiriesandTelephonicenquiries Totalregisteredclients NumberofclientsconsultedCLP Number of clients seen by Stress mgt and lifestyle managementteam NumberofclientsseenbyMaritalEnrichmentService team Number of clients seen by Family enrichment/ Parenting training/ Student & Adolescent Stress management/OccupationalStressmanagementteam NumberofclientsseenbyPositivePsychologyteam NumberofclientsseenbyDe-addictionteam NumberofclientsseenatPsychologyclinic Asare(Parentsupportgroup) Grand Total 1206 521 223 55 42 74 41 35 80 67 2344 VI. AYUSH SERVICES AYURVEDA Hospital Services Outpatientservicesareofferedonaregularbasisatthemain OPD block of NIMHANS. Patients with various neurological and psychiatric disorders are provided with specialised consultationsandtreatment.Numberofpatientstreatedduring 2013-14atOPDandIPDareasfollows: 60 / National Institute of Mental Health and Neuro Sciences Annual Report Follow EmergenAdmissions Discharges Death Up cies 4524 5697 300 303 00 00 New Special Clinics & Services 1. A special clinic is held on fourth Saturday of every monthinassociationwiththeDepartmentofNeurology. Ayurvedicmedicationsareprovidedandimprovementsin healthconditionsofpatientsareassessedthroughregular follow-ups.Duringthereportingyear,684patientswith neuromusculardisordersweretreated. 2. AspecialGeriatricOPDisbeingrunbytheInstitute,every Tuesdays.ThedataofpatientswhoattendedtheGeriatric OPDduringthereportingyearisasfollows: Number of patients attended New Old Grand Total Male Female Male Female Male Female 417 286 698 488 1115 774 Advanced Centre for Yoga - Mental Health and Neurosciences The Advanced Centre for Yoga - Mental Health and Neurosciences was started in 2007 in collaboration with the Morarji Desai National Institute of Yoga, New Delhi (funded by the Department of AYUSH, Govt. of India) for promoting training and research in Yoga. Activities of the centre were essentially interdisciplinary involving all clinical and many basicsciencedepartments. TheCentrecompletedthetermoffiveyearsin2012.However,in viewofunutilizedgrantsandneedforcompletionoftheresearch workcarriedoutbytheCentre,aone-yearextensionwasgranted. TheCentreiscurrentlyofferingyogaservicestopatientswiththe helpofaYogatherapistservingoncontractbasis. Yoga Therapy Services TheCentrehasbeenofferingYogatherapyforoutpatientsand inpatientssince2008.Followingaretheclinicalservicesoffered topatientsreferredfromotherdepartmentsofNIMHANS. • • • Yogatherapyservicesforpsychiatric&neurologicalpatients Regular Yoga sessions at Child & Adolescent Psychiatry Unit,NIMHANS. RegularYogaclassesforinpatientsatpsychiatricwardsof NIMHANSthroughtrainednursingstaff. • 2013-14 Regular Yoga sessions for caregivers of patients with psychiatric&neurologicaldisorders. In the year 2013-14, a total of 13154 Yoga (patient) sessions werecarriedout—8225foradultsand4929forchildren.Total number of sessions for new patients stood at 1688 (974 for adultsand497forchildren) Yoga Therapy at Child & Adolescent Psychiatry Unit About 500 children received Yoga therapy in the children’s wards, along with their caregivers, at the Child & Adolescent Psychiatry Unit, as part of the part routine ward activities carriedoutbytheYogaCentre. Yoga Sessions at Psychiatry Wards The Centre is alsorunning daily yoga classes at different psychiatric wards through nursing staff trained in Yoga. A yoga-based session with selected yogic asanas, pranayama and nadanusandhana techniques has been introduced in place of unstructured physical activity at both open and closed psychiatric wards. An average of about 15-20 patients participateintheseyogabasedsessions. VII. OTHER SERVICES HUMAN GENETICS Genetic counselling is provided to patients (and their family members) with various genetic disorders including brain and nervous system tumors, Down syndrome, Turner syndrome, DMD, osteogenesis imperfect-brittle bone disorder, mental retardation, Robertsonian syndrome, polyhydramnios, mitochondrial disorder, metabolic disorders such as metachromaticleukodystrophy.Premaritalcounsellingservices arealsooffered.Onlinegeneticcounsellinghasalsobeenmade availableforconvenienceandgreateranonymityofthepatients. Atotalof40patientsandtheirfamilymembersbenefitedfrom thegeneticcounsellingservicesduringtheyearunderreview. Karyotypingtestingwasperformedon16patients. MENTAL HEALTH EDUCATION The Department in collaboration with the Departments of Neurosurgery, Nursing, Psychiatric Social Work and Clinical Psychology developed a set of educational/informational brochures for people with head injury and their caregivers. Theseinclude: National Institute of Mental Health and Neuro Sciences / 61 Annual Report • • • • 2013-14 Head Injury – Discharge Information for Patients and Carers HeadInjury–PsychosocialAspects HeadInjury–CaringforCarers Neurosurgery – Advice on Discharge for Health Professionals The Department designed posters on identification of mental disorderslikedepression,OCD,andBipolarAffectiveDisorder. Each poster illustrates various symptoms associated with the illnesswhichcouldhelpinidentifyingthedisorder.Posterson first aid in epilepsy and identification of stroke and the need fortimelytreatmentwerealsobroughtout.Theposterscanbe usedbyfacultyandstudentsofvariousdepartmentstoeducate publicandcommunity. Photographic and Video Services Other specialised services of the Department include photography and video documentation and development of healtheducationvideosandvisualmaterials. In the year under review, 1027 requests for photographic services (650 for still photography and 377 for videos) were received. As many as 24735 photographs (17172 for clinical and training purposes, and 7563 for administrative purpose) were taken during the period, a decrease of about 20percent compared to the previous year. Due to the usage of PAX, the number of photographs of radiological images has greatly reduced. Majority of the requests were from the Department of Neurology (for a total of 2723 digital photographs) and Department of Neurosurgery (for 1853 photographs). A total of 7563 photographs of Institute functions, administration, documentation, and other activities were taken. A record of photosofallimportanteventsandfunctionsismaintainedand providedfordocumentationandpresentationontheInstitute Day. Expenditure on printing photographs has also reduced considerably.Photoalbumswerepresentedtodignitarieswho gracedimportantfunctionsoftheInstitute. Atotalof377requestsforvideoswerereceived,ofthese227videos wereedited.Forthefirsttime,chromakeytechniquewasusedin studio recording to insert visuals as background. In addition to the clinical videos, videos depicting various services and facilities availableintheinstituteweremade.Thevideosandhealtheducation clipswereshownonCCTVintheOPD.Videodemonstrationsand roleplaysfortrainingandacademicprogrammesandfordeveloping teachingandtrainingmaterialswerealsoontherise. Video clips for CCTV, Outpatient Department: 1. 2. 3. 4. 5. 6. 7. 8. 62 / National Institute of Mental Health and Neuro Sciences ProperuseofhelmetinEnglishandKannada FirstaidinEpilepsy OnlineRegistration OPDandscreeningservices CasualtyandEmergencyServices InformationaboutNCWB Medicationpouchmanufacturedbypatientsofpsychiatric rehabilitationinkannada,EnglishandHindi Artworkbychildrenofchildpsychiatrycentre Annual Report 2013-14 National Institute of Mental Health and Neuro Sciences / 63 Annual Report 2013-14 Human Resource Development A. POSTDOCTORAL FELLOWS 1. 2. 3. 4. 5. 6. Dr.SugnyaniDevi,Child&AdolescentPsychiatry Dr.KrishnaPrasadM,AcuteCareandEmergencyPsychiatry Dr.BijuViswanath,AddictionMedicine Dr.DeepakJayarajan,AddictionMedicine Dr.SatishRasaily,AddictionMedicine Dr. Ajish Gopinath Mangot, Clinical Neurosciences & TherapeuticsinSchizophrenia 7. Dr.NikhilJain,CommunityMentalHealth 8. Dr.VikramSinghRawat,ConsultationLiaisonPsychiatry 9. Dr.MalvikaRavi,ConsultationLiaisonPsychiatry 10. Dr. Easha Sharma, Obsessive Compulsive Disorder & RelatedDisorders 11. Dr.NiveditaPatra,Neuroinfections 12. Dr.AbuZafarAnsari,Neurology(MovementDisorders) 13. Dr.PrajnaRanjaniM,NeurologicalRehabilitation 14. Dr.DheerajA,NeurologicalRehabilitation 15. Dr.DSathiyaBama,Neuropathology 16. Dr.AshaU,Neuropathology Ph.D 1. Biostatistics (1) Ms. PTSubha 2. Clinical Psychology (7) Ms. AaratiTaksal Mr. AbdulSalamK.P Ms. HesiS.Herbert Ms. MahimaSukhwal Mr. RavikeshTripathi Ms. SelviM Ms. UttaraChari 3. 3. 4. Neurochemistry (1) Mr. MathewJohn Neurological Rehabilitation (1) Ms. PradnyaRajeshDhargave Neurophysiology (6) Mr. ChristoferThomas Dr. HarshaHN Dr. Dr. Dr. Mr. 5. Neurovirology (2) Ms. VijayalakshmiR Ms. PrachiRahulFadnis 6. 7. 8. B. QUALIFICATIONS AWARDED I. 9. Karnataka Delhi Kerala Kerala Rajasthan UttarPradesh TamilNadu AndhraPradesh MeghanaA RavikiranKisan SajishChandran SaravananS Nursing (2) Ms. KNJayanthi Ms. NKusuma Karnataka Karnataka Kerala TamilNadu Karnataka Maharashtra Karnataka Karnataka Psychiatric Social Work (6) Mr.AnishVCherian Ms.DianaRoss Mr.SJeyaram Mr.JimmySebastian Mr.SanjeevKumarManikappa Mr.SUbaharaSahayaraj Karnataka Kerala TamilNadu Kerala Karnataka TamilNadu Psychiatry (3) Dr.HariprasadVR Dr.LakshmiNarayananK Dr.GVenkatasubramanian Karnataka TamilNadu TamilNadu Speech Pathology & Audiology (1) Mr.PradeepY II. DM (Neurology)(5) Dr.AdwaniSikandarGokuldas Dr.GovindarajuC Dr.PradeepKallollimath Dr.SaileshModi Dr.ESenthilKumar Karnataka Maharashtra Karnataka Karnataka AndhraPradesh TamilNadu III. DM (Neuroradiology) (2) Dr.GudipatiAnantaRam Dr.ParamveerSinghSabharwal AndhraPradesh Uttarkhand Kerala IV. M.CH (Neurosurgery) (6) Maharashtra Kerala Karnataka 64 / National Institute of Mental Health and Neuro Sciences Dr.MehulNavinchandraModi Dr.PrakashMahantshetti Dr.PraveenKumarFSaligoudar Dr.RakshithKumarShettyAB Dr.RamanMohanSharma Dr.SudheeshRamachandran Gujarat Karnataka Karnataka Karnataka UttarPradesh Kerala Annual Report V. MD (Psychiatry) (20) Dr.GayatriSaraf Dr.HemendraSingh Dr.JitendraRohilla Dr.KapilJhamnani Dr.KavitaNagpal Dr.KumbharMaheshAnandarao Dr.SMahavirAgarwal Dr.PrabhuKiran Dr.PunithM Dr.RashmiA Dr.SabariSridharOT Dr.SaravanaKumarA Dr.ShahDharavSunil Dr.ShashidharaHN Dr.ShreeMishra Dr.SissiraVS Dr.SunilKumar Dr.SureshVC Dr.VinuthaR Dr.VirupakshaHS VIII. M. PHIL (Neurophysiology) (2) Maharashtra Rajasthan Rajasthan Rajasthan Delhi Maharashtra Orissa Karnataka Karnataka Karnataka TamilNadu TamilNadu Maharashtra Karnataka Maharashtra Kerala Karnataka Karnataka Karnataka Karnataka VI. DIPLOMA (Psychiatry) (6) Dr.HarshitHemantSalian Dr.KulkarniGajanan Dr.LakshmiS Dr.NaveenRGowda Dr.SuneethaKS Dr.VirupakshappaIrappaBagewadi Karnataka Karnataka Karnataka Karnataka Karnataka Karnataka VII. M.PHIL (Clinical Psychology) (16) Ms.AnjaliSudhindran Ms.DeeptiGuruprasad Ms.DivyaVSalian Ms.InduSMenon Ms.IndupriyaB Ms.LavanyaTP Ms.LeeshmaK Ms.LynElsaGeorgy Ms.NaphisabetKharsati Ms.PrateekshaVShetty Ms.RinshaEK Ms.SeemaPNambiar Ms.ShynimolKB Mr.SiddharthDutt Ms.SystlaRukminiPatanjali Ms.VaisnvyNM 2013-14 Kerala Karnataka Maharashtra Kerala Kerala Karnataka Kerala Kerala Meghalaya Karnataka Kerala Kerala Kerala Karnataka WestBengal TamilNadu Mr.SureshKumarParmar Mr.VijayaKumarK AndhraPradesh Karnataka IX. M.PHIL (Neurosciences) (4) Ms.AditiDeviN Ms.IngridDianaMonteiro Ms.RanganayakiS Dr.ShaileshKumarGupta Karnataka Maharashtra TamilNadu UttarPradesh X. M.PHIL (Psychiatric Social Work) (17) Mr.BGAnantharamu Mr.AnoopSyriyac Ms.BhuvaneshwariB Mr.BibinVP Ms.Chaithra Ms.ChithranjaliKV Ms.DahunlyneShylla Ms.DivyaBallal Mr.IjasAbdulMajeed Ms.JaniceSebastian Ms.JunaB Ms.ManjushaWarrierG Ms.ParamitaBhowmick Ms.SajithaK Ms.ShiniC Mr.Shrinivasa Mr.Virupaksha Karnataka Kerala TamilNadu Kerala Karnataka Kerala Meghalaya TamilNadu Kerala Kerala Kerala Kerala WestBengal Kerala Kerala Karnataka Karnataka XI. M.Sc. (Psychiatric Nursing)(8) Ms.AnnieJohnP Mr.MKathiravan Ms.PoornathaR Ms.RRajalakshmi Ms.RashmiN Ms.KSugavanaselvi Ms.TaniaMarinaThomas Ms.VijayalakshmiM Kerala TamilNadu Karnataka TamilNadu Karnataka TamilNadu WestBengal TamilNadu XII. B.Sc. (Nursing) (36) Ms.AnjaliSaji Ms.AnjalyKThomas Ms.AnjanaSebastian Ms.AnjuJoseph Ms.AnuBabu Ms.AnuJose Ms.AnumolJames Kerala Kerala Kerala Kerala Kerala Kerala Kerala National Institute of Mental Health and Neuro Sciences / 65 Annual Report 2013-14 Ms.AshwiniV Ms.AswathySajeev Ms.AthiraJoy Ms.DellaPJose Ms.DivyaMaryJacob Ms.GiftyMolAntony Ms.HPrarthanaHariet Ms.HarshaBiju Ms.HealaRoseBaby Ms.HemalathaM Ms.JeslinMariaJose Ms.JessyMolJoseph Ms.JibyJacob Ms.JincyJoseph Ms.JintuKBabu Ms.LinshyAlex Ms.NeethuBaby Ms.NeethuSunnyA Ms.NimmyJoy Ms.ParvathyRajagopal Ms.RemyaRaveendran Ms.RosminMathew Mr.ShahidAK Ms.ShaniKuriakose Ms.SharonKA Ms.ShimnaJohn Ms.SijimolS Ms.SujithaKS Ms.VimalJyothyJohn Karnataka Kerala Kerala Kerala Kerala Karnataka Karnataka Kerala Kerala Karnataka Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala Kerala TamilNadu TamilNadu Kerala XIII. B.Sc. (Radiography) (2) Mr.RoshanAntony Mr.SujitKumarSingh Mr. AbhishekPaul Ms. JeslitKJoy Ms.PriyaElsaJohn Department of Clinical Psychology (1) Ms.CathlynNiranjanaBennett WestBengal Kerala Kerala II. DM (Neurology) (1) Dr.RohanRMahale Karnataka Maharashtra III. DM (Neuroradiology) (1) Dr.ChandrajitPrasad Bihar IV. MD (Psychiatry) (2) Dr.ImonPaul Dr.SushmaBR V. DIPLOMA (Psychiatry) (2) Dr.NitturkarAbhishekRavindra Dr.VirupakshiJalihal WestBengal Karnataka Karnataka Karnataka VI. M.PHIL (Biophysics) (1) Ms.LataChaunsali Uttarakhand VII. M.PHIL (Mental Health & Social Psychology) (2) Mr.FirdousAhmadWar Ms.SwatiVasanthSapkale Jammu&Kashmir Maharashtra Ms.LishaTBalan Ms.JasmineMaryLyngdoh Ms.RoshiniC Ms.ThusathSatheesanSneha Kerala Meghalaya Kerala Kerala IX. M.PHIL (Psychiatric Social Work) (1) Ms.EktaJChheda Maharashtra M.Sc. (Psychiatric Nursing) (1) Ms.AnnieRuhmahAustin C. QUALIFICATIONS AWARDED IN-ABSENTIA AT THE 18TH CONVOCATION Kerala XI. B.Sc (Nursing) (8) PhD Department of Biostatistics (1) Ms.MKarunambigai TamilNadu Department of Psychiatry (1) Dr.BhavaniShankaraB X. I. Karnataka VIII. M.PHIL (Clinical Psychology) (4) Kerala AndhraPradesh XIV. B.Sc. (Anaesthesia Technology) (3) Department of Neurochemistry (1) Ms.RenjiniR TamilNadu 66 / National Institute of Mental Health and Neuro Sciences Ms.AleenaCPrince Ms.AnuTomson Ms.AshlyAbraham Ms.LakshmiRajan Ms.LiniVThomas Ms.LittyPThomas Kerala Kerala Kerala Kerala Kerala Kerala Annual Report Ms.ManasaThomas Ms.SilpaThomas Neuroinfections (1) Dr.NiveditaPatra Kerala Kerala Neurological Rehabilitation (2) Dr.PrajnaRanjaniM Dr.DheerajA POST-DOCTORAL FELLOWSHIP Child & Adolescent Psychiatry (1) Dr.SugnyaniDevi Karnataka Acute Care & EmergencyPsychiatry (1) Dr.KrishnaPrasadM Karnataka Kerala Karnataka Sikkim Sikkim Consultation Liaison Psychiatry (2) Dr.VikramSinghRawat Dr.MalvikaRavi TamilNadu Karnataka DIPLOMA (Clinical Neurophysiology Technology (DCNT) (2) Ms.NeethuCV Mr.StevenB Kerala Karnataka III. POST-BASIC DIPLOMA (Psychiatric / Mental Health Nursing) (5) Clinical Neurosciences & Therapeutics in Schizophrenia (1) Dr.AjishGopinathMangot Maharashtra Community Mental Health (1) Dr.NikhilJain UttarPradesh Karnataka Karnataka Neuropathology (2) Dr.DSathiyaBama Dr.AshaU II. Addiction Medicine (3) Dr.BijuVishwanath Dr.DeepakJayarajan Dr.SatishRasaily Odisha Neurology (Movement Disorders) (1) Dr.AbuZafarAnsari D. QUALIFICATIONS AWARDED AT THE INSTITUTE DAY CELEBRATIONS I. 2013-14 Mrs.BinduKP Ms.JaishriSudamraoGathe Maj.NKalpana Mrs.SavithaP Mrs.JThamayanthi Kerala Maharashtra TamilNadu Kerala TamilNadu IV. POST-BASIC DIPLOMA (Neuro Science Nursing) (3) Rajasthan Maharashtra Obsessive Compulsive Disorder & Related Disorders (1) Dr.EashaSharma UttarPradesh Capt.AnuZacharia Capt.SerahMathai Mrs.TanySebastian Kerala Maharashtra Kerala Ph.D Candidates under External Fellowships as on 31.03.2014 DEPARTMENT Basic Sciences Division Biophysics Biostatistics HumanGenetics Neurochemistry Neuromicrobiology Neurophysiology Neurovirology Psychopharmacology Behavioural Sciences Division ClinicalPsychology PsychiatricSocialWork Psychiatry Neuro Sciences Division Neurology ClinicalNeurosciences TOTAL CSIR UGC ICMR DST DST-Inspire OTHERS TOTAL 1 1 3 2 5 1 - 3 2 4 4 - 1 1 1 1 1 - 1 2 1 2 2 2 4 3 1 4 3 6 8 7 14 4 3 1 3 6 - 5 3 1 - - 4 6 14 12 15 16 14 22 22 35 1 4 1 39 1 22 115 National Institute of Mental Health and Neuro Sciences / 67 Annual Report CSIR UGC ICMR DST -Inspire DST Total 2013-14 2009 2010 2011 2012 2013 01 04 04 02 02 06 08 07 05 05 08 09 09 01 01 01 01 06 09 19 21 19 Total 13 21 36 03 01 74 E. OTHER COURSES Diploma in Clinical Neurophysiology Technology (DCNT) 1. 2. Ms.NeethuCV Mr.StevenB II. Post-Basic Diploma in Psychiatric / Mental Health Nursing 1. 2. 3. 4. 5. Mrs.BinduKP Ms.JaishriSudamraoGathe Maj.NKalpana Mrs.SavithaP Mrs.JThamayanthi Kerala Karnataka Kerala Maharashtra TamilNadu Kerala TamilNadu III. Post-Basic Diploma in Neuro Science Nursing Capt.AnuZacharia Capt.SerahMathai Mrs.TanySebastian F Kerala Maharashtra Kerala II. Sl No A B 01. 02. Courses offered at NIMHANS Sl No 1 2. 3 4 Name of the Course Neuroanaesthesia B.Sc.(AnaesthesiaTechnology) NIIR B.Sc.Radiography RadiographyTraineecourse Neurology Diploma(Diplomainclinical NeurophysiologyTechnology-DCNT) Nursing DiplomainPsychiatricNursing(DPN) DiplomainNeuroNursing(DNN) B.Sc.Nursing-Iyear IIyear IIIyear IVyear PassedOut 8 7 A total of 1,287 students from outside Institutes attended various training programmes (of periods ranging from 15-30 days) at the Department of Nursing to gain clinical experience. OTHER TRAINING I. Psychiatry Diploma(Psychiatry-2013-14) Diploma(Psychiatry-2012-2013) Atotalof26nursingpersonnelattendedthetrainingonHIV/ AIDSunderGFATMprojectduringtheyearunderreview. I. 1. 2. 3. 5 Number of Candidates 15 25 22 03. 06 22 6 76 74 63 26 42 68 / National Institute of Mental Health and Neuro Sciences Students from other Institutions coming to NIMHANS for training Stream No. of TOTAL Candidates INTERNATIONAL Clinical Psychology NATIONAL Biophysics MSc(BiochemicalTechnology) B.TechBiotechnology IntegratedBSc.-MSc.course Child & Adolescent Psychiatry MD(Psychiatry) MD(Pediatrics) DM(Neurology) DNB(Psychiatry) DNB(Pediatrics) DPM(Psychiatry) MPH(CM) DCH(Paediatrics) MBBs,FCPS(Psy),FRCP M.Sc.Psychosocial Rehabilitation MPhilinMedical&Social Psychology M.Sc.(Nursing-Psy) Clinical Psychology MD DNB DMRadiology DMNeurology MD/DPM DPM Medical&Paramedical MSSurgery MBBS Ph.D. M.Phil. M.Phil.ClinicalPsychology 3 3 1 1 1 123 65 9 4 11 2 11 1 6 1 9 3 1 199 72 3 1 1 1 1 40 1 2 3 31 7 Annual Report Sl No Stream M.Tech (IntegratedM.TechProgramin CognitiveNeuroscience) M.A 04. 05. 06. 3 M.Sc.(PsychiatricNursing) 4 Epidemiology 13 Fellowship(CommunityHealth) 5 Human Genetics 4 B.Sc.(Biotechnology) 65 BE/B.Tech(Biotechnology) 9 Neuroanasthesia 10. 13. 122 3 37 MD 7 PhD 2 M.Tech 1 B.Tech 6 14. 15. 20 1 Neuro Imaging & Interventional Radiology MD/DNB/Diploma/Mch/ 151 DMNeurology Neurological Rehabilitation M.Sc/MPT-Physiotherapy 35 B.Sc/BPT/BOT- Physiotherapy,Occupational Therapy Neurology 55 76 MD/MS 11. 125 Neurochemistry M.Sc. 09. 78 M.Sc./M.Tech.(Biotechnology) BE 08. 18 MD(CommunityMedicine) B.Sc.(AnaesthesiaTechnology) Sl No 12. 28 M.Sc. MD/MS 07. No. of TOTAL Candidates 1 151 16. 166 418 17. 399 MBBS 01 M.Sc. 02 B.Sc. 16 Neuromicrobiology 30 MBBS 1 M.Sc.Genetics 1 M.Sc.Neurobiology 1 M.Sc.Microbiology 15 M.Sc.Biochemistry 2 M.Sc.AppliedMicrobiology 2 M.Sc.MLT 5 M.Sc.Biotechnology 3 18. Stream Neuropathology DM,M.Ch,MD-Pathology, DM-NeuroRadiology MBBS M.Tech M.Tech.(Cognitive Neurosciences) BE(Biotechnology) M.Sc.(MLT) M.Sc.(Biochemistry) M.Sc.(Microbiology) B.Sc.Nursing B.Sc.Anesthesia StaffNurses Neurophysiology Ph.D. MBBS B.Tech.(Biotechnology) M.Sc.(Zoology) Neurosurgery M.Ch MSGeneralSurgery,ENTand DNB,FacioMaxillaryetc., Neurovirology MD BEBiotechnology M.Sc. Nursing M.Sc.Nursing PostBasicDiplomainNursing P.CB.Sc.Nursing BasicB.Sc.Nursing B.Sc.Nursing G.N.M DPN Psychiatry MD MBBS Diploma(Psychiatry) Psychiatric Rehabilitation MD(Psychiatry)/DPMexternal M.PhilPsychiatricSocialwork –External M.Sc.(Nursing)-external B.Sc.(Nursing)-external Diploma(Nursing)-external PCBasicBScNursing Psychiatric Social Work M.Phil. MSW Visited 2013-14 No. of TOTAL Candidates 425 219 63 01 01 05 2 01 01 96 3 31 9 4 1 3 1 179 34 145 66 60 5 1 1287 620 2 202 85 222 145 11 227 148 62 17 1011 24 172 538 179 5 93 620 1 155 464 National Institute of Mental Health and Neuro Sciences / 69 Annual Report Sl No 19. 20. 2013-14 No. of TOTAL Candidates Psychopharmacology 20 M.Pharma 8 M.Tech 2 B.Tech 3 BE(Biotechnology) 7 Speech Pathology & Audiology 144 PDF 2 MS(ENT) 44 DM(ChildPsychiatry) 2 BE(Biomedical) 17 B.Sc(Speech&Hearing) 79 Stream Number of trainees who underwent training at the Institute: A total of 3795 students from various government/private institutionsacrossthecountryvisitedandunderwenttraining atNIMHANSduringtheperiod1April2013to31March2014. PSYCHIATRIC SOCIAL WORK Enriching psychosocial competencies among children through NGOs in South India. Investigators: Dr. K. Sekar (Funding by EveryChild India) NIMHANS EveryChild project on “Enriching Psychosocial CompetenciesamongchildrenthroughNGOsinSouthIndia” initiatedsince2008aimstoprovidepsychosocialcompetency in an integrated manner with education development interventions for children living in difficult circumstances throughNGO’sofEveryChildIndia. The project has successfully completed the core objectives of (a) profiling the psychosocial status of children in difficult circumstances intervened by NGO’s and supported by EveryChild India (b) developing appropriate intervention strategies for building psychosocial competencies among children living in difficult circumstances (c) capacity building through TOT training program and cascading training by NGO trainers at community level (d) providing supportive supervision for the trained staff (e) Developing systems for periodicalmonitoringandevaluation.During2013-14towards institutionalization of psychosocial care activities, a tenday residential training programme, from 20-29 June 2013, was organised at NIMHANS for the psychosocial counselors from five NGOs supported by EveryChild India and Training programmes (by master trainers) on psychosocial care for children in difficult circumstances; life skills education for children in difficult circumstances; enriching family life; and student enrichment program for community-level workers (CCAC teachers), Anganwadi and Asha workers are being conductedonaregularbasis. Intervention with children A total of 7360 children benefited through the programme carried out by five NGOs. As many as 1129 children were identified to be at high risk, 598 children were provided with additional support and 461 children were linked to various socialprotectionschemes. Psychosocial care for children with disability and integrating into CBR approach for children with disability in Karnataka. NIMHANS -Sama Project on Psychosocial Care for Children withDisabilityandIntegratingintoCBRApproachforChildren withDisabilityinKarnatakaaimsatadaptingandintegrating four psychosocial modules for children with disability with special focus on physical disability and visual disability. The totalfundingforthisprojectfromChristoffelBlindenMission (CBM)isthroughSamaFoundation. Special Programmes The sensitization programmes (five workshops held) were conducted to enlist the support and cooperation of partner NGOs.Thefourmodules,namely:PsychosocialSocialCare,Life SkillsEducation,StudentEnrichmentProgramandEnriching Family Life were adapted for children with visual disabilities. After adapting the modules, select staff members of select NGOs were trained (four training programmes conducted) to provide psychosocial care to children with a specific kind of disabilitythroughparticipatorymethodologies.Afterreceiving training, these staff members conducted the activities with a largernumberofchildrenintheirselectedfieldareas. Field-based handholding support was provided to 64 units involving 80 direct participants by experts from NIMHANS andSamaFoundation. AYURVEDA The Ayurveda Unit was involved in imparting training and providingexposureontreatmentmethodologyandpanchakarma techniques in the management of neurological and psychiatric disorderstotheundergraduatestudentspostedtotheunit. 70 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 National Institute of Mental Health and Neuro Sciences / 71 Annual Report 2013-14 72 / National Institute of Mental Health and Neuro Sciences 18th Convocation & Institute Day 2014 Awardees Dr. Sailesh Modi Silver Jubilee Awardfor thebestoutgoingstudent inDMNeurology-2013 Dr. Gudipati Ananta Ram Golden Jubilee Award forbestoutgoingstudent inDMNeuroradiology- 2013 Dr. S. Mahavir Agarwal Dr. Praveenkumar F. Saligoudar Dr. Sudheesh Ramachandran Silver Jubilee Award for thebestoutgoingstudentin M.ChNeurosurgery-2013 Ms. Deepti Guruprasad Dr. Lakshmi.S Silver Jubilee Award for thebestoutgoingstudentin MDPsychiatry–2013 Dr. D.L.N. Murthy Rao Memorial Prizeforthebest outgoingstudentinDiploma inPsychiatry-2013 Dr. M.V. Govindaswamy Memorial Prizefor scoringthehighestmarksin M.PhilClinicalPsychology -2013 Ms. Shini .C Mr. Suresh Kumar Parmar Mr. Vijaya Kumar .K Ms. Lata Chaunsali Dr. M.V. Govindaswamy Memorial Prizefor scoringthehighestmarks inM.PhilPsychiatricSocial Work–2013 Dr. R.N. Moorthy Awardforscoringthe highestmarksinM.Phil Neurophysiology-2013 Ms. R. Rajalakshmi Dr. R.N. Moorthy Awardforscoringthe highestmarksinM.Sc. PsychiatricNursing-2013 Dr. Adwani Sikandar Gokuldas Dr. Anisya Vasanth Memorial Award for theBestPost-Graduate ResidentinNeurology -2013 Maj. N. Kalpana Dr M. V. Govindaswamy & Dr D.L.N. Murthy Rao Memorial Prize & Infosys Foundation Award for Excellence (inCash)forSecuringthe HighestMarksinPost-BasicDiploma inPsychiatric/MentalHealthNursing ExaminationheldinApril2013 Dr. R.N. Moorthy Award forscoringthehighestmarks inM.PhilBiophysics-2013 Ms Neethu C.V. Best Out-Going Student in DiplomainClinical NeurophysiologyTechnology (DCNT)Course intheyear2013 Capt. Anu Zacharia Infosys Foundation Award for Excellence(inCash)&Mukund Memorial Award(inCash)forSecuring DistinctioninPost-BasicDiplomain NeuroScienceNursingExamination heldinApril2013 Annual Report 2013-14 Conference / Symposia / Workshops I. Scientific Programs Organized at NIMHANS A. International Dr. Uma H, Professor of Clinical Psychology, conducted Symposium on Attachment Issues: Indian Perspective. InternationalConferenceof7thCongressofAsianSocietyforChild andAdolescentPsychiatry&AlliedProfessionsand12thBiennial ConferenceofIndianAssociationforChildandAdolescentMental Health,27September2013.30membersparticipated. Dr. Mathew Varghese, Professor & Head of Psychiatry Dept., Dr. Sanjeev Jain, Professor of Psychiatry, Dr. Vivek Benegal, ProfessorofPsychiatry,jointlyorganizedtheICMR-NIMHANSMRC UK Mental Health Scoping Workshop on Aetiology and life-course of substance misuse and relationship with mental illness,26-28February2014.40 membersparticipated. Dr.MallaBhaskarRao,ProfessorofNeurosurgeryandDr.Sanjib Sinha,AdditionalProfessorofNeurology,conductedInternational ColloquiumonDrugResistantEpilepsyinPsychiatryDSM-V,1618August2013.500membersparticipated. B. National Dr. P Marimuthu, Additional Professor, and Co-PIs of the project conducted National Workshop on Migrants’ Access to PublicHealthFacilitiesandHealthSystemResponse,15May 2013.15membersparticipated. CHILD AND ADOLESCENT PSYCHIATRY Dr. Satish C Girimaji, Professor & Head, Dr. Shiva Shankar N, Professor & Head of Speech Pathology and Audiology, conducted State Seminar on Early Intervention and Issues of ViolenceandSexual HarassmentofPersonswith Disabilities, 23November2013.60membersparticipated. CLINICAL PSYCHOLOGY Dr. Anisha Shah, Professor & Head, conducted National Workshop on Adult Psychotherapy- Emotion - Focused and Constructivist Approaches, 5-7 October 2013. 20 members participated. Dr. Ahalya Raguram, Professor, Dr. Seema Mehrotra, Additional Professor, conducted National Workshop on the Research Survey and Exploration in Psychology (6th ICSSR Survey) with ICCSR collaboration, 21 September 2013. 30 membersparticipated. BIOSTATISTICS Dr. K Thennarasu, Professor, Dr. Mariamma Philip, Sr. ScientificOfficer,conductedNationalWorkshoponStatistical MethodsinMedicalResearchandIntroductiontoSPSS,11-13, July2013.54membersparticipated. Workshop on Statistical Methods in Medical Research and Introduction to SPSS Dr.PMarimuthu,AdditionalProfessor,Dr.MariammaPhilip, Sr. Scientific Officer, conducted National Refresher Course in Statistical Methods for Behavioral Research – 2013, 29-31 August2013.32membersparticipated. Dr. LN Suman, Professor, and Dr. Veena Satyanarayana, AssistantProfessor,conductedDepartmentalWorkshop(i)for Counselors on Relationship Skills, 5 June 2013. 24 members participated (ii) for Counselors on Work Effectiveness, 4 September2013.11membersparticipated(iii)forCounselors on Counseling for the Elderly, 9 October 2013. 6 members participated (iv) for Counselors on Counselor Wellness, 11 December 2013. 15 members participated. (v) for Counselors on Psychological Counseling: Concepts, Skills and Ethical Issues,26March2014.29membersparticipated. Dr.LNSuman,Professor,conducteddepartmentalWorkshop on Orientation to Forensic Psychology for PhD Scholars in ClinicalPsychology,29October2013.12membersparticipated. Dr. Seema Mehrotra, Additional Professor, conducted (i) DepartmentalWorkshopforYouthonFeelingGoodandDoing Well:AnExperiential,6-9May2013.16membersparticipated (ii) Trainer’s Workshop on Feeling Good and Doing Well: A Promotive Intervention Module, 24-26 June 2013. 41 74 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 members participated (iii) Youth Pro Orientation Program, 8 August2013.24membersparticipated(iv)GoforYourGoals: WorkshopforYoung Adults,17December 2013.30members participated(v)AdvancedlevelTrainer’sWorkshoponFeeling Good and Doing Well: A Promotive Intervention Module for Youth,16-18December2013.18membersparticipated(vi)Go forYourGoals:WorkshopforYoungAdults,6March2014.35 membersparticipated. Dr. M Manjula, Associate Professor and Meghna Singhal, PhD Scholar, conducted Workshop on Maintaining Healthy Interpersonal Relationships for Youth, NCWB, 12 November 2013.14membersparticipated. Dr. Seema Mehrotra, Additional Professor, Dr. Prabha S Chandra,ProfessorofPsychiatryconductedinterdepartmental NationallevelYouthConferenceonYouthProActionLabs,9 December2013.250membersparticipated. Dr. M Manjula, Associate Professor, Mr. Vidhyasagar, PhD Scholar and Ms. Seema Nambiar, PhD Scholar, conducted WorkshoponEmotionRegulationforHealthyLiving,NCWB, 21December2013.18membersparticipated. Dr. Jamuna Rajeswaran, Additional Professor, conducted National Workshop on 4th Continuing Education in Neuropsychology-Neuropsychological Rehabilitation Emerging Hope: EEG- Neurofeedback Training (EH-NFT), 18-20 November2013.45membersparticipated. Dr. M Manjula, Associate Professor, conducted workshop on FacingExamsEffectively,NCWB,1March2014.13members participated. Dr. Paulomi M Sudhir, Additional Professor, conducted departmental workshop on Understanding and Managing SocialAnxiety,5October2013.13membersparticipated. Dr.PaulomiMSudhir,AdditionalProfessor,Dr.MahendraP Sharma, Professor and Dr. M Manjula, Associate Professor, conducted departmental workshop on Cognitive Behavior Therapy:ApplicationsinEmotionalDisorders,15-16November 2013.50membersparticipated. Dr. M Manjula, Associate Professor, and Ms. Meghna Singhal, Ph. D Scholar, conducted Parenting Teenagers/ YoungAdults:AworkshopforParents,NIMHANSCentrefor Well-Being(NCWB),Bangalore,22June2013.11members participated. Dr.MManjula,AssociateProfessor,Dr.ManojKumarSharma, Associate Professor, Dr. Poornima Bhola, Associate Professor and Dr. Roopesh, Assistant Professor, conducted National workshop on (i) Making a Difference: A workshop on Youth MentalHealthforCollegeCounselors,25June2013(ii)Making aDifference:AworkshoponYouthMentalHealthforCollege Counselors,11-12July2013.48membersparticipated. Dr. M Manjula, Associate Professor, Dr. Paulomi M Sudhir, Additional Professor and Dr. Mahendra P Sharma, Professor, conducted Workshop on Cognitive Behavior Therapy: Basic Principles and Applications, 13-14 August 2013. 60 members participated. Dr. M Manjula, Associate Professor and Ms. Mareena Susan Wesley,PhDScholar,conductedWorkshoponHandlingExams Effectively,NCWB,7December2013.13membersparticipated. Dr.DevvartaKumar,AssociateProfessor,Dr.PoornimaBhola, AssociateProfessor,Dr.PriyaSaxena,conducted(i)Orientation Programme: Orientation to Clinical Psychology: Emerging areas, 26-27 November 2013. 22 members participated. (ii) National Orientation to Clinical Psychology: Emerging Areas, 3-4December2013.22membersparticipated. Dr. Poornima Bhola, Associate Professor, conducted departmental workshop on (i) Tuning in: Being a reflective psychotherapist,NCWB,4April,2013.20membersparticipated (ii)ConsultationLiaisonClinicalPsychologybytheSt.John’s Medical Hospital Team, 29 August 2013 and 5 September 2013.70membersparticipated(iii)Mirror,MirrorontheWall: Becoming a Self-Reflective Practitioner, NIMRCPSYCH 2014: 2ndJointConferenceofNIMHANSandRCPSYCHUK:Training andLearningforthe21stcenturytraineeinPsychiatry,9March 2014.15membersparticipated. Dr. Poornima Bhola, Associate Professor and Dr. Ahalya Raghuram,Professor,conducteddepartmental Symposiumon WalkingtheLine:EthicalIssuesinPsychotherapyPractice,2627November2013.95membersparticipated. Dr. Roopesh BN, Assistant Professor, conducted Workshop on ManagementofDefianceandConductProblemsinChildrenand Adolescents-ATreatment,25June2013.25membersparticipated. EPIDEMIOLOGY Dr. Gururaj G, Professor & Head, Dr. Senthil Amudhan R, Assistant Professor and Dr. Girish N, Additional Professor, National Institute of Mental Health and Neuro Sciences / 75 Annual Report 2013-14 conducted National interdepartmental workshop on Developing a District Roadmap for Integrated Child Mental HealthServices,26February2014.19membersparticipated. Dr. Girish N, Additional Professor, conducted (i) Training programme for Counselors under National Programme for Cardiovascular diseases, Diabetes, Cancer and Stroke, 20-22 August 2013. 19 members participated (ii) Interdepartmental workshop on Elders Fortnight 2014, 21 September 2013-10 October2013.100membersparticipated(iii) Commemorating International Women’s Day, 11 March 2014. 35 members participated (iv) Refresher cum Training Programme for the StakeHoldersoftheFamilyCounselingCenters,18-19March 2014. 48 members participated (v) Workshop on Capacity StrengtheningforincludingNursingCareforGeriatricMental Health Issues in District Hospitals, 25-26 March 2014. 43 membersparticipated. Dr. Girish N, Additional Professor, Dr. Senthil Amudhan R, Assistant Professor, Dr. Sunitha Singh, Jr. Scientific Officer, conducted interdepartmental workshop on Research Methodology-2013, 18-21 December 2013. 33 members participated. Dr. Pradeep BS, Associate Professor, conducted interdepartmental stakeholders workshop on Understanding Issues Among Youth in Karnataka, 26 March 2014. 105 membersparticipated. Inauguration of Symposium on Mental, Neurological, Substance Use Disorders and Injuries in Workplaces HUMAN GENETICS Dr. Chetan GK, Additional Professor, conducted DST PAC meeting, 20-21 March 2014. 12 experts, 45 delegates participated. MENTAL HEALTH EDUCATION Dr. Jayashree Ramakrishna, Professor & Head and Dr. KS Meena, Assistant Professor, Department of Mental Health, in collaboration with Lady Health Visitors Training Centre, Vani Vilas Hospital, Bangalore, conducted (i) State-level WorkshoponIntroductiontoHealthEducationforMentaland NeurologicalDisordersforLadyHealthVisitor[LHV]Trainees, 22-26July2013.22membersparticipated(ii)onedaytraining inMentalHealthEducationfortwonursingstudentswhohad comeforCommunityMentalHealthTrainingfromthePunjab. NEUROANAESTHESIA Dr. V Bhadrinarayan, Professor, Dr. K Sriganesh, Associate Professor,Dr.VSudhir,AssistantProfessor,conductedState-level Workshopon Beorate,7-9March2014.100membersparticipated. Stakeholders Workshop on Understanding Issues Among Youth in Karnataka Dr.GauthamMS,AssistantProfessor,Dr.GururajG,Professor &Head,conducted InterdepartmentalSymposiumonMental, Neurological, Substance Use Disorders and Injuries in Workplaces,31October2013.180membersparticipated. Dr.MRadhakrishnan,AdditionalProfessor,Dr.SrinivasBabu, ProfessorofPhysiologyinCMC,Vellore,conductedWorkshop on Intraoperative Evoked Potential, March 31 2014. 30 membersparticipated. NEUROCHEMISTRY Dr. Gayathri N, Professor of Neuropathology, Dr. Srinivas BharathMM,AdditionalProfessor,Dr.ChandrashekharSagar BK, Additional Professor of Neuropathology, conducted 2nd 76 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 AnnualHands-onWorkshopinNeurochemistryandElectron Microscopy,15-20July2013.17membersparticipated. WorkshoponPilates,BalanceandGait,SwissBall,19January 2014.35membersparticipated. Dr. Gayathri N, Professor of Neuropathology, Dr. Srinivas Bharath MM, Additional Professor, conducted (i) PreConferenceWorkshoponOROBOROSO2konHigh-Resolution Respirometry and O2K-Fluorometry – IOC83, conducted by Prof. Gnaiger Erich, OROBOROS Instruments, Innsbruck, Austria,18December2013.20membersparticipated. NEUROLOGY Dr.ANalini,Professor&Headandfacultyofthedepartment, conductedWorkshoponMERT,19October2013.350members participated. NEUROMICROBIOLOGY NIIR Dr. AK Gupta, Professor & Head, Stanley Prasanna Kumar, Sr. Radiographer, P Ramachandra Reddy, Sr. Radiographer, Ashwath Narayan Rao J, Sr. Radiographer, A Sanjay, Sr. Radiographer, LM Prakasha, Radiographer, Siddalinga Swamy KM, Sr. Radiographer, Deshpande BN, Radiographer, Venkataramanappa G, Radiographer, conducted CME on Advanced Imaging Techniques-2013, 12 May 2013. 220 membersparticipated. Dr. AK Gupta, Professor & Head, Dr. Hima Shriniwas Pendharkar, Associate Professor, Dr. Arvinda HR, Associate Professor,Dr.JitendraSaini,AssistantProfessor,Dr.RoseDawn Bharath,AssociateProfessor,Dr.ChandrajitPrasad,Assistant Professor, Dr. Maya D Bhat, Assistant Professor, conducted 16th Annual Conference of Indian Society of Neuro Radiology ISNR2013-AnInterdepartmentalScientificProgramme,2629September2013.500membersparticipated. Dr. R Ravikumar, Professor & Head, conducted IAMM-KC Quarterly Scientific Meeting, 19 October 2013. 65 members participated. NEUROPATHOLOGY Dr. Gayathri N, Professor of Neuropathology, Dr. Yasha TC, Professor & Head of Neuropathology, Dr. Vani Santosh, Professor of Neuropathology, Dr. BKC Sagar, Additional ProfessorofNeuropathology,Dr.AnitaMahadevan,Additional Professor of Neuropathology, Dr. Anupam Gupta, Additional Professor of Neurological Rehabilitation, conducted 3rd Annual Conference of the Society for Mitochondrial Research and Medicine - Mitochondria in Health and Medicine, 19-20 December2013.102membersparticipated. Inauguration of 3rd Annual Conference of the Society for Mitochondrial Research and Medicine Dr. Gayathri N, Professor, conducted International PreConference Workshop on High Resolution Respirometry (O2K),18December2013.20membersparticipated. 16th Annual Conference of Indian Society of Neuro Radiology ISNR 2013 NEUROLOGICAL REHABILITATION Dr.PradnyaDhargave,Sr.Physiotherapist,Mr.SelvaGanapathy, Physiotherapist, Mr. T Karthikeyan, Physiotherapist, Mr. Rajesh VL, Physiotherapist, conducted Post Conference Dr. Gayathri N, Professor, Dr. BK Chandrasekhar Sagar, Additional Professor, Dr. MM Srinivas Bharath, Additional ProfessorofNeurochemistry,conducted2ndNationalHands-on WorkshopinNeurochemistryandElectronMicroscopy-2013, 15-20July,2013.12membersparticipated. National Institute of Mental Health and Neuro Sciences / 77 Annual Report 2013-14 Dr. Sundar Periyavan, Professor, conducted (i) National WorkshoponBombayBloodGroup, 7July2013.25members participated (ii) Regional Workshop on Blood transfusion Reaction, 17 August 2013. 30 members participated (iii) Preconference Workshop of 2nd national conference of Indian Society of Transfusion Medicine, on Therapeutic Plasma Exchange,12September2013.20membersparticipated. Dr. Sundar Periyavan, Professor, in collaboration with Mr. Manivannan, National Institute of Biologicals & Indian Pharmacopoeia Commission, MoHFW, GOI and State Drugs Control Department, Govt. of Karnataka, conducted a State CMEprogrammeonHemovigilance, 28 September2013,140 membersparticipated. Symposium on ”Mind Science” was organized during the Youth Interfaith Pilgrimage program of the Foundation for the Universal Responsibility of His Holiness The Dalai Lama at NIMHANS. Dr. BK Chandrasekhar Sagar, Additional Professor, Dr. Gayathri N, Professor, conducted National Workshop on An Introduction to Electron Microscopy as a Diagnostic Tool, in collaboration with ILQA, Bangalore, 1 February, 2014. 11 membersparticipated. Participants of National Workshop on ICMR ‘Mentor-Mentee’ for Advancement of Physiological Sciences in India (ICAPS) with the invited speakers and committee members Dr.BinduMKutty,Professor,Dr.TNSathyaprabha,Additional Professor,Dr.BSShankaranarayanaRao,AdditionalProfessor, conducted National CME on Challenges and Opportunities in Medical Education, 27 November 2013. 250 members participated. Hands-on workshop in Neurochemistry and Electron Microscopy NEUROPHYSIOLOGY Dr. Bindu M Kutty, Professor, conducted (i) 5th National Program Advisory Committee (PAC) meeting in Health SciencesofSERB,DST,GovernmentofIndia,5-6May2013. 50 members participated (ii) National Symposium on Mind Science,8August2013.50membersparticipated(iii)National Workshop on ICMR ‘Mentor-Mentee’ for Advancement of Physiological Sciences in India [ICAPS], 20-22 September 2013. 60 members participated (iv) 9th National Program Advisory Committee (PAC) meeting in Health Sciences of SERB, DST, Government of India, 20-21 March 2014. 55 membersparticipated. APPICON 2013: 59th Annual National Conference of Association of Physiologists and Pharmacologists of India Dr. TN Sathyaprabha, Additional Professor, Dr. TR Raju, Sr. Professor & Head, Dr. Bindu M Kutty, Professor, Dr. BS Shankaranarayana Rao, Additional Professor, Dr. Laxmi T Rao, Associate Professor, Dr. Phalguni Alladi, Sr. Scientific Officer, conducted 59th Annual National Conference of Association of PhysiologistsandPharmacologistsofIndiaonDecadesofResearch in Physiology and Pharmacology: Reminders to remember and focus,28-30November2013.1100membersparticipated. 78 / National Institute of Mental Health and Neuro Sciences Annual Report Dr.SathyaPrabhaTN,AdditionalProfessorofNeurophysiology, Dr.NagarathnaS,AdditionalProfessor,Dr.VeenakumariHB, Additional Professor, conducted APPICON-2013-Workshop and Conference, 26-30 November 2013. Approximately 1000 membersparticipated. Dr. BS Shankaranarayana Rao, Additional Professor, Dr. T N Sathyaprabha, Additional Professor, conducted (i) DST Sponsored National Workshop on Current Physiological Techniques:FromBasicstoAppliedAspects,26-27November 2013. 380 members participated (ii) National Workshop on Emerging Trends in Neurophysiology: From Cell to Systems, 26November2013.100membersparticipated(iii)Workshop on Comprehensive Multiparametric Evaluation of Autonomic Functions,26November2013.120membersparticipated. 2013-14 NURSING Dr. Nagarajaiah, Additional Professor, conducted Seminar on Ethical and Legal Guidelines for Nurses – funded by Dr. RN MoorthyFoundationFunds,27November2013. 80 members participated. Dr. Nagarajaiah, Additional Professor, Dr. Ramachandra, Principal,NursingCollege,conducted12thNationalConference ofISPN,8-10February2014.260membersparticipated. Dr. Sailaxmi Gandhi, Assistant Professor, conducted (i) Departmental Workshop on Psychiatric Emergencies and its Management, funded by Dr. RN Moorthy Foundation Funds, 26 February 2014. 89 members participated (ii) NationalConferenceonResearchandServiceinPsychosocial Rehabilitation,8-9March,2014.207membersparticipated. Dr. Prasanthi Nattala, Dr. Pratima Murthy, conducted Interdepartmental Focus Group Discussion on Interventions for Ensuring Community Health and Well-being, including Substance Use Control – Perspectives of Community Representatives,29August2013,8membersparticipated. DST Sponsored National Workshop on Current Physiological Techniques: From Basics to Applied Aspects NEUROVIROLOGY Dr. V Ravi, Professor & Head, Dr. Reeta Mani, Assistant Professor,Dr.ManjunathaMV,conductedWorkshoponPCR Technology,20-24January2014.11membersparticipated. Dr. V Ravi, Professor & Head, Dr. Anita Desai, Additional Professor, Dr. Reeta Mani, Assistant Professor, conducted Refresher Training Programme in Dengue and Chikungunya Serodiagnosis for NVBDCP Sentinel Laboratory Staff of KarnatakaState,21March2014.40membersparticipated. Dr. Anita Desai, Additional Professor, conducted two WorkshopsonEQAS,28June2013and31December2013.10 TechnicalOfficersfrom10StateReferenceLaboratories. Dr.AnitaDesai,AdditionalProfessor,Dr.VRavi,Professor& Head, conducted Workshop on Karnataka State Surveillance Unit, 10 January 2014. 8 Microbiologist from Sentinel site laboratories. Mrs. HN Poornima, Lecturer, Mrs. A Shamala, Clinical Instructor, Mrs. G Jothimani, Clinical Instructor, Mrs. S Jayamary,ClinicalInstructor,Mr.NRajesh,ClinicalInstructor, organized Departmental Seminar on Autism and Newer Perspectives,27June2013.100membersparticipated. COLLEGE OF NURSING Dr. Pratibha Swamy, Associate Professor, Ms. Vimal Devi P, Clinical Instructor, Mrs. P Vijayalakshmi, Clinical Instructor, Mrs. Suseela T, Clinical Instructor conducted Seminar on ComplementaryTherapiesinpatientcare,CollegeofNursing, 2September2013.120membersparticipated. Dr.CRajeswari,Lecturer,Mrs.MythiliD,ClinicalInstructor, Mrs. N Padmavathi, Clinical Instructor, Mrs. Sathyavathy N, Clinical Instructor, conducted Seminar on Role of Prosthesis onHearingImpairment,CollegeofNursing,26April2013.60 membersparticipated. Mrs. Poornima HN, Lecturer, Mrs. Shamala A, Clinical Instructor, Mrs. S Jeyamari, Clinical Instructor, Mrs. G Jothimani,ClinicalInstructor,Mr.RajeshN,ClinicalInstructor conductedSeminaronAutismandNewerPerspectives,College ofNursing,27June2013.120membersparticipated. National Institute of Mental Health and Neuro Sciences / 79 Annual Report 2013-14 Dr. S Valliammal, Lecturer, Mrs. Kanitha D, Lecturer, Mrs. Poornima HN, Lecturer, conducted Workshop on Immediate Newborn Care, College of Nursing, 26-27 July 2013. 120 membersparticipated. Dr. Pratima Murthy, Professor, Dr. VNR Pandian, Additional Professor of Psychiatric Social Work, conducted Workshop forCBOsofWomeninSexWork,14March2014.35members participated. Mrs. Kanitha D, Lecturer, Dr. S Valliammal, Mrs. Deiva K, Clinical Instructor, Mrs. Sivakami S, Clinical Instructor conducted Seminar on Breast Crawl, College of Nursing, 18 January2014.120membersparticipated. Dr. BN Gangadhar, Professor, Dr. Jagadisha Thirthalli, Additional Professor, Dr. Muralidharan Kesavan, Associate Professor,Dr.ShivaramaVarambally,AssociateProfessor,Dr. C Naveen Kumar, Assistant Professor, Dr. A Shyam Sundar, Assistant Professor, Dr. Preeti Sinha, Assistant Professor, Dr. Biju Viswanath, Assistant Professor, Dr. Shashidhara HN, Senior Resident (1 year PDF), Dr. Rajendra KM, Senior Resident, Dr.Vijay Danivas, MD with Post DPM, conducted ECT Symposium 2013, NIMHANS, 7 December 2013. 228 membersparticipated. PSYCHIATRY Dr. Santosh K Chaturvedi, Professor, Dr. Pratima Murthy, Professor, Dr. Arun Kandasamy, Assistant Professor, conducted workshop on (i) Professional Skills Enhancement Programme, 8 January 2014. 25 members participated (ii) EarlyCareerMentalHealthProfessionals,9-11January2014. 17membersparticipated. Dr. Santosh K Chaturvedi, Professor, Dr. Geetha Desai, Associate Professor, conducted interdepartmental Workshop on (i) Chronic Pain - (a) 15 December 2013. 25 members participated(b)23March2014.40membersparticipated. Dr.SrikalaBharath,Professor,conductedNationalWorkshop on (i) Empowering Adolescents Using Life Skills EducationTraining of Life Skills Educators, 26-28 September 2013. 28 membersparticipated(ii)EmpoweringAdolescentsusingLife SkillsEducation-TrainingofLifeSkillsEducators,13-15March 2014.31membersparticipated. Dr. Srikala Bharath, Professor, Dr. Preeti Sinha, Assistant Professor, conducted Workshop on Positive Aging (Part of Elderly Fortnight Activities), NCWB, NIMHANS, 1 October 2013.30-35membersparticipated. Dr. Prabha S Chandra, Professor, Dr. Senthil Kumar Reddi, Assistant Professor, Dr. Krishna Prasad, Senior Resident, conducted Training in Emergency Psychiatry for NIMHANS Casualty Medical Officers, NIMHANS, 10 April 2013. 9 membersparticipated. Dr. Pratima Murthy, Professor, conducted Workshop on AddressingRiskFactorsforNon-CommunicableDiseases,6-7 February2014.25membersparticipated. Dr.PratimaMurthy,Professor,Dr.SureshBadamath,Additional Professor,Dr.NaveenKumarC,AssistantProfessor,conducted Workshop on Forensic Psychiatry training, NIMRPSYCON, 7 March2014.25membersparticipated. Release of ECT Administration Manual (2nd Edition) at the ECT Symposium 2013 Dr. G Venkatasubramanian, Additional Professor, Dr. BN Gangadhar, Professor, conducted CME on Psychiatric Classification, NIMHANS, 20 February 2014. 200 members participated. Dr. G Venkatasubramanian, Additional Professor, Dr. Shivarama Varambally, Associate Professor, conducted CME on The Art & Science of Choosing Antipsychotics in Schizophrenia. Individualized Schizophrenia Treatment and Reintegration (InSTAR), NIMHANS, 14 March 2014. 130 membersparticipated. Dr.PTSivakumar,AdditionalProfessor,conductedWorkshop onYogaforelderly,3October2013.30membersparticipated. Dr. Arun Kandasamy, Assistant Professor, conducted (i) Departmental workshop on Tobacco Related Problem and its Intervention,24-25September2013.20membersparticipated (ii) One-month Orientation Programme on Substance Use Disorders, 15 November-13 December 2013. 50 members participated. 80 / National Institute of Mental Health and Neuro Sciences Annual Report PSYCHIATRIC REHABILITATION Dr. Jagadisha Thirthalli, Additional Professor, Dr. Geetha Desai, Associate Professor, Dr. Sivakumar T, Assistant Professor, Dr. Avinash Waghmare, Senior Resident, Dr. Poornima Bhola, Associate Professor of Clinical Psychology, Dr. Nirmala BP, Associate Professor of Psychiatric Social Work, Dr. Sailaxmi Gandhi, Assistant Professor of Nursing, conducted Interdepartmental Volunteer Training Program, National Conference on Research and Services in Psychiatric Rehabilitation:FocusonRecovery,9July2013.22volunteers participated. National Conference on Research and Services in Psychiatric Rehabilitation: Focus on Recovery Dr.NaveenKumarC,AssistantProfessor,Dr.SKChaturvedi, Professor, Dr. Jagadisha Thirthalli, Additional Professor, Dr. GeethaDesai,AssociateProfessor,Dr.SivakumarT,Assistant Professor, Dr. Avinash Waghmare, Senior Resident, Dr. Poornima Bhola, Associate Professor of Clinical Psychology, Dr.DevvrataKumar,AssociateProfessorofClinicalPsychology, Dr.HesiHerbert,JuniorConsultantofClinicalPsychology,Dr, NirmalaBP,ofPsychiatricSocialWork,Dr.SailaxmiGandhi,of Nursing,conductedInterdepartmentalNationalConferenceon ResearchandServicesinPsychiatricRehabilitation:Focuson Recovery,8-9March2014.207membersparticipated. Interdepartmental National Conference on Research and Services in Psychiatric Rehabilitation: Focus on Recovery Dr. Nirmala BP, Associate Professor of PSW, Udgiri S, PhD Scholar,Dr.WaghmareA,SeniorResident,Dr.SivakumarT, 2013-14 Assistant Professor, Dr. Kumar CN, Assistant Professor, Dr. Sailaxmi Gandhi, Assistant Professor of Nursing, Dr. Bhola P, Associate Professor of Clinical Psychology, Dr. Desai G, Associate Professor, Dr. Thirthalli J, Additional Professor, Dr. Chaturvedi SK, Professor, conducted one month National Orientation Programme in Psychiatric Rehabilitation, August toSeptember2013.4membersparticipated. Participants of one-month National Orientation Programme In Psychiatric Rehabilitation with the organisers Dr. Sivakumar T, Assistant Professor, Dr. Jagadisha T, AdditionalProfessor,Dr.GeethaDesai,AssociateProfessor,Dr. PoornimaBhola,AssociateProfessorofClinicalPsychology,Dr. Devvarta Kumar, Associate Professor of Clinical Psychology, Dr. Nirmala BP, Associate Professor of PSW, Dr. Sailaxmi Gandhi, Assistant Professor of Nursing, Dr. CN Kumar, Assistant Professor, Dr. A Waghmare, Senior Resident, Ms. S Udgiri,Ph.DScholar,Dr.HesiHerbert,JuniorConsultantof ClinicalPsychology,Dr.ChethanB,NonPGJuniorResident ofPsychiatry,conductednineinterdepartmentalWorkshopson Caregivers’EducationandSupportProgramme,fundedbyDr. Ramachandra N Moorthy Foundation for Mental Health and NeurologicalSciences-topicon(a)LivingwithSchizophrenia, 16 July 2013. 17 Caregivers and 20 Professionals participated (b) Marital issues in people with Schizophrenia, 20 August 2013. 23 Caregivers and 21 Professionals participated (c) Community reintegration, 17 September 2013.30 Caregivers and 20 Professionals participated (d) Portrayal of Persons withSchizophreniainMedia:MythsandRealities,15October 2013. 25 Caregivers and 25 Professionals participated (e) Coping with burnout, 19 November 2013. 24 Caregivers and 19Professionalsparticipated(f)Whatafterme?17December 2013. 25 Caregivers and 28 Professionals participated (g) Promoting therapeutic family environment, 21 January 2014. 32 Caregivers and 20 Professionals participated (h) Welfare benefits for persons with psychiatric disorders, 18 February National Institute of Mental Health and Neuro Sciences / 81 Annual Report 2013-14 2014.27caregiversand20professionalsparticipated(i)NGO’s workingformentallyillpatients,18March2014.18caregivers and 20 professionals participated. (Total: 221 caregivers and 188professionalsparticipated). PSYCHIATRIC SOCIAL WORK Dr. K Sekar, Professor & Head, Mr. Susindar Babu, Deputy Director, CBHI, DRHS, MoH and FW, GoI, Kendriya Sadan, Bangalore, conducted Interdepartmental Workshop on AwarenessofICF,DisabilityandHealth,11October2013.60 membersparticipated. Dr. K Sekar, Professor & Head, conducted Interdepartmental Workshop on Psychosocial Support for Children for ChhattisgarhRefugeesinAPforASDS,SIRINGOs,Khammam District, Andhra Pradesh, 19 October 2013. 15 members participated. Dr.NKrishnaReddy,AdditionalProfessor,Dr.Thirumoorthy, Additional Professor, Dr. N Janardhana, Assistant Professor, conducted Departmental Workshop for lay counsellors on Common Neurosurgical Illness seen in Casualty, November 2013.23membersparticipated. Dr. R Dhanasekara Pandian, Additional Professor, conducted Two months Interdepartmental Training Programme on Addiction Counselling for NRHM Social Workers from Himachal Pradesh, November and December-2013. 12 membersparticipated. Dr.AThirumoorthy,AdditionalProfessor,Dr.NJanardhana, Assistant Professor, organized (i) 2 days National workshop on Mental Health Care Services for TNPVP Chennai, 29-30 April2013.30membersparticipated(ii)NationalOrientation Training Program for Amateur Counselor Forum Samadana CounselingCentre,Bangalore,(LifeSkillEducation),10August 2013.45membersparticipated. Dr.AThirumoorthy,AdditionalProfessor,organizedaNational Orientation Training Program for Amateur Counselor Forum SamadhanaCounselingCentreBangalore(SuicidePrevention), 12thFebruary2014.26membersparticipated. Dr. Md. Ameer Hamza, Associate Professor, conducted (i) National Workshop on Adolescent Sexuality, Reproductive Health and Gender Equality- (a) 2-4 May 2013. 19 members participated(b)11-13September2013.35membersparticipated (ii) ICMR Workshop on Adolescent Sexuality, Reproductive Health and Gender Equality- (a) 16-18 September 2013. 32 membersparticipated(b)19-21September2013.36members participated(c)24December2013.16membersparticipated. Dr. BP Nirmala, Associate Professor, Dr. N Janardhana, Assistant Professor, conducted Departmental Workshop on (i) Counseling Techniques in Rehabilitation for the students ofRehabilitationScience,St.Anne’scollegeBangalore,28-30 November 2013. 26 members participated (ii) Mental Illness and Community Based Rehabilitation, 15-16 April 2013. 15 membersparticipated. Dr. N Janardhana, Assistant Professor, Professor, Dr. R Parthsarathy, Dr. D Muralidhar, Professor, Dr. K Sekar, Professor & Head, Dr. Shekar Seshadri, Professor of Child and Adolescent Psychiatry, conducted Interdepartmental Workshop on (i) Counseling and Capacity Building for the HouseParentsofGovernmentChildrenHomes,ICPS-(a)16-17 April 2014. 41 members participated (b) 18-19 April 2013. 42 members participated. (ii) Counseling and Capacity Building fortheLegalCumProbationOfficersofGovernmentChildren Homes, ICPS, 8-12 July 2013. 21 members participated (iii) Counseling and Capacity Building for the Institutional Heads ofGovernmentChildrenHomes,ICPS,7-9October2013.29 members participated (iv) Counseling and Capacity Building for the Probation Officers Grade II of Government Children Homes,ICPS,9-11December2013.30membersparticipated. Dr. N Janardhana, Assistant Professor, Dr. A Thirumoorthy, AdditionalProfessor,conductedDepartmentalTraining(i)For theCounselorsfortheAmateurCounselorFormonCommon Neurological Problems, 13 September 2013. 40 members participated(ii)FortheCounselorsfortheAmateurCounselor Form on Child Mental Health Problems, 10 April 2013. 80 membersparticipated(iii)FortheCounselorsfortheAmateur CounselorFormonCommonNeurologicalProblems.13June 2013.40membersparticipated. Dr.NJanardhana,AssistantProfessor,conductedDepartmental TrainingontheCounselingChildreninDifficultCircumstances for the Integrated Child Protection Personnel of Orissa, 18 January2014.18membersparticipated. Dr.SatishCGirimaji,Professor&HeadofChildandAdolescent Psychiatry, Dr. N Janardhana, Assistant Professor, Dr. H Uma Hirasave, Professor of Clinical Psychology, conducted Interdepartmental WorkshoponSexuality amongIntellectual Disabled Children and Young Adults, 21 December 2013. 150 membersparticipated. 82 / National Institute of Mental Health and Neuro Sciences 2013-14 Annual Report Dr.VrandaMN,AssistantProfessorandDr.KSekar,Professor &Head,conductedDepartmentalWorkshoponRecentTrends inPsychiatricSocialWork,26-27September2013.40members participated. Dr. K Sekar, Professor & Head, Dr. E Aravind Raj, Assistant Professor, conducted National Departmental Consultative MeetingonReviewofPsychoSocialSupportandMentalHealth Services(PSSMHS)inDisasterManagement,8January2014. 15membersparticipated. Dr.KavitaVJangam,AssistantProfessor,Dr.KSekar,Professor &Head,conductedDepartmentalWorkshopon(i)Psychosocial PreparednessinDisasterManagement,May2013.15members participated(ii)RecentTrendsinPsychiatricSocialWork,1820September2013.25membersparticipated(iii)TheRecent Trends in Clinical Practices in Mental Health, June 2013. 17 membersparticipated. Dr.KSekar,Professor&Head,Ms.KavithaP,Ph.D.Scholar, conducted Departmental Workshop on Psychosocial Care for Children in Difficult Circumstances, 20-29 June 2013. 6 membersparticipated. Dr.KSekar,Professor&Head,Dr.SanjeevKumarManikappa, Ph. D. Scholar, Ms. Revathi S, PSSDM student, conducted Departmental Workshop on Training of trainers psychosocial care and support for IDPs with special reference to children, 19-24August2013.6membersparticipated. Dr.KSekar,Professor&Head,Ms.RevathiS,PSSDMstudent, Ms. Paramita B, PSSDM student, conducted Departmental Workshop on Training of Trainers Psychosocial Care for DisasterRefresherCourse,23September2013-5October2013. 12membersparticipated. SPEECH PATHOLOGY & AUDIOLOGY Dr. Shivashankar, Professor & Head of Speech Pathology and Audiology,Dr.JamunaRajeshwaran,AdditionalProfessor,Dr.Rose Dawn, Associate Professor of NIIR, organized Interdepartmental MeetingoftheMinds,conductedbyHongKongUniversity(Prof. HoShuLeong,ProfLeeTatiaandProfTanLeeHai,Universityof HonKong),17August2013.150membersparticipated. WorkshoponEarlyIntervention&IssuesofViolence&Sexual Harassment of People with Disabilities, 23 November 2013. 100membersparticipated. II. Scientific Programs NIMHANS A. International Organized Outside Dr. BS Shankaranarayana Rao, Additional Professor of Neurophysiology,InternationalworkshoponHighereducation and career opportunities in Biotechnology. 1st International and 3rd National Conference of Biotechnology, Bioinformatics and Bioengineering. Tirupati, India, 28-29 June 2013. 140 membersparticipated. Dr.LaxmiTRao,AssociateProfessorofNeurophysiology,conducted Symposium on Environment, Nutrition and Brain Functions. InternationalSymposiumonEmergingTrendsandChallengesin Neuroscience and 31st Annual Conference of Indian Academy of NeurosciencesandlocalChapterofIAN,Allahabad,UttarPradesh, India,25-27October2013.150membersparticipated. Dr. V Ravi, Professor & Head of Neurovirology and Dr. Narayan Rishi, conducted International Asia pacific Congress of Virology, Amity University, 16-20 December 2013. 350 membersparticipated. Dr. Pratima Murthy, Professor of Psychiatry, Dr Girish N, Additional Professor of Epidemiology, Dr Manoj, Associate Professor of Clinical Psychology conducted (i) Symposium on TobaccoControl,7thCongressoftheAsianSocietyforChildand AdolescentPsychiatryandAlliedProfessionsand12thBiennial Conference, Indian Association for Child and Adolescent MentalHealth,27September2013.75membersparticipated. Dr.ShekharSeshadri,Professor,conductedNationalWorkshop onPracticalManagementofChildSexualAbuseintheIndian Setting.7thCongressofAsianSocietyforChildandAdolescent Psychiatry&AlliedProfessions(ASCAPAP),25-28September 2013.50membersparticipated. B. National BIOSTATISTICS Dr.NShivashankar,Professor&Head,Dr.SatishCGirimaji, Professor & Head, Child and Adolescent Psychiatry, Sevain-Action, an NGO as well as a State Nodal Agency Centre for National Trust, conducted Interdepartmental State level Dr. K Thennarasu, Professor, conducted Workshop on Biostatistics and Research Methodology, CIP, Ranchi, 5-8 November2013.65membersparticipated. National Institute of Mental Health and Neuro Sciences / 83 Annual Report 2013-14 Dr. K Thennarasu, Professor, Dr. P Marimuthu, Additional Professor, Dr. Marimamma Philip, Sr. Scientific Officer, Mr. ShivajiRao,ComputerProgrammer,conductedWorkshopon Biostatistics and Research Methods in Aerospace Medicine, Institute of Aerospace Medicine, Bangalore, 19-21 September 2013.50membersparticipated. Dr. Marimamma Philip, Sr. Scientific Officer, conducted workshopon(i)StatisticalMethodsinPsychology,Department of Psychology, Jain University, Bangalore, 28 February 2014. 20 members participated (ii) Biostatistics and Research Methodology workshop, LGBR IMH, Tezpur, 7-8 February 2014.40membersparticipated. CHILD AND ADOLESCENT PSYCHIATRY Dr. Satish C Girimaji, Professor & Head, conducted Regional WorkshoponChildPsychotherapyinCMEonPsychotherapy, DepartmentofPsychiatry,KMC,Manipal,16November2013. 200membersparticipated. Dr.ShobaSrinathandDr.AnilTambi,conductedStateCMEon ChildandAdolescentPsychiatry,SMSMedicalCollege,Jaipur, 10-11March2014.50membersparticipated. CLINICAL PSYCHOLOGY Dr.AhalyaRaguram,Professor,conductedRegionalworkshop on Psychiatry Update-2013, KMC, Manipal, 16-17 November 2013.200membersparticipated. Dr. Uma H, Professor, conducted (i) Workshop on Child PsychologyandChildMentalHealthforPoornaPramatiSchool Teachers,12June2013.8membersparticipated(ii)Sessionon StressManagementforJudgesatKarnatakaJudicialAcademy, Bangalore, 11 September 2013. 15 members participated (iii) ASessiononProblemsonOldAge,HKSangha,9November 2013.50membersparticipated(iv)WorkshoponSexEducation forChildrenandAdolescentswithMentalRetardation,Fame, India,4January2014.20membersparticipated. Dr. Mahendra P Sharma, Professor, conducted (i) Regional Workshop on Cognitive Behavior Therapy: Principles and Applications,InstituteofBehavioralSciences,GujaratForensic Sciences University, Gandhinagar, 23 August 2013. 30 membersparticipated(ii)WorkshoponMindfulnessIntegrated Cognitive Behavioral Interventions in Emotional Disorders, DepartmentofPsychiatry,KasturbaMedicalCollege,Manipal, 16-17November2013.80membersparticipated. Dr.PaulomiMSudhir,AdditionalProfessorandDr.Roopesh BN, Assistant Professor, conducted School Mental Health ProgramforTeachersofPSBB,LLA,Bangalore,18March2013. 25membersparticipated. Dr.PaulomiM.Sudhir,AdditionalProfessor,conductedSession on Mental Health Program for Executives and Managers of AshokLeylandLimited,Hosur,28December2013.45members participated. Dr.KeshavKumar,AdditionalProfessor,conducted(i)National Symposium on Cognitive retraining in Schizophrenia, 40th NationalConferenceofIndianAssociationofClinicalPsychologist (NACIACP), Kattankulathur, Chennai, 27 February-1 March 2014.70membersparticipated(ii) PreconferenceWorkshopon NeuropsychologicalRehabilitationinHeadInjury,40thNational conference of Indian Association of Clinical Psychologist (NACIACP), Kattankulathur, Chennai, 27 February 2014. 30 members participated (iii) Workshop on Emerging Trends in Neuropsychological Rehabilitation, National Seminar on NeuropsychologicalRehabilitation,EthirajCollegeforWomen, Chennai, 18 December 2013. 18 December 2013. 75 members participated (iv) Workshop on Cognitive Rehabilitation, SOAHS, Manipal University, Manipal, 14-15 December 2013. 75membersparticipated(v)Workshopon Psycho-somaticand Memory Management. Professional Certificate Programme on Tea Tasting and Marketing (PCP-TTM). Indian Institute of PlantationManagement,GovernmentofIndia,16May2013. Dr. M Manjula, Associate Professor, conducted (i) Workshop on Handling Exam Stress Effectively, Indian Institute of Technology,Hyderabad,3April2013.35membersparticipated (ii)WorkshoponHowtoFaceExamsEffectively,JainUniversity, Bangalore,6April2013.50membersparticipated(iii)Meeting theChallenge:AworkshoponHandlingAcademicsEffectively, ChristPre-UniversityResidentialCollege,11-12June2013.100 membersparticipated(iv)MaintainingHealthyRelationships: A workshop for the Youth, Indian Institute of Science, Bangalore,19September2013.18membersparticipated. Dr. Devvarta Kumar, Associate Professor, conducted Workshop on Metacognitive Therapy for Delusions, Department of Clinical Psychology, Sri Ramchandra University, Chennai, 14 August 2013 (ii) ICSSR sponsored Workshop on Rating Scales, Bharati VidyapeethDeemedUniversity,YCISSR,Pune,14December2013. 84 / National Institute of Mental Health and Neuro Sciences Annual Report Dr. Poornima Bhola, Associate Professor, conducted Session on (i) Managing Stress Levels in the IT Industry, NTT Data, Bangalore, 16 January, 2014. 90 members participated (ii) Mental Health Awareness and Help Seeking, Jain University, Bangalore,3February2014.70membersparticipated. Dr.RoopeshBN,AssistantProfessorandDr.VeenaAS,Assistant Professor, conducted Workshop on (i) Gender Sensitivity for Primary School Students, Bangalore, 28 November 2013. 60 members participated (ii) Gender Sensitivity for High School students,Bangalore,29November2013.40membersparticipated. Dr. Roopesh BN, Assistant Professor, conducted (i) Neuropsychological Tests used with Children, Manipal, Udupi District, 8 January 2014. 25 members participated (ii) Workshop on Development of Cognitive Functions, Dept. of ClinicalPsychology,Manipal,UdupiDistrict,7January2014. 30membersparticipated. Dr. Roopesh BN, Assistant Professor and Ankur Foundation, conductedWorkshoponManagementofBehaviorProblemsin ChildrenwhoareinFosterCare,Bangalore,8January2014.40 membersparticipated. EPIDEMIOLOGY 2013-14 NEUROANAESTHESIA Dr. KR Madhusudan Reddy, Professor & Head, Dr. Bhadrinarayan, Professor, conducted Malathi Memorial Oration.ISNACC2014NationalConference,Jaipur,31January 2014.300membersparticipated. Dr. Sriganesh K, Associate Professor, Dr. Sudhir V, Assistant Professor, conducted CME on Transfusion Medicine for Anaesthesiologists:WhatWeNeedtoKnow,12January2014. 235membersparticipated. NEUROCHEMISTRY Dr. Utpal Tatu, IISc, Bangalore, Dr. Srinivas Bharath MM, Additional Professor, conducted 5th Annual meeting of the Proteomics Society of India, 28-30 November 2013. 400 membersparticipated. NIIR Dr. Rose Dawn Bharath, Associate Professor, conducted FunctionalMRI:HandsonWorkshop,PGI,Chandigarh,12-21 August2013.15membersparticipated. NEUROLOGICAL REHABILITATION Dr.GururajG,Professor&HeadandDr.NGirish,Additional Professor,conducted(i)StrengtheningDistrictMentalHealth Programme with Public Health Approaches and Strategies, Tamil Nadu, 17-19 June 2013. 35 members participated (ii) StrengtheningDistrictMentalHealthProgrammewithPublic Health Approaches and Strategies in Kerala, Cochin, Kerala, 6-8December2013.35membersparticipated. Dr. Gautham MS, Assistant Professor and Dr. Girish N, AdditionalProfessor,conducted StressManagementWorkshop for Mid-Level Managers of Toyota-Kirloskar Motor Pvt. Limited,Bidadi,5October2013.60membersparticipated. Dr.NGirish,AdditionalProfessor,conducted(i)Preconference CMEon-(a)RecognizingHarmfromAlcoholUse(b)Integrating ScreeningforGeriatricMentalHealth,KACHSilvercon2014, BangaloreMedicalCollegeandResearchInstitute,Bangalore, 30 November 2013. 32 members participated (ii) Workshop on Commemorating founding day of CPH at NIMHANS, Sri DevarajUrsUniversity,Tamaka,Kolar,13December2013.100 membersparticipated. Dr. Anupam Gupta, Additional Professor, conducted (i) IAPMR National Mid-Term CME and Pre Conference Workshop on Botulinum Toxin- An In Spasticity Management,Mumbai,India,20-22September2013.More than60membersparticipated(ii)2ndNationalConferenceof IFNR-Indian Federation of Neuro-Rehabilitation, Mumbai, Maharashtra, 27 February-1March 2014. More than 100 membersparticipated. Dr. Pradnya Dhargave, Sr. Physiotherapist organized a Workshop on Empowering Women on Physical, Mental, Spiritual and Intellectual Health on International Women’s Day,withSamyakPrabodhanPratisthan,8March2014. Mr. T Karthikeyan, conducted Workshop and invited as a resource person on Physiotherapist Prospective on Traumatic Brain Injury, Dr. MV Shetty College of Physiotherapy,Mangalore,onWorldPhysiotherapyDay,8 September2013. National Institute of Mental Health and Neuro Sciences / 85 Annual Report 2013-14 NEUROLOGY Dr. PS Mathuranath, Additional Professor, Dr. Ratnavalli, Manipal Hospital, conducted 3rd WFN Teaching Course in Cognitive Neurology, Manipal Hospital, Bangalore, 5-7 April 2013.200membersparticipated. NEUROPHYSIOLOGY Dr.BSShankaranarayanaRao,AdditionalProfessor,conducted National Workshop on Research Challenges in EEG Signal AnalysisandApplication,jointlywithDr.AmbedkarInstitute of Technology, Bangalore, 25-26 June 2013. 80 members participated. Dr. BS Shankaranarayana Rao, Additional Professor, Dr. TN Sathyaprabha, Additional Professor and Dr. Sandya T Avadhany, St. John’s Medical College, conducted National WorkshoponTechniquesinBody CompositionMeasurements inHealthandDisease,St.John’sMedicalCollege,Bangalore, 26November2013.60membersparticipated. Dr. BS Shankaranarayana Rao, Additional Professor, Dr. TN Sathyaprabha,AdditionalProfessor,Gp.Capt.(Dr)DKDubey, conducted National Workshop on Evaluation of Aerospace StressesUsingSimulators,IAM,Bangalore,27November2013. 100membersparticipated. Dr. TN Sathyaprabha, Additional Professor, conducted Workshop on Research Methodology, Institute of Unani Medicine,Bangalore,October2013.250membersparticipated. Dr. Bindu M Kutty, Professor of Neurophysiology, conducted National CME on Basics of Sleep and Sleep Disorders, Raja Rajeswari Medical College, Bangalore, 9 March 2014. 200 membersparticipated. PSYCHIATRY Dr. Arun Kandasamy, Assistant Professor, conducted DepartmentalWorkshoponOverviewofSubstanceAbuseand IllEffectsofTobaccofortheTVSemployees,HosurCampus,28 May2013.100membersparticipated. Dr.NaveenKumarC,AssistantProfessorandDr.VishalIndla, Chief Psychiatrist of Vijayawada Institute of Mental Health and Neurosciences, conducted National Debate for Young Psychiatrists:PsychiatristshavenoRoletoPlayinSocialIssues. FortheMotion:Dr.RishikeshBehereandDr.K.ChandraSekhar, Againstthemotion:Dr.RukshedaSyedaandDr.HarishShetty. Vijayawada Institute of Mental Health and Neurosciences, Vijayawada,17January2014.50membersparticipated. Dr. SK Chaturvedi, Professor and Faculty of Pain Palliative Care department, St John’s Hospital, conducted Workshop on Communication skills, Pain and Palliative Care Unit, St John’s Hospital,Bangalore,15November2013.20membersparticipated. Dr. SK Chaturvedi, Professor, Dr. Sushma Bhatnagar, Professor of Psychiatry, AIIMS, conducted workshop on (i) Communication Skills, AIIMS, New Delhi (a) 29 June 2013. 35membersparticipated(b)15December2013.40members participated(ii)1stIndianCancerCongress2013,21November 2013.50membersparticipated. Dr.SKChaturvedi,Professor,Dr.JayitaDeodhar,Psychiatrist, Dr. Prabha S Chandra, Professor, conducted Workshop on International Psycho Oncology Society Academy, Tata MemorialHospital,Mumbai,29November-1December2013. 150membersparticipated. Dr. Santosh Loganathan, Associate Professor, conducted a symposium during -ANCIPS, 2014 Intervening with Stigma andDiscriminationinDifferentSettings,18January2014.3040membersparticipated. Dr.VivekBenegal,ProfessorconductedWorkshoponMotivation Enhancement,GoaPsychiatricSociety,Panjim,April,2013.24 membersparticipated(ii)NationalLevelWorkshoponBurden of Alcohol use in India. Alcohol Taxation And Multi-Sectoral Policy Interventions to Counter The Harms Associated With Alcohol Consumption, Public Health Foundation, New Delhi, April,2013.80membersparticipated. Dr. Prabha S Chandra, Professor, Dr. Muralidharan K, Associate Professor, conducted (i) NIMRCPSYCON 2014, 2nd JointConferenceofNIMHANS,BangaloreandRoyalCollegeof Psychiatrists,UK,7-8March2014.200membersparticipated (ii) National Workshop on OCD- Non Responsive to SSRI - WhatNext,AnnualNationalConferenceofIndianAssociation ofPrivatePsychiatry(ANCIAPP),NIMHANS,7-8March2014. PSYCHIATRIC SOCIAL WORK Dr. K Sekar, Professor & Head, Dr. Sanjeeva Kumar, Ph. D. Scholar, conducted Workshop on PSC in DMToT on Disaster Management. Administrative, Training Institute, Mysore, 26 November2013.40membersparticipated. 86 / National Institute of Mental Health and Neuro Sciences Annual Report Dr. K Sekar, Professor & Head, Kavitha P, Ph. D. Scholar, Mahesha R, Field Coordinator, conducted Workshop on (i) Psychosocial Care for Children in Difficult Circumstances, PRERANA,Raichur,10-11June2013.43membersparticipated (ii) Psychosocial care for children in difficult circumstances, Sri Gowthama Grama Kalyana Kendra, 13-14 June 2013. 42 membersparticipated. Dr. K Sekar, Professor & Head, Sudeep Jacob Joseph, PhD Scholar, conducted (i) Sensitization Program on Student EnrichmentandEnrichingFamilyLifeforChildrenwithVisual Disability, SAMA, Bangalore, 10 April 2013. 10 members participated (ii) Student Enrichment Program for Children withVisualDisabilities,SAMA,Bangalore,20-25May2013.12 membersparticipated(iii)EnrichingFamilyLifeforChildren with Visual Disabilities, SAMA, Bangalore 20-25 May 2013. 14membersparticipated(iv)WorkshoponICFSensitization, CBHI,11October2013.12membersparticipated. Dr.KSekar,Professor&Head,conducted(i)CBHITrainingOrientation course on Family of International Classification (ICD-10 & ICF), Bangalore, 9 January 2014. 20 members participated(ii)WorkshoponEffectualDisasterManagement in Karnataka Special Reference to Malnad Areas, Kuvempu University, Sankarghatta, 6-7 March 2014. 60 members participated. Dr. K Sekar, Professor & Head, Dr. E Aravind Raj, Assistant Professor, Dr. Kavita V Jangam, Assistant Professor, Ms. Revathi S, PSSDM student, Ms. Paramita B, PSSDM student, conducted 2 days Sensitization Program on Psychosocial Preparedness Disaster Management, Christ University, Bangalore,5-6March2014.31membersparticipated. Dr.KSekar,Professor&Head,Dr.SanjeevKumarManikappa, PhD Scholar, Ms. Paramita B, PSSDM student, Workshop on Training of Trainers on Psychosocial Support Recover SupporttoCommunitiesAffectedbyEthnicConflictinAssam and Mizoram-Tripura States of North-East India, North East Diosecean Social Forum, Joypur, Kharguli, Guwahati, 27-31 May2013.11membersparticipated. Dr.KSekar,Professor&Head,Ms.ParamitaB,PSSDMstudent, conducted(i)3-dayEssentialModuleTrainingonPsychosocial SupportPostUttarakhandDisasterforFHVinGuptakashi,ITI Guptakashi,Rudraprayag,Uttarakhand,17-19August2013.36 membersparticipated(ii)OnedaySensitizationandOrientation Workshop for Roshni Nilaya School of Social Work Students onPSSforDisasterAffectedSurvivorsinUttarakhand,Roshni 2013-14 Nilaya School of Social Work, Mangalore, 9 October 2013. 17 membersparticipated. Dr.KSekar,Professor&Head,Mr.SudeepJacobJoseph,PhD Scholar,Ms.ParamitaB,PSSDMstudent,conductedTraining onTrainersonPsychosocialFirstAidInAirDisastersforInter GlobeAviationLtd.,IndigoOffice,Indigo,Gurgaon,Haryana, 23-28September2013.20membersparticipated. Dr.KSekar,Professor&Head,Dr.VikramSinghRawat,Ms. Paramita B, PSSDM student, conducted Training of Medical officers in Disaster Mental Health and Psychosocial Support Post Uttarakhand Disaster, Regional Health and Family Welfare Training Centre, Dehradun, 21-26 October 2013. 36 membersparticipated. Dr. K Sekar, Professor & Head, Mr. Susinder Babu, Deputy Director, CBHI, DRHS, MoH and FW, GoI, Kendriya Sadan, Bangalore,conductedWorkshoponInternationalClassification ofFunctioning,Disability,Health:ImportanceandUses,Rajiv GandhiGeneralHospital,StanleyMedicalCollege,Chennai,17 November2013.60membersparticipated. Dr. N Krishna Reddy, Additional Professor, Dr. BP Nirmala, Associate Professor, conducted Workshop on Sensitization programs for the Caregivers of Persons with Cerebral Palsy, Hubli,22-23June2013.150membersparticipated. Dr. Prakashi Rajaram, Additional Professor, conducted Workshopon(i)RoleofParentsinfacilitatingLifeSkillsamong Adolescent Students I, Mothers’ Touch School, Jayanagar, Bangalore, 6 July 2013. 20 members participated (ii) Role of Parents in Facilitating Life Skills among Adolescent Students II, Mothers’ Touch School, Jayanagar, Bangalore, 8 July 2013. 50 members participated (iii) Skill Training in Clinical Social Work Practice, School of Social Work, Roshni Nilaya, Mangalore, 27 February 2014. 18 members participated (iv) Enhancing Professional Social work Skills for the Future, SchoolofSocialWork,RoshniNilaya,Mangalore,28February 2014.17membersparticipated. Dr. A Thirumoorthy, Additional Professor, conducted WorkshoponWomenEnterprisingSkillsTrainingforUG/PG SC/STGirlsStudents(StressManagementprogram),National InstituteofTechnology,Karnataka,Surathkal,Mangalore,1718August2013.50membersparticipated. Dr. Nirmala, Associate Professor, conducted Workshop on Building a Team for organizing Guidance and Counselling National Institute of Mental Health and Neuro Sciences / 87 Annual Report 2013-14 PSYCHOPHARMACOLOGY ProgrammeinSchool,SchoolCounsellorsofBhutan,NIPPCD, Bangalore,25June2013.12membersparticipated. Dr. N Janardhana, Assistant Professor, conducted Workshop on (i) Psychosocial Management for Children with Mental HealthProblems,SDMCollege,Ujjre,25September2013.90 members participated (ii) CBR and Mental Illness, Mobility India,20March2014.65membersparticipated(iii)Inclusion ofMentalHealthinDevelopmentwork,IGSSS,Delhi,10June 2013.40membersparticipated. Dr. N Janardhana, Assistant Professor and Manjula B, Psychiatric Social Worker, conducted Workshop on (i) Addressing Needs of Care Givers of PWMI and Stress Management,APD,8January2014.40membersparticipated (ii)CounsellingSkillsforCounsellorsworkingwithRelationship IssuesamongFemaleSexWorkers,KHPT,Bagalkote,17June 2013.20membersparticipated. Dr. Vranda MN, Assistant Professor, conducted Workshop on (i)PromotionofMentalHealthandPsychologicalWell-beingof AdolescentsinSchools,ByreshwaraVidyasansthe,Srinivasapura, 27-28January2014.40membersparticipated(ii)Promotionof Mental Health and Psychological Well-being of Adolescents in Schools,St.TeresaGirl’sHighSchool,KGF,29-30January2014. 42membersparticipated(iii)PromotionofMentalHealthand Psychological Well-being of Adolescents in Schools, Women’s College, Kolar, 31 January-1 February 2014. 43 members participated(iv)PromotionofMentalHealthandPsychological Well-beingofAdolescentsinSchools,KLEEducationalInstitute, Maluru, 17-18 February 2014. 56 members participated (v) Promotion of Mental Health and Psychological Well-being of AdolescentsinSchools,SSSharadaGirl’sHighSchool,Mulbagal, 19-20February2014.57membersparticipated(vi)Promotionof Mental Health and Psychological Well-being of Adolescents in Schools, Women’s Pre-University College, Bangarapete, 21-22 February2014.50membersparticipated. Dr.KavitaVJangam,AssistantProfessor,conductedWorkshop on Psychosocial Preparedness in Disaster Management, DepartmentofPsychiatricSocialWork,ChristUniversity,5-6 March2014.35membersparticipated. Dr.ChittaranjanAndrade,Professor&Head,conducted(i)CME on(a)DrugInteractionsinPsychiatry,IndianPsychiatricSociety, Karnataka, Bangalore, 25 May 2013 (b) Psychopharmacology, Postgraduates in Psychiatry and Medicine, Indian Psychiatric Society,Kerala,Tiruvalla,18August2013(c)Psychopharmacology, Venad Guild of Psychiatrists, Trivandrum, 10 November 2013. (d) Recent Advances in Anxiolytic Pharmacotherapy, Indian Association of Private Psychiatry, Gujarat, Ahmedabad, 16 February 2014 (e) Biostatistics for Psychiatric Research, Indian PsychiatricSociety,Nagpur,1March2014.(f)Benzodiazepinesin theManagementofAnxietyDisorders,IndianPsychiatricSociety, Nagpur,1March2014(g)PsychopharmacologyforNeurologists, Trivandrum Neuro Club, Trivandrum, 8 March 2014 (h) Anxiety Disorders, Venad Guild of Psychiatrists, Trivandrum, 9 March 2014 (ii) Workshop on (a) Clobazam in Generalized Anxiety Disorder, Seth VS General Hospital, Ahmedabad, 4 August2013(b)TreatmentOptionsinAnxietyandSomatoform Disorders, Spandana Hospitals, Bangalore, 7 September 2013 (c) Recent Trends in Psychopharmacology, Visakha Psychiatric Society, Vishakhapatnam, 10 September 2013 (d) Psychopharmacology, Asha Hospital, Hyderabad, 11 September 2013 (e) Psychopharmacological Approaches to Anxiety Management, Indian Psychiatric Society, Vijayawada chapter, Vijayawada, 12 September 2013 (f) Clobazam in Psychiatry, Mangalore Psychiatric Society, Mangalore, 21 September 2013 (g) Management of Somatoform and Generalized Anxiety Disorders,BombayPsychiatricSociety,Bombay,5October2013 (h)OpipramolforSomatoformDisorders,MangalorePsychiatric Society, Mangalore, 30 October 2013 (i) Two-day Workshop on Cognitive Behavior Therapy in Psychiatry, DY Patil University, Bombay, 16-17 November 2013 (j) Anxiety Disorders, Central Travancore Psychiatric Society, Kottayam, 6 March 2014 (k) Anxiety Disorders, Ernakulam Psychiatric Society, Cochin, 21 March 2014 (i) Drug Interactions in Psychiatry, Part 1, Grant MedicalCollege,Bombay,22March2014(m)DrugInteractions inPsychiatry,Part2,GrantMedicalCollege,Bombay,23March 2014 (n) Holistic Psychopharmacology in the Management of Schizophrenia, Behavioral and Neuroscience Academy of India, Bombay,23March2014 SPEECH PATHOLOGY & AUDIOLOGY Dr. E Aravind Raj, Assistant Professor, conducted (i) CBHI Training-Orientation course on Family of International Classification (ICD-10 & ICF), Bangalore, 10 January 2014. 20 membersparticipated(ii)Workshopon(a)AwarenessofICD10, Pariyaram Medical College, Kannur, Kerala, 29 January 2014. 200membersparticipated(b)AwarenessofICD10,PESMedical College,Kuppam,20February2014.100membersparticipated. Dr.NShivashankar,Professor&Head,Dr.NGirish,Additional Professor of Epidemiology and Indian Speech and Hearing Association-Bengaluru Chapter, conducted Interdepartmental WorkshoponEarlyIdentificationofCommunicationDisorders forANMandAnganvadiWorkers,HolurPHC,KolarDistrict, 13December2013.50membersparticipated. 88 / National Institute of Mental Health and Neuro Sciences Annual Report Dr. N Shivashankar, Professor & Head and Department of Community Medicine, MS Ramaiah Medical College, Bangalore,conductedInterdepartmentalWorkshoponStroke Rehabilitation, 19 April 2013. 35 Health workers and PHC Doctorsparticipated. III. Specific training underwent by the faculty / staff 2013-14 NIIR Dr. Rose Dawn Bharath, Associate Professor, 9 day training on Functional MRI Connectivity and Resting State fMRI, Dr.BharatBiswalNewJerseyinstituteoftechnology,Newark, 16-24January2014. NEUROLOGY CLINICAL PSYCHOLOGY Dr. Keshav Kumar, Additional Professor, two day training on workshop on Electrophysiology, Axxonet Brain Research Laboratory,Bangalore,India,11-12January2014. Dr. SR Chandra, Professor, (i) Introduction to Research Methodology Biostatistics and SPSS, NIMHANS, July, 2013 (ii)ChennaiNeuroupdate2014-TraininginBOTOXinjections, Chennai,26January2014. Dr. Ravi Yadav, Associate Professor, Colloquim on Drug ResistantEpilepsy,Bangalore,16-18August2014. EPIDEMIOLOGY Dr.VivekGupta,AssistantProfessor,underwent6weekstrainingon DataManagementforClinicalResearch,UniversityofVanderbilt, OnlineCourse(www.Coursera.org),November-December2013. NEUROANAESTHESIA Dr. KR Madhusudan Reddy, Professor & Head, one day Workshop on TEE, Fortis Hospital, Cunningham Road, Bangalore,12September2013. Dr.MRadhakrishnan,AdditionalProfessor,(i)two-daytraining onUSGandECHOinICU,ISCCM,Pune,11-12July2013.(ii) two-daytrainingonECHOforHemodynamicmonitoring,Tata MemorialHospital,Mumbai,08-09March2014. Dr.SriganeshKamat,AssociateProfessor,onedayWorkshop on TEE, Fortis Hospital, Cunningham Road, Bangalore, 12 September2013. Dr.VSudhir,AssistantProfessor,onedayWorkshoponTEE,Fortis Hospital,CunninghamRoad,Bangalore,12September2013. NEUROCHEMISTRY Dr. Srinivas Bharath MM, Additional Professor, Dr. Nandakumar DN, Assistant Professor, 4-day training on 37th Internal audit and Quality Management Systems Certificate Course, Institute of Hotel Management, Bangalore, 19-22 September,2013. Dr.SubasreeR, AssistantProfessor,(i)Thirdteachingcoursein CognitiveNeurology,WorldFederationofCognitionDisorders andAphasia,Bangalore,April2013(ii)FundamentalsofMass Spectrometry based Proteomics for beginners: Workshop, Bangalore,March-2014. NEUROMICROBIOLOGY Dr.RRavikumar,Professor&Head,(i)NABHAssessorsCourse programmeonimplementation,AFMC,Pune,3-7June2013(ii) Programme on implementation of NABH hospital standards, ColumbiaAsiaHospital,Hebbal,Bangalore,26-28July2013(iii) Board Review Course on Infectious Disease, SEPSIS Congress 2013, New Delhi, 4-5 December 2013 (iv) Sample preparation for proteomics of Cryptococcus neoformans clinical isolates, InstituteofBioinformatics,Bangalore,18-26March2014. NEUROPATHOLOGY Dr.YashaTC,Professor&Head,four-dayInternalAuditand Quality Management training program for NABL Foundation forQuality(India),InstituteofHotelManagement,Bangalore, 27-30July2013. Dr. Anita Mahadevan, Additional Professor, (i) three-day Training in Plastination Technique (Museum Technique for Specimen Preservation), CMC, Vellore, 18-20 April 2013. (ii) four-day Internal Audit and Quality management training programforNABLFoundationforQuality(India),Instituteof HotelManagement,Bangalore,25-28August2013. National Institute of Mental Health and Neuro Sciences / 89 Annual Report 2013-14 Dr. Sangeetha Seshagiri K, Sr. Clinical Pathologist, 4 Days Internal Audit and Quality Management training program for NABL Foundation for Quality (India), Institute of Hotel Management,Bangalore,25-28August2013. NEUROVIROLOGY Dr.AnitaDesai,AdditionalProfessor,three-dayOrientationto ISO15189:2012,Puducherry,19-21February2014. Mr. Manjunatha MV, Sr. Scientific Officer, four-day FACS MasterSortingTrainingCourse,BD-JHFACSAcademy,Jamia HamdardUniversityCampus,NewDelhi,2-5July2013. PSYCHIATRY Dr. Muralidharan K, Associate Professor, 1 year visiting Professorship- Mood Disorders Centre, University of British Columbia,Vancouver,BCCanada,1July2012-30June2013. Dr. Arun Kandasamy, Assistant Professor, four-day Course on Leadership and Professional Development of Young Asian Psychiatrists,Bangkok,20-23August2013. SPEECH PATHOLOGY & AUDIOLOGY Dr.VandanaVP,AssistantProfessor,WorkshoponRapidPrompting Method,SpasticSocietyofKarnataka,Bangalore,15March2014. Academic activities funded by Dr. Ramachandra N Moorthy Foundation Dr. Ramachandra N Moorthy Foundation for Mental Health and Neurological Sciences funded 14 events of NIMHANS during the year 2013-14. The events are: (i) Demonstration of ethical and legal guideline to maintain standards of conduct within the profession, Dept.ofNursing(ii)Anational-levelessaycompetition for postgraduate students in psychology on the theme “Psychologists as positive social change agents in India: Ideas for action” (iii) Symposium on Mental, neurological and substance use disorders and injuries in workplace settings, Centre for Public Health (iv) Two-day National symposium entitled Walking the Line:EthicalissuesinPsychotherapyPractice,Dept.of ClinicalPsychology(v)CaregiversSupport&Education Programme Workshops, Psychiatric Rehabilitation Services(vi)OnedayCME/symposiumonthepractice Professional Skills Enhancement Workshop for NIMHANS faculty members of electroconvulsive therapy for psychiatrists and psychiatrytraineesinthecountry,Dept.ofPsychiatry(vii)OrientationProgrammeonMentalHealthandAddictionPrevention for NSS Programme Officers, Dept. of Psychiatric Social Work (viii) World Mental Health Day celebrations, Psychiatric RehabilitationServices(ix)Onedayworkshoponthepsychiatricemergencies,Dept.ofNursing(x)OnedayYouthConference (YouthProActionLabs),followedbyhalfdayworkshoponInnovativeMethodsforMentalHealthPromotion(MindBlitz), Dept.ofClinicalPsychology(xi)SecondEarlyCareerMentalHealthProfessionalsWorkshop,withProfNormanSartorius&Dr MohanIsaac,January,2014(xii)ProfessionalSkillsEnhancementWorkshopforMid-levelFaculty,NIMHANS,January2014 (xiii)Aone-and-a-halfdayNationalConferenceonResearchandServicesinPsychiatricRehabilitation(xiv)SecondNIMHANS RoyalCollegeofPsychiatristsConference,March2014. Dr. Ramachandra N Moorthy Foundation for Mental Health and Neurological Sciences at NIMHANS was created through a generousdonationbyDr.RamachandraNMoorthy,anIndian-bornPsychiatristinVancouver,Canada.Oneofthemajorgoalsofthe FoundationistopromotetrainingandacademicactivitiesinthefieldofmentalhealthinIndia.ThetotaldonationwasaboutRs.3.35 crore,andithasbeendecidedtousetheannualinterestsgenerated(ofaboutRs.30lakh)forvariousacademicactivities.ACommittee hasbeenformedundertheChairmanshipoftheDirector/ViceChancellorofNIMHANSandincludestheRegistrar,DeputyFinance Officer,VisitingProfessorDr.MohanKIsaac,Dr.RamachandraNMoorthy,andfacultymembersfromthedepartmentsofClinical Psychology,PsychiatricSocialWork,andNursing.TheMemberSecretarycoordinatestheactivitiesfundedbytheFoundation. 90 / National Institute of Mental Health and Neuro Sciences Central Facilities Annual Report 2013-14 NEUROBIOLOGY RESEARCH CENTRE (NBRC) Table 2: Awards and Publications The Neurobiology Research Centre is a sophisticated common research facility at NIMHANS. The objective is to promote interdisciplinary research at NIMHANS as well as advance inter-institutional collaborative research. The centre provides infrastructure that supports translational research and development of cutting edge technology in frontier areas of neuroscience. Ithouses15researchlaboratoriesandfourcommon centralfacilities.Mostofthelaboratorieshavereceivedextramural grants for their research work; the funding sources being DBT, DST,ICMR,CSIRandothers.ThemandateoftheNBRCisthat all the central facilities and research laboratories are common facilities,tobesharedandusedbyscientists,researchscholarsand studentsatNIMHANS.Atotalof128students/researchscholars arecurrentlyusingthefacility(62PhD,9MPhil,2post-doc,SSO, SRF,JRF-41,14Trainees).Outof70researchprojectstakenupby thecentre,19havebeencompletedand51areinprogress(Table 1).Thecentregenerated75peer-reviewedpublicationsandalso baggedseveralawardsforitsresearchactivitiesinthereference year(Table2).NBRChousesstate-of-the-artequipmenttocarry out cutting-edge research. Various equipment and instruments wereprocuredduringtheyear2013-14toaugmenttheresearch capabilities (Table 3). Details of various laboratories and its facilitiesaregiveninthefollowingparagraphs. Laboratory Awards TranslationalPsychiatryLaboratory Multi-modal Brain Image Analysis Laboratory MetabolicLaboratory Neuro-OncologyLab MolecularGeneticsLaboratory BioinformaticsLaboratory CellCultureandStemCellBiology ElectrophysiologyLaboratory OpticalImagingLab NeuromuscularLaboratory NeurotoxicologyLaboratory Cognitive Psychology & Cognitive NeurosciencesLaboratory 8 1 Total Publications 20 7 Nil 1 1 1 2 1 Nil 1 Nil 1 1 9 4 8 2 7 1 14 1 1 TranslationalPsychiatry Laboratory Multi-modalBrainImage AnalysisLaboratory AdvancedFlowCytometry Laboratory MetabolicLaboratory Neuro-OncologyLab MolecularBiology Laboratories-Communicalble andNon-Communicable MolecularGenetics Laboratory BioinformaticsLaboratory NeuromuscularLaboratory CognitivePsychology& CognitiveNeurosciences Laboratory Laboratory TranslationalPsychiatry Laboratory Multi-modalBrainImage AnalysisLaboratory AdvancedFlowCytometry Laboratory MetabolicLaboratory Neuro-OncologyLab Table 1: Research projects during the year 2013-14 Laboratory Table 3: Purchase of equipment during the year 2013-14 TOTAL (including non-funded projects) Com- Ongo- Com- Ongopleted ing pleted ing Funded projects Nil 10* Nil 12 1 4 1 4 Nil 4 Nil 4 1 2 1 3 2 5 1 5 Nil 1 1 2 1 4 2 5 4 1 7 5 7 1 12 5 Nil 1 Nil 1 MolecularBiology Laboratories-Communicable andNon-Communicable MolecularGeneticsLaboratory BioinformaticsLaboratory CellCultureandStemCell Biology ElectrophysiologyLaboratory OpticalImagingLab Equipment purchased Workstationcomputerand serverforimageanalysis TwoworkstationsforMRI analyses;andarefrigerator AdvancedfourlaserBDFACS AriaIIIcellsorterandathree laserFACSVerseanalyzer Nitrogengenerator HPWorkstationwithHPall -in-one1005laserJetPrinter forhighthroughputstatistical analysis;ENDUROTMGDS ImagingSystemalongwith APCBR1000UPSSystem; Cytovisonsoftwareupdate, Fluorescentmicroscopefilters. LiquidNitrogentank(YDS-65216)forcryopreservationof clinicalsamples. CO2Incubator;Inverted microscopefortissueculture; Pyromarksequencer;PCR machine OrbitrapFusionMass spectrometer HorizontalLaminarAirFlow Unit,CO2Incubator,pHmeter MEASystem Doublepatchstar micromanipulatorsystemfor patchclamp;Vibratome;CO2 incubator *OneCentreofExcellenceproject National Institute of Mental Health and Neuro Sciences / 91 2013-14 Annual Report Laboratory NeuromuscularLaboratory NeurotoxicologyLaboratory CognitivePsychology& CognitiveNeurosciences Laboratory Equipment purchased -80°Cfreezer,Refrigerated centrifuge,Dewarsflask, Vortexmixer,Sonicator, Cryostat,Waterbath,Multiwell platereader -200°CFreezer;-40°C refrigerator;imagingsystem formicroscope;laminarflow chamber;liquidnitrogen container. Noisecancellationhead phones;Cortisolreagentkits withcalibratorsandcontrols (foratotalof360sample);Bi Spectralindex(BIS)electrodes Common Facilities A. Human Brain Tissue Repository (Human Brain Bank) (Officer In-charge: Dr. SK Shankar) The Human Brain Bank located in the ground floor of Neurobiology Research Centre, has continued the mandated activities of (a) collection of donated brains from cases of Neurodegenerative and Infective conditions (b) collection of brains from victims of Road Traffic Accidents, as relatively normal controls (c) Distribution of the brain tissue, CSF and serumforinvestigativestudies. During the year 2013-2014, brains were collected from cases of schizophrenia, stroke, brain mass lesion, HIV and TBM. In addition, 32 fresh brain biopsy samples following epilepsy surgerywerecollectedandstoredonlyaftertakingthetissuefor diagnosticwork.Fortyfourcadaverheartsfromvictimsofroad traffic accidents were collected and provided for homograft transplantation to Jayadeva Institute of Cardiology and ResearchCentre,ManipalHospitalandNarayanaHrudayalaya. Required brain tissues from various anatomical areas, CSF samples from normal controls and diseased states were distributedto15scientistsfortheirresearchworkthroughout India. In collaboration with Institute of Bioinformatics, proteomics studies were continued in cases of tuberculous meningitis, cryptococcal meningitis, toxoplasma encephalitis, cerebral malaria, rabies encephalitis and schizophrenia. In thesestudies,someseminalobservationswerereported. Cadaveric temporal bones collected from unclaimed bodies with the permission of the Police were provided to the Department of ENT of Commando Hospital, Bangalore for teachingpurposes. Table 4: Samples stored during the year 2013-2014 Sl.No. Details 1 Freshbrainscollected* 2 Numberofformalinfixedbrains (TBM-01;HIV-02;Psychiatric (Schizophrenia)-02;Stroke-02; PulmonaryEmbolism-02;Rt. ParietalMassLesion-02;Glioma-01; Normal–01) 3 CSFandSerumsamplesfrozen 4 FreshtissuesfrozenfromAutopsy/ Biopsy(BrainBiopsy-32;HIV-01) 5 AntemortemBloodSamples Collected(13/HIV/C206,13/N/S156, 13/HIV/S165,CJD-Nil) 6 BloodSamplesCollectedforDNA Extraction 7 Freshheartscollectedfrommedico legalautopsiesforvalve/aorta homograftcollectedwithin6-20hrs ofpost-mortemandhandedoverto surgeons. 8 BloodSamples(Serum,Plasma,Buffy Coat)/CSFcollectedforothertests Total No. 06 13 13 33 03 55 54 44 BrainBankisactivelyinvolvedinthepromotionofneuroscience research and public awareness programmes, especially about neurologic disorders, cadaver organ donation and brain donation. Human brain specimens are provided to various schools and colleges for demonstrating them to the general public, thus enhancing their participation. Neuroinfection teaching slides have been provided to various premier institutionsacrossthecountry. The staff of HBTR participated in the annual conference of IndianEpilepsyAssociation,BangaloreChapterasvolunteers. About 950 schoolchildren and 100 teachers from 9 schools visitedtheexhibitionheldduringtheconference. AspartofthepublicawarenesseventheldonOrganDonation Day, green ribbons were distributed on 6 August 2013. Sixty seven research scholars and trainees working in various sectionsofNRCandadministrativestaffpledgedtheirorgans/ brain by signing the consent form and donor card. Healthy HeartAssociationofBangalorefelicitatedDr.SKShankarand Dr.AnitaMahadevanfortheircontributioninpopularizingthe organdonation,brainbankingandpromotionofneuroscience inschoolsandcolleges.Sevenresearcharticleswerepublished duringtheyearutilizingthematerialsoftheBrainBank. Classes in Neuroanatomy and Neuropathology are being conductedasapartofthePhDNeurosciencemodule,andfor 92 / National Institute of Mental Health and Neuro Sciences Annual Report theDM/MCh/MDPathologystudentspostedtotheDepartment ofNeuropathology. B. Neuropathology Brain Museum (Dept. of Neuropathology; Head: Dr. Yasha TC, Officer Incharge-Prof. SK Shankar) TheNeuropathologyBrainMuseum(HumanBrainMuseum), the only one of its kind in the country, is located in the NeurobiologyResearchCentre.Thisuniquefacilityhasbecome acentreofattractionforschoolandcollegestudents,servingas avaluablesourceofNeurosciencematerials. TheNBRCisalsoprovidedwithadedicatedcentralwastedisposal facilityinthegroundfloorwhichisequippedwithalargevolume autoclaveandashredderforhospital/labwastedisposal. During the year 2013-2014, the NBRC acquired a liquid nitrogen storage tank of capacity 900 litres. This is a source of supply for liquid nitrogen which is being used regularly by several laboratories at NBRC. This facility is also being used routinely by some laboratories in the administrative block such as Departments of Neurovirology, Neuropathology, Neurochemistry,NeurophysiologyandBiophysiscs. D. Themuseumsawexponentialgrowthintermsofvisitornumbers (Graph 1.). During the review year, the number of visitors stood at 3208 (General public/patients at NIMHANS-423; organization representatives/dignitaries-115; press/media persons-9;residentsatNIMHANS,researchscholars,Nursing students, staff, and others-1435). Many foreign scientists and dignitaries,whocametoNIMHANSforscientificcollaboration, visited the Neuropathology Brain Museum and greatly appreciatedtheuniquecollectionandthemeansofdisplay. 4000 3000 2000 1000 0 2010-2011 2011-2012 2012-2013 2013-2014 Graph 1: Visitors to Neuropathology Brain Museum (from 2011 to 2014). Human brain, spinal cord and other parenchymal organs are displayed at the museum, providing the visitors a unique experiencetotouchandfeeltheseorgans.ThestaffofHuman Brain Bank regularly conducts guided tour for the visitors, explainingthenatureandimportanceofspecimensexhibited. C. Central Facility for Millipore Water Purification System, Liquid Nitrogen and Waste Disposal A new high capacity Millipore (ELIX 70 Ltr/Hr and Synergy) water purification system has been installed in the ground floor that provides purified water for multiple laboratory and hospital applications, including ultrapure water required for molecularbiologyresearch. 2013-14 Centre for Advanced Research for Innovation in Mental Health and Neurosciences – Funded by Department of Health Research (DHR), Ministry of Health and Family Welfare, Govt of India and Indian Council of Medical Research (ICMR-2014) The ICMR Centre for Advanced Research at NIMHANS was conceptualized during the visit of Hon’ble Minister of Health and Family Welfare, Govt. of India to NIMHANS inJanuary2011.Realizingtheleadershippotentialshown and the rapid progress made by NIMHANS in the field of Mental Health and Neurosciences, Department of Health Research(DHRandICMR)decidedtoestablishtheCentre for Advanced Research for Innovation of Mental Health and Neurosciences with a dual component of manpower development to achieve a critical mass of technical person and propel translational research to take scientific investigation to the bedside medicine. The vision of the Centre for Advanced Research for Innovation of Mental Health and Neurosciences supported by DHR and ICMR at NIMHANS is “to be a leader in the field of mental health and neuroscience and evolve the state-of-the-art technology and innovation for translational research and developcriticalmassofmanpowertomeetnationalneeds byscientificcollaborationandco-operation”. The Centre was inaugurated on 26 March 2014 by Dr. VM Katoch,DirectorGeneralofIndianCouncilofMedicalResearch, NewDelhi.TheAdvancedCentre,locatedinthethirdfloorof Neurobiology Research Centre, presently has three projects sanctionedafterevaluationbytheexpertcommittee.‘Anatlas ofcommoninfectionsofnervoussystemwithasetofteaching slides’andabookletdevelopedbytheHumanBrainBankwere releasedontheoccasion. National Institute of Mental Health and Neuro Sciences / 93 Annual Report 2013-14 Research Laboratories Translational Psychiatry Laboratory charge: Dr. G Venkatasubramanian) Multi-modal Brain Image Analysis Laboratory (MBIAL) (Officer In-charge: Dr. John P John) (Officer In- The Translational Psychiatry Laboratory (TransPsych Lab) facilities have been created towards initiation of an integratedclinicalresearchfacilitywithfocusontranslational applications in psychiatry. This research facility is supported byresearch grants from Welcome Trust /DBTIndiaAlliance Senior Fellowship Award as well as from the Department of Biotechnology. The goal of the TransPsych Lab is to evaluate and establish composite biomarkers involving neuroimmunobiological abnormalities in Schizophrenia and other disorders like Obsessive Compulsive Disorder, Bipolar Affective Disorder and Alzheimer’s disease. The vision of this Centre is to create a translational research facility of internationalcaliber,integratingclinical,neuroimmunological, neuropathological,neuroimagingandadvancedcomputational researchtechniquestoexaminethe‘Neuroimmunopathogenetic ModelforSchizophrenia’. Completed research activities: Research activities completed during the year 2013 – 2014 include evidence for brain derived neurotrophic factor abnormalities in schizophrenia, clinical & neurobiological studiesontheeffectoftranscranialDirectCurrentStimulation (tDCS) in schizophrenia, hippocampal & superior temporal gyrus abnormalities in schizophrenia, structural brain abnormalities in obsessive-compulsive disorder (OCD), functional MRI studies involving symptom provocation paradigminOCD. Ongoing research activities: Ongoing research activities focus on examining the Neuroimmunogenetic and neuroplastic correlates of brain abnormalities in schizophrenia, neuromodulatory effects of tDCS in schizophrenia, eye movement abnormalities in schizophrenia and OCD, EEG/ERP abnormalities in schizophreniaandOCD,neurohemodynamicabnormalitiesin schizophreniausingfunctionalNearInfraredSpectroscopyand imaging-geneticsstudiesinOCD. Patient Care Services: TransPsych Lab critically facilitates provision of transcranial direct current stimulation for schizophrenia patients (n=46). Researchstaffinthelabcontributestotheclinicalservicesof theschizophreniaclinicaswellasthemetabolicclinic. This laboratory aims at integrating the acquisition and analysis of multiple modalities of brain imaging for a more comprehensiveunderstandingofbrainstructure,functionand signalling in various neuropsychiatric disorders. This facility aims at employing an integrated multi-disciplinary approach toexaminebrainstructureandfunctioninhealthanddisease through active collaborations between various departments both within and outside the institute. Research projects being undertaken at MBIAL include multi-modal imaginggenomicsstudiesinschizophreniaanddementia,aswellasof certain cognitive processes; these projects are funded by the DepartmentofScienceandTechnology(DST)andDepartment ofBiotechnology(DBT).ManyPhDscholars,MD(Psychiatry) post-graduates as well as trainees from other departments of NIMHANSaswellasexternaltraineeshaveutilizedthefacility forobtainingtraininginvariousaspectsofmulti-modalimage acquisitionandanalysis. Completed research activities: (a) EEG power spectral and complexity analyses in neuroleptic-naïve patients with recent-onset schizophrenia (b) Novellandmark-baseddefinitionoftherostralprefrontal cortexandevidenceforneurodevelopmentaldevianceof therostralprefrontalcortexinschizophrenia (c) Corpus callosal abnormalities in schizophrenia and genderdimorphismofcorpuscallosum (d) MRI brain activations and deactivations during word generationandaberrationsofthesameinschizophrenia (e) Development of a task-based ensemble synchrony measureofEEGusingFrobeniusnorm Ongoing research activities: Presently,themajorthrustareasofresearchatMBIALinclude: (i) multi-modal imaging-genomics approach to investigating the link between impaired word generation and aberrant glutamatergic function in schizophrenia; (ii) examination of aberrantneuralsynchronyinschizophreniausingEEG,fMRI and polysomnography; (iii) study of the link between blood biomarkersandneuroimagingparametersinschizophrenia;(iv) examinationofthelinkbetweencandidategenepolymorphisms andneuropsychologicalandinformationprocessingdeficitsin schizophrenia; (v) network connectivity in minimal cognitive impairmentandearlydementia;(vi)defaultmodenetworkand cognitioninhealthyageing;(vii)diffusiontensorimagingand 94 / National Institute of Mental Health and Neuro Sciences Annual Report apoEpolymorphismsinAlzheimer’sdementia;and(viii)neural correlatesofwell-beingassociatedwithmindfulnessmeditation and(ix)structureandfunctionoftherostralprefrontalcortex (BA10). Advanced Flow Cytometry Laboratory (Officer Incharge: Prof. V Ravi) 2013-14 Completed research activities: Thephenotypic,electrophysiologicalandradiologicalfeatures ofchildrenwithinbornerrorsofintermediarymetabolismwere evaluated by a cross-sectional, retrospective-cum-prospective hospital-based study as a part of DM Neurology dissertation work. The Advanced Flow Cytometry Laboratory enables sorting and analysis of single cells based on multiple parameters respectively. Students / researchers from the Departments of Neurovirology and Neuropathology use this facility for their researchworks. Ongoing research activities: Ahigh-throughputmassspectrometry-basedscreeningtestfor Gaucher, Pompe, Niemann-Pick, Krabbe and Fabry diseases, using dried blood spots, has been established. Using this method,samplesarebeingtestedtodeterminetheprevalence ofthesedisordersintheIndianpopulation. Completed research activities Innate Immune Mechanisms in Japanese Encephalitis Virus Infection(PhDthesisbyPrachiRFadnis) Patient care services: 3558 samples were screened for IEM using tandem mass spectrometry Ongoing research activities: (a) A Comparative Study of Innate and Cell Mediated Immune Responses in Human Immunodeficiency virus infectedindividualswithandwithoutNeurotuberculosis (b) Clinical and immunological profile of patients with SubacuteSclerosingPanEncephalitis (c) Flow cytometry based detection of dysferlin protein expression in CD14 positive monocytes from peripheral bloodsamplesofpatientswithDysferlinopathy (d) Analysisofbraininfiltratinglymphocytesinmousebrain following vaccination against Rabies or infection with Rabiesvirus. (e) Analysis of cellular immune responses in patients with Schizophrenia. Neuro-Oncology Lab (Officer In charge: Dr. Vani Santosh) Metabolic Laboratory (Officer In-charge: Dr. Rita Christopher) ThisLaboratoryconductshigh-throughput,massspectrometry (MS)-basedscreeningforInbornErrorsofMetabolism(IEM). In a drop of blood collected on filter paper, 40 analytes are measuredincluding10aminoacids,freecarnitineand29acyl carnitines. Based on the characteristic profiles, inborn errors of amino acid metabolism, fatty acid oxidation defects and organic acidemias are identified. This facility, which is the firstofitskindinagovernmentset-upinthecountry,attracts samplesfromalloverIndiaaswellasfromotherneighbouring countries. The lab has obtained 100 per cent satisfactory resultsintheNewbornScreeningQualityAssuranceProgram conducted by the Center for Disease Control and Prevention (CDC),Atlanta,USA. The Neuro-Oncology Lab was established in September 2011 with a prime objective of translational research in NeuroOncology. In addition to tissue based research carried out at the lab, collaborations with core biological research institutes have promoted dissection of various pathways related to gliomagenesis. Completed research activities: Research activities completed during the year 2013-2014 include studying the role of novel biomarkers; STAT-1,PP1A, MMPs and SOD2 in the pathogenesois and prognosis of glioblastoma,patho-biologicalcharacterizationofWHOgrade IIIgliomas,usingvariousmarkersbytechniquessuchasIHC, FISH and PCR studies. Tissue microarray (TMA) blocks for several gliomas, meningiomas, medulloblastomas have been builtandIHCvalidationsarebeingcarriedoutontheseTMA sections. Ongoing research activities: The prognostic relevance of various molecules involved in possible radiation resistance such as NNMT, MELK, Osteopontin,etc.isbeingcurrentlyevaluated,andthepotential role of few of the molecules as a serum biomarker in GBM explored. To evaluate the role of the molecules associated withglioblastomatumorinvasionandrecurrence,28casesof coreandtumorperipheryinglioblastomahavebeenarchived, and their histological characterization has been completed and further biological studies are in progress. Other studies National Institute of Mental Health and Neuro Sciences / 95 Annual Report 2013-14 in the lab include relation between the Clinico-Pathological properties of meningiomas and their chromosomal deletion statuses as diagnosed by FISH studies and characterisation of novel biomarkers such as IMP3, SOX2, CSNK2-α, p65 on varioustissuesamplesofglioblastoma.Inaddition,phosphoproteomicsworkinMedulloblastomaincollaborationwithIOB hasbeeninitiated. Patient care services: 1p19q status using FISH technique is routinely performed in thelab.Atotalof50patientsampleswerestudiedandreported, during the year under review. MGMT methylation status for diagnosticpurposewasperformedonfivepatientsamples. Molecular Biology Laboratories-Communicable and Non-Communicable (Officer In-charge: Prof. V Ravi) The Molecular Biology labs (Communicable and NonCommunicable Disease labs) are being used routinely by students from various departments at NIMHANS namely Human Genetics, Molecular Genetics, Biophysics, Bioinformatics, Neuropathology, Neurochemistry, Neurovirology, Neurophysiology, Neuromicrobiology, etc either for performing Real Time PCR / Conventional PCR assaysorforanalysisofgels/blotsonthechemiluminescence enabledGelDocumentationsystem.Tworoomsinthisfacility arebeingusedforCellcultureworkbytheMolecularGenetics Lab. Ongoing research activities: Faculty and students in the two laboratories are carrying out a comparativestudyofinnateandCellMediatedImmuneResponses inHumanImmunodeficiencyvirusinfectedindividualswithand withoutNeurotuberculosis,studyingthemolecularaspectsofthe pandemicInfluenzaA2009(H1N1)viruswithspecialreferenceto hostimmunefactors,offeringmoleculardiagnosisforDengueand studying the epidemiology of Dengue virus and innate immune responsesinJapaneseEncephalitis. Patient care services: EvaluationofDenguediagnosisbyconventionalandRealtime PCRassaysandDengueVirusEpidemiologystudies. Molecular Genetics Laboratory (Officer In-charge: Prof. Sanjeev Jain) The Molecular Genetics lab has been involved in several researchandmoleculardiagnosticsprojectsinneuropsychiatric disordersincludingschizophrenia,dementia,OCD,alcoholism, spino-cerebellar ataxia, muscular dystrophy, etc. In addition to candidate gene studies using case control association, lymphoblastoidcelllinesarebeingderivedfrompatientblood lymphocytestohaveapermanentsourceofDNAandalsouse it as a model system. PBMCs are isolated from whole blood and transformed with EBV to derive LCL lines. Epigenetic studieshavebeeninitiatedonalcoholsamples.Therehasbeen significant overlap and exchange of knowledge between the clinicandthelabviainteractions. Completed research activities: A project involving telomere length in dementia and Huntington’sdiseasehasbeencompleted. Ongoing research activities: Tissuecultureworkhasbeeninitiatedforthedevelopmentof lymphoblastoid cell lines as model systems to study disease biology.UndertheDST-inspireprogramme,Dr.BijuViswanath has been working in the laboratory on ‘Imaging-genomics approach to identify molecular markers of Lithium response in bipolar disorder’. A post-doctoral fellow working in Centre for addiction medicine is carrying out his dissertation in the laboratoryontheepigeneticsofalcoholism. Patient care services: Atotalof125individualsandtheirfamiliesavailedtheservices forgeneticcounsellingandtestingforthelateonsetmovement disorders (HD/SCA). MLPA method of analysis on the DNA sequencer has been standardized for diagnosis of Duchenne musculardystrophyandtested55individualsweretestedinthe yearunderreview.Inaddition,testingforSMAfor16samples wascarriedout. Bioinformatics Laboratory (Officer Dr Keshav Prasad, Dr. SK Shankar) In-Charge: The Bioinformatics and Proteomics Laboratory is actively involved in genomic, proteomic phospoproteomic and glycoproteomic analysis of various human tissues to understand the cellular biology. The main areas of thrust at thislaboratoryarestudyofchronicmeningitisliketuberculous meningitis, cryptococcal meningitis, and rabies encephalitis. In collaboration with the Department of Neurovirology, the scientists have studied temporal evolution of mouse brain proteome in response to rabies infection. They demonstrated dysregulationofchemokineandinterleukinreceptorpathways in addition to large number of protein involved in synaptic vesicle exocytosis and RNA processing. They also evaluated 96 / National Institute of Mental Health and Neuro Sciences Annual Report quantitative proteomic of various types commercially availablerabiesvaccines.IncollaborationwithDepartmentof Neurochemistry, quantitative proteomics and glycoproteomic analysisofcerebralstrokeandischemicstrokehasbeencarried out. In addition the laboratory is involved in studying the proteomicalterationsincerebralheadinjuryandsomeofthe neuromusculardisorders. Completed research activities: Quantitative proteomic analysis of brain tissue samples from cryptococcal meningitis patients co-infected with HIV and toxoplasma encephalitis patients co-infected with HIV was carried out to identify molecules involved in host response and identified 260 and 180 differentially expressed proteins, respectively when compared to tissues from uninfected individuals. Proteomics, proteogenomics and phosphoproteomicstudiesofCryptococcus neoformansusing highresolutionmassspectrometryhavealsobeencarriedout. Proteome of human pituitary glands has been mapped and a totalof2,286proteinsidentified. Ongoing research activities: The proteins altered in chronic meningitis are being profiled using brain tissue and CSF samples. In addition, temporal analysis of rabies virus infected mouse cerebrum and cell lines such as BHK21 and neuro2A has been performed. Glycoproteomicanalysisofserumsamplesfromischemicand hemorrhagicstrokehasalsobeenperformed. Cell Culture and Stem Cell Biology Laboratory (Officer In-charge: Dr. TR Raju) expression of NF-H in NSC-34 cells upon exposure to ALS-CSFwasfound;howevertheexpressionofNF-Lwas up-regulated when compared to the control groups viz. NCandNALS. (b) Quantitative proteomic analysis by iTRAQ labelling was carried out to identify toxic factors present in CSF of Amyotrophic Lateral Sclerosis patients (ALS-CSF). The mass spectrometry results of 10 ALS-CSF samples compared with 10 normal CSF samples from patients undergoing orthopaedic surgery (N-CSF) showed upregulation of approximately 31 proteins (showing morethan1.5foldincrease)and17proteinsweredown regulated (showing less than 0.5 fold decrease) in ALSCSFsamples.Thefourproteins(chitotriosidase(CHIT), osteopontin, chitinase-3-like protein 2 and chitinase-3likeprotein1),up-regulatedinALS-CSF,werevalidated usingELISA.CHITactivityalsoshowedatenfoldincrease in ALS-CSF. Immunostaining revealed that microglial cells exposed to ALS-CSF expressed CHIT, but not the astrocytes.AlltheseresultsindicatethatCHITmayplay animportantroleinpathogenesisofALS. Ongoing research activities: (a) MitochondrialdysfunctioninthesporadicmodelofALS has been investigated. Proteomics of the mitochondrial proteins from the spinal cords of ALS-CSF injected animals revealed up-regulation and down-regulation of several key proteins, thereby identifying the pathways whichleadtomitochondrialdysfunction. (b) Proteomics analysis of ALS-CSF revealed up-regulation ofChitotriosidase(CHIT-1)comparedtonormalCSF.The levelofCHIT-1wasfurtherevaluatedbyELISAinalarger cohort of patients’ CSF, which showed a 17-fold increase in the CSF of ALS patients. To determine the biological significanceoftheup-regulatedCHIT-1,itseffectonNSC34motorneuronalcelllinewasinvestigated.CHIT-1didnot haveadirecteffectontheviabilityofNSC-34cellsasshown by MTT assay. The effect of CHIT-1 on the non-neuronal cellsviz.astrocytesandmicrogliaisbeinginvestigated. (c) PrimaryastrocyteswereexposedtoCSFfromALSpatients (ALS-CSF)andcomparedwiththenormalcontrols(NC) andNon-ALS(NALS-CSF).Thestudiesrevealedadownregulation of trophic factors VEGF and GDNF in ALS, while inflammatory markers like IL6, and TNF-α were foundtobesignificantlyup-regulated,suggestingtherole ofneuroinflammationintheexacerbationofthedisease. Thislaboratoryiswellequippedwithadvancedinfrastructure and technology. Currently primary cultures of motor neurons, astrocytes, microglia, olfactory bulb and cell lines of motor neurons (NSC-34), Dopaminergic neurons (N27), Neuroblastoma(SHSY5Y)andglioblastoma(U251MG,U87MG) are grown in the cell culture laboratory. These cell lines are usedascellularmodelsystemtodelineatethepathogenesisof ALS,Parkinson’sdiseaseandGlioma.Severalfundedprojects arebeingexecutedinthislaboratory. Completed research activities: (a) To investigate the possibility that aggregation of phosphorylated neurofilaments might have occurred due to the deranged expression of the neurofilament subunits,theexpressionofsub-unitsNF-HandNF-Lin NSC-34 cells was examined upon exposure to ALS-CSF by immunocytochemistry and Western blotting. Stable 2013-14 National Institute of Mental Health and Neuro Sciences / 97 Annual Report 2013-14 Culturesrichinmicrogliawerederivedfromembryonic ratspinalcords.Up-regulationofchitotriosidase(CHIT) was also observed in the microglial cultures exposed to ALS-CSF. Reduced trophic support and enhanced activation of microglia with up-regulated CHIT, an indicator of neuroinflammation hints at crucial role of astrogliaandmicrogliainelicitinginflammatorycascades intheneurodegenerationassociatedwithALS. Electrophysiology Laboratory (Officer In-charge: Dr. BS Shankaranarayana Rao) The electrophysiology laboratory is engaged in studying the synaptic plasticity mechanisms in various animal models of neurological and psychiatric disorders in various animal models of neurological and psychiatric disorders are being studiedusinglivebrainslicesofthehippocampusandmedial prefrontalcortex.Inaddition,microelectrodearraytechnology has been used for in vitro recording of electrophysiological activity of neurons over a long period of time. The effect of BDNF on electrophysiological activity of olfactory bulb neuronal populationhasbeenstudied. Completed research activities: Researchers in the lab have studied the role of amygdala in the modulation of hippocampal and prefrontal cortical functionsinstress:Implicationsforthetreatmentofaffective disorders,roleofescitalopramandreboxetineantidepressants on hippocampal neurogenesis and structural plasticity in endogenousanimalmodelofdepression,cellularandmolecular basis of epilepsy-induced cognitive deficits, role of enriched environment and antidepressant treatment on depression induced cognitive deficits, regulatory role of amygdala on hippocampalandfrontalcorticalfunctionsinstress,enriched environmentexposurerestoresimpairedhippocampalsynaptic plasticity in chronically restrained rats and protective effect of Celastrus paniculatus Willd oil on chronic stress-induced cognitiveimpairmentinadultmaleWistarrats. Ongoing research activities: Ongoing research activities include studies on the cellular and molecular basis of endogenous depression induced cognitive deficits, antiepileptic activity of medicinal plants in animal models of Epilepsy; Effect of Celestrus paniculatus oncognitivedeficitsinchronicallystressedrats:Abehavioral, neurochemical, structural and electrophysiological approach, cellular,molecularandelectrophysiologicalbasisofdepressioninduced cognitive deficits, role of enriched environment and antidepressants on chronic stress-induced depression and cognitivedeficits,amygdalainstress-inducedcorticalplasticity, enriched environment and antiepileptic drugs on epilepsyinduced cognitive deficits, depression-induced cognitive deficits: Effect of modulation of glutamatergic transmission andbrainstimulationreward. Optical Imaging Lab (Officer In-charge : Dr. Preeti Joshi) This laboratory is an advanced facility for conducting sophisticated experiments such as real time recording of signallingeventsincellsandtissue.Thelaboratoryisequipped withconfocalmicroscope,epifluorescencesystemsforimaging andpatchclampsetupforelectricalrecordingfromcells.These state-of-the-arttechniquesarebeingusedbytheresearchersto unravel the cellular and molecular basis of physiological and pathological signalling in the nervous system. The long-term objective of the research is to identify the defective signalling modules and its origin at molecular level (ion channels/ receptors etc.) in neuro-psychiatric disorders. This can be translated into targeted therapy by developing drugs against theidentifiedmoleculartargets. Ongoing research activities: Researchers in this laboratory are currently focussing on the roleofglialcellsinepilepsy,intraandintercellularsignaling aberrations in neuropsychiatric disorders and pain sensation. Itwasfoundthatseveralmetabotropicpurinergicreceptorsin astrocytesareupregulatedwithin1-2hrsofstatusepilepticus. Astrocytes elicit hyper Ca2+ activity independent of neuronal activity. Experiments on neuron-astrocyte cross talk show that activation of P2Y2 receptors in astrocytes significantly enhances the hyperactivity in neurons. To investigated the changes in cellular signaling in dementia patients we have studied the signaling events in lymphoblasts derived from dementiapatientscarryingdifferentallelesofApoEgene. Someoftheprojectsinthislabareincollaborationwithdepartment of Neurology and department of Psychiatry. A new project on understandingthemechanismsofneuropathicpainandexploring newtherapeutictargetswasinitiatedincollaborationwithBristol Myers Squibb Company (BMS) USA and Biocon Bristol- Myers Squibb R & D Centre Bangalore. The Research projects for this laboratoryarefundedbyDBTandBMS. Neuromuscular Laboratory (Officer In-charge: Dr. AB Taly) The Neuromuscular Laboratory was conceptualized with the objectivesofprovidingmoleculardiagnosisforneuromuscular 98 / National Institute of Mental Health and Neuro Sciences Annual Report disorders (muscular dystrophies, spinal muscular atrophy, myotonic dystrophy, and mitochondrial disorders), immunodiagnosis for immune mediated disorders, skin punchbiopsiesforassessmentofsmallfibreneuropathiesand moleculardiagnosisforhereditaryandinfectiousneuropathies. During the year, the research work has been translated into 14 publications in peer reviewed National and International journals. Patient care services: The research staff of Neuromuscular laboratory have assisted the Department of Neuropathology by performing muscle immunohistochemistryformusculardystrophies-141cases.In collaboration with Neurotoxicology laboratory, Immunoblots for 8 cases and Respiratory Enzyme assays for 60 cases were carriedout. Neurotoxicology Laboratory (Officer In-charge: Dr. Srinivas Bharath) The Neurotoxicology Laboratory focuses on investigating the mechanisticandtherapeuticaspectsofneurotoxicmodelswith implicationsfordegenerativediseases.Thelaboratoryemploys biochemical,proteomicandepigeneticmethodstounderstand thetoxicologicalbasisofdiseaseandtheroleofoxidativestress andmitochondrialdamage. Completed research activities: One of the projects completed during 2013-14 involved a comparisonofbiochemicalandproteomicalterationsinbrain mitochondria of prepubertal and adult mice exposed to the neurotoxin3-nitropropionicacid(3-NPA). Ongoing research activities: (a) A new project sanctioned during 2013-14 involved analysis of the epigenetic regulation of red/ox mechanisms in neurotoxic models of Parkinson’s disease involving investigation of the role of chromatin modifications (Funded by DST). The other aspect is to testnaturalproductsandtheirderivativeswithpotential neuroprotectivefunction,withtherapeuticpotential.One of the ongoing projects investigates the neuroprotective effects of nanoassisted C60-pyrimidine derivatives in neurotoxicmodelsofParkinson’sdisease. (b) In addition, several diagnostic tests have been standardizedandthetechnicalknow-howtransferredto theNeuromuscularLab(NML). No. 1. 2. 3. 4. 5. (c) Name of the test WesternblotforCalpain-3 WesternblotforDysferlin Westernblotforα- Dystroglycan WesternblotsforTelethonin Enzymeassaysfor respiratorycomplexes:I, II,III,IV,Vandcitrate synthase (Respiratorycomplexwork-up) 2013-14 Disease Calpainopathy(AR-LGMD2A) Dysferlinopathy(AR-LGMD2B) α-Dystroglycanopathy (AR-LGMD2I) Telethoninopathy (AR-LGMD2G) Mitochondrialdisorders (MELAS,CPEO,MERRF, Leigh’ssyndromeetc.) Development of a cost-effective western blot reagent withpotentialdiagnosticuse:Westernblottingisavery commonandpowerfultechniqueemployedinbiomedical research and diagnostic laboratories to detect specific proteins in a mixture, using antigen antibody reaction, on a membrane filter. To facilitate increased sensitivity in this technique, there are several chemiluminiscencebaseddetectionreagentsthatarecommerciallyavailable. However, the higher price of such commercial reagents poses a major hurdle in those laboratories carrying out western blotting on a daily basis. To circumvent this, a costeffective,enhancedchemiluminiscencekithasbeen standardized by critical modification of a published protocol to achieve higher sensitivity and long-term storage, comparable to commercial reagents. Extensive testinginourlaboratoryandothersatNRChasconfirmed the sensitivity of the reagent comparable to commercial reagents.The Centre proposes to donate this reagent, on a regular basis, free of cost for any western blot-based test carried out from NIMHANS. Cognitive Psychology & Cognitive Neurosciences Laboratory (Officer In-charge: Dr. Jamuna Rajeshwaran) The research focus of this laboratory is music cognition and neuromusicology from basic science to clinical application. This is the first laboratory in India which aims at scientific investigations into basic cognition and neural correlates of musicperceptionandcognitionaswellasapplicationofmusic inclinicalconditions. Completed research activities: (a) Perception & Identification of Ragas of Indian Classical Music: An Exploratory electrophysiological study (Fundingagency-DepartmentofScienceandTechnology, FastTrackSchemeforYoungScientist) National Institute of Mental Health and Neuro Sciences / 99 Annual Report (b) 2013-14 Electrophysiological changes and autonomic response variationstohappyandsademotioninducedviamusic- Fundingagency-DepartmentofScienceandTechnology (Cognitivescienceinitiative) Ongoing research activities: A double blind randomized controlled group study using ragasofNorthIndianclassicalinstrumentalmusic(NICM)is beingcarriedoutonpatientssubjectedtoauniformtechnique of anaesthesia during spinal surgery. The effect of NICM on stress level assessed using subjective reporting methods and physiological measures such as cortisol level, heart rate variability,bloodpressure,aswellasdosageofsedativedrugs anddepthofanesthesiainpatientsundergoingspinalsurgeryis beingexamined(NIMHANSintramuralresearchgrant). THE VIRTUAL DEPARTMENT OF CLINICAL NEUROSCIENCES The Virtual Department of Clinical Neurosciences has been created to foster research temperament amongst medical graduates with brilliant academic records. The long-term objectiveofcreationofthedisciplineofClinicalneurosciences istoboostcapacityatthenationallevelintheemergingfieldof TranslationalMedicine,specificallyasitappliestoNeuroscience. TheInstituteenvisagesthatthenewlyset-updepartmentwould succeed in bringing out clinician-neuroscientists, who are equallyadeptinbothclinicalandresearchaspects,unlikethe dichotomythatseemstoexistatpresent.Thisnewenterprise, therefore expects to bridge the wide gap that exists between the“benchandthebed-side”,therebyleadingtotranslational researchthatwillhavemoredirectclinicalapplications. TheDepartmenthasthreeadjunctfacultymembers:Prof.Vani Santosh (HOD), Dr. John P. John and Dr. Ravi Yadav. The Department currently has 23 PhD scholars who are selected and provided financial support under the Indian Council of Medical(ICMR)TalentSearchScheme(TSS).Fivecandidates whohavecompletedMBBSwithbrilliantacademicrecordsare selectedeachyearonthebasisofacompetitivenational-level entranceexaminationandpersonalinterview. During the year under review, interactive workshops were conducted for various groups – students, parents, teachers, elderly,generalpublic,mentalhealthprofessionalsandmedical professionals—on topics related to mental health promotion and prevention. Mental health education programmes were organised for Anganwadi children, adolescent girls and teachers of a few government schools, and young mothers in Primary Health Centre. The centre has initiated three new clinicsnamely–TraumaRecoveryClinic(TRC),Awakeclinic andSHUT(ServiceforHealthyUseofTechnology)clinic. TRCprovidesbriefpsychologicalinterventionstoadolescents (>16yearsofage)andadultsurvivorsoftraumathroughoneto-one and /or group counseling and psychotherapy formats, aswellassocialinterventionstoalleviatesymptomsandpave the way for holistic healing and recovery. Awake clinic offers counseling and support to address psychological problems, particularlyabuseandviolence.SHUTclinicprovidesscreening forproblematicusageoftechnologyandconductsawareness andskillbuildingworkshop/trainingworkshopforcounselors at the Centre as well as in the community (school, colleges, corporateetc). PositivePsychologyTeamandNIMHANSCentreforWellBeing organizedaConferencetitled‘YOUTH-PALS:YouthProAction Labs’ - Youth Conference with a Difference on 9 December 2013. About 250 participants from more than 25 colleges and other organizations from different parts (States) of India participatedintheconference.Conferenceincludedsessionson mentalhealthpromotionby/foryouth,peersupportforsuicide prevention, a theatre play on emotion regulation, a song for road safety, screening of short movies on mental health, and grouplevelactionlabsforideagenerationandactionplanning underYouth-PROcorethemes. Duringtheyear2013-14,NCWBconducted18workshopsand other educational events (9 at NIMHANS and 9 outside the Institute),andthefacultyassociatedwiththeCentredeveloped 15 IEC leaflets on mental health related topics. The details of the workshop and other events are given under each faculty separately. NIMHANS CENTRE FOR WELL BEING CENTRE FOR PUBLIC HEALTH NIMHANSCentreforWellBeing,anurbancommunitycentre,aims atworkingonpreventiveandpromotiveaspectsofmentalhealth. The centre offers clinical services and organizes various training andoutreachprograms.Theclinicalservicesincludepsychological interventionsandpsychiatrichelpforminormentalhealthissues. The Centre for Public Health (CPH) has been established to providestronginputsforstrengtheningpublichealthresponse to Mental, Neurological, and Substance Use Disorders (MNSUDs), injuries and other non-communicable diseases. Themainareasofworkincludehumanresourcedevelopment, 100 / National Institute of Mental Health and Neuro Sciences Annual Report strengthening public health research, policies and providing inputsforprogrammesandadvocacy. Oneofthekeyactivitiesundertakenin2012-13isthedevelopment ofapublichealthobservatoryinKolardistrict(Government of Karnataka circular ref: N.HFW30CGE2013 dated 30/1/2013) to field test public health approaches and strategies for strengthening response to MNSUDs, injuries and other noncommunicable diseases. A baseline assessment of health and human resources for mental health, health management information systems, mental health education and health care systems for management of MNSUDs was conducted in Kolar by the CPH team. Training, system development and health promotion initiatives are being developed to integrate mental health components into various health programmes. Further, theKarnatakacomponentoftheNationalMentalHealthsurvey isbeingcurrentlyundertakeninKolardistrict. Toincreasethepublichealthcompetenciesofmedicalofficers, atwo-year‘MastersinPublicHealth’(MPH)wasinitiatedwith five seats from the academic year 2013-14. The MPH course isdeliveredinaseriesofconcurrentmodulescoveringgeneral publichealthconceptsandcorecompetenciesinthefirstyear, followed by focused training on MNSUDs and injuries in the secondyear.Attheendofthecourse,thecapacitytomanage MNSUDsandinjuriesfromapublichealthperspectivewillbe strengthened,thusleadingtoincreasingavailabilityoftrained manpowerinduecourseoftime. CENTRAL ANIMAL RESEARCH FACILITY TheCentralAnimalResearchFacility(CARF)wasstartedinthe year 1979 for pursuing and conducting research and training inneurobiologicalsciences.AtCARFadequatecareistakento follow rules and regulations, and humane care of laboratory animals, as proposed by the Ministry of Social Justice and Empowerment, Government of India, the Committee for the PurposeofControlandSupervisionofExperimentsonAnimals andtheBreedingofandExperimentsonAnimals(Controland Supervision)Rules1998and2001. 2013-14 renewalprojects)wereplacedbeforetheIAECforconsideration to conduct research using animals. Apart from timely supply of requiredage,sexandweightofeachstrainofanimal,necessary support was provided to several studies. In addition, the CARF also guided and assisted researchers in designing and planning of protocols, and in day-to-day care of animals (husbandry). The CARF maintains good standards in husbandry practices, uses laboratory animals for research responsibly and is deeply committedtotheprincipleof3R’s:Reduction,Replacementand Refinementofuseofanimalforresearch. Duringtheyear2012-13,theCARFhousedandmaintaineda totalof75,764animals(mice:24,216;rats:51,041,rabbits:243, guineapigs:264) Teaching - Training Programme CARF was also involved in manpower development activities including organizing IAEC meetings and conducting training programmes. A total of 40 students and researchers from NIMHANS (23), as well as from outside institutes (10 plus 7 privatecandidates),attendedthecourseonCare,Breedingand Management of Laboratory Animals—out of which 38 were successfulincompletingthecourse. BIOMEDICAL ENGINEERING The growing acquisition of sophisticated medical and analyticalequipmentforclinicalandbiologicalresearchworks necessitated the formation of a Biomedical Instrumentation Division at NIMHANS. Biomedical Engineering Department, established in 1982, performs the dual function of Clinical EngineeringandBiomedicalEngineering. CARF supplied research team with timed pregnant animals, andneonatalanimalsforpreparationofcelllines.Experiments onspinalcordallograft,studiesonElectroConvulsiveTherapy (ECT), behavior studies, specialized enrichment experiments werecarriedout,andassistanceforexperimentalsurgerywere alsoprovided. Major functions of the Department include: designing and development of hardware and software instruments to support research and clinical programmes; designing biosensorsandbiomedicalinstrumentationsystemstodetect, record and analyze physiological functions; repairing and servicing of medical and analytical instruments, electrical, mechanical and electromechanical instruments, computer software and hardware—and their preventive maintenance; offering consultation for research and clinical specialties and recommending solutions to instrumentation and electrical safety problems. The department carried out inspection of all equipment for condemnation, storage and disposing (of unserviceableitems). Duringtheyear,theInstitutionalAnimalEthicsCommittee(IAEC) metfourtimesandatotalof47researchprojects(28newand19 The department was associated with academic section for carrying out activities related to computerized evaluation of National Institute of Mental Health and Neuro Sciences / 101 Annual Report 2013-14 entranceexaminationforadmissionsoffreshstudentsforthe year2013-14. A crash course on Bioinstrumentation and Computer was conducted (as part of the DCNT Course) for the students of DepartmentofNeurologyandBasicsofBiomedicalEngineering for B.Sc. Anesthesia Technology students. A course on Introduction to Computers was conducted for B.Sc. Nursing students.In-planttrainingwasprovidedforBiomedicalstudents fromvariousotherinstitutions.Projectswereofferedforstudents ofengineeringcollegesaspartoftheirfinalyearcurriculum. the year under review, the major focus was on accelerating online access to the latest medical and health information resourcesinthefieldofmentalhealthandneurosciences.The process of providing off campus access to e-resources of the library to NIMHANS was initiated this year. External users fromdifferentinstitutionsinthecountrycontinuedtousethe libraryresourcesattheinstitute. ENGINEERING Library resources use statistics for the year 2013-14 were as follows: 4,602 books and journals circulated; 11,923 (pages) photocopies made; and 155 availed literature search service. The number of internal and external users of the library was 13,582and6804respectively. The Engineering Department caters for the maintenance of hospitalinfrastructure,administrativebuilding,staffquarters, roads, machinery and equipment like air-conditioners, lifts, generators,etc.Theactivitiesarecoveredunderplanandnonplanheadofaccount. Networking: All the subscribed library e-resources and e-databases, including full-text databases, are available for accessfrommorethan1,500LANaccesspointsontheCampus Network.Thisisahighbandwidth(1GB)networkfromtheNIC NationalKnowledgeNetwork. Someofthemajorworkscompletedintheyear2013-14include: Constructionofthirdfloorintheexistingladieshostel(Nurses Hostel) at BRC campus; conservation of old OPD (Children’s Pavilion)/heritage building; construction of chamber for the President, NIMHANS Society above Library and Information Centre; construction of third floor above the existing Cauvery hostel at BRC campus; construction of additional sump tank adjacenttoKabiniHostelbuilding;constructionofahallinthe firstfloorofNCWBatBTMlayout;supplying,installing,testing andcommissioningof250KVADGsetatSakalawaracampus; constructionofbuildingforinpatienttreatmentforwomenwith substanceuse(groundfloorandfirstfloor);providingwireless smokedetectorsandalarmsystemtoNBRCandGovindaswamy Centre; providing solid waste converter near at laundry; providingtrenchlessinterlinkingofwatersupplysystem. Cyber Hall:CyberHallfacilityisapopularserviceamongthe userswhereinuserscometothelibraryandhaveaccesstoall the e-resources of the library. The facility has been upgraded withlatestcomputersystemsonhighbandwidthnetworkand applications. Other important works which are under progress include: ConstructionofadolescentsinpatientwardsfortheDepartment ofChildandAdolescentPsychiatry;constructionofsecondand thirdfloorabovethebuildingforinpatienttreatmentforwomen withsubstanceuse;andconstructionofcompoundwallaround theproposednortherncampusatKyalasanahalli,Bangalore. LIBRARY AND INFORMATION CENTRE TheLibrary&InformationCentrecontinueditseffortstomake more and more services of the library to be computer-based andachievedgreatsuccesswiththeinaugurationofOPACand circulation services by the Director on 3 March 2014. During Library Automation:Theautomationofcirculationservices oftheLibrarywasinauguratedbytheDirectoron3March2014. Withthis,thecompleteprocessofissueandreturnofbookswill becarriedoutthroughBarcodedMembershipCards.Thesystem sendsautomaticemailstotheuserontheissuanceofabook, andremindstheuserwhenabookisdueforreturning.During theyear,thealreadyexistingwebOPAC(OnlinePublicAccess Catalogue)ofthelibraryalsogotupgradedforenhancedonline accessthroughLIBSOFT.TheexistingCirculationCounterwas redesigned,andtherenovatedcounterwasinauguratedbythe Directoronthesameday. e-journals subscribed: Amajorreviewofthequalityandthe number of e-resources being subscribed to by the library was carriedoutduringtheyear.Electronicjournals(2362)andprint journals(49)subscribedintheyearincludeElsevierHealth(6); ElsevierHealthClinics(8);Karger(22);Nature(14);Ovid(26); ProQuest (1253); EBSCO: Psychology & Behavioral Science Collection(557);EBSCO:Psycarticles(104);PsychiatryOnline (4); Sage + Online Free (10); Science Direct (131); Society Journals (29); Springer (10); Taylor & Francis (149); Wiley (39). Other library online bibliographic databases subscribed include Ebsco:MedlineCompleteandPsycInfo. 102 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 Atotalof202newbooksand110newgiftbooksanddissertations wereaddedtothecollection,duringtheyear. Studies,checkingnameboards/signboards,rubberstamps,etc. weretheotheractivitiescarriedoutonaregularbasis. Dr.MJayaram,SeniorProfessor,Dept.ofSpeechPathologyand Audiology was nominated as Officer-in-Charge of the Library witheffectfrom1August2013onthesuperannuationofDr.HS Siddamallaiah,PrincipalLibraryandInformationOfficer.The new Library Advisory Committee was constituted, with effect from18October2013,withProf.GSUmamaheswaraRaoas Chairperson Hindi Cell PUBLICATION DEPARTMENT TheDepartmentofPublicationcontinuedtoprovideanefficient systemfordisseminatingknowledgeaboutmentalhealthand neurosciences through various specialised services and other importantactivitiesduringthereviewperiod. The department undertook copy editing and proof-reading— and coordinating the printing—of the following publications: Directory of Mental Health Care Centres in South India; Effective Caregiving in Dementia; Handbook of Psychiatric RehabilitationServices;ECTAdministrationManual—Revised Edition.Copyediting/proofreadingofleaflets,flyers,prospectus andothervitalinformationmaterialswerecarriedout.Printing andpublishingofConvocationmaterialswerealsohandledby thedepartment. Institute Reports: The Annual Report 2012-13 (both in English and Hindi) was successfully brought out by the department, under the aegis of the Co-ordinating Committee formedbytheDirector.TheInstituteActivityReports—which presentcomprehensiveinformationoftheInstitute’sactivities, developments and achievements—were also generated for BoardofManagementandAcademicCouncilMeetingsheldin theperiodunderreview. Language Classes: The Department organised Kannada classesinassociationwiththeKannadaandCultureDepartment, Government of Karnataka, for the benefit of non-Kannada speaking faculty and staff. English classes for BSc Nursing (I year)studentswerealsocoordinatedbytheDepartment. Other Activities:Certificatesforconsentforms(tobepresented to the Ethics Committee) of various research activities were issued after comparing/checking the veracity and correctness ofthetranslatedformswiththeoriginalversion(s).Publications storage and inventory management, translation of notices and vital administrative communications into regional language, coordinatingtranslationworkswiththeInstituteofTranslation Hindi Cell, functioning under the Publication Department, undertook various activities under the guidance of the Department of Official Language, Union Ministry of Health andFamilyWelfare,GovernmentofIndiawithaviewtoensure compliancewiththeOfficialLanguageImplementationpolicies andConstitutionalprovisions,andtopromoteprogressiveuse ofHindifortheofficialpurposes. Translation Activities: Consent forms for research/ academic activities, tender notifications, and other important correspondencesweretranslatedintoHindi,onaregularbasis. Correspondence in Hindi: LetterstoofficesoftheCentral Government,locatedinregions‘A’,‘B’and‘C’,asclassifiedby theMinistry,wereissuedinHinditotheextentpossible.Official documentspertainingtotheMinistrywerebeingsignedbythe DirectorandRegistrarinHindi. All name boards and sign boards of the Institute have been displayed in trilingual format (English, Hindi and Kannada). Thought for the Day was written in Hindi and English, every day,onthedisplayboardsatAshwiniBlockandNeuroCentre for the benefit of employees/ hospital staff and to facilitate learningofHindi. Hindi Training: Hindicourse/classes(Probodh,Praveenand Pragya), under the Hindi Teaching Scheme, were conducted regularly to impart training to the employees of the Institute whodonotpossessworkingknowledgeofHindi.HindiTyping and Hindi Stenography training was also provided under the scheme. Hindi Week Celebrations: Hindi Week was celebrated at NIMHANSinthemonthofNovember.Athree-dayworkshopon Unicode,byShri.EshwarChandraMishra,AssistantDirector, Central Translation Bureau, and various other competitions suchasessaywriting,debate,notinganddrafting,singing,etc. wereorganisedaspartoftheHindiWeekcelebrations. Valedictory function was held on 28 December 2013. Smt. Janaki Nair, Joint Director, Central Translation Bureau, Kendriya Sadan, Bangalore was the chief guest. Cash awards and certificates to those who have passed Hindi exams with distinction were given away by the Director/Vice-Chancellor and the chief guest of the function. Prizes were also handed National Institute of Mental Health and Neuro Sciences / 103 Annual Report 2013-14 overtothewinnersofvariouscompetitions,heldaspartofthe HindiWeekCelebrationsinNovember. carom, chess and basketball. It also has men and women Gymnasium wings, library, crèche, locker rooms, utility/yoga room,amphitheater,andcommunityhall. The Basketball Court was renovated during this reporting period.ItwasinauguratedbythePresidentandVicePresident, NIMHANS Gymkhana on 9 July 2013.On the same day, free notebooksweredistributedto96childrenandmeritcashprizes wereawardedto115children(from1ststandardtoPGcourses) oftheNIMHANSstaff. Valedictory function of Hindi Week Celebrations NIMHANS GYMKHANA TheNIMHANSGymkhanaisarecreationalandsportsfacility provided exclusively to the staff, students and their families. The Director/Vice-Chancellor, NIMHANS is the President of Gymkhana and Registrar, NIMHANS is the Vice-President. All the activities are monitored by the Executive Committee headed by a nominated Chairman. The Executive Committee has representations from all categories of staff, apart from student representatives. Situated on Byrasandra campus of NIMHANS,Gymkhanahasbeenbuiltinanareaof2,535sqm withaplinthareaof10,320sqm. TheGymkhanahasthestate-of-the-artfacilitiesandequipment for sports, physical activities and recreation. It has multiple facilitiesforvariousindoorgameslikebadminton,tabletennis, SPICMACAY-NIMHANSchapterinassociationwithNIMHANS Gymkhana organised a santoor recital by Padma Vibhushan PanditShivkumarSharmaatNIMHANSConventionCentreon 22July2013. Indoor/outdoorsportsandculturalcompetitionswereheldfor thestaffandstudentsofNIMHANS,aspartoftheInstituteDay celebrations.Theeventsevokedoverwhelmingresponseandsaw participationfrom1200participantsfromstaffandstudents. Various sports and games were conducted for children of the staff, on the occasion of Children’s Day. About 210 children participatedintheevents.Cashprizesweredistributedtothe winnersonChildren’sDay(14November2013). Aspecialscientifictalkon“CleanandGreenCampus”andvideo demonstration of scientific disposal of waste on the campus washeldon7December2013,atGymkhana.Ontheoccasion, Gymkhanaconductedadrawingcompetitionforchildrenand cashprizeswereawardedtothewinners. 104 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 National Institute of Mental Health and Neuro Sciences / 105 Annual Report 2013-14 Research Activities Biophysics 1. Purinergic signaling in astrocytes: Implications in pathophysiology of epilepsy. Investigator: Dr. Preeti Joshi (Funding by DBT) Traditionallytheprimaryfocusofresearchonpathophysiologyof epilepsy has been neuron centric. Recent studies suggest a direct contribution of astrocytes to generation of epileptic discharge. Studies on experimental model of focal epilepsy suggest that neurons engage astrocytes in a recurrent excitatory loop that promotestheinitiationandsustenanceoftheictaldischarge.These studiesestablishthatastrocytesarecrucialpartnersinepileptiform activity but the mechanisms responsible for spread of epileptic dischargeandepileptogenesishavenotbeenaddressed.Purinergic receptors play a pivotal role in neuron-astrocyte cross talk. The changesinglialfunctionduringdifferentphasesofepileptogenesis are being investigated. In an animal model of temporal lobe epilepsy, significant morphological and functional changes in astrocytes immediately after the onset of first seizure have been observed.Astrocytesshowsignificantmorphologicalchangessuch ashypertrophyandelongationofprocesses.Expressionofseveral metabotropic purinergic receptors in astrocytes is considerably upregulatedwithin1-2hoursofstatusepilepticus.Astrocyteselicit hyperCa2+activityindependentofneuronalactivity.Experimentson neuron-astrocytecrosstalkshowthatactivationofP2Y2receptors inastrocytessignificantlyenhancesthehyperactivityinneurons. ApoEgenemutationshavebeenassociatedwithdementia.ApoE4 allele is considered a risk factor for Alzheimer’s disease (AD) butthecellularmechanismsforthisassociationarenotknown. Deregulation of intracellular signaling events is a common event in disease biology. Abnormalities in Ca2+ regulation in the peripheral cells including lymphoblasts, lymphocytes and fibroblasts have been reported. The role of naturally occurring apoE3/3alleleinCa2+dysregulationinaperipheralmodelofa lymphoblastoid cell line and in derived cell lines, which differ onlyintheApoEgenotype,isbeinginvestigated. TheCa2+ signalingprofileoflymphoblastoidcelllines(LCL)isolated fromAlzheimer’spatientswerestudied.Thebasal[Ca2+]ilevelswere determined and the signals evoked by various neurotransmitters and other activators of intracellular Ca2+ release were measured. Blindexperimentswereperformedondifferentcelllinestoavoid thebias.SignificantdifferencesinCa2+ signalingincelllinesderived fromADpatientsandcontrolsubjectswereobserved. Measurement of Ca2+ signals in lymphoblastoid cells. Fluorescence intensity Ratio (340/380 nm) images of fura-2 loaded before and after stimulation with PMA and a typical [Ca2+]i kinetics in a single cell. 3. Morphological changes in live hippocampal slices isolated from rats in control and status epilepticus condition for 2 hrs. Scale = 20 µm. 2. Calcium signaling, mitochondrial and ER function in lymphoblastoid cells with different ApoE genotypes. Investigator: Dr. Preeti Joshi (Funding by DBT) 106 / National Institute of Mental Health and Neuro Sciences Mechanisms of action of neuropathic pain targets: Electrophysiological and calcium imaging studies in spinal cord neurons. Investigators: Dr. Preeti Joshi, Yu-Wen Li, Bristol-Myers Squibb Company, Wallingford, CT, USA, Reeba Vikramadithyan, Biocon Bristol-Myers Squibb R&D Center, Syngene International Ltd., Bangalore, Sreenivasulu Naidu Annual Report Pattipati, Biocon Bristol-Myers Squibb R&D Center, Syngene International Ltd., Bangalore (Funding by Bristol-Myers Squibb Company) Followingnerveinjury,primarysensoryneuronsinthedorsal root ganglion and secondary sensory neurons in the spinal cord dorsal horn exhibit a variety of electrophysiological abnormalities, including increased baseline sensitivity and/or hyper-excitability,whichcanleadtoabnormalburstinactivity and central sensitization that underlies pain. However, the molecularbasisforthesechangeshasnotbeenfullyunderstood. Understandingthemechanismsofactionofknowndrugsand noveltargetsinneuropathicpainmodelsiscriticalindesigning moleculeswithimprovedefficacyandreducedliabilitiesinclinic andinsupportingclinicaldevelopmentofthesemolecules.The investigatorsarecharacterizingthespinaldorsalhornneuronal signaling in chronic constriction injury (CCI) and diabetic peripheral neuropathic pain (DPNP) rat models of pain in termsofcalciumsignals,andtheeffectsofsomeknowndrugs usedforneuropathicpainarebeinginvestigatedusingrealtime Ca2+imagingandelectrophysiologyinlivespinalcordslices. 4. Role of mitochondria in selective degeneration of motor neurons in amyotrophic lateral sclerosis. Investigators: Dr. Preeti Joshi, Dr. NB Joshi, Dr. A Nalini 2013-14 targets for various neurological disorders including ischemia, epilepsy, Parkinson’s and Alzheimer’s diseases. The known iGluA modulators, cyclothiazide (CTZ), IDRA-21, and other benzothiadiazide derivatives (ALTZ, HCTZ, and CLTZ) bind to the ligand-binding domain of flip-form of iGluA2 at the dimer interface, thereby increasing steady-state activation by reducingdesensitization. To discover new modulator compounds, the investigators performedvirtualscreeningfortheligandbindingdomain(LBD) of iGluA2 against NCI Diversity Set III library containing 1597 compounds,andsubsequentlyperformedbinding-energyanalysis forselectedcompounds.ThecrystalstructureofratiGluA2S1S2J (PDB ID: 3IJO) was used for docking studies. From this study, four compounds were obtained: (1) 10-2 (methoxyethyl)-3phenylbenzo[g]pteridine-2,4-dione, (2) 2-benzo[e]benzotriazol2-yl-aniline, (3) 9-nitro-6H-indolo-(2,3,-b) quinoxaline, and (4) 1-hydroxy-n-(3-nitrophenyl)-2-napthamide.Thebindingmodeof thesefourcompoundsisverysimilartothatofabovementioned established modulators: two molecules of each compound independently bind to the protein symmetrically at the dimer interface;occupythesubsitesB,C,B’andC’;potentiallyinteract withSer518andSer775.Bindingenergyanalysisshowsthatallthe fourhitsarecomparabletothedrugmolecule,CTZ,andhence, theinvestigatorsproposethatthediscoveredhitsmaybepotential molecules to develop new chemical libraries for modulating the flipformofiGluA2function. Selective and progressive loss of motor neurons in the spinal cord, brainstem, and motor cortex is hallmark of the Amyotrophiclateralsclerosis(ALS).Thoughthemotorneuron degeneration in ALS is considered a multifactorial process, the glutamate induced toxicity is a major contributory factor in the selective injury to motor neurons. The investigators observed that cerebrospinal fluid from ALS patients causes mitochondrial dysfunction, selectively, in motor neurons (in culture)throughglutamatereceptors.AdditionofALSCSFto mixed spinal neuron culture caused fusion of mitochondria clustering towards the plasma membrane. The mitochondrial functionalparameterssuchasmembranepotential,Ca2+levels werealsosignificantlyaltered. 5. Identification of novel modulators for ionotropic glutamate receptor, iGluA2 by in-silico screening. Investigator: Dr. B Padmanabhan Ionotropic glutamate receptors (iGluAs, IUPHAR nomenclature) are the major excitatory amino acid neurotransmitter receptors in the mammalian central nervous system (CNS). iGluAs are potential therapeutic drug A representative diagram for superposition of the compound #3 onto #4. The ligands and interacting residues are shown in sticks. The oxygen and nitrogen atoms are colored in red and blue, respectively. 6. Analysis of dimerization of BTB-IVR domains of Keap1 and its interaction with Cul3, by molecular modeling. Investigator: Dr. B Padmanabhan National Institute of Mental Health and Neuro Sciences / 107 Annual Report 2013-14 Oxidative damage has been associated with various neurodegenerative diseases including Parkinson’s disease, amyotrophiclateralsclerosis(ALS),andAlzheimer’sdisease,as well as non-neurodegenerative conditions such as cancer and heartdisease.TheKeap1-Nrf2systemplaysacentralroleinthe protectionofcellsagainstoxidativeandxenobioticstress.TheNrf2 transcription function and its degradation by the proteasomal pathway(Keap1-Nrf2-Cul3-Roc1complex)areregulatedbythe cytoplasmic repressor protein, Keap1 which possesses BTB, BACK(IVRregion)andKelchdomains.TheBTB-BACKdomains areimportantforKeap1homo-dimerizationaswellastointeract withCullin-3forNrf2degradation.Thecrystalstructureofthe Keap1-Kelchdomainisknown;however,thatoftheBTB-BACK domains are not yet determined. The investigators present, throughmolecularmodelingstudies,theanalysisofKeap1-BTB dimerization,andofBTB-BACKdomainsroleincomplexwith Cul3. The electrostatic charge distribution at the BTB dimer interface of Keap1 is significantly different from other known BTBcontainingproteinstructures.Anotherintriguingfeatureis alsoobservedthatthenon-conservedresiduesattheBTB-BACKCul3 interface region may play critical role for differentiating Cul3recognitionbyKeap1fromotheradaptorproteinsfortheir specificsubstratesproteasomaldegradation. neurodegeneration, autoimmune/inflammatory diseases, metabolic diseases and viral infections. Hence, the epigenetic targetsareofgreatimportancetodiscovernewdrugmolecules for various major diseases. While drugs targeting histone deacetylase (HDAC) and DNA methyltrasferase (DNMT) are clinically approved recently, drug discovery targeting other epigenetic markers are in the pipeline. One of the epigenetic ‘reader’proteins,bromodomaincontainingproteinsrecognizes acetylated-lysinehistones(H3andH4)andinvolveinregulating geneexpressionandgenesilencing. The BET family nuclear proteins have a unique architecture with two tandem bromodomains (BD1 and BD2) and a conserved extra-terminal domain. The BRD2 protein, which belongs to the BET family, recognizes mono-acetylated histone H4 at Lys12 (H4K12ac) and di-acetylated histone H4 at Lys5 and Lys12 (H4K5ac/H4K12ac) through N- and C-terminal bromodomains, respectively. The BRD2 protein are reported to possess potential role in the pathogenesis of cancer, defects in embryonic stem cell differentiation, seizures and neurodegenerative disorders (NDD) such as Parkinson’s disease. The project aims to obtain inhibitor moleculesforBRD2BD1andBD2bromodomainsbyrational drug discovery approach. The work involves multifaceted approachesofmolecularbiology,proteinbiochemistry,protein crystallography,andcomputationalbiology.Theinvestigators recentlycloned,expressedandpurifiedtheBRD2BD2protein tohigh-endpurity.In-silicoscreeningusingNCI-DiversitySet III library gave a set of compounds with significant binding energyvalues(Figure). A cartoon ribbon diagram of the BTB-BACK domains in complex with Cul3 (violet) (PDB Id: 4AP2), and labeled only the interacting secondary structure elements. 7. Drug discovery of potent inhibitors for epigenetic marker, BRD2 bromodomains by rational structure based approach. Investigator: Dr. B Padmanabhan (Funding by DBT) Aberrations in epigenetic mechanisms results in abnormal cellularfunctions,andcanleadtothedevelopmentofcancer, The compound BD1-INI#1 nicely binds into the acetylated-histone binding pocket of human BRD2-BD1. 108 / National Institute of Mental Health and Neuro Sciences Annual Report 8. Structure-function analysis of HDAC domain of human SIRT1 and discovery of pharmaceutically acceptable SIRT1 inhibitors by rational drug design approach. Investigator: Dr. B Padmanabhan (Funding by DST) Sirtuins belongs to the NAD+-dependent class III histone deacetylases (HDACs) family, distinct from ‘classical’ class I/ II/IV HDACs. Sirtuins are known to protect against stress associated with neurodegeneration, including oxidative damageandproteinmisfolding.TherecentliteratureonSIRT1 and SIRT2 suggest that these targets are emerging targets in neurodegeneration. SIRT1 is ubiquitously expressed in all tissues including the brain. SIRT1 is known as a nuclear protein, which is predominantly expressed in neurons. The activation of SIRT1 by a drug molecule, in the brain, may be usefulfortheNDtreatment.Theprincipalaimofthisproposal istodeterminethecrystalstructureofHDACdomainofSIRT1, and to rationally design lead selective small-molecule SIRT1 activators for treating ND. The investigators have cloned, expressed the HDAC domain of human SIRT1 and purified it byNi-NTAaffinitycolumn(Figure1).Theproteinproduction optimization and in-silico screening to obtain modulators are inprogress. 9. Drug discovery of novel inhibitors for human Superoxide Dismutase I (hSOD1). Investigator: Dr. B Padmanabhan, Dr. Richard Strange, Liverpool University, UK MostcasesofAmyotrophiclateralsclerosis(ALS),aresporadic (sALS); however, approximately 10% are familial (fALS). The fALS disorder is primarily a heterozygous genetic condition. Morethan140pointmutationslinkedtofALShavebeenfound in throughout human SOD1-gene. The cumulative lifetime risk for MND is approximately 1 in 1000. Patients succumb tothisdiseasewithin3-5yearsafterthediagnosis.Becauseof late diagnosis, life expectancy of patients is usually low. The currentlyapproveddrugtilldateforthetreatmentofMNDis Riluzole,butitseffectivenessisless,providinga9%gaininthe chanceofsurvivalforoneyearafterinitiationoftreatment. Superoxide dismutase 1 (SOD1) is a ubiquitous homodimeric metalloenzyme. The aggregation or oligomerization which is usuallyfoundinSOD1mutantsleadstopathogenesis.Hence, blocking aggregation or oligomerization is a better strategy to cure ALS/MND disease. The objective of this project is to discover and develop compounds by rational structure-based drugdiscoverymethod,toarrestaggregationofSOD1,thereby 2013-14 preventingorslowingdownALS/MNDdisease.Inthisaspect, the investigators have recently expressed human SOD1 in E.coli, and purified to homogeneity with more than 95 % purity. They have obtained the hSOD1 protein crystals from proteincrystallizationscreening(Figure1).In-silicoscreening and docking studies and protein crystallography work are in progress. A B (A) SDS-PAGE of hSOD1 before and after cleavage of His-tag. (B) A representative image of hSOD1 crystals grown in PEG6000 as major precipitant. 10. Preclinical studies on brain tumours: combination of adjuvants with different mechanisms of radiosensitization. Investigator: Dr. Vijay Kumar Kalia, Dr. Vani Santosh (Funding by DBT) Primary cells of high grade gliomas obtained from tumour biopsies were cultured in EMEM + 20% FBS. These cultures did not show the typical lag phase observed in cultures from established cell lines. Ultrastructural studies (TEM) showed that the untreated glioma cells had ounded nucleus with a prominentnucleolus,plasmamembranehadlotsofmicrovilli like processes. Temozolomide (TMZ, 10 and 20µM, 4hrs) treatedcellsshowednucleardamage(indentednuclei,nuclear fragments and smooth plasma membrane. Exponentially growing cells as monolayer were fixed in Methanol-Acetic Acid and stained with 0.002% Acridine Orange. These cell linesshowedvariablefrequenciesofdamagedcells(apoptosis, andmicronuclei),evenwithoutanycytotoxictreatments.The damagewasincreasedafterTMZ(≤10M)andirradiation(1-2 GyCo60γrays).Combinationof2-Deoxy-D-Glucose(0.5mM) further increased damage in all the tumors. Combinations of thesedrugsatclinicallyfeasible,lowconcentrations±radiation could,therefore,improvetreatmentofmalignantgliomas. ThefocusofthestudyareEffectsofcombiningAllTransRetinoic Acid(RA,Retinal)withTemozolomidetreatmentonradiation damageinU373MG,anestablishedmalignanthumanglioma cellline,EffectsofcombiningeitheraretinoidorLonidamine withTemozolomidetreatmentonradiationdamageinhuman National Institute of Mental Health and Neuro Sciences / 109 Annual Report 2013-14 brain tumour cells of different origins, Elucidate the possible mechanism(s)ofradiosensitization;andTheeffectsoftumour biologyonthecellularresponsetothesetreatments. 11. P2Y receptor mediated signaling in rat hippocampus. Ms. Biji Jose (CSIR Fellow). Guide: Dr. Preeti Joshi 12. Interaction of P2Y receptor and TRPV1 channel in dorsal root ganglion (DRG) neurons. Mr. Mahendra Singh (UGC Fellow). Guide: Dr. Preeti Joshi 13. Involvement of astrocytes in epilepsy.Mr. Bhanu Prakash Tewari (CSIR Fellow). Guide: Dr. Preeti Joshi 14. Neuron-astrocyte interaction in relation to excitotoxicity in spinal neurons. Ms. Siksha Sharan (DST INSPIRE Fellow). Guides: Dr. Preeti Joshi, Dr. A Nalini 15. Role of endoplasmic reticulum and mitochondria in calcium signaling in spinal neurons. Mr. Ajay Irmale, Guide: Dr. Preeti Joshi 16. Protein production of mouse KEAP1-DC and screening of its designed inhibitors and crystal structure analysis of hypothetical protein TM0360. Mr. Prashant Deshmukh. Guide: Dr. B Padmanabhan 17. Glutamatergic and purinergic signaling in spinal sensory neurons. Mr. Yuvraj Joshi. Guide: Dr. Preeti Joshi 3. Migration, poverty and access to health care: A study on people’s access to health systems’ response. Investigators: Dr. P Marimuthu, Dr. DK Subbakrishna, Dr. K Sekar, Dr. Manoj Kr. Sharma, Dr. RT Venkatesh, Deputy Director (State Surveillance Unit), Office of the Director General of Health Services, Government of Karnataka (Funding by ICMR) The investigators have involved diverse and inclusive representationofstakeholders/participantsfrommigrantand host communities including community-based organizations and personnel from health, political and other, social developmentsectorsoflocaladministration,non-governmental agencies in decision-making. The intervention components willbeimplementedinafewurbanpocketsidentifiedasmost vulnerableandsomeotherpocketswillbeselectedandstudied ascontrolgroups. Beneficiaries will be informed by the community leaders, CBO and NGO working in the slum locations. Health services will be provided to the migrant population by a team of health service providers, consisting of doctor(s), nursesandhelpers.Theteamwillvisittheslumsonceinten days, for providing the general health services, treatment of minor illness, supply of medicine, referrals, diagnosis, healtheducationandmentalhealthintervention.Atotalof 10 visits for three and a half months has been proposed. A research associate and a research assistant will also be partoftheteamproposedforthehealthcamp.Intervention programme is completed and the end-line survey is about tostart. 4. Development of screening tool for Psychiatry morbidity. Investigator: Dr. Manoj Kumar Sharma, Prof. SK Chaturvedi, Dr. P Marimuthu (Funding by INHANS) Biostatistics 1. Structural equations modeling approach to study latent relations among clinical, immunological & neuroimaging parameters in schizophrenia. Investigator: Dr. DK Subbakrishna (Funding by DBT) 5. Comparison of illness severity scoring systems for mortality prediction in Neuro intensive care unit. Investigator: Dr. Sonia Bansal, Dr. Mariamma Philip 2. Biostatistical consultancy for conduct of fresh anthropometric survey of a representative sample of IAF Aircrew. Investigator: Dr. DK Subbakrishna (Funding by Institute of Aerospace Medicine) 6. Generativity in cognitive networks under Cognitive Science Research Initiative (CSI). Investigators: Dr. DK Subbakrishna, Dr. Rose Dawn Bharath, Dr. B Indira Devi (Funding by DBT) 110 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 correlationsduringmoreattentivetaskofvisualencoding.In tunewiththerecentstudiesoncognitivereserve,investigators alsofoundthatnumberofyearsofeducationwasasignificant factor influencing working memory connectivity. SE had higherpositivecorrelationtoDLPFCregionandlowernegative correlation to DMN in comparison with CE during encoding andretrieval. Child & Adolescent Psychiatry 1. Effect of Ayurvedic Coded Drug (Ayush-Manas) in the management of Manasa Mandata (Mental retardation). Investigators: Dr. Girimaji SC, Dr. Srinath S, Dr. Seshadri SP (Funding by CCRAS, Govt. of India) ThisisadoubleblindplacebocontrolledclinicaltrialofanAyurvedic coded drug with one-year prospective follow-up in 6 to 13 yearoldchildrenwithmildtomoderatedegreeofmentalretardation. In total, 797 were screened, 120 participants were recruited and followed up. Ninety one participants completed the trial. Data obtainedwassenttoCCRASforcentralizeddataanalysis. Seed to voxel based connectivity for PCC seed for encoding and retrieval in the context of education. CE encoding (a), CE retrieval (b) SE encoding (c), SE retrieval (d). Red color demonstrating positive correlation with source seed and blue color demonstrating negative correlation with source seed Human memory is an enigmatic component of cognition which many researchers have attempted to comprehend. Accumulatingstudiesonfunctionalconnectivityseebrainasa complexdynamicunitwithpositivelyandnegativelycorrelated networksinperfectcoherenceduringatask.Theinvestigators aimed to examine coherence of network connectivity during visual memory encoding and retrieval in the context of education. School Educated (SE) and College Educated (CE) healthy volunteers (n = 60) were recruited and assessed for visual encoding and retrieval. Functional connectivity using seed to voxel based connectivity analysis of the posterior cingulatecortex(PCC)wasevaluated.Theinvestigatorsnoticed thattherewerereciprocaldynamicchangesinbothdorsolateral prefrontal cortex (DLPFC) region and PCC regions during working memory encoding and retrieval. In agreement with the previous studies, there were more positively correlated regions during retrieval compared to encoding. The default mode network (DMN) networks showed greater negative 2. Study of neural development in a human induced Pluripotent Stem cell (hiPS) model of primary microcephaly. Investigators: Dr. Satish Girimaji, Dr. K John Vijay Sagar (Funding by DST) 3. An exploratory study of Emote Sensor in children with Autism Spectrum Disorder. Investigators: Dr. John Vijay Sagar, Dr. TN Sathyaprabha 4. A study of brain imaging, neuropsychological profile, genetic markers and eye movements in first degree relatives of children with Autism spectrum disorders (ASD). Investigators: Dr. Srinath S, Dr.Girimaji SC, Dr. Seshadri SP, Dr. Vijay Sagar KJ, Dr. Ravindranath V, Dr. Kumar K, Dr. Murthy A, Dr. Prasad C Eighteen families with 33 first degree relatives of children diagnosedwithAutismSpectrumDisorderhavebeenrecruited for the study in the proband group. Of this the whole set of assessments mentioned above has been completed for nine families(i.e,19firstdegreerelativesofchildrenwithASD).For theresttheprocessoftestingisongoing.Inthecontrolgroup, four families with six individuals have been recruited for the study. National Institute of Mental Health and Neuro Sciences / 111 Annual Report 5. 6. 2013-14 Autism spectrum disorders and epilepsyExploration of a relationship. Investigators: Dr. Srinath S, Dr. Girimaji SC, Dr. Seshadri SP, Dr. Vijay Sagar KJ, Dr. Satishchandra P, Dr. Sinha S, Dr. Hirisave U, Dr. Roopesh BN, Dr. Shivashankar, Dr. Yamini, Dr. Subbakrishna DK (Funding by ICMR) Imaging and biochemical correlates in children with Autism spectrum disorder with and without Epilepsy. Investigators: Dr. Vijay Sagar, Dr. Srinath S, Dr. Seshadri SP, Dr. Vijay Sagar KJ, Dr. Jain S, Dr. Purushottam M , Dr. Subbakrishna DK 7. Role of genetics in Autism spectrum disorder with and without epilepsy. Investigators: Dr. Girimaji SC, Dr. Srinath S, Dr. Seshadri SP, Dr. Vijay Sagar KJ, Dr. Jain S, Dr. Purushottam M, Dr. Subbakrishna DK 8. A prospective study of the course and outcome of children and adolescents with attention deficit hyperactivity disorder in a tertiary care centre. Ms. Preeti Jacob. Guides: Dr. Srinath S, Dr.Girimaji SC, Dr. Seshadri SP, Dr.Vijay Sagar KJ The objective was to examine the short-term course and outcome of children with ADHD who received treatment as usual from the out-patient services of a tertiary care centre. Sixtythreechildrenwereincludedinthestudyatbaselinewere diagnosedtohaveADHDasperDSM-IV-TRdiagnosticcriteria. Thirtyninechildrenwereavailableforthe24thweekfollow-up assessment and 37 children were present for all assessments (baseline, 6 weeks, 12 weeks and 24 weeks). There were 54 boysand9girlsinthesamplestudied,and92.1%hadADHDCombined subtype. Psychiatric comorbidity was present in 82.5% of the sample at baseline with Oppositional Defiant Disorder(ODD)andAnxietydisordersbeingthemostfrequent. There was a significant relationship between psychiatric comorbidity and the ADHD-RS scores. The medications used to treat ADHD were Clonidine, Atomoxetine and Methylphenidate.Risperidonewasusedinasmallproportion of subjects to control aggressive and disruptive behaviour. Combinationmedicationwasusedmorefrequentlyinsubjects with severe illness and intellectual disabilities. There was no change in the weight in 8 (12.7%) children, and 12 (30.8%) lost weight ranging from 1-5 kilograms over 6 months. The severityofsymptoms,functionalityandqualityoflifeimproved significantlyover24weekswithtreatmentasusual.Severityof illnessatbaselineandthepresenceofpsychiatriccomorbidity especially oppositional defiant disorder predicted short-term outcome. 9. Short term outcome of anxiety disorders in children and adolescents. Ms. Preeti Kandasamy. Guides: Dr. Girimaji SC, Dr. Srinath S, Dr. Seshadri SP, Dr. Vijay Sagar KJ Thestudyaimsatprospectivelystudyingthecourseofanxiety disorders in children and adolescents overaperiod of six monthswithemphasisonfollowingoutcomemeasures-levelof functioningandqualityoflife.Italsoaimsatexaminingfactors thatmodifytheshort-termcoursesuchassocio-demographic variables,clinicalvariables-illnesscharacteristics,comorbidity, etc.andlifeevents.Theothermajorobjectiveofthestudyisto examinethesubjectiveexperienceofchangeintermsofillness experience,illnessimpactandtreatmentimpactthroughtheir narratives. The recruitment process has been done, while the six-monthfollow-upevaluationisnearingcompletion. 10. Factors affecting outcome in oppositional defiant disorders: a 3-month prospective study. Mr. Raghunandan Mani. Guides: Dr. Vijay Sagar KJ, Dr. Srinath S, Dr. Girimaji SC, Dr. Seshadri SP Oppositionaldefiantdisorder(ODD)isaleadingcauseofreferral foryouthmentalhealthservices;yet,manyuncertaintiesexist about ODD as it is rarely examined as a distinct psychiatric disorder. Children’s early individual differences could set off a chain of transactions between child and environment that could lead eventually to ODD. Studies of ‘vulnerability associations’haveshownthatpersonalitytraitscouldbearisk factor that causes individual to be vulnerable to development of psychopathology, particularly in certain environmental conditions. The aim of the study is to examine individual factors, psychosocial factors and the correlates of outcome in children and adolescents with ODD, who attend the Child andAdolescentoutpatientorinpatientservicesatNIMHANS. This is a non- randomized observational prospective study of naturalistic treatments (treatment as usual) of children and adolescentswithODD,followedupforaperiodof3monthsin atertiarycarecentre.About40caseshavebeenincludedinthe studytilldate. 11. 112 / National Institute of Mental Health and Neuro Sciences A clinical study and short term outcome of children and adolescents with history of child sexual abuse. Dr. Sowmya Bhaskaran TS. Guides: Annual Report Dr. Shekhar P Seshadri, Dr. Shoba Srinath, Dr. Satish C. Girimaji, Dr. K. John Vijay Sagar Childsexualabuseisassociatedwithawiderangeofpsychiatric symptoms and difficulties, and these problems can persist over years.Athoroughexplorationoftheseconsequencesandthefactors thataffecttheoutcomeisvitalinordertoformulatemanagement andpreventativestrategiesforsexuallyabusedchildren.Theaim of the study is to examine the clinical characteristics and shorttermoutcomeofsexuallyabusedchildrenandadolescents.Thisis acasecontrolprospectivestudyofchildrenandadolescentswith ahistoryofchildsexualabusecomparedwithcontrolswhohave nohistoryofchildsexualabuse,followedupforaperiodofthree monthsinatertiarycarecentre.Eighteencasesand10controls havebeenrecruitedinthestudy. 12. Study of suicidality in children and adolescent in an inpatient setting. Dr. Arun Vangili. Guides: Dr. Shoba Srinath, Dr. Satish Girimaji, Dr. Shekhar Seshadri, Dr. John V Sagar The aim of the study is to examine the prevalence and clinical characteristics of suicidality in children admitted to an in-patient facility. Children who are admitted to the Child Psychiatry Centre, NIMHANS, who fulfil the inclusion criteria, are diagnosed using a structured assessment method after consent from the parents and assent from the child are obtained. All the children without developmental disorders are screened for suicidality and children who are positive are assessed for severity of suicidal ideation using appropriate instruments. Children with developmental disorders are screenedforsuicidalityusingasemi-structuredquestionnaire anddimensionsofproblembehaviourassessed.Sofar,atotal of 60 patients have been recruited. Statistical analysis will be doneafterrecruitmentofallsubjectsiscompleted. Clinical Neurosciences 1. Imaging correlates of cognitive impairments in essential tremors. Dr. Ketaki Swapnil Bhalsing. Guides: Dr. Pramod K Pal, Dr. AK Gupta 2. A longitudinal study of Mild traumatic brain injury: Neuro imaging, cognitive function outcome and ApoE gene polymorphism. Dr. Ashok M. Guides: Dr. B Indira Devi, Dr. Dhaval Shukla, Dr. Jamuna Rajan (Funding by DST) 2013-14 3. Acceleratedaging and schizophrenia: Clinical and neuro immunometa boliccorrelates. Dr. Shiv Kumar. Guides: Dr. BN Gangadhar, Dr. V Ravi 4. Molecular genetic basis of radiation and chemoresistance in glioblastoma. Dr. Arun HS. Guides: Dr. S Sampath, Dr. Vani Santosh, Dr. Arivazhagan A Despite aggressive radiochemotherapy, the median survival GBMpatientsisonlyabout14monthswiththemajorcauseof death attributed to local recurrence arising from tumor cells whichhaveinfiltratedintonormaltissueandhaveevadedcell deathfollowingirradiationorchemotherapy.Theobjectivesof thisstudyistounderstandtheroleofradioresistantmolecular markers, such as IGFBP3, STST-1,Osteopontin, stem cell marker;Maternalembryonicleucinezipperkinase(MELK)and nicotinamide n-methyltransferase (NNMT) in glioblastoma pathogenesis and to understand the role with regard to chemo-resistanceandradiobiologyofGBM.Theexpressionof MELKandNNMTinGBMtumorsandothergradesofdiffuse gliomashas been studied and prognostic significance is being analysed.Radiobiologyexperimentshavebeencarriedoutand thestudyisinprogress. 5. Study of functional connectivity in early Alzheimer’s dementia. Dr. Rakesh B. Guides: Dr. Srikala Bharath, Dr. Sanjeev Jain 6. Mitochondrial respiratory chain disorders: Phenotypic, genotypic and functional correlation. Dr. Sonam Kothari. Guides: Dr. Bindu PS, Dr. Taly AB, Dr. Gayathri N, Dr. Srinivas Bharath MM Mitochondrial respiratory chain disorders (RCD) are known for phenotypic, biochemical and genetic heterogeneity. This ongoing study in collaboration with the Departments of Neuropathology and neurochemistry has successfully established the respiratory chain complex assays for patients with suspected mitochondrial disorders. Over the last two years, a large cohort of patients with both syndromic and nonsyndromic mitochondrial disorders has undergone the phenotypic assessment and biochemical assays. The most commondeficiencyobservedwascomplexIandIVfollowedby combinedenzymedeficiency. 7. Adenosine signaling pathway in medically refractory epilepsy due to mesial temporal sclerosis (MTS) lesions. Dr. Vikas Dhiman. Guides: Dr. Sanjib Sinha, Dr. P Satishchandra, National Institute of Mental Health and Neuro Sciences / 113 Annual Report 2013-14 Dr. Anuranjan Anand, Dr. Anita Mahadevan, Dr. Arivazhagan A (Funding by ICMR) The aim of this study is to find out the role of various genes involvedintheadenosinesignalingpathwayAdenosinekinase, A1 receptor,5’nucleotidase,adenosinedeaminase,c-myc,c-fos, c-jun, CREB1, ERK1/MAPK1, NF-kB), in medically refractory epilepsy due to MTS using surgically resected hippocampal tissuesfrompatientsofMTS.Expressionprofileofthesegenes willalsobetestedinbloodsamplesofthepatientsinanattempt tofindbiomarkersforprognosis. 8. Macro and microstructural videopolysomnographic signal analysis: Sleep and epilepsy correlation. Dr. Chetan S Nayak. Guides: Dr. Sanjib Sinha, Dr. AB Taly 9. Role of Renin-Angiotensin-Aldosterone system in cognitive deterioration in patients with cerebral small vessel disease. Dr. Thomas GregorIssac. Guides: Dr. Chandra SR, Dr. Rita Christopher, Dr. Jamuna Rajeswaran, Dr. Mariamma Philip (Funding by ICMR) The objectives of this research are to study the phenotypic characteristics of cerebral small vessel disease, correlate the same with imaging and neuropsychological parameters and to examine the association of gene polymorphisms of the renin-angiotensin-aldoseterone pathway in determining the progressionofcognitivesymptoms.Bloodsamplesofpatients arebeingcollected andprocessed,andinitialneuropsychological assessmentforexecutivedysfunctionisbeingcarriedoutonthe recruitedpatients. 10. Simultaneous EEG FMRI to study phase synchronization and functional connectivity in symptomatic localization related epilepsy. Dr. Ganne Chaitanya. Guides: Dr. Satish Chandra, Dr. Sanjib Sinha, Dr. Rose Dawn Bharath 13. Genetic characterisation of respiratory chain disorders in pediatric population. Dr. Shwetha Chiplunkur. Guides: Dr. Bindu PS, Dr. Taly AB, Dr. Gayathri N, Dr. Srinivas Bharath MM Diagnosingmitochondrialdisorderisachallengetoclinicians. Routine biochemistry, respiratory enzyme assays and genetic analysis form the investigatory battery for mitochondrial disorders. The investigators are already successful in functionally assessing complexes of mitochondrial electron transport chain. A more obvious next step is to confirm the dysfunction by providing a genetic validation. Since all of the mitochondrial dynamics is run by mitochondrial and nuclear genes,itisimportanttoanalyseboth.Inthepurviewofavailable resources,identifyingdeletionsanddepletionsinmitochondrial genome, with few known, nuclear gene mutations affecting mitochondrialfunctioningareaimedat,incollaborationwith MolecularGeneticsLab. 14. A study of inflammatory markers and heart rate variability in severe head injury. Dr. Akhil Deepika. Guides: Dr. Indira Devi B, Dr. Dhaval P. Shukla, Dr. Rita Christopher, Dr. Sathyaprabha TN This study aims at identifying inflammatory markers and heartratevariabilityasbiomarkersforfunctionaloutcomein severetraumaticbraininjury(TBI).Clinicalandneuroimaging findingsarerecordedinTBIpatients.Inflammatorymarkers aremeasuredandheartratevariabilityrecordedondays1,3 and10aftertheinjury.Basedonoutcomemeasures,patients are divided into 3 groups: (i) Brain Dead, (ii) Favorable outcome (GOSE 5 to 8) (iii) Unfavorable outcome (GOSE 1 to 4). The collected data will be analyzed with appropriate statistical measures to study the correlation between autonomic function changes and inflammatory markers and functionaloutcome. Clinical Psychology 11. Austism spectrum disorders–Role of oxytocin and imaging analysis. Dr. Sowmyashree. Guides: Dr. Shoba Srinath, Dr. Satish Chandra Girimaji, Dr. Rose Dawn Bharath 1. 12. Vitamin D, autoimmunity and autism spectrum disorders. Dr. Salah Basheer. Guides: Dr. Satish C Girimaji. The aim of the study was to explore emotional, behavioral and social influences on academic success among 6-7 yearoldchildren.Atotalof200childrenattendingregularschools 114 / National Institute of Mental Health and Neuro Sciences Emotional, behavioral and social influences on academic success among 6-7 year-old Indian children. Investigators: Dr. Uma H, Dr. Subbakrishna DK (Funding by ICSSR) Annual Report were recruited for the study. Tests were used to assess psychological functioning, social preference, intelligence and learning disabilities. Academic success was measured by a standardized test as well as from marks obtained in class tests. Multiple linear regression and discriminant functional analysis was used to analyze the data. On the teacher rated measure of academic success peer relation problems as observed by teacher in the class room along with likability of thechildandintelligenceaccountedfor41.9%ofthevariance in academic success. Knowledge of alphabets, numerals, social preference in the class room and problematic behavior observed by teacher in the classroom discriminated average andaboveaveragechildrenontheresearcherratedmeasureof academicsuccess.Theresultssuggestamodelhighlightingrole of behavioral variables (inattention; hyperactivity and global difficulties)socialvariables(peerproblems,socialpreference) and cognitive variables (intelligence, knowledge of alphabets andnumbers)wereidentifiedasinfluencingacademicsuccess. Thefindingshaveimplicationsfor childrenatriskforacademic under achievement and for developing intervention packages domainsofchildbehavior. 2. Efficacy of Partial Exposure and Response Prevention (ERP) Vs. Conventional ERP Vs. Mindfulness integrated CBT for patients with Obsessive Compulsive Disorder: A randomized control trial. Investigators: Dr. Mahendra P Sharma, Dr. Devvarta Kumar, Dr. Paulomi M Sudhir, Dr. Manjula M, Dr. YC Janardhan Reddy This study examines the relative efficacy of partial exposure and response prevention (ERP) Vs. conventional ERP Vs. mindfulness integrated CBT for patients with obsessive compulsive disorder. A sample of 30 patients with primary diagnosis of OCD will be randomized to one out of the three intervention groups. Patients in all the three groups will undergo 15-20 sessions of therapy. Pre, mid and postassessments will be carried out. Tools used to assess OCD symptoms, symptom severity, insight, obsessive beliefs, subjective distress, depression, improvement, mindfulness, qualityoflife,workingallianceandhomeworkcompliancewill beincludedinthestudy.Theresultsofthepresentstudywillbe analyzedquantitativelyaswellasqualitatively. 3. Aggressive driving and anger on roads among two wheeler riding college youth. Investigators: Dr. Seema Mehrotra, Dr. Paulomi Sudhir, Dr. Manoj Sharma, Dr. Neelima Chakrabarthy, CRRI, New Delhi (Funding by CSIR) 2013-14 This project aims at examining the prevalence of aggressive drivingamongsttwowheelerridingcollegeyouth,thecorrelates ofthesameaswellasdocumentingtheexperienceofnegative emotions, especially anger on the roads. An intervention program for promoting safe and respectful riding behaviors in youth (SMART RIDERS) has been developed. It has been field tested and the data are being analyzed with respect to gains in knowledge, changes in riding attitudes and efficacy aboutemotionalregulationontheroads.Amanualfortrainers is being developed for wide dissemination of this preventivepromotiveinterventionprogram. 4. Youth Engagement program: Development and examination of psychosocial outcomes. Investigators: Dr. Seema Mehrotra, Dr. Srikala Bharath, Dr. Ravikesh Tripathi (Funding by ICSSR) The study is aimed at developing brief program for youth engagementandfieldtestingthesameinordertoexamineits psychosocial impact. The pilot phase entailed examining the psychometricpropertiesoftherelevantassessmentmeasures/ outcome indicators. A brief youth engagement program (ENGAGE TO CHANGE) has been developed which consists of an orientation workshop and an extended support phase fortheparticipatingyouthtoimplementtheirplansdeveloped duringtheorientationworkshop.Thethemescoveredforyouth engagementinthisprograminclude:mentalhealth,disability, environment and road safety. The program is currently being fieldtested. 5. Brain correlates of creativity. Investigators: Dr. Jamuna Rajeswaran, Dr. K Thennarasu (Funding by DST) Creativity is defined as something new or novel, unique or originalwithanelementofsurpriseandusefulness.Creativity is appreciated, useful and required in all spheres from a very simple invention of a consumer product to as complex inventionofamissile.Researchincognitiveneurosciencehas used predominantly EEG/ERP paradigm. This paradigm has not been extensively used even in creativity research. EEG is useful in understanding the temporal and spatial resolution ofcognitiveprocesses.Thestudywillbehelpfulinidentifying thebrainprocessinvolvedincreativityandalsowhichregions mediatecreativity.Asampleof60subjectswillbechosenfrom Bangalore.ThirtysubjectswillbetakenfromSchoolofDesign from Bangalore (National Institute of Design, Shristi School of Design, Chitra Kala Parishat) and 30 subjects will be from National Institute of Mental Health and Neuro Sciences / 115 Annual Report 2013-14 normalpopulation.Afterobtainingwritteninformedconsent, the recording of the EEG will be carried out based on the changesmadeafterthepilotstudyon60subjectsindividually. 6. A study of cognitive functions and biochemical correlates in traumatic brain injury. Investigators: Dr. Jamuna Rajeswaran, Dr. Rita Christopher (Funding by DBT) Traumatic brain injury (TBI) is a complex injury with a broadspectrumofsymptomsanddisabilities.Theimpacton apersonandhisorherfamilycanbedevastating.Cognitive difficultiesareverycommoninpeoplewithTBI.Studieshave shown Neuropsychological rehabilitation to be usefulness in improvingthecognitivefunctionsanddaytodayfunctioning. Neurofeedbacktrainingisanoperantconditioningprocedure whereby an individual modifies the amplitude, frequency or coherence of the electrical activity of his/her own brain. The aim of the present study is to examine the biochemical correlatespre,postneuro-feedbacktraining(NFT)inpatients with TBI. Sixty patients diagnosed with TBI according to ICD-10 (WHO, 1992) will be recruited to one of the two groups within a month of injury into intervention group (neurofeedbacktraining)andtreatmentasusual.Theserum levelsoftheabovewillbecomparedbeforeandafterNFTin bothgroupstoelucidatethebiochemicalmechanismswhich mayapossibleroleintherecovery.Thestudywillbehelpful inadministeringtheNFTintheearlystagesofTBI,indicating thatalongwithneuralplasticityNFTaugmentsimprovement cognitionandQOL. 7. Parenting styles and socialization processes in the development of perfectionism: An intergenerational study of Indian youth. Investigators: Dr. Paulomi M Sudhir, Dr. DK Subba Krishna (Funding by ICSSR) The project was aimed at understanding the development of perfectionism in youth with parenting styles as possible contributors and examining dimensions of perfectionism, parenting styles attachment styles and neuroticism in Indian youth.Ayouthsampleof400wasdrawnfromcolleges.Asecond setofdata,whichcomprisedofparentsandyouth,wasrecruited from community (n=57). Intergenerational transmission of perfectionismwasanalyzed.Perfectionismwasnotassociatedwith greater psychological distress. There were positive correlations betweenself-orientedperfectionism,discomfortwithcloseness, preoccupationwithrelationship,confidenceinrelatingtoothers. Self-orientedperfectionismwasassociatedwithananxiousand secureattachmentstyle.Avoidant,anxiousstyleswerepositively correlated with Neuroticism and higher psychological distress. Women showed higher self-oriented perfectionism. There was a negative association between psychological distress and maternalandpaternalcare,whileoverprotectionbyfatherand an authoritarian style of parenting as perceived by the sample was positively associated with psychological distress. There were significant differences between high and low distressed subjects on neuroticism, socially prescribed perfectionism. Therewassignificantpositivecorrelationbetweenotheroriented perfectionism in youth and parents, and positive correlation between self-oriented perfectionism in youth and parents. Sociallyprescribedperfectionismwasnegativelycorrelatedwith self-orientedperfectionisminparents. 8. Electrophysiological correlates of cognitive decision making and emotional decision making. Investigator: Dr. Keshav Kumar (Funding by DST) The aimof the study is to compare the nature of information processing in cognitive decision making(monitory loss/gains) with emotional decision making (romanticloss/gains). The Neuralcorrelatesofcognitiveandemotionaldecisionmaking will be examined using EEG and ERP and fMRI in healthy normalsandindividualswithalcoholdependence. 9. Exploration of need and efficacy of internet based program for the management of psychological problems. Investigator: Dr. Manoj Sharma (Funding by Dr. Ramamurthy Foundation for Mental Health & Neurological Sciences) Internetasamediumofmasscommunicationposesnumerous opportunities, challenges and dilemmas for mental health professionals.Theproposedinternet-basedprogramprovided the authentic educative information about psychological problems as well as online guidance to manage their day-today stressors. The sample consisted of 500 subjects (both male and female) in the age range of 20-50 years recruited from the general community for the assessment of felt needs fortheprogramandscreeningofpsychologicalproblemsand 50 subjects amongst them (with presence of psychological problems–anxiety,depression,somaticcomplaintsandstress, familiarity with the internet usage) were recruited for the internet-basededucational program. The education program consistedofassessment(intheformofquestion-answerformat) ofproblems,educatingthemaboutthepsychologicalproblems, identifying unhelpful, irrational thoughts/coping behaviors andstrategiesrequiredtohandlethem.Weeklysessionswere 116 / National Institute of Mental Health and Neuro Sciences Annual Report conductedandparticipantsweregivenhomework/worksheet assignmenttofacilitatepracticebetweenthesessions. 10. Computer assisted cognitive retraining programme to improve cognitive functions for elderly. Investigators: Dr. Keshav Kumar, Dr. Varghese M, Dr. John PJ, Dr. Jain S, Dr. Bagepally BS (Funding by DST-TIDE program) Normalagingisassociatedwithcognitivedeclineinthedomains of memory, speed of processing and executive function. Mild CognitiveImpairments(MCI)isknowntobeatransitionstage betweennormalaginganddementia.Tento15%ofindividuals withMCIwilldevelopdementiaplacingademandoncaregivers andmedicaltreatment.Specificallydesignedcognitivetraining programmes are known to reduce the risk of rapid cognitive decline in healthy normal elderly, individuals with MCI and dementia. Improvement in cognitive function improves the quality of life; possibly delay dementia and decreases dependence.Thepilotstudyindicatedimprovementincognitive functionsinthedomainsofattention,workingmemory,verbal andvisuallearningandmemoryinbothhealthynormalsaswell as clinical population (MCI and mild Dementia patients). The preliminaryfindingsuggestthatcognitiveretrainingprogramme ispromisinginimprovingcognitivefunctioninhealthynormals aswellasclinicalpopulation. 11. Behavioral addiction in the community: An exploration. Investigators: Dr. Manoj Sharma, Dr. Vivek Benegal, Dr. Girish N (Funding by ICMR) A total of 2755 subjects in the age group of 18-65 years were interviewed at their door steps from an urban locality in Bangalore.ThestudywasfundedbyIndianCouncilofMedical Research, Delhi undertaken by the department of Clinical Psychology, Center for Addiction Medicine and Centre for Public Health, NIMHANS, Bangalore. Addictive use was presentfor-1.3%(2%males&0.6%females)forinternet;4.1 %(5%males&3.1%females)formobilephonesand3.5%for social networking sites. Physical/Psychological distress was presentasmorbidity—6.8%withmobilephoneaddiction;4.2% withinternetuseand3%withsocialnetworkingsites. 12. Stress management in youth: A preventive intervention. Investigators: Dr. M Manjula, Dr. Roopesh BN, Dr. Mariamma Philip (Funding by Indian Council for Social Science Research) 2013-14 Specific objectives of the study are (i) To develop a prevention program and examine its efficacy in a) reducing depression b) reducing suicidal behaviours c) enhancing knowledge d) coping and d) building self-esteem (ii) To prepare module for suicide preventionforyouth. The approximate sample size for the exploratory study is 1500 from two government and two private high schools and pre-university colleges using stratified random sampling. The interventionstudywoulduseatwogroupcomparisondesign. The sample for study group would consist of students from one private and one government school (300) and similarly for college (around 380). In addition, 200 students from school and college were assessed for validation of suicidal behavioursscale.Thedatacollectionforexploratorystudyhas been initiated and module development for the intervention programisunderway. 13. Neural effects of cognitive remediation in schizophrenia: An ERP and fMRI study. Investigators: Dr. Devvarta Kumar, Dr. BN Gangadhar, Dr. Ganeshan Venkat Subramanian, Dr. Shivram Varamabally, Dr. Rose D (Funding by DBT) This study aims to see the neural effects of cognitive retraining (specifically home-based training) in patients with schizophrenia. The schizophrenia patients will be randomly divided into three groups – home-based remediation group, clinic-basedremediationgroupandthewait-listcontrolgroup. Pre-andpost-neuropsychologicalandneurophysiological(fMRI andEEGbasedERP)changeswillbeassessedtodeterminethe effectsofremediation.Thepilotphaseoftheprojectisoverand themainphasehasstarted. 14. Determining sensitivity and specificity of Event Related Potentials for its use as cognitive function biomarker in Schizophrenia. Investigators: Dr. Devvarta Kumar, Dr. Shivaram Varamabally, (Funding by DBT) This study is intended to see the sensitivity and specificity of variousEEGbasedEvent-RelatedPotentialsinschizophrenia. TheERPparadigmshavebeendevelopedandtheprocessfor recruitmentofJRFhasbeenstarted. 15. Self-injurious behaviours and psychopathology among adolescents and young adults in National Institute of Mental Health and Neuro Sciences / 117 Annual Report 2013-14 Bangalore. Investigators: Dr. Poornima Bhola, Dr. Manjula M (Funding by ICMR) Thestudyexploredtheoccurrence,methods,characteristicsand reportedreasonsforSelf-InjuriousBehaviours(SIB)among1571 high school, pre-university and undergraduate college students, anditssocio-demographicandmentalhealthcorrelates.Results indicated that 40.7% reported SIB in the past year, with male preponderance and higher rates among youth between 13- below 18 years. The rate of non-suicidal self-injury was 33.9%., with 16.7% of self-injurers reporting associated suicidal intent. Moderate/severe forms of SIB were reported by 19.4%, most commonly cutting (8.2%) and burning (7.7%). 21.3% used only minormethods;mostfrequentlybitingself(19.6%)andself-hitting (17.2%).Multipleself-injurymethodsweremostoftenendorsed and 14.8 years was the mean age of onset. Characteristics like durationofforethought,associatedlevelsofpainandconcurrent substanceuseweredescribed.DistinctivepatternsofSIBemerged basedongender;theseverityofmethodsused;andthepresence orabsenceofsuicidalintent.SIBservedbothtoregulateinternal emotional states (automatic reinforcement) and to influence others in the environment (social reinforcement). Self-injuring youthhadsignificantlyhigherlevelsofinternalizing,externalizing andtotalproblems.Separatelogisticregressionanalysesidentified predictors of the occurrence of self-injurious behaviours and predictorsofsuicidalintentamongself-injuringyouth. 16. Professional development of clinical psychology trainee therapists. Investigators: Dr. Poornima Bhola, Dr. Ahalya Raguram (Funding by NIMHANS Intramural Research Grant) This study aims to assess therapist characteristics, positive and negative aspects of work experience and professional development among Clinical Psychology trainee therapists in India.Thisincludedtheoreticalorientation,sourcesoflearning, therapeutic skill, perceived progress, therapeutic difficulties and coping strategies, cultural aspects of psychotherapeutic practice, interpersonal manner, personal functioning and satisfactionwithsupervisionandthetrainingsetting.Thepilot study hasbeencompleted. Thisinvolvedinterviewswithfour psychotherapysupervisorsandfinalisationofTheDevelopment of Psychotherapists Common Core Questionnaire – Trainee version, Background and Process forms after administration and feedback from 10 Clinical Psychology trainee therapists. Themainstudyisongoing.Sixtyfivetraineetherapistsfromthe Department of Clinical Psychology and select M.Phil Clinical Psychologytraininginstitutesacrossthecountrycompletedthe assessmentattheendoftheirtraining.Atwo-pointassessment hasbeencompletedforasub-sampleof16traineetherapists; at mid-point and at the end of training to assess changes in variousdomainsofprofessionaldevelopment. 17. Explanatory models of mental illness among caregivers of mentally ill referred to rehabilitation services. Investigators: Dr. Poornima Bhola, Dr. Hesi Herbert, Dr. Devvarta Kumar, Dr. Sailaxmi Gandhi, Dr. SK Chaturvedi This project aims to study the explanatory models of mental illness among caregivers of individuals with psychiatric disordersseekingtreatmentatatertiarycareneuropsychiatric hospital.Theobjectivesaretoexploretheexplanatorymodels ofcaregiversofmentallyillandtostudytherelationshipwith socio-demographic variables and select clinical variables. The sample will consist of 60 caregivers of inpatients or outpatients,withapsychiatricdiagnosisreferredtoPsychiatric Rehabilitation Services. The study is exploratory in nature with a single group and purposive sampling. The tools used for assessment are Socio Demographic Data Sheet and Barts ExplanatoryModelInventory. 18. Electrophysiological and neuropsychological correlates of treatment outcome in ADHD children. Investigators: Dr. Roopesh BN, Dr. Shoba Srinath, Dr. Satish Girimaji, Dr. Shekhar Seshadri, Dr. John Vijayasagar, Dr. Keshav Kumar (Funding by DBT) Theprojectaimstolookatthecorrelatesintheneurodynamics (neuropsychological and electrophysiological) of the brain of the children diagnosed with ADHD after they were given cognitivetraininginadditiontotreatmentasusual. 19. Just World Belief in parents of children with conduct disorder. Investigators: Dr. Roopesh BN, Dr. John Vijayasagar Thehypothesisof‘JustWorldBelief’(JWB)statesthatpeople have a need to believe that their environment is a just and orderly place where people usually get what they deserve. Conduct Disorder (CD) is a repetitive and persistent pattern ofdissocial,aggressiveordefiantconductbehavioursthatare diagnosed in children. Among various risk factors, parental psychopathology such as antisocial personality disorder, substance use, and depression is observed in the parents of childrenwithCDcomparedtoparentsofchildrenwithoutCD. Giventhis,thecurrentstudylookedhowJWBdifferbetween 118 / National Institute of Mental Health and Neuro Sciences Annual Report parents of children with and without CD. For the same, 15 parents of children with CD were taken from inpatient and outpatientservicesofNIMHANS,afterfulfillingtheinclusion andexclusioncriteria.Asacomparisongroup,ageandeducation matched15parentsofchildrenwithoutCDwererecruitedfrom the community. The results showed no significant difference betweenthetwogroups. 20. Development and standardization of flipchart on informed assent for children who participate in research. Investigators: Dr. Roopesh BN, Dr. Jayashree Ramakrishna, Dr. John Vijayasagar The aim of the project was to develop a flipchart for the children who are approached to participate in various researchactivitiesandareexpectedtoread,understandand signtheinformedassent.Giventhattheyoungchildrenhave difficulty to comprehend written and verbal instruction; a flipchart of the informed consent was developed. This flipchartwascomparedwiththeverbalinformedconsentin childrenbetween6–16yearsofage.Theresultsshowedthat agehadasignificantpositivecorrelationwithunderstanding the informed consent. Results further showed that girls preferred more of verbal and boys preferred more of visual stimuliforinformedconsent. 21. Development and standardization of insight in conduct disorder scale in children. Investigators: Dr. Roopesh BN, Dr. Manoj Sharma, Dr. John Vijayasagar 22. Development and standardization of belief in just world scale for children. Investigators: Dr. Roopesh BN, Dr. Manoj Sharma, Dr. John Vijayasagar 23. Decision making in patients with ADS. Investigators: Dr. Roopesh BN, Dr. Manoj Sharma, Dr. Vivek Benegal PatientswithAlcoholDependentSyndrome(ADS)haveshown tohavedeficitsinvariousdecisionmakingprocesses,especially in gambling type of tasks. However, in some of the gambling tasks,thepersonhastorememberthegainorlossofaparticular choice.Inadditiontoplacingdemandonmemoryresources,it rarelyresemblesthereallifegamblingexperiences.Therefore, theprojectaimstostudytheperformanceofthepatientswho arealcoholdependentintasksthatmimicthereallifegambling. 2013-14 24. Integrated treatment for in timate partner violence and alcohol use for heavy drinking men in South India. Investigators: Dr. Satyanarayana, VA, Dr. K Srinivasan (Collaboration with St. John’s Research Institute, funding by SBR/ICMR) The aim of the study is twofold: (a) To explore perpetration and victimization experiences of problem drinking inmen and their wives, and (b) To examine the comparative effectiveness of standard intervention (treatment as usual) and enhanced intervention(standardpluscognitivebehavioralintervention)for problemdrinkinginmen,knowntoperpetrateIPV.Theprimary objectivesaretocomparetheeffectofstandardversusenhanced interventions in reducing (a) alcohol consumption among problemdrinkers(b)thefrequencyofperpetrationofIPVamong problem drinkers (c) the frequency of IPV related victimization among wives of problem drinkers. The secondary objectives are tocomparetheeffectofstandardversusenhancedinterventions inreducing(a)symptomsofdepression,anxietyandstressamong wives of problem drinkers and (b) emotional and behavioral problemsinchildren.Thestudyisconductedintwophases:the formativephaseandtheinterventionphase.Theformativephase is completed and a manuscript based on the findings has been submitted for publication. The intervention phase is currently in progress and recruitment of 177 patients for the control and interventiongroupshasbeencompleted.About130patientswere followedupinthefirstmonthand108afterthreemonths. 25. Efficacy of a nurse delivered mobile phone intervention in improving adherence to HIV treatment and mental health outcomes in women with HIV: A feasibility RCT. Investigators: Dr. Satyanarayana VA, Dr. Chandra PS (Funding by NIH/ICMR) The objectives of the study are: (a) conducting formative researchtoadaptaNurse-deliveredmobilephoneintervention forwomenwithHIVwhohavementalhealthorpsychosocial barriers. This part of the research will inform the content of theinterventionandhelptoadapttheexistinginterventionfor Indianneeds(b)trainingIndiannursestodeliverthetheoryguided, standardized phone intervention for mental health issuesandpsychosocialbarrierstoimproveARTadherenceand retentionincareandimproveclinicaloutcomes(c)evaluating the feasibility, acceptability, fidelity and preliminary efficacy of the standardized phone intervention in a randomized, controlled pilot study, in which 120 HIV-infected women are randomized to treatment as usual or treatment as usual plus National Institute of Mental Health and Neuro Sciences / 119 Annual Report 2013-14 the phone intervention. Recruitment and training of research staff for the formative phase of the study has been done. Formativephasehasbeeninitiated,andqualitativeinterviews on women with HIV/AIDS, their family members and health careprovidersarecurrentlyongoing. 26. Effect of Indian classical music on perceived anxiety, depth of anesthesia and cortisol level in patients undergoing spinal surgery: A double blind randomized controlled study. Investigators: Dr. Shantala Hegde, Dr. GS Umamaheswara Rao, Dr. Rita Christopher, Dr. Gopala Krishna KN (Funding by NIMHANS, Intra-mural research grant) Perioperative anxiety remains a major issue for patients undergoing any surgical procedure. Recent developments in anaesthesia have contributed to satisfactory management of systemic physiology during and after surgery, but total management of pain and anxiety remains less than ideal. Pharmacological approach to the problem is fraught with addedrisksintheformofcardiorespiratoryandothersystemic complications. Recent studies point to the deleterious effects ofdeepintra-operativeanaesthesiaonpostoperativeoutcomes. Research studies examining the effect of music on health have reported that music has beneficial effect in lowering the usageofsedativedrugs,aswellasinloweringofstresslevels assessed via behavioral as well as physiological measures in patients undergoing various kinds of surgery. This study is a double blind randomized controlled group study using ragas ofNorthIndianclassicalinstrumentalmusic(NICM)isbeing carried out on patients subjected to a uniform technique of anesthesiaduringspinalsurgery.TheeffectofNICMonstress levelassessedbothbehaviorallyaswellasusingphysiological measures such as cortisol level, heart rate variability, blood pressure—anddosageofsedativedrugsanddepthofanesthesia in patients undergoing spinal surgery—is being examined. So far,42patientshavebeenrecruitedfortheresearchstudy. 27. Perception and identification of ragas of Indian classical music: An exploratory electrophysiological study. Investigator: Dr. Shantala Hegde (Funding by DST) The present study is aimed to examine the EEG/ERP changes in musically trained and untrained participants while passively listeningtoragaexcerptswithnotesthataremelodicallycongruent yet theoretically incorrect notes (incongruent note) that do not conform to the raga. The sample consisted of musically trained (n=30) and musically untrained participants (n=34). EEG was recordedusingtheNeuroscan(SynAmps),samplingrateof256Hz, with30electrodesplacedaccordingthe10/20electrodeplacement system. ERP analysis was carried out using scan software (4.5). ERPduringcongruentandincongruentnotepresentationunder eachragaexcerptsweregrandaveragedundereachgroup.Results showedsignificantdifferencebetweenthetrainedanduntrained group.WhilsttrainedgroupshowedP600ERPcomponentduring the incongruent note presentation, the untrained group did not show any significant difference between the two conditions. Interestingly,theP600isalanguage-relevantERPandisthought tobeelicitedbyhearingorreadinggrammaticalerrorsandother syntacticanomalies.Inthisstudy,themusicallytrainedseemedto haveprocessedmusicalexcerptssimilartolanguageandanomaly in musical excerpt similar to grammatical errors. The results provided further evidence to our understanding of shared and distinctneuralcorrelatesofmusicandlanguage. 28. Electrophysiological changes and autonomic response variations to happy and sad emotion induced via music and a functional MRI study of musical emotions Investigator: Dr. Shantala Hegde (Funding by Department of Science and Technology (Fast Track Scheme for Young Scientist) The aim of the study was to investigate the neural correlates of musical emotions using excerpts of ragas and functional MRI method. This is the first study of its kind to investigate musical emotionsviaragasofnorthIndianclassicalmusic.Thestudyalso aimedtoexaminethedifferencesandsimilaritiesintheactivation of the brain areas in musically trained (n=11) and untrained individuals(n=17)duringthetwomusicalemotionconditions.The stimuluswaschosenbasedonapriorbehaviouralstudyinwhich musicallytrained(n=30)andmusicallyuntrained(n=31)ratedset ofmusicalexcerptschosenfromsixragasofHCM.Ofthesixraga excerpts,theexcerptratedassignificantlyevoking‘veryhappy’and ‘very sad’ by both the groups were chosen for the present fMRI study.Blockdesign(ABA)methodwasusedinthepresentstudy. Thebrainactivationduringthetwoemotionalconditionsdiffered significantlywithmorenumberofbrainareasbeingactivatedduring happy condition compared with sad condition in both musically trainedanduntrainedgroup.Apartfromtheactivationofprimary auditory areas and emotion areas such as para-hippocampal region, activation in right insula and right medial, inferior and superiorfrontalareaswereobservedinhappycondition.Thesad condition activation in the putamen, right thalamus, caudate, precentralgyrus,leftinsulaandleftfusiformgyruswereobserved. The findings contribute to the further understanding of musical emotionsanditneuralcorrelatesandvariationsintheunderlying neuralcorrelatesduetomusicaltraining. 120 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 (c) (a) (d) (b) Voxel based morphometry group analysis. Figures (a) and (b)show the brain activation during happy and sad musical emotion in musically untrained group and (c) and (d) show the brain activation during happy and sad musical emotion in musically trained group. Apart from the primary auditory areas and emotional areas, some of the brain areas observed to be activated in musically trained group was not observed in the musically untrained participants and during sad emotion condition, musically trained participants activated more number of areas than the untrained. National Institute of Mental Health and Neuro Sciences / 121 Annual Report 2013-14 29. A study of client characteristics in the process and outcome of psychotherapy. Ms. Mahima Sukhwal. Guide: Dr. Ahalya Raguram 32. Childhood Leukaemia: An exploratory study of a hospital-based psychological intervention. Ms. Uttara Chari. Guides: Dr. Uma Hirisave, Dr. L Appaji The aim of the study was to examine client pre-therapy characteristics in the process and outcome of therapy. These includedclients’roleandoutcomeexpectancies,motivationfor psychotherapyandinterpersonalfunctioning.Processvariable includedclients’ratingsofworkingallianceandoutcomewas ratedbyclientsandanindependentclinician.Pessimismabout outcome and overall working alliance predicted improvement on clients’ symptom distress, social role and interpersonal functioning. The role of positive versus negative expectancies and intrinsic versus extrinsic motivation was found to be more complex than previously understood. Working alliance was found to have a positive association with the outcome of psychotherapy. The aim of the study was to explore the therapeutic effect of a hospital based psychological intervention on children with leukemia.Thesampleconsistedof20children,theirmothers and primary nurse in-charge. The normal group comprised of 20 healthy children and their mothers. Play therapy and supportive counseling were carried out. There was difference in play behavior in the two groups of children. Following intervention there was decrease in psychological difficulties; better adjustment to illness related stressors and improved playbehavior.Thesegainsweremaintainedatfollow-up.Play behavior showed decrease in anxiety and greater adaptive defenses. 30. A psychosocial exploration of persons seeking divorce. Ms. Suruchi Sonkar. Guides: Dr. Ahalya Raguram, Dr. Suresh BM 33. Effectiveness of cognitive behavior therapy for children with anxiety disorders in school setting. Ms. Selvi M. Guide: Dr. Uma Hirisave Divorceisoneofthemoststressfullifeeventsanindividualcan experience.Evidencesuggeststhatmaritaldistress,conflictand disruptionareassociatedwithawiderangeofdeleteriouseffects on both adults and children, on physical health and mental health and well-being. The aim of the study is to explore the perceivedcausesofdivorceamongpersonsseekingdivorceand examinetheirmentalhealthandpsychologicalcharacteristics. These include communication, conflict resolution, social support, well-being and emotional status. The study is being carriedoutonpersonsseekingdivorcewhohavebeenreferred formediationbythefamilycourts. The study aimed to examine the effectiveness of cognitive behavior therapy in children with anxiety disorders in school setting in comparison to a control group. Fifty school-going children aged 8 to 14 years were assessed on measures of anxiety,worriesandglobalfunctioning.TheKendall’sCoping Cat Programme was effective in reducing anxiety symptoms andimprovementinglobalfunctioning,Theeffectsizeindicates themagnitudeofchangeinanxiety,andglobalfunctioningwas higherintheinterventiongroupthaninthecontrolgroup. 31. Systemic therapy with families of youth with mental disorders. Ms. Suvarna Joshi. Guides: Dr. Ahalya Raguram, Dr. Mathew Varghese Family therapy attempts to understand human behavior as shaped by its context. Family functioning has significant implicationsforthedevelopmentandwell-beingofindividual members and includes the individual, marital and the overall familylevels.However,therelativecontributionsofindividual ordyadicfactorstooverallfamilyfunctioningarenotclearand have not been examined in clinical samples. This study aims to examine the impact of systemic family therapy in families of youth with mental disorders on well-being, emotional adjustment,dyadicadjustmentandoverallfamilysatisfaction andidentifypredictorsofthesame. 34. Development of parent-training videos for child behavior problems. Ms. Megha Rupa. Guides: Dr. Uma Hirisave, Dr. Jayashree Ramakrishna The aim of the study is to develop parent-training videos for behavior problems in young children and evaluate its impact onparentingsenseofcompetence.Datawillbecollectedfrom parentstoidentifycommonchildbehaviorproblemsinchildren in the community between 3-8 years of age. When data is saturated,contentanalysiswillbeperformedandscreenplays willbeprepared.Afterestablishingthevalidityandreliabilityof thescreenplays,videoswillbeshot.Theimpactofthesevideos, thusdevelopedwillbeassessedusingasinglegrouprepeated measuresdesignintheevaluationphaseofthestudy. 35. Development of as caletoassess experiences in children and adolescents. Ms. Snigdhasree 122 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 Dr. Anisha Shah Bhattacharyya. Guides: Dr. Uma Hirisave, Dr. N Janardhana The aim of the current study is to develop a scale to assess experiencesinchildrenandadolescents.Thestudywouldexplore howchildrenandadolescentsconceptualizeexperiencesintheir day-to-day lives. Following which a scale will be developed to assessexperiencesinchildrenandadolescents,andpsychometric propertiesofthescalewillbeestablished.Thesamplewillinclude school-goingstudentsbetween8–16yearsofagefromEnglish/ Kannada medium of instruction.Qualitative and quantitative methodswillbeusedforanalysisofdata. The objectives of the study are to explore and examine the relationshipbetweensexualinteraction,sexualcommunication, marital intimacy and marital quality in couples with sexual dysfunction. A format for marital therapy in couples with sexual dysfunction will also be developed and the effect of marital therapy on the above variables will be examined. An integrated marital sex therapy will also be developed. A hybriddesignwillbeusedandPart1ofthestudywillbecrosssectionalwithasampleof250marriedindividuals.Part2will involveInterventionwith20couples,withpre-postandfollowupassessments. 36. An exploratory study on gender, migration and mental health in persons from the Khasi community. Ms. Ila Lyngksiar Rynjah. Guide: Dr. Anisha Shah (Funding by ICMR) 39. Client experiences in combined couples therapy. Ms. Ashmeet Nagpal. Guide: Dr. Anisha Shah Theaimistoexaminetheexperienceofmigrationandthemental healthofpersonsfromtheKhasicommunitywhohavemigrated to Bangalore, through a gendered perspective. The study employs a mixed method design, wherein quantitative data is beingobtainedusingscales,whichhavebeendecidedupon,and qualitative data from the semi-structured interview which has beenconstructedbytheresearcher.Thesampleforquantitative data is 180, of which, 92 have been obtained so far. From the 180 samples, 30 persons will be interviewed. Currently, data collectionisinprogress,followingwhichappropriatestatistical andqualitativeanalysiswillbecarriedout. 37. Differentiation of self, attachment and marital quality in married persons. Ms. Madhurini Vallikad. Guide: Dr. Anisha Shah The aim of the study is to study differentiation of self, attachmentandmaritalqualityinmarriedpersons.Thestudy will employ a cross-sectional design comparing distressed and non-distressed groups on the variables of interest. The samplewillconsistof120marriedpersons.Thefollowingtools will be administered to participants: The Socio-Demographic data sheet, Beck’s Depression Inventory, Marital Quality Scale,Differentiation of Self Inventory- revised, Attachment Style questionnaire and Marital Intimacy questionnaire. In addition, two of the questionnaires will be administered to a sample of 150 participants from a community population to generatenorms. 38. Marital therapy in couples with marital distress and sexual dysfunction. Ms. Manjula V. Guide: Theaimofthestudyistobridgetheresearcher-practitionergap by using in-depth interviews with clients to understand how individual sessions can be integrated with conjoint sessions in couples’ therapy. Clients perceived needs and experiences of individual and conjoint sessions can better inform therapists in making treatment decisions. Additional variables of interest thatwillbestudiedareindividualpsychopathologyinspouses, maritalqualityandlevelsofdifferentiationofself,withtheaimof understandingtheassociationofthesevariableswiththechoice offormatofsessions.Thestudywilluseamixedmethoddesign. 40. Effectiveness of mindfulness integrated cognitive behavior therapy (MICBT) in social phobia. Mr. Abdul Salam KP. Guides: Dr. Mahendra P Sharma, Dr. CR Chandrashekhar The aim of the study was to examine the effectiveness of MICBTinpatientswithsocialphobia.Thesampleconsistedof 47 patients who were randomly assigned to either of the two groups–MICBT(n=25)orExposureonly(n=22).Assessments weredoneatpre,postand1monthfollow-upphases.Results indicated that MICBT is as effective as Exposure only in reducing symptom severity in social phobia. MICBT was effectiveinreducingcognitionsandmeta-cognitionsassociated withsocialphobia.MICBTwasalsoeffectiveinenhancingthe quality of life of these patients. Qualitative data reveals that patientsperceivedMICBTtobehelpfulinproducingrelaxation, decreasingdistress,reducingspectatorshipandavoidanceand handlinginterpersonaltensions. 41. Effectiveness of a mindfulness-based stress reduction (MBSR) program in reducing stress National Institute of Mental Health and Neuro Sciences / 123 Annual Report 2013-14 in adolescents. Ms. Urvashi Anand. Guide: Dr. Mahendra P Sharma Thisstudyexaminedtheeffectivenessofamindfulness-based stressreduction(MBSR)programinreducingstress,increasing adjustment and enhancing well-being in adolescents. Sample comprised of 192 adolescents from two schools. MBSR group received eight 40-minute weekly sessions of the program within the school hours while the control group received no treatment. Pre-analysis results reveal significant differences frompre-assessmenttopost-assessmentandpost-assessment tothree-monthfollow-upassessmentonallthesubscalesofthe SchoolSituationSurvey,thePre-AdolescentAdjustmentScale and Personal Well-Being Index-School Children. Moderate to largeeffectsizesemergedonalloutcomemeasuresindicating the effectiveness of the program. Good compliance,high attendance,highretentionratesandpositivefeedbacksupport theprogram’sfeasibilityandacceptability. 42. Sexuality and quality of life in women survivors of breast cancer. Ms. Michelle Sangeeta Barthakur. Guides: Dr. Mahendra P Sharma, Dr. SK Chaturvedi, Dr. Suraj Manjunath Theobjectivesofthestudyistostudythepatternofbodyimage issues, sexuality, marital satisfaction, anxiety, depression and overallqualityoflifeinwomensurvivorsofbreastcancerandto examinetherelationshipbetweenthesevariables.Quantitative data was collected from 50 women and qualitative interviews with 15 women for those meeting criteria of study. Results revealdepressionaspredictorofqualityoflife;qualitativedata suggests trends of good coping skills, difficulties encountered with health care system, good social support and posttraumaticgrowth.Basedonfindingsofthestudy,contentsof aninterventionmodulewillbeoffered. 43. Efficacy of mindfulness integrated cognitive therapy in patients with OCD. Ms. Sonal Mathur. Guides: Dr. Mahendra P Sharma, Dr. YC Janardhan Reddy TheaimofthestudyistoexaminetheefficacyofMindfulness Integrated Cognitive Therapy (MICT) on symptom severity, beliefs about obsessions, depression, quality of life and psychological flexibility in patients with obsessive compulsive disorder. A two-group design with baseline, post and followup assessments will be adopted. Sixty patients with primary diagnosis of OCD will be randomly assigned to either MICT intervention group or Stress Management intervention group and each group will have 15 sessions of intervention. Appropriate statistical measures will be used to assess the improvementandcomparethetwogroups. 44. Effectiveness of acceptance and commitment therapy in patients with somatic symptom disorder. Ms. Fatema Khanam. Guide: Dr. Mahendra P Sharma, Dr. SK Chaturvedi TheaimofthestudyistoexaminetheeffectivenessofAcceptance andCommitmentTherapy(ACT)onsomaticsymptoms,anxiety anddepression,globalfunctioning,psychologicalwell-beingand improvingacceptance,mindfulnessandvalued-livinginpatients with somatic symptom disorder. A two-group design with baseline,postandfollow-upassessmentswillbeadopted.Forty patients with primary diagnosis of somatic symptom disorder willberandomlyassignedtoeitherACTinterventiongroupor treatment-as-usual group and the ACT group will have 8-10 sessionsofintervention.Appropriatestatisticalmeasureswillbe usedtoassesstheimprovementandcomparethetwogroups. 45. Cognitions, Metacognitions, Neuropsychological functioning and symptom dimensionality in obsessive compulsive disorder. Ms. Manpreet Kaur. Guides: Dr. Mahendra P Sharma, Dr. Keshav Kumar, Dr. YC Janardhan Reddy OCD is a heterogeneous condition. Recent research shows one such method used to reduce this heterogeneity is to examine symptom dimensions in OCD. It has been shown that symptom dimensions have distinct but overlapping brain substrates. There are also some early indications that symptom dimensions might have distinct neuropsychological correlates. However, it is unknown that whether symptom dimensions in OCD are associated with specific dysfunctional beliefs and metacognitions. Hence, the present study aims to examineobsessivebeliefsandmetacogntionsinOCDsymptom dimensions and their relationships with neuropsychological functions 46. Life adversities, relational experiences and selfesteem in women with alcohol use disorders.Ms. Kanika Malik. Guides: Dr. LN Suman, Dr. Prabath K Chand, Dr. P Marimuthu The aim of the study is to examine the clinical profile of women with alcohol use disorders (AUDs). It also aims to explore adverse life experiences, relational factors,self-image and perceived social support among women with alcohol use 124 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 disorders. The study will use both quantitative measures and interview techniques to collect data. The sample will consist of35womenwith aprimarydiagnosisofalcoholusedisorder. Interviews with a family significant other will also be carried out.Thefindingswillcontributetobetterunderstandingofthe treatmentneedsofthispopulation. in-depth interviews have been conducted with 14 long-term volunteers,sofar,toaddressthestudyobjectives. 47. Personal growth: processes and determinants in college youth. Ms. Anindita Bhattacharya.Guide: Dr. Seema Mehrotra (Funding by UGC) Thisstudyaimsatexploringsocialwell-being,itsmanifestations anddimensionsfromtheperspectivesofyouthanddeveloping abrieforientation-sensitizationprogramforenhancingyouth engagement. The survey has yielded rich observations on indicatorsofsocialwell-beinginyouthandthedimensionsof socialwell-beingmostrelevantforurbanIndianyouth.Abrief orientation-sensitizationprogramhasbeendevelopedbasedon focusgroupdiscussionsandsurveys.Thisprogramiscurrently beingpilottested. Personal growth goal processes were examined in multiple samples of 18-30 years old youth in college settings using mixedmethods.Linkagesbetweenimplicittheoriesofchange, possible selves, role of self as an agent and growth pursuit processes were noted. Ameasure for assessment of personal growthgoalwasdeveloped.Severaldifferenceswereobserved between extreme scorers. The stages of change model had limitedutilityinthiscontext.Contemplationandactioncame upasthetwocoredimensionsofchange.Thefindingsprovide leads for developing promotive programs to support young adultsininternationalpursuitoftheirdevelopment 48. Positive mental health: Exploring salient dimensions and developing an interview-based assessment measure. Mr. Diptarup Chowdhury. Guides: Dr. Seema Mehrotra, Dr. Ahalya Raguram This is a multiphase study that aims at identifying relevant dimensionsofpositivementalhealththroughatwo-stepDelphi method, conducting in-depth interviews to understand the livedexperiencesrelatedtovariousdimensionsthusidentified, and subsequently developing and standardizing an interview schedule for assessment of positive mental health. The study is currently in its last phase of standardizing the interview schedule. 49. Motives,patterns and psychological outcomes of formal volunteering: An exploratory study.Mr. Jereesh K Elias. Guides: Dr. Seema Mehrotra, Dr. Paulomi Sudhir (Funding by ICSSR) The major objectives of this study are to explore patterns of formal volunteering, motives and other psychosocial factors associated with the same in contemporary India as well to documentexperiencesandmentalhealth/wellbeingoutcomes linked to regular formal volunteering. It uses a prospective mixedmethodsdesign.Datahavebeencollectedfrom83new/ prospectivevolunteerswhoarebeingfollowedup.Inaddition, 50. Social well-being in Indian youth. Mr. Rajeev Jospeh Michael. Guides: Dr. Seema Mehrotra, Dr. Srikala Bharath (Funding by CSIR) 51. Integrated neuro and social cognitive intervention program (INSCIP) for patients with schizophrenia: A randomized controlled study. Ms. Aarati Taksal. Guides: Dr. Paulomi M Sudhir, Dr. Keshav Kumar J, Dr. Jagadisha The study examined effectiveness of the Integrated Psychological Therapy (IPT) in improving social functioning inpatientswithschizophrenia.Sampleconsistedof29patients with schizophrenia or schizoaffective disorder. A single group design with baseline, post- follow-up assessment was adopted. The IPT was modified for cultural appropriateness and had 16-20 sessions of Cognitive Differentiation, Social Perception,Verbal Communication, and Social Skills. Psycho education was included for patients’ caregivers. RMANOVA showed significant improvement on social cognition, social skills, social functioning, symptom severity and some neurocognitive functions. Medium to large effect sizes for socialcognition,socialskills,socialfunctioningandsymptom severity. 52. Attachment, interpersonal sensitivity and affect regulation in social anxiety. Ms. Selvi Kumari R. Guides: Dr. Paulomi M Sudhir, Dr. Seema Mehrotra The study examined the role of attachment, interpersonal sensitivityandaffectregulationinsocialanxietywithasample of360communityparticipants(intwosteps)and50patients withadiagnosisofsocialphobia,usingamixedmethoddesign. Assessment of the community sample was done in two steps. Apreliminarymodelwasdevelopedandreplicatedinasecond National Institute of Mental Health and Neuro Sciences / 125 Annual Report 2013-14 sampleandsubsequentlyinaclinicalsample.Resultsindicate significant differences in community and clinical samples. Path analysis indicated that reappraisal, suppression and ruminationmediatedtherelationshipbetweenattachmentand social anxiety and interpersonal sensitivity and social anxiety inallgroups. 53. Development and feasibility of a self-management intervention in Type 2 diabetes mellitus. Ms. Anisha Mary Abraham. Guides: Dr. Paulomi M Sudhir, Dr. Ganapathi Bantwal Thestudyaimedtoexplorefeltneedsofdiabetescareproviders, patientsandsignificantothersofpatientswithdiabetesandto developadiabetesself-managementinterventionandexamine its feasibility and impact on improving self-care, metabolic control and quality of life in patients with Type 2 Diabetes Mellitus.Thirtyeightinterviewswerecarriedout,andanalyzed inStudyI.Acopingskillsintervention,focusingonaddressing self-care and emotional issues in diabetes was designed. Eightypatientshavebeenrecruitedandrandomizedtoeither intervention or treatment as usual group in Study II. Data analysisandinterpretationareinprogress. 54. Efficacy of Metacognitive therapy in patients with social anxiety disorder. Ms. Lakshmi J Guides: Dr. Paulomi M Sudhir, Dr. Mahendra P Sharma, Dr. Suresh Bada Math ThestudyaimstoexaminetheefficacyofMetacognitivetherapyin patientswithsocialphobia,usingacontrolgroupwhichwillreceive AppliedRelaxation.Thetotalsamplewillbe50patientswhowillbe assessedonmeasuresofMetacognition,socialanxiety,postevent processinganddepression.Theywillreceiveapproximately10-12 sessionsoftherapyandwillbeassessedatpre,postandfollow-up periods.Thepilotphaseofthestudyisinprogress. 55. Effectiveness of an integrated intervention program for alcoholism (IIPA): To enhance executive functions, affect regulation, and quality of life. Mr. Rajesh Kumar. Guides: Dr. Keshav Kumar J, Dr. Vivek Benegal, Dr. Roopesh BN, (Funding by ICMR) TheaimofthestudyistodevelopanIntegratedIntervention Program to enhance executive functions through cognitive remediation and affect regulation ability using Qigong and Tai-chi Chuan practice. For base line and outcome assessment behavioral scale, neuropsychological test and electrophysiologicalmeasurewereincludedinthisstudy.Tools whichrequiredtobedevelopedbytheresearcheraredeveloped and10tasksforcognitiveremediationprogramalsodeveloped by the researcher. Qigong and some moves of Tai-chi Chuan which will be used in intervention is being practice by the researcher. The pilot phase is initiated, after which the main phasewillbestarted. 56. Development of an intervention programme for socio-cognitive deficits in schizophrenia spectrum disorders. Ms. Dhanya C. Guides: Dr. Keshav Kumar, Dr. Jagadisha Thirthahalli Socio-cognitivedeficitsformaninherentcontributionofmany mental illnesses, and have been studied in autism spectrum disorders,psychosesandpersonalitydisorders.Inschizophrenia spectrumdisorders,psychotropicdrugshavebeensuccessfulin eliminating most positive symptoms. However, their efficacy inalteringsocio-cognitivedeficitsisnotproventilldate.This implies that patients who are symptom-free and stable on medications will be unable to lead functionally independent lives,due to deficits in socio-cognitive processes. The current researchaimstodevelopaholisticinterventionprogrammefor socio-cognitivedeficitsfromaneuropsychologicalperspective, andtestitsutilityinSchizophreniaSpectrumDisorders. 57. Resilience based intervention in college students. Ms. Hesi S Herbert. Guide: Dr. Manjula M The aim was to examine the correlates of resilience and the effect of resilience based intervention for college students. In phase I, 200 college students were assessed and in the phase II, 90 students received resilience-based intervention in a workshop format. Results showed that the students experienced high stress levels in academics and dealing with financial and relationships issues. Half of the students had mildlevelofdepression,stressandmoderatelevelofanxiety. Positive emotion and conscientiousness predicted resilience inpositivedirection.Interventionimprovedtheresilienceand problemsolvingandreducedthenegativeemotionatthethird monthfollow-up. 58. Emotion regulation therapy in anxiety disorders: an outcome study. Dr. Vidhya Sagar K. Guides: Dr. Manjula M, Dr. Mahendra P Sharma, Dr. Suresh BM (Funding by ICMR- JRF) The study aims to examine the efficacy of emotion regulation therapy in anxiety disorders (GAD, SAD & PD) in improving 126 / National Institute of Mental Health and Neuro Sciences Annual Report emotion regulation and reducing symptoms. In addition, mediating role of Mindful awareness and Homework complianceandroleofmoderatorssuchasanxietysensitivity andtraitanxietyinoutcomewillbeexamined.Sampleconsists of 60 participants (Intervention group 30 and Treatment as usualgroup,30)withprimarydiagnosisofoneoftheanxiety disordersincludedinthestudy.Interventiongroupwillreceive 16sessionsofemotionregulationtherapy.Bothgroupswillbe assessedatpre,postandfollow-upperiods. 59. Cognitive styles, Psychosocial and clinical determinants of functioning inpatients with bipolar disorder. Ms. Mareena Susan Wesley. Guides: Dr. M Manjula, Dr. Jagadisha T, (Funding by ICMR-JRF) The study aims to examine the cognitive styles, clinical and psychosocial determinants of functioning and subjective experiencesinpatientswithbipolardisorder.Asampleof150 patientsdiagnosedwithbipolardisorder,fulfillingtheinclusion andexclusioncriteriawillbeselectedforthequantitativestudy of which a sub-sample will be drawn for in-depth interviews using a semi-structured interview format. A cross sectional, mixedmethodexploratorydesignwillbeused.Thepilotphase ofthestudyiscompletedwith26patientsfortheexploratory study, and 2 patients have been interviewed using semistructuredinterviewforsubjectiveexperiences. 60. Efficacy of a school-based group coping skills program for adolescents. Ms. Meghna Singhal. Guides: Dr. M Manjula, Dr. K John Vijay Sagar The present study is an endeavor to provide intervention to adolescents with sub-clinical depression, in order to arrest the growth of future psychopathology. The aim is to study theefficacyofaschool-basedgroupcopingskillsprogramfor adolescentswithsub-clinicaldepression. Themainstudyhasbeencompleted:atotalof800students across five schools have been screened. The 8-weekly intervention has been carried out with students in index group(n=49)andaninteractivepsycho-educatorysession has been carried out with control group students (n=51). Post-intervention and follow-up assessments have also been carried out with all the students in the index and control groups. Currently, statistical analysis is being carriedout. 61. Brief cognitive behavior therapy in remitted bipolar disorder. Ms. Seema P Nambiar. Guides: 2013-14 Dr. M Manjula, Dr. Shyam Sundar A (Funding by ICMR-JRF) The study is being undertaken to examine the effect of brief CBT on inter-episodic symptoms, dysfunctional cognitions, adherencetotreatment,emotionalregulation,functioningand qualityoflifeinremittedbipolardisorder.Agrouprandomized control design with multiple assessments (pre, post & followup at 3 months) is planned. The sample would consist of 30 patientsintheinterventiongroupand30patientsintheTAU (treatmentasusual)conditionintheage-rangeof18-55years. Eight-10 individual sessions are being held on a weekly basis for the study group and screened using the MINI, SCID-II, YMRS&BDI-II. 62. Development and validation of an instrument for the assessment of internet use in Indian context. Mr. Thamilselvan P Guides: Dr. Manoj Kumar Sharma, Dr. Prabha S Chandra, Dr. K Thennarasu 63. Ethical beliefs and practices in psychotherapy and counselling: An exploratory study among mental health practitioners and development of a training module. Mr. Ananya Sinha. Guides: Dr. Poornima Bhola, Dr. Ahalya Raguram, Dr. Prabha S Chandra The study aims to explore the ethical beliefs and practices in psychotherapy and counselling among mental health practitioners and develop a training module on ethics in psychotherapy and counselling. A total of 265 participants, practicing Clinical Psychologists, Psychiatrists, Psychiatric Social Workers, Trainees from the three disciplines and counsellors will be administered a survey schedule on ethical beliefsandpractices.Asub-sampleof28participants,including fourfromeachgroup,willbeselectedtoconductanin-depth interview. Basedonthefindingsofthesurveyandinterview,atrainingmodule onethicsinpsychotherapyandcounselingwillbedeveloped. 64. Psychosocial aspects of children of female sex workers. Mr. Siddharth Dutt. Guides: Dr. Roopesh BN, Dr. Janardhana N Inthisstudy,theinvestigatorswillexploreattachmentpattern, resilience,risktakingbehaviour,parentingpractices,justworld belief, attitude towards education and career and perceived stigma in children of female sex workers. The child rearing practicesamongsexworkerswillalsobeexplored.Attachment National Institute of Mental Health and Neuro Sciences / 127 Annual Report 2013-14 pattern, resilience, risk taking behaviour, parenting practices andjustworldbeliefswillbecomparedwithchildrenofsingle parentsandchildrenlivingwithboththeparents. 65. Felt obligation and separation-individuation in offspring’s of individuals with severe mental disorders. Ms. Seema Nambiar. Guide: Dr. Ahalya Raguram The study compared youth with and without parental mental illness on the variables of felt obligation, separationindividuation and psychological distress, using a mixedmethods design. There was no significant difference in the process of separation-individuation or level of psychological distress between the two groups. Themes of felt obligation included perceived difficulties in spending time with parents andsatisfactionwiththesame. 66. Individuation in youth: The parental perspective. Mr. Shiju Joseph. Guides: Dr. Ahalya Raguram The study aimed to understand the perspective of parents of youth regarding their children’s process of individuation, using qualitative methodology. Analysis of themes revealed that over-conforming youth and vigilant parents formed a symbiotic pair which was based on the knowledgeoftheyouth’slife.Parentspreferredtheiryouth todevelop‘maturity’thatismarkedbyvalueorientation, obedience, connectedness and behavioral independence rather than individuation. Separateness, emotional autonomyorvalueautonomywerenotencouraged.These findingssuggestthatunfoldingofpsychologicalprocesses like individuation is highly influenced by culture. This also implies that achievement of separation would be a challengeforyouth. 67. Exploring attachment relations: Child’s perspective. Ms. Divya V Salian. Guide: Dr. Uma Hirisave The aim of the study was to explore child’s perspective of attachmentrelationsusingdifferenttypesofpsychologicaltests. Asampleof30childrenintheagegroup6-8yearswasincluded. Parental perception of child’s attachment was assessed by an interview schedule. The results indicated that a majority of childrenexpressedsecureattachmentwiththeirparentsacross tests. The children expressed more positive feelings towards their mothers and this finding was corroborated by parental reports. 68. Exploring quality of life in children and adolescents with epilepsy: A qualitative study. Ms. Mallika Batra. Guides: Dr. Uma Hirisave, Dr. Sanjib Sinha, Dr. PS Bindu Theaimofthestudywastoexplorethequalityoflifeinchildren and adolescents with epilepsy. The perspective of parents wasalsolookedinto.Twentychildrenaged9to16yearswith a diagnosis of epilepsy and their parents were interviewed. Thematic analysis was used to arrive at prominent themes. Theresultsindicatedifficultiesindomainsofphysical,social, emotional,behavioral,cognitiveandacademics.Thequalityof lifewasfoundtobepoorastheyhadexcessivetiredness,lack ofautonomy,sadness,angerandacademicunderachievement. Theirknowledgeofepilepsywasfoundtobeverylimited. 69. A qualitative study of communication in couple therapy. Ms. Vaisnvy NM. Guide: Dr. Anisha Shah A qualitative study of communication in couple therapy was completed. It was designed to explore the process of communication with couples in a clinical setting. Thematic analysis using a priori codes for communication was used for 34 conjoint couple session records. Results showed that communication issues were a common presenting problem, gender differences are present in communication issues in couple therapy, and poor engagement between couples and poordifferentiationfromfamiliesoforiginwereevidentinthe couples. 70. Marital satisfaction in couples. Mr. Subhash Chandra Singh. Guide: Dr. Anisha Shah A study on marital satisfaction in couples is ongoing. The aim of the study is to examine trait expressiveness, partner responsiveness, need satisfaction and marital satisfaction in married persons. Forty married persons including 12 couples comprisedthestudysample.PersonalAttributeQuestionnaire, Partner Responsiveness Scale, Basic Needs Satisfaction in RelationshipsScale,RelationshipAssessmentScale,andScale ofPositiveandNegativeExperiencewereadministeredtothe participants.Pearson’sProductMomentCorrelation,t-testand Mann-Whitney Test showed significant correlations among the study variables, no gender differences but significant differences on study variables when comparisons were made onthebasisofageandmaritalduration. 71. 128 / National Institute of Mental Health and Neuro Sciences Eating disorder, body image concerns and selfesteem among college students: A survey. Ms. Annual Report Rinsha EK. Guides: Dr. Mahendra P Sharma, Dr. Prabha S Chandra The study aimed at exploring eating disorder, body image concerns and self-esteem among 299 college students. The resultsrevealedthateatingdisordersymptomsandbodyimage concernswerepresentinIndiancollegestudents.OnEAT-26, 13%scoredabovecutoffandonBITE,27%werefoundtohave disordered eating pattern and 1% was found to have highly disordered eating pattern. Disordered eating and body image concernswerepositivelycorrelated.Disorderedeatingandbody image concerns were negatively correlated with self-esteem. Therewerenosignificantdifferencefoundbetweenmalesand females on disordered eating symptoms, body image concern andself-esteembutsymptomseveritywasmoreinmalesthan infemales.Weightreductionattemptswerereportedby31%of students. 72. Beliefs, psychological impact and quality of life in men with sexual dysfunction. Mr. Sujith Babu. Guides: Dr. Mahendra P Sharma, Dr. Nagaraja Rao The aim of the present investigation was to study the beliefs, psychological impact and quality of life in men with sexual dysfunction. The sample consisted of 25 men with sexual dysfunctionand25normalcontrols.Theresultsrevealedthat men with sexual dysfunction have negative stereotypes about sexuality,poorersexualknowledgeandmoreconservativesexual attitudes in comparison to normal controls. Men with sexual dysfunctionexperiencehigherlevels ofanxietyanddepression, andsexualdysfunctionhavenegativepsychologicalimpactand adverselyaffectqualityoflife.Someofthestereotypedbeliefs werenegativelycorrelatedwithsomedomainsofqualityoflife. 73. Stress and coping among family members of men with substance dependence. Ms. Shynimol KB. Guides: Dr. LN Suman, Dr. Prabath K Chand Theaimofthepresentstudywastoexaminestressanddistress amongfamilymembersofmenwithsubstancedependence.The sampleconsistedof60familymembers:30familymembersof maledrugdependentsand30familymembersofmalealcohol dependents.ThefamilymemberswereadministeredtheCoping Questionnaire,FamilyMemberImpactQuestionnaire,Symptom RatingTestandtheHopefulness-HopelessnessQuestionnaire. Findings indicated that the family members of both groups wereequallystressedandexperiencedsignificantdistressdue tothepatients’dependenceonsubstances.Thesefactorshave tobeaddressedwhileplanningfamilyfocusedinterventions. 74. 2013-14 Smoking motives, perceived consequences and motivation to quit among men with common mental disorders. Ms. Arathy VS. Guide: Dr. LN Suman Theaimofthestudyistoexaminesmokingmotives,perceived consequencesandmotivationtoquitamongmenwithcommon mentaldisorders.Thesamplewillconsistoftwogroups.GroupI willconsistof30malesmokerswithcommonmentaldisorders andGroupIIwillconsistof30malesmokerswithoutcommon mental disorders. Data will be obtained from K6 Screening scale, Fagerstrom Test for Nicotine Dependence, Wisconsin Inventory of Smoking Dependence Motives, Smoking Effects Questionnaire, Knowledge of Health Effects and Stages-ofChangeQuestionnaire. 75. Stress, wellbeing and self-care practices in mental health trainees. Ms. Lyn G. Guides: Dr. Seema Mehrotra, Dr. Thirumurthy Stress,self-care,andwellbeingin58mentalhealthtraineesin ClinicalPsychologyandPsychiatricSocialworkwereexplored throughatwo-pointsurveyspacedthreemonthsapart.Average levelsofperceivedstressandnegativeeffectswerehigher,while positive effects, life satisfaction and psychological wellbeing were lower than in other Indian youth studies. There was significant decline in psychological wellbeing over the study period.Lowengagementinself-caredomainswasobservedin asignificantproportionofthesample,self-careatTime1was significantlycorrelatedwithallthewellbeingindicesatTime2. 76. Interactions with mental health service providers: Caregiver perspectives. Mr. Dinakaran P. Guides: Dr. Seema Mehrotra, Dr. Srikala Bharath The study explored the importance of various interactional aspectsofmentalhealthcareduringpsychiatrichospitalization from the perspectives of 50 family caregivers between 1879 years of age range. Six domains of interactional aspects of care were identified: Dignity, confidentiality and fairness, informational inputs, addressing of concerns raised, prompt attention and consistent care, autonomy and collaboration, and demonstration of general support. Significant differences emergedontheperceivedimportanceofthefirstfourdomains ofcarebetweensubgroupsofcaregiversbasedoneducational level,socioeconomicstatus,thepatients’hospitalizationhistory andbroaddiagnosticgroups. 77. Perfectionism, rumination and negative affect in patients with social phobia. Ms. Rukmini S. National Institute of Mental Health and Neuro Sciences / 129 Annual Report 2013-14 Guides: Dr. Paulomi M Sudhir, Dr. Suresh Bada Math resultssuggestthepresenceofaspecificcognitiveprofileand itsrelationtoreductionofqualityoflife. The study examined the relationship between perfectionism, rumination, emotion regulation strategies of positive reappraisalandacceptanceandnegativeaffectinpatientswith socialphobia.Sampleincluded30patientswithsocialphobia and 30 community participants. Results showed the patients with social phobia had elevated levels of perfectionism and rumination, both reflection and brooding and had lesser use of positive reappraisal strategy than a community sample. Rumination was associated with maladaptive perfectionism and overall perfectionism. Personal standards and parental expectations were positively correlated with positive reappraisal. Parental criticism was a significant predictor of socialphobiaandbroodingsignificantlypredicteddepression. 80. Neuropsychological, social and emotional correlates of traumatic brain injury. Ms. Fasli Sidheek. Guides: Dr. Keshav Kumar J, Dr. Jagath Lal 78. Perfectionism, procrastination, coping and psychological outcomes. Ms. Athulya Jayakumar. Guide: Dr. Paulomi M Sudhir The study aimed at examining neuropsychological, social cognitive and emotional correlates of people with Traumatic Brain Injury (TBI) and their association with impulsivity. The sample consisted of 20 patients. The results showed that patients with TBI had significant deficits in social cognition along with neurocognitive deficits, second order theory of mind, identifying faux pas and social perception. On tasks of emotion perception, deficits were not prominent though they haddifficulties.Theimplicationsandstrengthsofthestudyas wellaslimitationshavebeendiscussed,withrespecttofindings andrelevantliterature. 81. The study examined perfectionism, procrastination, coping styles, psychological outcomes of self-esteem, mood in young adults.Sampleconsistedof192collegestudents,between1826years.Procrastinationandpsychologicaldistresswerehigh in the sample. Female participants reported higher parental expectations and avoidant coping than males. There was a significant negative relationship between procrastination and the adaptive perfectionism dimension. Adaptive dimensions of perfectionism were associated with lower distress as compared to maladaptive dimension. Higher procrastination was associated with lower experience of self-esteem, greater depression, anxiety and stress. Maladaptive perfectionism predictedgreaterdistress,andadaptiveperfectionismpredicted higherself-esteem. 79. Neuropsychological profile in patients with juvenile myoclonic epilepsy. Mr. Mohd. Afsar. Guides: Dr. Keshav Kumar J, Dr. Sanjib Sinha Thestudyaimedatexaminingtheneuropsychologicalprofile, andqualityoflifeinpatientswithJME(n=20)andgender,age, education,matchedhealthycontrolsintheage16to45years. The results revealed that JME patients have impairment in attention, visual search, mental flexibility, word reading and visual memory compared to controls. There was significant correlation between attention, visual working memory and verbal memory and quality of life. There was negative correlationbetweenimpulsivityandoverallqualityoflife.The Emotion regulation, attachment styles and psychological problems among college students. Ms. Lavanya TP. Guide: Dr. M Manjula The aim was to examine emotion regulation, attachment styles and psychological problems among college students. Thesampleconsistedof419students,studyingpre-university and graduation respectively. The results indicated that, predominantlypositiveemotionregulationstrategies(refocus onplanningandpositivereappraisal)wereused;especiallyby studentsinpre-universitygroup.Majorityofthestudentshad secure and avoidant attachment styles. Affective/depressive and conduct problems were reported more by the students. Students in undergraduate group had comparatively more psychological problems. Significant correlations between emotion regulation, attachment styles and psychological problemswerefound.Femaleshadmoreofanxietyproblems andmaleshadconduct/antisocialproblems. 82. Sexual attitude, knowledge, behaviour and sources of influence in youth. Mr. Siddarth Dutt. Guides: Dr. M Manjula The aim of this study was to explore sexual knowledge, attitude,behaviourandthesourcesofinfluenceinyouth.The studywasdoneintwophases.Inthefirstphase,thescalefor assessing sexual behaviours, and Sources of Influence (SBSI) wasdeveloped.Inthesecondphase,theSexualKnowledgeand Attitude Questionnaire were used to assess sexual knowledge 130 / National Institute of Mental Health and Neuro Sciences Annual Report and attitude. The questionnaires were administered to 300 collegestudents.Theresultsshowedtheyouthhadpoorsexual knowledge—there was a positive relationship between sexual knowledgeandattitude.Internetwasfoundtobethemajorand reliablesourceforgatheringinformation. 83. Self-injurious behaviours, attachment styles and emotion regulation among college students. Ms. Naphisabet Kharsati. Guide: Dr. Poornima Bhola Thestudyexaminedself-injuriousbehaviours(SIB)among470 undergraduateandpost-graduatecollegestudentsandexplored associations between SIB, attachment styles and emotion regulation.Resultsindicatedthat31.2%reportedSIB(pastyear), with19.4%engaginginmoresevereformsofSIB.Meanageof onset was 15.86 years, with more males engaging in SIB. The majority did not report any suicidal intent, engaged in the act impulsivelyandfeltlittleaccompanyingpain.SIBservedtoalter emotionalstates,influenceothersorescapefrominterpersonal demands. Higher levels of anxious attachment and emotion regulationdifficultieswerereportedbyyouthengaginginSIB. 84. Autobiographical memory narratives of clients with borderline personality disorder in psychotherapy. Ms. Deepti Guruprasad, Guide: Dr. Poornima Bhola A mixed-method case study design explored autobiographical memory narratives in individual psychotherapy of five clients with borderline personality disorder. Questionnaires assessed working alliance, emotion regulation and attachment styles. Session transcripts of the biopsychosocial interview and five therapysessionswerecodedandqualitativelyanalysed.Results indicated emotion regulation difficulties,varied insecure attachmentstylesandindividualpatternsofclientandtherapist ratedalliance.Narrativeshadmoderatelevelofcomplexity,were predominantly autobiographical, with low specificity, largely non-integrated and reflecting themes of contamination (with relativelylowerthemesofagency,communionandredemption). Affective scripts revealed early traumatic experiences contributingtonegativeeffectandinterpersonaldistress. 85. Social cognition and attachment among individuals with emotionally unstable personality disorder. Ms. Anupama V. Guides: Dr. Poornima Bhola, Dr. Jagadisha Thirthalli Thestudyaimedatexaminingattachment,mentalizationand social cognition, in individuals diagnosed with Emotionally 2013-14 Unstable Personality Disorder (EUPD). The study was conducted on the clinical group (N=20) and control group (N=20)aged18-50years.ThetoolsincludedAttachmentStyle Questionnaire,MentalizationQuestionnaire,ReadingtheMind in the Eyes Test, and Social Cognition Rating Tool in Indian Setting (SOCRATIS). The results indicated that individuals diagnosedwithEUPDhadsignificantlyhigherscoresonanxious attachment,preoccupiedattachment,lowermentalizingability, lowerfacialemotionrecognitionabilityandselectdomainsof socialcognition. 86. Marital relationship, distress and resilience in women with primary infertility. Ms. Sisira C. Guide: Dr. Veena Satyanarayana Thepresentstudyexploredthequalityofmaritalrelationship, psychological distress and resilience among women with primaryinfertility.Thesamplecomprisedof30adultwomen diagnosed with primary infertility- female factor by the consultant gynecologist at a renowned infertility hospital in Bangalore. The study was cross-sectional in nature and employed a single group mixed methods design. Findings indicated that women who experienced violence were more likely to report lower quality of marital relationship, higher levels of distress, and lower resilience. Experience of at least one form of violence emerged as a significant predictor of distressexplaining36%oftotalvariance. 87. Evaluation of musical rhythm discrimination ability in patients with Parkinson’s disease. Ms. Amrita Biswas. Guides: Dr. Shantala Hegde, Dr. Pramod Kumar Pal The present study assessed musical rhythm discrimination abilityinpatientswithParkinson’sdisease(PD)andexamined therelationshipbetweenneurocognitivefunctionsandmusical rhythm discrimination ability. The sample consisted of PD group(n=21)andage,genderandeducationmatchedhealthy volunteers (HC) (n=21). The patients and participants were assessed with a set of neurocognitive measures to examine working memory, attention and immediate memory. The musical rhythm discrimination ability was assessed by using seashore rhythm test, auditory rhythm test, beat alignment test,andtwosub-testsoftheMontrealbatteryofevaluationof amusia(MBEA)—rhythmiccontourandmetrictest.Thestudy wascarriedoutinasound-treatedroomandtherhythmtests were presented via windows media player using 2.1 speakers. TheresultsshowedsignificantdifferencebetweenPDandthe HCgroupsonalltheneurocognitive(p<0.001)andmusical National Institute of Mental Health and Neuro Sciences / 131 Annual Report 2013-14 rhythm measures (p < 0.001). There was significant positive correlation between neurocognitive measures and musical rhythmperception(p<0.001).Thepresentstudyisthefirstof its kind examining various dimensions of rhythm perception including stimuli that were musically based and not just metronomebased.Thefindingsthrownewlightonimpairment intemporalprocessingatdifferentlevelsinPDandindicatethe stronginter-connectionbetweenprefrontalareasandthebasal gangliainthiscognitiveprocess,worthexaminingusingother methodsinfutureresearch. The aim of the study is to examine defensive pessimism, perceivedstress,copingandpsychologicalfunctioninginyouth, relationshipamongthesevariablesaswellasgenderdifferences indefensivepessimism.Thesamplewillcomprise300students pursuing their graduation studies from Bangalore, in the age range of 18-24 years. The tools used for the study are sociodemographic data sheet, defensive pessimism questionnaire, proactivecopinginventory,Rosenbergself-esteemscale,youth self-reportandperceivedstressscale. 91. 88. Just world belief and executive functioning in children with conduct disorder. Ms. Prateeksha S. Guides: Dr. Roopesh BN, Dr. John Vijayasagar Prosocial behavior and executive functions in children and adolescents with conduct disorder. Ms. Lalhmingmawii. Guides: Dr. Roopesh BN, Dr. John Vijayasagar The aim of the study was to examine Just World Belief in children with conduct disorder in comparison with Typically Developing Children. Each group comprised of 13 children, aged11-15years.TheywereadministeredtheJustWorldBelief Scale(JWBS)andExecutiveFunctions(EF)tests.Theresults revealed that both the groups significantly differed in their BeliefaboutUnjustWorldforOthers.InEF,significantgroup differenceswerenotedinallthecomponentsofStroopWord– time,suchasNeutralWord–time,EmotionalWord–time,and MoralWord–time.Analysisofresponsesonthecasevignettes revealedthattheCDgroupplacedresponsibilityontheperson and not on the victim and opted for retribution rather than compensationofthe victim. The aim of the study is to examine Prosocial Behavior in children with Conduct Disorder in comparison with Typically DevelopingChildren.Thesamplewillconsistoftwogroups— children with Conduct Disorder and Typically Developing Children. Each group will comprise 15 children, aged 8-16 years.ThesechildrenwillbeassessedintermsoftheirProsocial Behavior and Executive Functions. They will be administered theProsocialBehaviorScale(PSBS),whichwasdevelopedfor thepurposeofthestudy,CaseVignettesforassessingProsocial Behavior,ExecutiveFunctionstestslikeWisconsinTypeCard Sorting Test (WCST), Tower of London (TOL), Corsi Block SpanTest,WordStroopTest,PictureStroopTest,StopSignal Test,VerbalFluencyTestandDigitSpanTest. 89. Insight and decision making in children with conduct disorder. Ms. Anjali S. Guides: Dr. Roopesh BN, Dr. John Vijayasagar 92. Assessment of value of life and executive functions in children with conduct disorder. Ms. Meghana V. Guides: Dr. Roopesh BN, Dr. John Vijayasagar The present study explored the relationship between insight and decision making in children with conduct disorder. Sample consisted of two groups of 12 children with conduct disorder and 12 matched typically developing children. Children with conduct disorder were administered Insight Scale and Conduct Disorder Rating Scale. Both the groups wereadministeredRealGamblingTask,SamplingShiftTask, DelayDiscountingTask,RPMwereadministered.Theresults showedthat,comparedtotheTypicallyDevelopingChildren, CD children showed deficits in delaying their gratification, made impulsive choices without exploring the options and ignored the feedback. There was no significant relationship betweeninsightanddecisionmaking. TheaimofthestudyistoexaminetheValueofLifeandexecutive functionsinchildrenwithconductdisorder,incomparisonwith typically developing children. The sample would comprise two groups,15ineach;onegroupconsistingofchildrenwithconduct disordersandanotherconsistingofTypicallyDevelopingChildren. ThechildrenwillbeassessedonValueofLifeparameters,CPM, DBRS, SDQ, Delay Discounting Task, Modified Information Samplingtask,DigitSpanandPictureStroopTest. 90. Defensive pessimism, coping and psychological functioning in youth. Ms. Asha Ravi. Guide: Dr. M Manjula 93. Effectiveness of neurofeedback training: clinical, cognitive, electrophysiological and neurochemical measures in alcohol dependence syndrome. Ms. Reji Mohan. Guides: Dr. Jamuna R, Dr. Nandakumar DN, Dr. Pratima Murthy Addiction is a primary, chronic disease of brain reward, motivation,memoryandrelatedcircuitry.Dysfunctioninthese 132 / National Institute of Mental Health and Neuro Sciences Annual Report circuits leads to characteristic biological, psychological, social and spiritual manifestations. This is reflected in the individual pursuingreliefbysubstanceuse.Theaddictioncaninvolvecycles ofrelapseandremission.Withouttreatmentorengagementin recovery activities, addiction is progressive and can result in disabilityorprematuredeath.Thisstudywasaimedattheeffect ofEEGNeurofeedbacktrainingonclinical,electrophysiological andneurochemicalparametersinalcoholdependence. This is a representative statewide survey to generalize health problemsamongtheyouth(10-24years)inHimachalPradesh. Thesurveyisongoing,and1600interviewswerecompletedout ofthe2500required,ason31stMarch2014. 4. Epidemiology 1. Monitoring and evaluation of road safety–10 India project. Investigator: Dr. Gururaj G (Funding by Johns Hopkins University, USA) Withroadtrafficinjuriesbecomingaleadinghealthproblemin India, World Health Organization and the Ministry of Health andFamilyWelfareinitiatedtheRoadSafetyProjectintheState of Andhra Pradesh at Hyderabad and Vizag during 2011. The projectaimsatimplementinganintegratedprogrammewitha focusontworiskfactors,namelyhelmetuseanddrinkingand driving. The Department provides monitoring and evaluation technical support for data collection undertaken by IIPH – Hyderabad through road side surveys, road side interviews, secondary data, focused group discussions with key stake holdersandin-depthinterviews.Fourroundsofdatacollection havebeencompleted. 2. Development of population based rural stroke registry in India. Investigator: Dr. Gururaj G (Funding by ICMR, New Delhi) Good quality epidemiological data forms the backbone for developing preventive, promotive, curative and rehabilitation servicesforpatientswithstroke.Intheabovementionedproject, a rural population based stroke registry has been developed in collaboration with Community Medicine Department of MSRamaiahMedicalInstitutioninChintamanitalukandthe feasibilitystudyhasbeencompleted.Theresultsindicatethat it is possible to establish stroke registry in rural areas using existing health care functionaries in defined populations. The Stoke registry aims at understanding prevalence, incidence, mortality, disability, and risk factors of stroke in a taluk populationandthevalidationstudyarecurrentlyinprogress. 3. Adolescent and youth health survey at Himachal Pradesh. Investigators: Dr. G Gururaj, Dr. Pradeep BS (Funding by National Rural Health Mission – Himachal Pradesh) 2013-14 The burden attributable to headache disorders in the general population of India Phase I: A community based survey in Karnataka State. Investigators: Dr. Gururaj, Dr. Girish N, Dr. Girish B Kulkarni, Dr. Kavita R, Dr. Subbakrishna DK (Funding by Global Campaign) Headachedisordersconstituteamajorgroupinthespectrum ofNeurologicaldisorders.Theabovecommunity-basedproject aims to estimate the prevalence of various types of headache and health seeking behaviors, and compare the quality of life amongstthosewithheadacheandwithoutheadache,inurban andruralareasofKarnataka.Atotalof2329individualswere interviewed. The period and point prevalence was 63.9% and 10%, respectively, with greater burden in rural areas (71.2% and 57.3% respectively). The methodology paper has been completedandhasbeenpublishedintheJournalofHeadache andPain. 5. National mental health survey, Kolar pilot study. Investigator: Dr. Gururaj G, (Funding by MH&FW) Mental, neurological and substance use disorders (MNS) are increasinginIndia.ThenumberofIndiansaffectedwithMNS disorders is not clearly known and the available estimates are basedondatathatismorethantwodecadesold.Thenational survey proposes to estimate true burden of mental health problemsinarepresentativepopulationandprovideaframework forevaluatingtheimpactofDMHP.Theobjectivesofthepilot study in Kolar district are to understand the feasibility of the samplingdesignadoptedfortheNationalMentalHealthSurvey, identify challenges and operational feasibility of the proposed study methodology including the use of MINI instrument. It wouldprovideestimatesofprevalenceofdifferentmentalhealth problemsinthedistrictofKolarandalsoregardingfeasibilityof usingahandhelddevicefordatacollection. 6. Analysis of highway crashes and determinants in Kolar district. Investigator: Dr. G Gururaj (Funding by Road Traffic Injury Network (RTIN) Highway road crashes contribute for 40% road deaths and injuries in India.Traumatic brain Injury in the crashes is the commonest type of injury. However, the burden, pattern and National Institute of Mental Health and Neuro Sciences / 133 Annual Report 2013-14 characteristicsofroadcrashesonNationalandStatehighways arenotknownduetolackofresearch.WithsupportfromRoad Traffic Injury Research Network, the present project aims at delineatingriskfactorsamonghighwaycrashes. 7. The burden attributable to headache disorders in the general population of India Phase 2: Cochrane systematic reviews. Investigators: Dr. Girish N, Dr. Girish B Kulkarni, Dr. Gururaj G, Dr. Thennarasu K (Funding by Lifting the Burden) Tension Type Headache (TTH) is a common but neglected problem. Despite the huge burden, the WHO Essential drug listdoesnotcontainthetreatmentguidelinesformanagement of TTH. Hence, two Cochrane systematic reviews are being undertaken: Paracetamol (acetaminophen) for acute episodic tension-typeheadacheinadultsandAspirinforacuteepisodic tension-typeheadacheinadults.Protocolshavebeenpublished intheCochranelibraryandstudyisunderprogress. 8. Developing and implementing an integrated mental health promotion services for youth through a district empowerment model in Karnataka – Youth policy 2012 initiative. Investigators: Dr. G Gururaj, Dr. Pradeep BS, Dr. Seema Mehrotra (Funding by Department of Youth Empowerment and Sports) costs. To obtain a pan-India perspective, qualitative studies have been undertaken in Mangalore and Bellary in Karnataka, Puducherry, Thiruvananthapuram, Uttarakhand, Shimla and Ludhiana. The final study report has been submitted to the GovernmentofIndia.Datasetsarebeingeditedandcleaned. 10. Iodine deficiency disorders–resurvey in Kolar. Investigator: Dr. Girish N (Funding by IDD Cell, Govt. of Karnataka) Iodine Deficiency Disorders (IDD) is a preventable cause of Intelligent Deficiency and is considered a public health problem.UnderthenationalprogrammeforIDD,UniversalSalt IodizationhasbeenthevehicleforcontrolofIDDcoupledwith periodic monitoring of Goitre rates among schoolchildren— measuringmeanUrinaryIodineIntakeandestimatinglevelof Iodine in household salt samples have been undertaken. The Centre for Public Health undertook the resurvey in Kolar. A totalof4500childrenwereexaminedforGoitrefromrandomly selectedschoolsacrossKolardistrictusingthemodifiedcluster samplingtechnique.Inaddition,nearly1000saltsamplesand 325 urine samples were collected for analysis. Currently, the saltsampleanalysisisbeingdone. This project aims to develop a comprehensive mental health promotionservices(includingcounseling)foryouthandtheir parents in the state of Karnataka and implement the same in theproposedYouthEmpowermentCentersindifferentdistricts ofthestate.Thisprojectwillinitiallybedonein10districtsin Karnataka with Kolar and Chikkaballapur districts being the demonstrationdistrictsforthiswholeproject. 9. Patterns and consequences of alcohol misuse in India – A 5 region study. Investigators: Dr. Vivek Benegal, Dr. Girish N, Dr. Gurruaj G, Dr. Pratima Murthy, Dr. Prabhat Chand (Funding by WHO India Country Office) Children with Goitre (top). Children being examined in the school (bottom) 11. Alcohol use is common across India. Prevalence estimates indicate a huge burden: nearly one-third of adult males and about5%ofadultfemalesconsumealcohol.A5-centrestudyis currentlybeingimplementedin5regions(Dhule-Maharashtra, Vishakpatnam-AndhraPradesh,Surat-Gujarat,Cuttack-Odisha and Sikkim) where information pertaining to alcohol use is scarce.Thekeyobjectivesofthestudyaretostudytheprevalence andpatternsofalcoholuseandestimatetheindividualandsocial Household burden of severe psychiatric conditions a study from India, a developing country. Investigators: Dr. Srikala Bharath Dr. Girish N (Funding by Sanofi Venties) Amajorconsequenceoftheepidemiologicalanddemographic transitionis the increased need forhealth care of the elderly. The Dementia India Report 2012 estimated that the average costsofcareformanagingapersonwithdementiainIndiais 134 / National Institute of Mental Health and Neuro Sciences Annual Report about INR 43,000. However, this cost is unrealistic keeping in mind the burden of the disease and need for care. Hence, the study, household burden of severe psychiatric conditions including schizophrenia, depression, dementia and bi-polar disorderisbeingundertaken. Datacollectionanddataanalysis hasbeencompletedandreportisunderdevelopment. 12. Patient satisfaction survey at NIMHANS. Investigators: Dr. Girish N, Dr. Gururaj G, Dr. Sateesh V 13. Assessment of perceived needs and barriers for care among patients with Stroke and unipolar depression. Investigators: Dr. Gautham MS, Dr. Girish B Kulkarni, Dr. Santosh Loganathan, Dr. Gururaj G (Funding by NIMHANS) Evidence regarding type of perceived needs and barriers experienced by patients with stroke and depression will be usefultobridgetreatmentgap,improvediseaseoutcomesand enhancequalityoflife.Hence,ahospitalbasedcrosssectional studywithacommunity-tracingsubcomponent,isconducted to assess the perceived needs and barriers for care among a convenientsampleofpatientswithstrokeanddepression.The studywillhelpinneedbasedre-organizationofservicedelivery andshortentreatmentgap. 14. Community follow-up study of Parkinsonism patients seen at NIMHANS. Investigators: Dr. Vivek Gupta, Dr. G Gururaj, Dr. Pramod Pal, Dr. Ravi Yadav (Funding by NIMHANS Intramural Grant) Parkinsonism is among major causes of disability especially in thegeriatricagegroup.WhiletheepidemiologyofParkinsonism in India has been studied in terms of its prevalence and risk factors,literatureonhealthseekingpatternsofpatients,disease progressionandmortalityamongpatientsandtheburdenamong caregivers of patients is unfortunately lacking. Accordingly, a follow-upstudyofpatientswithParkinsonismseenatNIMHANS OPDisbeingconductedadoptingacommunity-basedlongitudinal follow-up design, to study the patterns and motivations for health seeking among these patients. Simultaneously the survivalpatternsandcaregiverburdenwillbeanalyzed.Results ofthestudywouldenableinformedprogrammaticdecisionsfor managingthesedisordersbetterbyprovidingdataonneedsofnot onlythepatientsbutalsotheircaregivers. 15. Stigma experience and related barriers of helpseeking in psychosis, depressive disorders 2013-14 and alcohol use disorders: A hospital based exploratory study. Investigators: Dr. Senthil Amudhan R, Dr. Girish N, Dr. Santosh Loganathan, Dr. Arun K (Funding by NIMHANS) Stigma associated with mental illness acts as a significant barrier to access mental health care. In India, the research relatedtomentalhealthstigmaisverylimited.Thisstudyaims to generate evidence on stigma and related barriers of help seekingamongschizophrenia,depressivedisordersandalcohol use disorders in a sample of patients and their care givers attendingtheOPDservicesofNIMHANS,throughquantitative and qualitative approach. The study will provide evidence for strengthening the public health approach in overcoming the stigma and related barriers to improve the mental health servicesutilization. 16. Pilot study on youth mental health behavior survey in Bangalore: Phase 1-Development of methodology and questionnaire validation. Investigators: Dr. Sunitha Singh, Dr. Gururaj G (NIMHANS Intramural funding) The project is initiated with an objective to develop and validate appropriate and culture specific study instrument(s) tounderstandandquantifymentalhealthbehaviorsincluding substance use disorders and injuries among youth aged 16 to 30 years in Bangalore adopting quantitative and qualitative research methodologies on a sample of 1900 youths from educational institutions, workplaces and slums coming under BBMPwards.Theoutcomesofthestudyincludevalidationof studyinstrumentandgeneratingevidenceonperceptionsand patternsofmentaldisordersincludingsubstanceusedisorders andinjuriesamongyouthandstakeholders. 17. Impact of a school based health education program for epilepsy awareness among teachers and school children. Investigator: Dr. Meena KS, Dr. Vivek Gupta (Funding by NIMHANS) Epilepsy is one of the most common neurological disorders thataffectapproximately70millionpeopleworldwide,affects childrentoagreatextent.Schoolteachersusuallydonothave any formal instructions on epilepsy during their training. An operational feasibility health education program is being carried out for educating the teachers and schoolchildren, whichwouldalsoassessthetrainingoftrainers’methodologyin School-basedhealtheducationprogramonepilepsyawareness forteachersandstudents. National Institute of Mental Health and Neuro Sciences / 135 Annual Report 2013-14 Human Genetics 1. Expression and regulation of p16 and Bmi1 genes in human glioma progression. Investigators: Dr. Chetan GK, Dr. Dhananjaya I Bhat (Funding by SERB, DST) Glioma,abroadcategoryofbraintumorsthatcomefromglial cells,arethemostcommonprimarymalignantneoplasmsofthe centralnervoussystem.Somanymutationsoccurfrequentlyin genesthatcontrolcellcycleandproliferationleadingtotumor progression. The understanding of the role of bmi1 and p16 tumorsuppressorgeneindiagnosisofglioma,especiallyatthe transcriptionallevelisininfantstage.Genealterationstudies of both genes will be helpful for diagnostic and therapeutic purposes.Mainalterationsinp16geneincludemutationsand transcriptional regulations and deletions in one of the exons. Aberrantmethylationofp16ingeneinserumcanbeanearly diagnostic tool in glioma. Analysis of p16 SNPs in Indian population may help to develop personalized medicine. Bmi1 geneamplificationandtranscriptionalandposttranscriptional modification will be useful in prognosis of glioma. In this project,weareconsideringthecorrelationofalterationsinboth geneswiththeclinicaldata.Sothesegenescanbeconsideredas goodprognosticanddiagnosticmarkersingliomaespeciallyin theIndianpopulation. 2. Genetic and expression studies of HLA-G and cytokines to evaluate the immune-mediated risk of schizophrenia. Investigators: Dr. Monojit Debnath, Dr. Ganesan Venkatasubramanian (Funding by NIMHANS) Multiple lines of evidence have implicated dysregulated immune processes in the pathogenesis of schizophrenia. HLA-G plays a pivotal role in the outcomes of pregnancy. AlteredexpressionofHLA-Gduetoenvironmentalandgenetic variations lead to pregnancy complications, some of which confer risk for schizophrenia. The 14bp insertion/deletion (INDEL)polymorphismlocatedwithinthe3´UTRregionofthe HLA-GlocusinChr.6p21.3isassociatedwithHLA-Gexpression and function. Analysis of the role of 14bp polymorphism(151 patients and 113 healthy controls) and the impact of fetomaternal compatibility/incompatibility (64 mother-patient duos)atthislocusontheriskofschizophreniawasstudied.In addition,theeffectof14bpINDELonbrainstructurealterations inschizophreniapatients(76patientsand108healthycontrols) was also investigated. A significant increase of heterozygous (+14bp/-14bp) genotype was observed in the female patients (p≤0.05). Interestingly, mother and the female patients also sharedincreased+14bp/-14bpcompatibility.Imaginganalysis indicatedthatpatientsexhibiting+14bp/-14bpgenotypeshad significantly deficient volume in the right hippocampus and rightparahippocampalgyrus. This study demonstrates a possible role of HLA-G in the pathogeneticpathwayofschizophrenia.Takentogether,these findingssuggest HLA-Gcould be animportant biomarkerfor schizophrenia. 3. The Immuno-psychiatry in South India study (IPS)-Immunogenetic and immunophenotype characterization of major psychoses. Investigators: Prof. Vir Singh Negi, JIPMER, Prof. MA Vijayalakshmi, VIT, Dr. Monojit Debnath (Funding by Indo-French Centre for the Promotion of Advanced Research) The main objective of this study would be to characterize the nature and extent of dysimmunity associated with schizophrenia and bipolar disorders in two geographically distinct population groups (French Caucasians and South Indians)encounteringdistinctenvironmentalfactors.Thiswill provide insights into the genetic and biological heterogeneity of these disorders within and across the studied populationgroups, immunogenetic basis of associated auto-immunity, andenvironmentalinfluencesonhumanHumanEndogenous Retroviruses-Wfamilyinestablishingthediseaseandrelapsing episodes. 4. Analysis of RB1 and p53 gene products in human brain/nervous system tumors. Investigator: Dr. R Gope Thisstudyisaimedtoexploretheeffectofsmallmoleculesonthe modulationofthelevelandpost-translationalmodification(s) of RB1 and p53 gene products in human intracranial tumors invitro.Thehumanintracranialtumorsampleswereexposed to small molecules and their effects were analysed on tumor cellsurvival/celldeathinvitro.Thepreliminarydataindicates that the small molecules modulate the post-translational modificationssuchasphosphorylationofpRbandp53proteins onlyinthetreatedsamplesascomparedtotheuntreatedones. Thesmallmoleculesalsomodulatedtheexpressionsofothercell survival/celldeathgenesinthetreatedsamplesascomparedto theuntreatedones.Thepossibleroleofsmallmoleculesinthe tumorcelldeathinvitroisbeinginvestigated.Theresultscould 136 / National Institute of Mental Health and Neuro Sciences Annual Report leadtodevelopmentofsmallmoleculesaspossibletherapeutics tomanagethehumanintracranialtumors. 5. Effect of growth factors and wound healing in diabetic animal model. Investigator: Dr. R Gope Thisstudyisaimedtounderstandtheeffectsofgrowthfactors incutaneouswoundhealingprocessindiabeticmousemodel. Variousgrowthfactorsandavarietyofsmallmoleculesalone orincombinationsarebeingtestedfortheirpossiblebeneficial effects,ifany,onthequalityandrateofwoundhealingprocess. The preliminary data indicates that these factors accelerated thewoundhealingprocessinacombinationandconcentration dependentmannerintheanimalmodel.Thesecombinations/ concentrations also modulated the gene expression patterns inthetreatedwoundsascomparedtotheuntreatedcontrols. Thedatashowsthatthesefactorsalsoimprovedthequalityof thehealedwoundonlyonthetreatedanimalsascomparedto the untreated ones. Development of these factors as possible therapeuticstomanagediabeticwoundisbeingevaluated. 6. Prognostic and predictive significance of p16 and Bmi1 genes in human glioma. Mr. Sibin MK. Guides: Dr. Chetan GK, Dr. Dhananjaya I Bhat (Funding by CSIR) 2013-14 the interaction between IL-6 mediated inflammatory and cholinergic anti-inflammatory pathway will be investigated in schizophreniapatients. 10. Evaluation of Immuno-inflammatory pathways of schizophrenia: Study of potential interactions between HLA-G, NRG1 and cytokines, Ms. Ashwini R. Guides: Dr. Monojit Debnath, Dr. Venkatasubramanian Ganesan (Funding by DST INSPIRE) Thisstudyaimstoexplorethenovelrolesofimmuno-modulatory genes,HLA-GandNRG-1andintergenerationalgeneticeffects attheHLA-Glociinconferringsusceptibilitytoschizophrenia. Understanding the potential interactions between HLA-G, NRG1 and cytokines will help to delineate the pathogenetic pathwaysofschizophrenia.Inaddition,correlatingtheimpact of these genetic variations with the dermatoglyphic patterns (indirectmeasureofneurodevelopmentalabnormalities)would help in bridging the gap between genetic polymorphisms and itsimpactonneurodevelopmentinschizophrenia. Neuroanaesthesia 1. Comparison between suction above cuff endotracheal tube (SACETT) and standard endotracheal tube (SETT) on the incidence of ventilator associated pneumonia in Neuro ICU. Investigators: Dr. Sriganesh K, Dr. Sritam, Dr. Ramesh VJ, Dr. Bhadrinarayan V, Dr. Veenakumari HB, Dr. Ravikumar R Evaluation of the effects of 1% propofol on the cortical and sub-cortical areas of the brain using functional magnetic resonance imaging technique. Investigators: Dr. Sriganesh K, Dr. Saini J, Dr. Bhat DI (Funding by NIMHANS) 7. Study on the influence of O-6-methylguanine-DNA methyltransferase (MGMT) gene on downstream DNA mismatch repair genes in human high grade malignant glioma. Ms. Jeru Manoj. Guides: Dr. Chetan GK, Dr. Narasinga Rao (Funding by UGCMaulana Azad National Foundation, UGC, India) 8. Study on the regulation of human telomerase in glioblastoma cell lines using knockdown approaches. Ms. Lavanya CH, Guides: Dr. Chetan GK, Dr. Srinivas Bharath MM (Funding by UGCRajiv Gandhi National Fellowship, India) 2. 9. Immunogenetic investigations of Interleukin-6 (IL-6) abnormalities in Schizophrenia. Ms. Deepthi Venugopal. Guides: Dr. Monojit Debnath, Dr. Venkatasubramanian Ganesan, Dr. Moinak Banerjee, RGCB, Trivandrum (Funding by UGC) This project evaluated the effect of anesthetic drug propofol ontheBOLDsignalchangesandrestingstatenetworksinthe brain.TheinvestigatorsobservedreductioninBOLDsignaland functionalactivityfollowinganesthesiaindifferentareasinthe brain.ConnectivitybetweenthalamusandPCCincreasedafter anaesthesiasuggestingdifferentialactionsofpropofol. This study involves the influence of genetic, gene expression andepigeneticchangesofIL-6geneontheriskandprogression of schizophrenia. In addition, the status of anti-alpha7 nicotinic acetylcholine receptor (alpha7nAChR) antibody and 3. Acute kidney injury in traumatic brain injury. Investigators: Dr. Sriganesh K, Dr. GS Umamaheswara Rao National Institute of Mental Health and Neuro Sciences / 137 Annual Report 2013-14 patients undergoing surgery ≥2 hours duration during Suprane Anaesthesia. Investigators: Dr. Ramesh VJ, Dr. M Radhakrishnan (Funding by Baxter India Ltd.) The study evaluated the incidence, risk factors and outcomes in patients operated for severe TBI at NIMHANS. The investigatorsobserveda12%incidenceofAKIinthepopulation anditresultedinprolongedICUandhospitalstayandlonger durationofventilation. 4. Blood pressure – Plethysmographic time lag as a model to quantify systemic vascular resistance: Design and validation. Investigators: Dr. Ramesh VJ, Dr. M Radhakrishnan (Funding by Life Sciences Research Board, DRDO, New Delhi) The study hypothesis is whether arterial blood pressure – plethysmographic time lag can be considered to indicate peripheral vascular resistance. This will enable to noninvasivelyquantifysystemicvascularresistance,andthisalso hasimplicationinmanagementofpatientswithhemorrhagic states. The data acquisition has been completed. Majority of the patients were subarachinoid haemorrhage patients comingforclippingoftheintracranialaneurysmsandlarge meningioma patients coming for excision. The time lag between the waveforms has been calculated. Various other parameters like pulsatality index, pulse transmit time, systolic pressure variation, amplitude variation, etc. have been calculated. Statistical analysis of the parameters is in progress. 5. Heart rate variability as a tool to assess autonomic nervous system in patients with neurosurgical disorders. Investigators: Dr. M Radhakrishnan, Dr. Ramesh VJ (Funding by DST) The study is about assessing the function of autonomic nervoussystem,intermsofheartratevariability(HRV),in patients undergoing surgeries for supra and infratentorial tumors, intracranial aneurysms, cervical compressive myelopathyandheadinjuries.HRVisassessedbyrecording theECGfor5minutesandcalculatingtheR-Rintervalsfrom it.Thisgroupofpatientstendstohavegreaterhemodynamic fluctuations in the perioperative period. The abnormal findings of heart rate variability, recorded prior to surgery, withintraoperativehemodynamicsandconditionofpatients at discharge from the hospital will be correlated. The data acquisitionisinprogressanddatahasbeenacquiredinmore than55patients. 6. Itisamulti-institutionalstudy.Primaryobjectiveistoobtain informationonpracticeandusagepatternsofDesfluranewhen administered in a real-world setting to adult inpatients in India.Secondary objectives are to evaluate the length of time forrecoveryfromanesthesiaandthequalityofrecoveryfrom anesthesia with the usage of desflurane. The data has to be collectedanduploadedonline.Afterpoolingthedatafromall the centres, the data will be analysed with respect to various recoveryparameters.Theparameterswillbecomparedamong differentagegroups. 7. Evaluation of the incidence of coagulopathy and its effect on outcome in patients with traumatic brain injury (TBI). Investigators: Dr. Sonia Bansal, Dr. Bhadri V Narayan, Dr. Rohini Surve, Dr. B Madhusudhana Rao (Funding by ISNACC) 8. Pre-clinical and clinical imaging of microvasculature with quantitative photoacoustic microscopy. Investigators: Dr. Manojit Pramanik, EE Department, IISc Bangalore, Dr. GS Umamaheswara Rao (Funding by NIMHANS) 9. Confirmation and molecular characterization of hospitaland community-acquired staphylococcus aureus (HA and CA - MRSA) by polymerase chain reaction. Investigators: Dr. HB Veenakumari, Dr. GS Umamaheswara Rao (Funding by ICMR) 10. Continuous intraoperative endotracheal tube cuff pressure monitoring in neurosurgical patients. Dr. Vinay B. Guide: Prof. Bhadrinarayan. 11. Validity of surgical Apgar score in predicting outcome in patients undergoing elective neurosurgical procedures-A retrospective study. Dr. Vinay B. Guide: Prof. Bhadrinarayan. 12. Spectrum of serum sodium disturbances in patients with non-sellar/ suprasellar supratentorial tumors. Dr. Sritam Swarup Jena. Guides: Dr. Ramesh VJ, Dr. Rita Christopher, Dr. Dhananjaya I. Bhat. A multicenter, prospective, observational registry for assessment of clinical outcomes in Indian adult (≥18-40 years, ≥41-65 and >65 years) in 138 / National Institute of Mental Health and Neuro Sciences Annual Report Sodium disorders are the most common and probably the most poorly understood electrolyte disorders in neurological patients. As central nervous system plays an important role in the regulation of sodium and water homeostasis, patients sufferingfromCNSinsultfrequentlyexperienceserumsodium disturbances and it exacerbates their neurologic and general conditions.Theaimofourstudyistodeterminethefrequency of sodium disturbance in patients with non-sellar/suprasellar supratentorialtumorsandelucidateitscorrelationwithclinical outcome,bothinretrospectiveandprospectivemanner. 13. Effect of anaesthetics on Glioblastoma cell line migration, proliferation and matrix metalloproteinase-2. Dr. Mohit Mittal. Guides: Dr. Umamaheshwara Rao GS, Dr. Nandakumar DN Tumourmetastasisisacomplexprocessthatincludescellular separationfromtheprimarytumour,invasionofandmigration through surrounding tissues, invasion of the intravascular space, cellular transport in the bloodstream, and subsequent extravasation and proliferation in the target tissue or organ. Anaestheticsarewidelyusedduringbrainsurgery.Anaesthetics andanaesthesiatechniqueshavesomeimpactoninvasionand migration ability of tumor cells that can possibly affect longtermoutcomeofpatientswhohaveundergonecancersurgery. Thisstudywasplannedtoinvestigatetheeffectofinhalationand intravenousanaestheticsoncellproliferationandmigrationof glioblastomacells. Neurochemistry 1. Establishment of high-throughput mass spectrometry-based screening for lysosomal storage disorders using dried blood spots. Investigators: Dr. Rita Christopher, Dr. Nagaraja D (Funding by DBT New Delhi) Theinvestigatorshaveestablished ahigh-throughput,robust, and reliable mass spectrometry-based method to screen for lysosomal storage disorders using dried blood spots collected on filter paper. The diseases selected in the panel include Gaucher disease, Pompe disease, Fabry disease, NiemannPickdiseasetypesAandBandKrabbedisease.Thetechnique hasbeenusedtoscreenbloodsamplesof5100newbornsand 14,000 sick children for these disorders. Two children with Pompe disease, one with Niemann-Pick disease and two with Gaucher disease have been identified. At present, effective enzyme replacement therapy is available for Gaucher, Pompe 2013-14 andFabrydisease.Earlydiagnosisofthesedisordersbeforethe onsetofirreversiblepathologieswillleadtobetteroutcomesfor currentandproposedtherapies. 2. Proteomic analysis of neurological stroke. Investigators: Dr. Rita Christopher, Dr. Nagaraja D, Dr. Yasha TC, Dr. Akilesh Pandey (Funding by DBT, New Delhi) Thisisamulti-institutionalprojecttoidentifyserumbiomarkers forstrokeanditssubtypes.Inthefifthyear,usingLTQOrbitrap VelosFouriertransformmassspectrometry-basedproteomics approach, quantitative glycoproteomic analysis was done to identify the serum glycoproteins that are differentially expressed in acute ischemic stroke (AIS) and intracerebral hemorrhagicstroke(ICH).InAIS,29proteinswereupregulated and15,downregulated.Similarly,26proteins(≥2-fold)and11 proteins(≤0.5-fold)werefoundtobedifferentiallyexpressedin ICH.NovelproteinsupregulatedinAISincludeCD5Lantigen like protein (CD5L) (2.5-fold), zinc-alpha-2-glycoprotein (AZGP1)(2.4-fold)andgalectin-3-bindingprotein(LGAL3BP) (1.7-fold).OtherproteinsupregulatedwereComplementfactor I (CFI) (2.2-fold), C4b-binding protein (C4BPB) (2-fold), ComplementC1q(C1QB)(2-fold).Plateletbasicprotein(PPBP) was downregulated 4-fold. The glycoproteins altered in ICH includeNeuronalmembraneglycoproteinM6-A(GPM6A)(1.8fold),Angiotensinogenprotein(AGT)(2.4-fold),Synaptophysin (SYP) (1.5-fold), APOA2 (3-fold), and Calcium/calmodulindependent protein kinase type II alpha (CAMK2A) (2.6-fold). Of these glycoproteins, candidate proteins were selected for validation by ELISA. Mean serumlevels of LGAL3BP were foundtobeelevatedinAIScasescomparedtocontrolsubjects. SerumC4BPB,AGT,andAPOA2werenotsignificantlyaltered in stroke cases compared to controls in the ELISA-based validationstudy. 3. Vitamin D receptor gene variants and vascular risk: Study in ischemic stroke. Investigators: Dr. Rita Christopher, Dr. Nagaraja D (Funding by ICMR, New Delhi) Theobjectivesofthisstudyweretoelucidatewhethervariants of the vitamin D receptor (VDR) gene are associated with increased risk for ischemic stroke in vitamin D sufficient and deficientyoungadultsandtoexaminethepossiblemechanisms bywhichVDRgenevariantsmayaffectvascularrisk.Thestudy group comprised of 150 control subjects (112 males and 38 females)withmeanageof46.83±13.28and150strokepatients (115malesand35females)withmeanageof47.53±15.67years. Body mass index, alcohol, smoking, metabolic syndrome, National Institute of Mental Health and Neuro Sciences / 139 Annual Report 2013-14 hypertension,andfamilyhistoryofhypertensionanddiabetes mellitus were found to be significantlyassociated withriskof stroke.GenotypingforVDR BsmI,FokIandTaqIwascarried outbyPCR-RFLP.Allelefrequenciesofthevariousgeneswere in Hardy-Weinberg equilibrium. VDR gene variants were not associated with increased risk of stroke in both Vitamin D sufficient and deficient subjects. There was no association between serum Vitamin D and the VDR genotypes. Similarly, therewasnoassociationbetweenVDR genotypesandsystolic ordiastolicbloodpressure. 4. Vitamin D status and vascular cognitive impairment in the elderly. Investigators: Dr. Rita Christopher, Dr. Chandra SR (Funding by ICMR, New Delhi) TheobjectivesofthisstudyweretodeterminewhetherVitamin D insufficiency is associated with increased risk for severe vascular cognitive impairment in the elderly, to establish whetherthegenevariantsoftheVitaminDmetabolicpathway could predict the risk for cognitive decline and to elucidate thepossiblemechanismbywhichlowVitaminDstatuscould increase risk for vascular cognitive impairment. A total of 58 healthy controls and 60 subjects with vascular cognitive impairment have been recruited after informed consent. GenotypingforvitaminDreceptorgenevariants,namelyTaqI andBsmI,isbeingcarriedout. 5. Protective role of Withania somnifera against scopolamine induced memory impairment in Alzheimeric rats. Investigators: Dr. Visweswari G, Dr. Rita Christopher (Funding by DST) The objectives of this study were to monitor the bioactive factors from the medicinal plant, Withania somnifera, for antialzheimeric activity, and to study the pathophysiological sequelae of neurotransmitter mechanisms in Scopalamineinduced dementia. Adult male Wistar rats, 4 months of age, with weights between 300-350g, were used for the study. Increasedacetylcholinesterase(AChE)activityinscopolaminetreatedratswasdecreasedinadose-dependentmannerinall thefivebrainregionswithmethanolextract(ME)andaqueous extracts (AE) of the plant. At the same time acetylcholine (Ach) content was reversed in scopolamine-treated and both ME and AE treated rats. The changes in AChE activity and ACh content were maximal with 300mg/Kg b.w. of ME and AE.Hence,theinvestigatorsconcludethattheseextractswith this concentration have anti-alzheimeric activity and cause perceptiblechangesinthecholinergicsystem,atleastaspartof theiranti-alzheimericeffect. 6. A study of neuroprotective aspects of Klotho biology. Investigators: Dr. Vijaya Majumdar, Dr. Rita Christopher (Funding by DBT) Variousneuroprotectiveandneurorestorativemechanismsare deployedbybraincellstomaintaintheirintegrity,tofacilitate responsestoenvironmentaldemandsandpromotefunctional recoveryaftercellularinsults.Klotho,anovelanti-agingprotein has been shown to have a plethora of biological functions viz., regulation of mineral metabolism, vascular homeostasis, regulation of metabolic pathways and protection against oxidativestress.Owingtoitsabundantexpressioninbrainand itsreportedabilitytomediateapoptosisandcombatoxidative stress, the investigators propose that Klotho could play a role of neuroprotectant. The proposed project will attempt to elucidatetheneuroprotectiveaspectofKlotho’sbiology.Itwill involvetheanalysisoftheeffectsofoverexpressionofKlothoon neuronal death caused by exposure to various cellular insults like oxidative stress, excitotoxicity and trophic deprivation. ExperimentallythestudywillinvolvegenerationofstablePC12 cells transfected with Klotho encoding plasmid. The control aswellasKlothooverexpressingcellswouldbetreatedwitha varietyofcellularinsults,followedbyassessmentofcellsurvival and apoptotic cell death. This study would also contribute towardsabetterunderstandingofKlotho’sbiologicalfunction with respect to the signaling pathways induced by Klotho in neuronalcells. 7. Pharmacogenetics of oral anticoagulation therapy in patients with cardiac valve replacement. Investigators: Dr. Kalpana SR, Dr. Rita Christopher, Dr. Manjunath (Funding by ICMR) The treatment of rheumatic heart disease with valve replacementsurgerywithmechanicalprotheticvalvesrequires lifelong oral anticoagulation, to prevent thromboembolic complications.However,chronicanticoagulationpost-surgery ischallengingbecausepatientsexhibitlargevariabilityintheir dose-anticoagulant effect response thrombotic complication. The inter-individual variability is known to depend on environmental factors, but a genetic influence has also been demonstrated. The two key enzymes in the metabolism of Acitrom are cytochrome P450 (CYP) 2C9 (CYP2C9 gene) and the C1 subunit of the Vitamin K 2,3 epoxide reductase complex(VKORC1gene).Theaimsandobjectivesofthisstudy are to explore the contribution of CYP2C9 and VKORC1 gene polymorphisms on optimal therapeutic dose requirements of oralanticoagulantsinpatientswithcardiacvalvereplacement. 140 / National Institute of Mental Health and Neuro Sciences Annual Report 8. Conformation dependent antibodies as therapeutic strategies for protein misfolding disorders. Investigator: Dr. Sarada Subramanian (Funding by DST, New Delhi) firstphase,theneutralizingpotentialoftheimmunodominant epitopeslocatedintheN-terminalregionofTau(residues1850,68-71and111-137)arebeingtestedinratmodels. 10. Manyneurodegenerativedisordersarefundamentallyassociated with aging and accumulation of misfolded proteins as amyloid fibrils. Although such diseases are associated with different proteins, they share several pathological features. Because protein misfolding is thought to be central to the pathological state, it is essential to be able to distinguish such pathological states from native and non-pathological states. Generation of conformation specific monoclonal antibodies that bind to the amyloidfibrilstatewithlittleapparentdependenceonaminoacid side chain should contribute to the development of diagnostic and therapeutic agents for protein misfolding diseases. Here, the efforts were directed to generate conformation-specific monoclonalantibodiesthatbindtoanddestabilizetheamyloid fibril state of the misfolded proteins of unrelated protein sequence, such as amyloid ß (1-42) peptide, islet amyloid polypeptide,immunoglobulinlightchain,ß2-microglobulin,etc. Thisnewclassofantibodieswasassociatedwithafundamental amyloidfoldingmotifandrecognizesacommonconformational epitope with little apparent dependence on amino acid side chain information. These antibodies should contribute to the understandingofamyloidstructure,assembly,andtoxicityand alsomaybenefitthedevelopmentofdiagnosticandtherapeutic agentsforconformationaldisorders. 9. Biochemical and histological analysis of traumatic brain injury in neurotrauma patients. Investigators: Dr. Srinivas Bharath MM, Dr. Nupur Pruthi, Dr. Shankar SK, Dr. Anita Mahadevan (Funding by ICMR) The current project aimed to examine the role of oxidative damageinthebrainsfromtraumaticbraininjury(TBI)patients. Theinvestigatorscarriedouthistopathologicalandbiochemical analysisofthecontusionandpericontusionregionsofthebrain (frontal cortex) of TBI patients (both surgical samples and postmortemtissue).Histologicalexaminationofthesesamples showed elevated astrogliosis (indicated by GFAP expression), microglialactivation(indicatedbyiba-1expression)andaxonal damage (indicated by neurofilament phosphorylation). On the other hand, biochemical analysis showed that contusion displayed the highest oxidative damage compared to control, followed by pericontusion. Further, synaptic terminals showed elevated oxidative damage compared to non-synaptic mitochondria thereby highlighting the role of oxidative stress andmitochondrialdamageincontusionandpericontusion. 11. Tau-focused immunotherapeutic approaches to Alzheimer’s disease. Investigator: Dr. Sarada Subramanian (Funding by CSIR, New Delhi) Alzheimer’s disease (AD) is the leading cause of dementia, affecting more than 30 million worldwide. The two major pathological findings in patients with AD are extracellular plaques formed mainly of amyloid ß (Aß) peptide and intracellular neurofibrillary tangles (NFT) which contain hyperphosphorylated tau. The cognitive impairment in patients with AD is closely associated with loss of synapses andtheformationofNFTintheneocortexandlimbicsystem. Potential side effect of current tau-based immunotherapy targetedprimarilytowardsthecentralprolinerichregionand thepositivelychargedC-terminalregionisthatitisprohibiting normal tau from performing its normal cellular functions. Given that there are multiple phosphorylations on tau, many ofthemhavebeenreportedtohavepathologicalconsequences; the identification and selection of the most therapeutically relevant phospho-epitopes requires further research. In the 2013-14 Nanoassisted C60-pyrimidine derivatives: Their synthesis, characterization, neuroprotective and antiviral activities. Investigators: Dr. Srinivas Bharath MM, Dr. Devashish Sengupta, Assam University, Dr. Shaheed Jameel, ICGEB, New Delhi (Funding DBT, New Delhi) Thecurrentprojectanalysestheneuroprotectiveeffectsofnovel nanomoleculesinexperimentalmodelsofParkinson’sdisease. The initial part of the project, involving design, synthesis, isolation, purification and characterization of the fullerenepyrimidine derivatives, will be conducted and supervised by thePI(Dr.DevashishSenguptafromAssamUniversity).These molecules will be tested for potential neuroprotective and therapeuticpropertiesinvitroinN27dopaminergicneuronal cell model of Parkinson’s disease. The molecules that show neuroprotectivepropertyinthecellmodelwouldbetestedin an MPTP mouse model of Parkinson’s disease. The analysis in both models includes monitoring of apoptotic markers, dopaminergicmarkers,redoxandmitochondrialmarkers. 12. A comparison of biochemical and proteomic alterations in brain mitochondria of prepubertal National Institute of Mental Health and Neuro Sciences / 141 Annual Report 2013-14 and adult mice exposed to 3-nitropropionic acid (3-NPA). Investigators: Dr. Shinomol George K, Dr. Srinivas Bharath MM (Funding by DST, New Delhi) The project aimed to determine the biochemical changes mediated by 3-Nitropropionic acid (3-NPA) in vitro and in vivo. The 3-NPA caused dose dependent neurotoxicity in dopaminergic cells in vitro, along with increased oxidative stress, lowered antioxidant function (depletion of glutathione etc.) and mitochondrial damage. Injection of 3-NPA in mice (youngandadult)causedsignificantmotordeficitsasindicated bybehavioralassays(poletest,stridelengthandrotarodassay). The mice also displayed mitochondrial damage (indicated by lowered activities of mitochondrial respiratory complexes andATP/ADPratio)andelevatedoxidantmarkers(indicated by elevated protein oxidation and lipid peroxidation) in the striataltissue.Alltheseeffectswerecomparablebetweenyoung andadultanimals. 13. Analysis of the epigenetic regulation of red/ox mechanisms in neurotoxic models of Parkinson’s disease: Role of chromatin modifications. Investigators: Dr. Mythri R, Dr. Srinivas Bharath MM (Funding by DST, New Delhi) Studies in Parkinson’s disease demonstrate that red/ ox mechanisms and mitochondrial damage contribute to neurodegeneration in PD. Oxidative stress and lowered antioxidant function are closely linked with the expression of genes such as NRF-2 pathway genes (Phase II pathway). The expression of these genes could be modulated by epigenetic mechanisms including histone acetylation mediated by histone acetyltransferases (HATs)], resulting in increased transcription. In contrast, histone deacetylation [by histone deacetylases(HDACs)]repressesgenetranscription.Oxidative stress activates the expression of stress response kinases and redox-sensitivetranscriptionfactorsprobablyviatheactivation of intrinsic HAT activity and inhibition of HDAC activity. Interestingly, acetylation on specific lysine on core histones hasbeenimplicatedinpathologicalconditionssuchascancer, ischemia and neurodegeneration. Although oxidative insult induces epigenetic changes, the status of histone acetylation/ deacetylation at specific lysines and altered HAT/HDAC dynamics, with relevance to oxidative stress and red/ox genes in PD has not been completely delineated. The current proposalaimsto(i)investigatethedynamicsofspecifichistone acetylation/deacetylation events and HAT/HDAC activities and(ii)correlatehistoneacetylationeventswiththeexpression ofred/oxgenesintheMPTP/MPP+modelofPD. 14. Role of Glutamate excitotoxicity and cytokines in invasion of glioblastoma. Investigators: Dr. Nandakumar DN, Dr. Sampath S, Dr. Vani Santosh (Funding by DBT, New Delhi) Glioblastoma (GBM) is one of the most common malignant tumoursofthecentralnervoussystem.Despitenewdiagnostic techniques and combined modality therapy prognosis remains dismal. Decades of surgical therapy, radiotherapy and chemotherapy have failed to drastically change survival. Theadditionoftemozolomidetoradiotherapymedianoverall survivalhasimprovedfrom12.1monthsto14.6months.They haveexceptionalabilitytoinfiltratenormalbrain,oftenalong blood vessels or nerve fibres. This feature makes complete radical surgical resection virtually impossible and leading in almost all cases to tumor recurrence. Their genetic and metaboliccharacteristicsaffectinginvasiveability,alterationof immuneresponseandthedevelopmentoftreatmentresistance mustbeunderstoodindetailtoaddresstheminameaningful fashion.Oneofthedistinguishingfeaturesofthegliomatumors is their diffuse infiltrative nature. Several factors are thought tocontributetotheinvasiveandmigratorypropertiesofGBM cells, interacting with the microenvironment and enhancing motilityandinvasion. Theinvestigatorsaimatunderstandingglutamateexcitotoxicity in GBM and the role of cytokines on invasiveness of tumour and by doing so, perhaps, contribute to the understanding of thecomplexbiologicalinteractionsthatregulateglioblastoma migration,invasionandrecurrence. 15. Genetic and biochemical profiling of patients with glutaric aciduria type I. Investigator: Dr. Kruthika Vinod TP (Funding by DST, New Delhi) Glutaric acidemia type I, is an autosomal recessive disorder ofaminoacidmetabolismandcausedduetodeficiencyofthe enzymeglutaryl-CoAdehydrogenase,amitochondrialenzyme located in the degradative pathway of the amino acids lysine, hydroxylysine and tryptophan. The aim of this project is to correlate biochemical phenotype with its respective genotype andtoknowtheprevalenceoflowexcretesanditsgenotypein Indianpopulation.Thefindingfromthisstudy,willimprovise thediagnosticsensitivityandspecificityofneonatalscreening for GA-I and in addition it also helps in acquiring accurate figuresonitsprevalenceinthepopulation. 16. 142 / National Institute of Mental Health and Neuro Sciences Generation of experimental models of muscular dystrophy: Analysis of molecular mechanism and Annual Report myoprotection. Investigators: Dr. MM Srinivas Bharath, Dr. Gayathri N (Funding by ICMR) Diagnosisandtreatmentofmusculardystrophies(MDs)such as Duchenne muscular dystrophy (DMD) and limb girdle muscular dystrophy (LGMD) is a major healthcare challenge in India. Although several factors downstream of genetic mutations, such as oxidative stress, mitochondrial damage, calciumdynamics,signaltransductionpathwaysetc.havebeen implicatedinmusclepathology,theinterplayandthechronology of these mechanisms have not been completely understood. Cardiotoxin-mediated simulation of a muscular dystrophic pathologyin vitroandin vivooffersanexperimentalmodelto studythepathwaysinvolvedindegenerationandregeneration of muscle and to evolve novel therapy for a multitude of musculardystrophyandextrapolatedtothehumancondition tounderstandtheroleofdifferentpathwaysinMDsandhow theycanbemodulatedfortherapy.Thestudyisunderway. 17. Pharmacogenetics of oral anticoagulation in patients with cerebral venous thrombosis. Ms. Tanima De. Guides: Dr. Rita Christopher, Dr. Nagaraja D (Funding by CSIR) The impact of CYP2C9 and VKORC1 -1173C>T and 1639G>A polymorphisms on acenocoumarol, a commonly prescribed oralanticoagulantdrug,wasinvestigated.476acenocoumaroltreated CVT patients were genotyped for CYP2C9 and VKORC1 -1173C>T and 1639G>A polymorphisms. Mean acenocoumarol dose required for achieving and maintaining a stable international normalized ratio (INR) was calculated for different genotypes. The effect of co-administration of the anticonvulsant drug, phenytoin, was also determined. A significant association was observed between the mean dose, clinicalcovariates,andtheVKORC1-1639andCYP2C9variant genotypes. An algorithm for acenocoumarol dose calculation wasdevelopedforpatientswithCVT. 18. Mass spectrometry based protein profiling to identify candidate biomarkers in biological fluids: Study in stroke. Mr. Rakesh Sharma. Guides: Dr. Rita Christopher, Dr. Nagaraja D (Funding by DBT) Proteins present in serum of ischemic and hemorrhagic stroke patients were profiled using iTRAQ based LC-MS/ MS approach. In ischemic stroke 65 proteins exhibited a foldchange >1.5 whereas in hemorrhagic stroke 69 proteins were upregulatedand48downregulatedAlteredlevelsofpotential 2013-14 candidateproteinssuchasVonWillebrandfactor,ADAMTS13, S100 A7, Apolipoprotein CII, Apolipoprotein C III PSD-95, Peroxiredoxin-2, Ficolin 2, Dermicidin, Fibrinogen-gamma, ApolipoproteinCIIIAntileukoproteinase,Vasodilator-stimulated phosphoprotein,Galactin-3-bindingprotein–werevalidatedby ELISA.Thepanelofcandidatemarkersidentifiedfromthestudy mayassistexistingmodalitiesinthediagnosisofstroke. 19. Circulating microRNAs: Role as molecular biomarkers in cerebral small vessel disease. Mr. Prabhakar P. Guides: Dr. Rita Christopher, Dr. Chandra SR (Funding by ICMR) MicroRNAs(miRNA)areinvolvedintheregulationofdiverse cellular processes, and may serve as points of cross-talk between signaling pathways. MicroRNA deregulation often resultsinimpairedcellularfunctionanddiseasedevelopment. Cerebral small vessel disease (SVD) is a common cause of vascular dementia and age-related cognitive decline. The aim of this study is to identify differentially expressed miRNAs in SVD and validate the differentially expressed miRNAs as molecularbiomarkerstodiagnoseSVD.Thestudyalsoaimsto identify target genes for the differentially expressed miRNAs and predict the role of differentially expressed miRNA in the etio-pathogenesisofSVD. 20. Parental consanguinity and its association with metabolic abnormality in schizophrenia patients living in a rural community of South India: A clinical and genetic investigation. Mr. Vikas Agarwal. Guides: Dr. Jagadisha Thirthalli, Dr. Rita Christopher, Dr. Naveen Kumar C Theassociationofconsanguinityandmetaboliccomplications in patients with schizophrenia remains unexplored. The objective of this study is to compare the degree of parental consanguinitybetweenschizophreniapatientslivinginarural community in South India and healthy controls in the same community and to examine the association between parental consanguinity and metabolic abnormalities in patients with schizophrenia. This study is expected to provide insights into thecomplexmechanismofmetabolicabnormalitiesassociated withschizophrenia,theroleofparentalconsanguinityandthe roleofrecessivetransmissionofriskfactorsforthedevelopment ofmetabolicabnormalitiesinschizophrenia. 21. Determinants of cognitive dysfunction in patients with neurocysticercosis correlation with CSF acetyl cholinesterase, serum TNF alpha and National Institute of Mental Health and Neuro Sciences / 143 Annual Report 2013-14 IL-10 activity. Dr. Vinod Varghese. Guides: Dr. Chandra SR, Dr. Rita Christopher, Dr. Jamuna Rajeswaran, Dr. Chandrajit Prasad, Dr. Subasree This prospective, hospital-based study was aimed at determining the factors which could be related to cognitive decline in neurocysticercosis. Acetylcholinesterase present in the cyst capsule was expected to deplete acetylcholine in the brainandcausecognitiveimpairment.Theresultsshowedthat even though there was an increase in acetylcholinesterase in CSFofpatientswithneurocysticercosis,itwasnotstatistically significant. There was a significant correlation of cognitive impairmentwiththenumberofMRIlesions.SerumTNF-alpha and IL-10 were significantly increased and correlated with vesicularstages.Itislikelythatcognitiveimpairmentisdueto inflammation-triggeredneurodegeneration. 22. Genetic determinants of cognitive dysfunction in patients with cerebral small vessel disease. Dr. Vinod Varghese. Guides: Dr. Chandra SR, Dr. Rita Christopher, Dr. Jamuna Rajeswaran, Dr. Chandrajit Prasad, Dr. Subasree Genetic predisposition has been suggested to be critical for development of cerebral small vessel disease (SVD). The role of aldosterone synthase CYP11B2 T-344C polymorphism in vascular cognitive dysfunction associated with SVD was investigated.The study showed no statistically significant associationbetweengenotypesandcognitivescoringalthough CYP11B2 TC genotype was associated with hypertension in men. However, significant association between hypertension and homocysteinemia with the severity of brain MRI white matterchangeswasfound. 23. Role of ubiquitin c terminal hydrolase and s-100β in predicting deficits in cognitive control in young adults with mild traumatic brain injury A prospective study. Dr. Subir Dey. Guides: Dr. Jagath Lal, Dr. Rita Christopher The aim of this study is to determine whether the proteins, ubiquitin c terminal hydrolase and s-100β could be used as biomarkers to predict deficits in cognitive control in young adultswithmildtraumaticbraininjury. 24. Small molecule inhibitors of amyloid ß aggregation and toxicity – An in vitro study. Ms. Maya Mathew. Guides: Dr. Sarada Subramanian (Funding by DST, New Delhi) In search of small molecules as an effective strategy for AD, plants being used in Ayurveda for treating dementia and cognitivedysfunctionwereconsidered.TheseincludedNelumbo nucifera, Valeriana wallichii, Celastrus paniculatus, and Raulfia serpentina. The effect these extracts and their active phytocompoundsweretestedforinhibitionofAβoligomerization and protection against Aβ mediated toxicity in rat primary hippocampal cultures. The results showed that, β-sitosterol, valerenicacid,α-asaroneandglycyrrhizinwereeffective.These substancesmayholdtherapeuticpotentialforADtreatment. 25. Role of ghrelin-leptin (im) balance on Alzheimer’s disease. Ms. Sowmya Madhavadas. Guides: Dr. Sarada Subramanian, Dr. Bindu M Kutty (Funding by DST, New Delhi) To investigate the role of obesity on cognitive functions, monosodium glutamate (MSG) was first administered to rat pupsatneonatalstages.Bysixmonths,hypercholesterolemia, hyperglycemia and leptin resistance were established. Serum leptin levels showed inverse significant correlations with hippocampal weights (r = -0.77, p< 0.05). Administration of ghrelin receptor analog [D-Lys (3)] GHRP-6 to 18-month-old obese rats resulted in significant reversal of leptin resistance leptin with concomitant reduction in hippocampal amyloid β, cholinesterase levels with marked improvement in Barne’s mazetask.Thesefindingssuggestthepotentialof[D-Lys(3)] GHRP-6asapromisinganti-Alzheimercandidate. 26. Recombinant expression and characterization of core sequence of the various isotypes of human 14-3-3 protein and development of isoform specific immunoassays. Ms. Udaya Kumari HB, Guide: Dr. Sarada Subramanian The 14-3-3 protein belongs to a family of conserved, dimeric proteinswithamonomericmolecularmassofabout30kDa,and isubiquitouslyexpressedinvariousmammaliantissues.Seven isoformsoftheseproteinscanbedetectedinthecerebrospinal fluid of patients with different neurological disorders. The objective of the proposed study is to develop isotype specific immunoassay for each isoform of the 14-3-3 protein. Towards this,theindividuallinearantigenicdeterminantsspecifictoeach isoformofthe14-3-3proteinwereselectedbyusingpredictive algorithms. Custom synthesis and production of polyclonal antibodiestotheseindividualsequencesisunderway. 27. 144 / National Institute of Mental Health and Neuro Sciences Molecular event related to Nitrosative stress during oxidative and brain aging, Annual Report neurodegeneration and neurotrauma. Mr. Harish G, Guide: Dr. Srinivas Bharath MM (Funding by ICMR) The study demonstrated that the redox status, mitochondrial physiology and proteomics in the human brain are highly dynamic and inter-related. These processes are regulated by pre/postmortem factors, aging, degeneration and injury. Nevertheless,oxidativeandmitochondrialchangesarecommon eventsthatlinkaging,degenerationandinjurymechanismsin the human brain. The data also indicated the persistence of signaturepatternofredoxmarkersinnon-traumatizedregions of young and old brains. In the injured regions of the brain, distinct biochemical, pathological and proteomic changes differentiatecontusionfromthepericontusionregions. 28. Evaluation of the mechanisms associated with neurotoxicity in cell and animal models and neuroprotection by natural products: Implications for Parkinson’s disease. Mr. Raghunath N, Guide: Dr. Srinivas Bharath MM (Funding by CSIR-SRF) Parkinson’s disease (PD) is a neurodegenerative disease that occurs due to the gradual degeneration of dopaminergic neurons leading to the loss of striatal dopamine. Research evidences have revealed the contribution of various genetic and environmental factors in PD pathology. Environmental factors include exposure to pesticides and toxic metals such as manganese. Acute exposure to Mn has been demonstrated toinduceneurotoxicitybothin vitroandin vivo.Thecurrent study aims to understand the role of oxidative stress and mitochondrial damage in Mn-dependent neurotoxicity in dopaminergicneuronalcellsandinmiceusingtranscriptomic andepigeneticapproaches. 29. Comparative analysis of cellular changes in Duchenne Muscular Dystrophy (DMD), sarcoglycanopathies and other muscle diseases: Focus on mitochondrial function. Ms. Debashree Bandopadhyay. Guides: Dr. Srinivas Bharath MM, Dr. Gayathri N, Dr. Nalini A Muscular dystrophies (MDs) arise due to muscle protein defects. Molecular mechanisms underlying MDs include necrosis/apoptosis, inflammation, calcium dysregulation etc. The role of mitochondrial dysfunction and oxidative stress in muscledamageanddegenerationisbeingrecognized.Analysis ofamousemodelofmuscledegenerationfromthelabclearly 2013-14 demonstrated the role of oxidative stress and mitochondrial damage in muscle pathology. However, the status of these processesisnotthoroughlyinvestigatedinhumanmuscle.The current project aims to characterize human MDs and related muscle pathologies with a focus on mitochondrial function usingbiochemical,histologicalandproteomicmethods. 30. Epigenetic analysis in the 3-nitropropionic acid (3-NPA) model of neurotoxicity: Implications for neurodegenerative diseases (Tentative title). Ms. Ranganayaki S, Guide: Dr. Srinivas Bharath MM 3-Nitropropionic acid (3-NPA) is a fungal toxin and a food toxin that causes neurotoxicity in the striatum via inhibition ofmitochondrialcomplexIIleadingtomitochondrialdamage. 3-NPA is known to cause dose-dependent neurotoxicity in dopaminergic cells in vitro, along with increased oxidative stress,loweredantioxidantfunction(depletionofglutathione, etc.) and mitochondrial damage. The current project aims to characterize the epigenetic mechanisms induced by 3-NPA in cellmodelbyanalyzingthe(i)statusofthepost-translational modifications of histones such as acetylation (ii) activities of histone acetyl transferases and histone deacetylases both in vitroandinvivo. 31. Role of IL1beta, IL6 and glutamate receptors in invasion of glioblastoma. Ms. Hurmath Fathima K. Guides: Dr. Nandakumar DN, Dr. Sampath S Glioblastoma multiforme (GBM) is one of the most common primarybraintumorswithpoorprognosisandhighlyinvasive behavior.Glutamatehasbeenimplicatedasanimportantplayer inthegrowthandinvasionofgliomas.IL-1βhasbeenimplicated in glioblastoma invasiveness. Evidence has emerged on the interplaybetweenIL-1βandexcitotoxicityincaseofischemic brain damage. In gliomas, the level of IL-6 gene expression increaseswiththegradeofmalignancy.Theinvestigatorsaim tolookattheeffectoftheinterleukinsIL-1βandIL-6onglioma cells, as well as their interplay with glutamate receptors to mediatetheiraction. 32. Role of glutamate excitotoxicity, TNF-alpha and IL-13 in the invasion of high grade glioma. Mr. Palaniswamy R. Guides: Dr. Nandakumar DN, Dr. Dwarakanath Highgradegliomasarelethalasitinfiltratesthesurrounding brain tissue. Glutamate uptake is reduced and excitotoxic concentrations of glutamate are released, leading to glioma National Institute of Mental Health and Neuro Sciences / 145 Annual Report 2013-14 growth.Eighty percent ofthe high-grade gliomasarepositive forTNF-αandthedecoyreceptorforIL-13,IL-13Rα2protein isexpressedathighlevelsonlyinhigh-gradegliomacells.No studyisavailableontheroleofinvasionmediatedbyglutamate excitotoxicity,TNF-αandIL-13.Theinvestigatorsaimtostudy thedirectroleoftheseoninvasionandcrosstalkbetweenthese moleculesanditssignalingpathway. 33. Biochemical and histopathological study of duchenne muscular dystrophy (DMD) and related neuromuscular disorders. Ms. Renjini R. Guides: Dr. MM Srinivas Bharath, Dr. Gayathri N, Dr. Nalini A (Funding by CSIR) ACTX-mediated transient acute mouse model of muscle degeneration that displayed inflammation and degeneration at days 1 to 7 and subsequent regeneration at day 11 and beyondwasgenerated.Itwasfoundthatlimbstrengthdeficits resembled human MDs and inflammatory myopathies. The histopathologicalfindingsofacuteinflammation,degeneration and the ultra-structural evidence of sarcolemmal disruption were characteristic of human MDs and inflammatory myopathies. Expression of cytokines, cytokine receptors and apoptotic mediators were found to be increased in the degenerativephase.Themodelalsodisplayedcalciumdeposits duringdegeneration.Theprocessofcalciummediateddamage wasbycalciuminfluxintomitochondriacausingdepolarization and increased ROS. Proteomic analyses confirmed oxidative damage of six proteins from DMD samples compared to controlsamongwhichtwoweremitochondrial. The investigators found that the phytochemical curcumin hastened the functional recovery of the CTX treated muscle and cell model. The tissue repair, regeneration and recovery of sarcolemmal stability in the curcumin treated muscle were relatively faster compared to the controls. Further, GSH production was significantly improved with concomitant reductioninlipidperoxidationfollowingcurcumintreatment. Curcumin and similar molecules might have therapeutic benefitswithimplicationsforhumanmusclediseases. NIIR 1. fMRI correlates of auditory discrimination in auditory Dys-synchrony: A Voxel-based Morphometry Study. Investigators: Dr. Rose Dawn Bharath, Dr. AK Gupta, Dr. Jayaram V, Mr. Naveen (Funding by NIMHANS) Results of the group analysis rendered over a glass brain representing areas which were seen significantly larger in patients with auditory dysynchrony compared with controls. Auditory dys-synchrony describes a condition in which a patient’s otoacoustic emissions (OAE) are (or were at one time) present and auditory brainstem responses (ABR) are abnormal or absent. In some instances, it is identified on the basis of present cochlear microphonics (CM) and abnormal or absent ABRs with or without abnormalities of OAEs. All subjectswerestudiedusingahighresolutionanatomicalscan of the whole brain acquired in 3.0 Tesla Siemens Skyra MR Scanner with 20-channel head coil using a three dimensional T1 weighted sagittal magnetisation prepared rapid gradient echo (MP-RAGE) sequence in 192 slices with TR: 1900 ms; TE:2.44ms;TI:900ms;FOV:250x250;Resolution:256x256; Slicethickness:1mm.Voxelbasedmorphometryanalysiswas done using VBM8 toolbox of SPM8 comparing the group of auditory dys-synchrony patients with the group of healthy controls.Results demonstrated structural brain differences in auditory dys-synchrony patients in areas including right superior temporal gyrus, bilateral anterior cingulate, left 146 / National Institute of Mental Health and Neuro Sciences Annual Report cingulategyrus,leftuncus,bilateralinferiorfrontalgyrus,right precentralgyrus,leftmiddlefrontalgyrus,leftsuperiorparietal lobule, post central gyrus and left sub-lobar putamen when compared with healthy controls. Voxel based morphometry group analysis of patients compared with controls revealed significantvolumetricchangespredominantlyinvolvingsensory andmotorcortices.Thisfindingcouldimplycorticalplasticity inpatientstoaccommodatefortheauditoryneuropathy. 2. 3. rCBV as compared to both non-responders and surgically excisedlesions.Theinvestigatorsconcludethatpresenceofvery low rCBV values on initial scan in a tuberculoma may be the reasonfornonresponsetoantituberculoustherapy,andmaybe anindicatorofanearlyexcisionespeciallyinlargelesionsand lesionsinposteriorfossa. 4. Brain organization in normative multilingualism. Investigator: Dr. Rose Dawn Bharath (Funding by DST) Languageisasystemofbraincircuits.FunctionalMRIisbeing increasinglyusedtounderstandthedynamicsofbraincircuits especially language. The study was undertaken to assess the neuralsystemsoflanguageinbilingualsbymeansofantonym generationinTamiltoTamil(TT),EnglishtoEnglishLanguage (EE)andcodeswitchingbetweenTamiltoEnglish(TE)using functional Magnetic Resonance Imaging (fMRI). Proficient 16TamilnativespeakersfromruralTamilNadu,SouthIndia participated in the study. Tamil (L1) was first language and English (L2) second language. The Blood Oxygenation Level Dependent (BOLD) signal showed TT uniquely activated prosody and EE activated semantic processing and visual attentionseparately.Thecommonareasforboththelanguages involvedhigherordercognitiveprocessinglikecentralexecutive of working memory, error monitoring, cognitive control, subvocal speech, auditory rehearsal, semantic fluency and visual processing. The code switching task TE was mediated by executive processes, cognitive control, visual attention, semanticprocessing,memoryretrieval,emotionalprocessing, visualprocessing,motor-programmingandarousal.Hence,the language processing in the brainrequires executive processes andcognitivecontrols. The role of T2* perfusion in therapeutic response assessment of CNS tuberculomas. Investigators: Dr. Anatharam, Dr. Rose Dawn Bharath Theinvestigatorsconductedserialfunctionalimaginganalysis using T2* perfusion in 19 patients with tuberculoma with an aimofevaluatingtheroleofperfusionparametersinpredicting response to standard treatment with ATT. Analysis results found that, of the 19 cases of brain tuberculomas evaluated using T2* perfusion, 13 cases with high rCBV on initial scan showedclinicalandimagingimprovement.Sixcaseswithlow rCBVoninitialscandidnotrespondtotreatment.Treatment responders showed statistically significant higher values of 2013-14 Comparison of different sequences of images for effective brain tumor detection, segmentation and volume measurement. Investigators: Dr. Chandrajit Prasad, Dr. AK Gupta (Funding by NIMHANS) Inthisproject,theinvestigatorshavepresentedaKnowledgeBased Brain Tumor segmentation system. It was designed, tested and evaluated for efficient brain tumor segmentation. Two radiologists hand-labeled the tumor slices of interest. Performance parameters were drawn by comparing the manuallylabeledsliceswiththeonesgeneratedbyKBBTS.The images displayed in the results showed that the system was successfulinsegmentingthetumorfromhealthybrainpixels. Themeanvaluesforsensitivity,specificity,accuracy,PPVand NPVwerefoundtobe94.79%,99.6%,and99.39%,91.64%and 99.76%respectively 5. The role of Electroencephalogram functional Magnetic Resonance Imaging (EEG-fMRI) in assessing the neuro-hemodynamic changes induced by Repetitive Trans Cranial Magnetic Stimulation (rTMS) in patients with Writer’s Cramp. Dr. Bhaskar MV. Guides: Dr. Arun Kumar Gupta, Dr. Rose Dawn Bharath, Dr. Pramod Pal The investigators conducted fMRI EEG study on 18 patients withwriter’scrampimmediatelybeforeandafter(1Hz)rTMS session. It was found that rTMS induced hemodynamic and electricalcorrelatesweresignificantlyhigherevenaftersingle session of rTMS. The changes induced by rTMS was not just localized to the subjacent motor cortex but was widespread to even involve the cerebellum. The changes varied between dominantrighthandmotortaskandnon-dominantleftmotor task. Visual correlation analysis of rTMS induced changes in beta spectral power had a similar pattern of distribution on simultaneouslyacquiredEEG.However,changesincerebellum and deeper structures could not be visualized on EEG. The investigators conclude that fMRI is a reliable modality in assessing changes induced by rTMS in patients with writer’s cramp and hence can be a potential tool for development of biomarkerswhileassessingrTMSinducedbrainplasticity. National Institute of Mental Health and Neuro Sciences / 147 Annual Report 6. 2013-14 Clinical and angiographic outcome of endovascular management of the ruptured and unruptured posterior circulation aneurysms. Dr. Bhaskar MV. Guides: Dr. Arun Kumar Gupta, Dr. Arvinda HR, Dr. BIndira Devi A retrospective study of 82 patients treated by endovascular technique of all the posterior circulating aneurysms, from November 1998 to December 2013 was done to evaluate the immediate and long term efficacy, angiographic and clinical outcome of endovascular treatment of posterior circulation aneurysms.Themeanageofpatientswas44.6years.Majority of the patients were females (n=46, 56%), the ruptured aneurysms were 78%, the most common symptom was headache(84%),SAH=Fischergrade3(n=30,46%),followed byFischergrade4(n=22).Unrupturedaneurysmswere18in number. The decreasing order location were in basilar artery (trunk and its bifurcatuion, 35.3%), followed by vertebral artery(n=19,23%)andposteriorcerebralartery(n=16,19.5%). Narrow neck noted in majority of patients (54.8%) and multiple aneurysms in 7 cases (8.5%). The coiling alone was donein34%,stentassistedcoilingin22.6%andparentartery occlusionsin21.3%ofcases.Majorityhadnormalangiography (84%) on follow up, 6 cases showed residual aneurysms, one casewithregrowthofaneurysm.Mortalitywasseenin6cases (7.3%) and significant morbidity in 3 cases (3.6%). The trend of endovascular technique increased in recent 5 years (58%), and42%inlast10years.Thestudysuggeststhatendovascular treatment provides a reasonably safe and effective method of treatment for treatment of both ruptured and unruptured posteriorcirculationaneurysms. 7. Magnetic resonance imaging and neuropsychological abnormalities in survivors of herpes simplex encephalitis. Dr. Gorky Medhi. Guides: Dr. AK Gupta, Dr. Jitender Saini, Dr. Netravathi M, Dr. Keshav Kumar Neurological Rehabilitation 1. International retrospective comparison of nontraumatic spinal cord injury rehabilitation outcomes. Investigator: Dr. Anupam Gupta First retrospective phase of this international project is completed and the prospective phase will commence from April2014.Thisinternationalprojectwasinitiatedintheyear 2009with8spinalinjurycentresparticipating.Latertwomore centers joined and now the project has participation of 10 centersacrossfivecontinentsoftheworld.Theobjectiveofthis projectwasseeingtheinfra-structureavailableacrosstheworld for spinal cord injury (SCI) patients both in developed and developing worlds. The infrastructure includes availability of rehabilitationphysiciansinthesecentersaswellasparamedical staffsuchasnursing,physiotherapists,occupationaltherapists, psychologists,socialworkers,orthotists,counselors,etc.among others. Other than the staff, the facilities available for rehabilitation ofthispatientpopulationlikeurodynamiclabs,balance&gait training labs, ADL skills training labs etc were also observed, noteddownandcomparedamongthecentres. The etiopathological causes of SCI, epidemiology of SCI in hospitals,barrierstoadmissionanddischargeforthesepatients were also noted down, compared and analysed. Patients’ neurological and functional recovery status with inpatient rehabilitationwasalsocompared. The prospective phase of this project would consist of longitudinalstudyinthepopulationgroupandwouldfocusnot only on the abovementioned issues but also other associated complications and co-morbidities observed in these patients usingISCoSdataset. 2. Comparison of antipsychotics for nonneurological adverse effects- Pilot study. Investigators: Dr. Anupam Gupta, Dr. Preeti Sinha (Funding by NIMHANS) Thisresearchproposalaimstoexaminepatientswithpsychotic disorderwhoarestartedonmonotherapywithChlorpromazine, Clozapine, Olanzapine or Risperidone in either in-patient or out-patient setting in prospective manner for a period of 14 weekstoassessthepatternandtime-courseofantipsychotics emergentadverseeffectsincludingsexualeffects,enuresisand postural hypotension and explore urodynamic parameters of antipsychoticsemergentenuresis. 3. Prevalence of depression, fatigue and sleep disturbances in myelopathies and their relation to functional and neurological recovery. Dr. Nitin Menon. Guides: Dr. Anupam Gupta, Dr. Meeka Khanna. Thepurposeofthestudyistoidentifyprevalenceofdepression, fatigue and sleep disturbances in myelopathy patients and to 148 / National Institute of Mental Health and Neuro Sciences Annual Report comparetheseindicatorswithstandardoutcomemeasuresin spinal injuries to determine their correlation with functional outcome and neurological recovery. Outcome measures/ instruments included in the study are: Fatigue Severity Scale (FSS);HospitalAnxietyDepressionScale(HADS);Pittsburgh Sleep Quality Index (PSQI); Barthel Index; Spinal Cord IndependenceMeasures(SCIM) cortical inhibition as evidenced by reduced silent period with escape discharges suggesting asymptomatic changes in the gabanergic system in these patients opening the role of the therapeutic role of GABA agonists in addition to serving as a biomarker in early diagnosis. In patients with AD,CMCT was normalbutcorticalinhibitionwasreduced. 4. 4. Study of effectiveness of robotic hand therapy in patients with stroke: A pilot study. Dr. Nidhi Rawat. Guides: Dr. Meeka Khanna, Dr. Anupam Gupta The purpose of the study is to assess the efficacy of Amadeo robotic hand therapy in stroke patients. It is a prospective observational study in which data of patients diagnosed with strokewithresidualhemiparesisofeitherside,bothin-patient andout-patient atDepartment ofNeurological Rehabilitation (DNR),NIMHANS,Bengaluru,betweenstudyperiodOctober 2013 to May 2014, fulfilling inclusion criteria, would be collected.Allpatientswouldreceive15sessionsoftrainingby theroboticsystem. Outcome measures/ instruments included in the study are: (i) The Fugl-Meyer Assessment (FMA) of upper-extremity function(Upperextremitymotorscore;Upperextremityrange of motion score; Upper extremity pain score) (ii) Medical ResearchCouncil(MRC)score(iii)ForceandROMassessment onAmadeohandrobot Neurology 1. Lafora body disease – Role of malin and ubiquitin protisome pathway in the pathogenesis. Investigators: Dr. Nihar Renjen Jena, Dr.P Satishchandra, Dr. Sudeendra Rao, NBRC, New Delhi (Funding by DST) 2. Kerala-Einstein Study: Healthy lifestyle, vascular disease, and cognitive decline. Investigators: Dr. PS Mathuranath, Dr. Joe Verghese (Funding by National Institute of Health) 3. TMS as a biomarker to differentiate cortical dementias. Investigator: Dr. SR Chandra Transcranial magnetic stimulation showed central Motor conductiontimeprolongedinfrontotemporaldementias.There was evidence for increased cortical excitability and decreased 2013-14 Factors determining cognitive impairment in neurocysticercosis. Investigator: Dr. SR Chandra CognitivedysfunctioninNCCisnotrelatedtothesiteofNCC but it increased with the increasing number, vesicular stage, pro inflammatorycytokine levels as well as there was a trend withcholinesteraselevels. 5. Role of the aldosterone synthase CYP11B2 T-344C polymorphism in vascular cognitive dysfunction associated with SVD. Investigator: Dr. SR Chandra Cognitive dysfunction: The CYP11B2 T-344C gene polymorphism showed an increasing association with hypertension and hyperhomocystenemia but its role in determining cognitive impairmentincerebralSmallVesseldiseasecouldnotbeestablished. 6. Genetic determinants of cognitive impairment in cerebral small vessel disease. Investigators: Dr. Chandra SR, Dr. Rita Christopher (Funding by ICMR, New Delhi) Theaimsandobjectivesofthisproposedresearcharetostudy the contribution of genetic risk factors to the development of cognitive decline in patients with cerebral small vessel disease (cSVD). 103 subjects with cSVD and having cognitive impairmentand96cognitivenormalcontrolsubjectswithSVD wererecruited.Demographicandclinicaldetailsofthesubjects were recorded. Based on brain MRI studies subjects were categorized for radiological severity using Fazekas grading. NIMHANSNeuropsychologicalbatterytest(NNBP)andHindi mentalstateexaminationtest(HMSE)scoreswererecordedfor cognitive function assessment. No significant correlation was observedbetweenradiologicalseverityandcognitivefunction test score. Genotyping for angiotensin converting enzyme Insertion/deletion (ACE I/D) and aldosterone synthase gene (CYP11B2 -344 T/C) gene polymorphisms were studied using directPCRandRFLPmethods.ResultsofgenotypingforACE I/D and CYP11B2 -344T/C gene polymorphism in cases and controlshowthatthesepolymorphismsarenotassociatedwith cognitivedysfunctionincSVD. National Institute of Mental Health and Neuro Sciences / 149 Annual Report 7. 2013-14 Factors determining course and prognosis in tuberculous meningitis. Cognitive functions in idiopathic Parkinsonism. Investigators: Dr. Sikandar Adwani, Dr. SR Chandra Patients with culture positive TBM, multiple co-morbidities, extremes of age and intermittent therapy , drug toxicity necessitatingshifttosubstituteregimesandpresenceoflesions inthecisternalspacesadverselyinfluencedtheoutcome.Most personswithparkinsonismhadexecutivefunctiondefectbutit wasnotinfluencedbythesideofonsetofthedisease. EDTA-Vacutainertubes.Thecollectedbloodsamplesarestored asperprotocolinafridgeandaretransferredtoIISc,Bangalore. Some of the families have been explained about the research underway and requested to bring the rest of the members at follow up so as to collect the samples from them also. So far, collectedbloodsamplesfrom400individualsfrom119families have been collected. For many families, blood samples need tobecollectedfromoneorbothparentsandotheraffectedor normalsiblings.Tillnow50familieshavebeentested. 13. Sleep architecture and disorders in patients with Juvenile Myoclonic Epilepsy (JME) syndrome: A polysomnographic (PSG) study. Investigators: Dr. Sanjib Sinha, Dr. P Satishchandra, Dr. AB Taly (Funding by DST) 8. Glucocerebrosidase mutation in Parkinson’s disease -3 years. Investigators: Dr. Pramod Kumar Pal, Dr. Ravi Yadav (Funding by DBT) 9. Genetics of movement disorders: Genotypephenotype correlates in ataxias and Huntington’s disease. Investigator: Dr. Pramod Kumar Pal (Funding by ICMR) 10. Modulation of clinical features and cortical excitability following low frequency repetitive transcranial magnetic stimulation in Writer’s Cramp and Primary Writing Tremor. Investigators: Dr. Pramod Kumar Pal, Dr. Ravi Yadav (Funding by Others) 11. Gray and white matter correlates of REM sleep behaviour disorder and psychosis in Parkinson’s disease. Investigator: Dr. Pramod Kumar Pal (Funding by ICMR) 12. Detection of known and new genetic mutations and phenotype-genotype correlation in Wilson’s disease from south Indian cohort. Investigators: Dr. Sanjib Sinha, Dr. AB Taly (in association with IISc, Bangalore—funding by DBT) 14. Automated portable epilepsy-EEG system with Axxonet systems. Investigators: Dr. P Satishchandra, Dr. S. Sinha, in association with Axxonet Technologies, Bangalore (Funding by DBT) PatientswithWilson’sdisease,whoarebeingfollowedupatthe Neurologyout-patientservicesatNIMHANS,arebeingrecruited for the study. The recruits undergo a detailed evaluation of history, physical examination and relevant tests. Thepatients alsoundergoMRIofthebrainasperWilson’sdiseaseprotocol, biochemicaltestsforWilson’sdiseaselikeserumcopper,serum ceruloplasmin,and24hoursurinarycopper.Afterobtainingan informedconsentfromthepatientsandtheirfamilymembers, 3-5mlofbloodsamplearecollectedfromeachoftheparents (ifavailable),normalandaffectedsiblings(ifavailable)inNa- 15. Development of Intra-operative ECoG and depth recording electrodes for surgery for refractory epilepsy - part 1. Investigators: Dr. S Sinha, Dr. P Satishchandra (Funding by DEBEL/SBMT) 16. Towards identification of novel genes for reflex epilepsy (hot water epilepsy) triggered by tactile and temperature stimuli. Investigators: Dr. A Anand, JNCASR, Dr. S Sinha, Dr. P Satishchandra (Funding by ICMR) ThesubjectsofJMEsyndromeandcontrolshavebeenrecruited from the Neurology out-patient and emergency services, and screening block, Department of Neurology, NIMHANS. The recruits were selected after a detailed evaluation of history and a physical examination. All the recruits were subjected to standardizedsleepquestionnairestorefinetheselectionprocess; namely the Epworth Sleepiness Scale, the Pittsburgh Sleep QualityIndexandNCSDQ.Thesubjectswerethenmadetogo throughanEEGandaPSGonthesamedayandtheyunderwent an MRI brain subsequently. The drug naïve patients were subjectedtothePSGonthesamedayofassessmentandwere started on suitable medication the very next day. A total of 90 subjectshavebeenrecruitedsofar:PatientswithJME-drugnaïve -30;PatientswithJMEonvalproate–30;andHealthycontrols –30.Tilldate,90polysomnographies,88scalp-EEGand75MRI (brain)havebeendonealongwithphenotypicassessment. 150 / National Institute of Mental Health and Neuro Sciences Annual Report 17. Genetic Analysis of the Beta-glucocerebrosidase gene in South Indian patients with Parkinson’s disease. Investigators: Prof. Arun Kumar, IISc, Prof. Pramod Kumar Pal, Dr. Ravi Yadav (Funding by DBT) In this project, the investigators intend to study the GBA mutations in Indian patients with Parkinson’s disease. More than300patientandcontrolsampleshavebeencollected.The analysisisstillongoing. 18. The role of metals in the etio-pathogenesis of Parkinson’s disease. Investigators: Dr. Pramod Kumar Pal, Dr. Rita Christopher, Dr. Ravi Yadav, Dr. Rose Dawn Bharath, Dr. Jitender Saini (Funding by DBT) Thisisamulti-institutionalprojectaimedatstudyingtherole ofmetalsintheetiopathogenesisofParkinson’sdiseaseandthe objective is to compare the possible disease markers between a cohort of patients with Idiopathic Parkinson’s Disease (PD) andageandgender-matchedhealthycontrols:(i)Serumlevels ofmetalsincludingFe,Cu,Zn,Pb,Mg,Mn,etc.,(ii)Markersof metabolitesofoxidativestressinserum,and(iii)Iron/metal depositioninthebrainasdetectedbyadvancedMRItechniques. 100 patients with Parkinson’s disease and 85 controls were recruitedtillMarch2014.Eachpatient’smotorandnon-motor symptoms were evaluated using different Parkinson’s disease ratingscales.Markersofoxidativestresshavebeenstudiedby theassayofferricreducingabilityofplasma(FRAP)andserum malondialdehyde.Patientshadhigherserummalondialdehyde levels compared to controls. Patients who had MRI analysis for detection of iron/metal deposition in the brain showed significant atrophy mainly in the caudate nucleus, thalamus andcingulategyrus. 19. Exploring subclinical cerebellar dysfunction in patients with essential tremor, primary writing tremor and Writer’s cramp by quantitative characterization of ocular movements and eye – hand coordination and advanced neuroimaging techniques. Investigators: Dr. Pramod Kumar Pal, Dr. K Thennarasu, Dr. Jitender Saini, Dr. Ravi Yadav (Funding by DBT) 20. Spectrum of autoantibody expression in generalized myasthenia gravis: Clinical phenotype and immunological correlation. 2013-14 Investigators: Dr Madhu Nagappa, Dr. Anita Mahadevan, Dr. Shripad Patil, Dr. AB Taly (Funding by NIMHANS) Myasthenia gravis (MG) is an immune mediated disorder characterized by fatigable weakness of skeletal muscles. Heterogeneityintheageatonset,diseaseexpression,associated thymichistology,severityofmuscleinvolvementandresponse to treatment in MG are recognised. This depends on the expression patterns of specific autoantibodies which forms thebasisofclassificationofMGintoimmunologicallydistinct subtypes. Majority of patients are positive for antibodies to acetylcholine receptor. Several other auto-antibodies are expressedinthesepatientswith‘seronegative’MG. The proposed study will investigate the auto-antibody profile inpatientswithgeneralizedMG,includingantibodiestoAChR, MUSK, titin, and ryanodine receptor. Classification based on theauto-antibodystatuswillnotonlyhelptodefinetheclinical subsetsofMGinthecohort,butalsohelpintailoringtherapy andpredictingtheprognosis. 21. Genetics and Epilepsy. Satishchandra Investigator: Dr. P Following projects are being undertaken in collaboration withtheMolecularGeneticsDepartmentofJawaharlalNehru Center for Advanced Studies at Bangalore: After getting two lociforthisuniquetypeofreflexepilepsy;HotwaterEpilepsy – one Chromosone 10q21-23 and another at 4q 24-28. The investigatorsarecontinuingthenextphaseofGenehuntingin theseregions.Theyhaverecentlyidentifiedgene–Glutamate Transporter gene for the causation of Hot-Water epilepsy on chromosome9q.Furtherworkisgoingonthisdirection. Pharamaco-geneticsisanupcomingfieldinepilepsy.Theyhave startedtheresearchworkinlookingat‘PharmacoGeneticsof IntractableSeizures’and‘GeneticsofRefractorinessofEpilepsy’ incollaborationwithJNCASR,BangaloreandInstituteofBio Informatics,Bangalore.FirstpaperonMedicalTemporalLobe EpilepsyGeneticProfiling–isalreadyin. 22. Pregnancy and Epilepsy. Investigator: Dr. P Satishchandra Thisisoneofthecommonlydebatedproblems.Becauseofthe problemsinvolvedinthisarea,andsparseliteratureespecially fromIndia,theinvestigatorsarelookingattheteratogenicityof AEDs,andsuccessfulpreganancyamongepileptics. National Institute of Mental Health and Neuro Sciences / 151 Annual Report 2013-14 23. Reflex Epilepsy. Investigator: Dr. P Satishchandra Reflex epilepsies are interesting variety of seizures/epilepsy classifiedasaseparategroupundertheproposedInternational classification of seizures/epilepsy. These could be used as a modelforfurtherunderstandingthemechanismofepilepsyin general.Henceastudyhasbeenundertakentoevaluatethese reflexseizuresbyAutonomicfunctiontests,Electrophysiological followedbyInterIctal/ictalSPECTscan.Thiswouldhelpinthe processofunderstandingthepathophysiologicalmechanisms. 24. Autonomic Nervous system and Hot water epilepsy. Investigator: Dr. P Satishchandra Hot water epilepsy an interesting variety of reflex seizures is being studied for more than two decades. Currently, the investigators are exploring the role of Autonomic Nervous system and HWE, with a hope that this must be playing an importantroleinitscausation. 25. CJD Registry. Investigator: Dr. P Satishchandra This is ongoing project in collaboration with the Department of NeuropathologyatNIMHANS.Initiallyitwasfundedbutnowitis anon-fundedproject.Thisregistryincludesprobableanddefinite CJDs confirmed histopathologically. The investigators are also partof‘SurveillanceofCJDinIndia’undertheMinistryofHealth. 26. HIV and Nervous system. Investigator: Dr. P Satishchandra Thisisanongoingproject.Sofar,morethan1500patientswith NeuroAIDS/HIVinfectionarebeingevaluatedatNIMHANS. Nearly 140 autopsies have been carried out in collaboration with the Department of Neuropathology. These materials are beingprocessedandanalyzedtounderstandvariousOIs.The dataonCryptococcalmeningitis,andworkonToxoplasmosis, PMLhavealreadybeenpublished.CNSTuberculosisassociated withHIVinfectionisbeingstudied.Theinvestigatorshavejust completed a non-funded study of ‘An approach to focal brain lesions associated with HIV clade C infection’. Interesting associationwithHIVandSino-Venousthrombosis,Lymphoma andNeurosypilishasbeenestablished. Another interesting area is ‘Neuro IRIS’. This is a new area yet to be understood among the scientific community. The investigators are finding cases of patients with their condition worsening on HAART with very high CD4 cell count – a paradoxical reaction. Cases of TBM, Tuberculoma, CryptococcusMeningitis,PMLetchavebeenfound.Theproject isbeingtakenupthisyearasanewinitiativeforfurtherstudy. 27. Resting state fMRI in hot water epilepsy. Investigators: Dr. Raghavendra, Dr. Sanjib Sinha, Dr. Rose Dawn Bharath Frequencyofseizurescouldbeanimportantfactorwhichcan alter the properties of functional brain networks. To explore this possibility, the investigators applied graph theoretical approachtorestingstatefunctionalMRInetworksin36drug naïvepatientswithhotwaterepilepsy(HWE)and18matched healthycontrolsavoidingpotentialconfoundsofanti-epileptic drugs. Seed-based connectivity analysis revealed that HWE with frequent seizures had increased connectivity within the medial temporal structures and several regions with poor connectivityeveninvolvingthedefaultmodenetwork(DMN) in comparison with the infrequent seizure group. Though the infrequent seizure group was similar to the healthy controls inmajorityofseedsandhadpreserveddefaultmodenetwork connectivity, some seeds in the somato sensory cortices, frontallobes,superiortemporalandinsularevealedincreased connectivity. Patients with infrequent seizures have focal network abnormalities, preserved DMN and medial temporal lobeprobablyreflectingdirectfunctionofdiseasehighlyunlike patients with frequent seizures. While features like diffuse network abnormalities, involvement of the DMN and medial temporallobestructuresshouldraisearedflagalertforanearly diagnosisofrefractoryepilepsy,itisencouragingtoinferthat earlyandadequateseizurecontrolcanpotentiallyinterruptthe viciouscycleofseizuresandprogressivenetworkdisruption. 28. White matter abnormalities in Wilson’s disease: A clinical and serial MRI correlative study. Dr. Anish L. Guides: Dr. AB Taly, Dr. Sanjib Sinha, Dr. Jitender Saini This study analyzed 35 patients with Wilson’s disease with brain MRI with diffusion tensor imaging (DTI). Nineteen patients with leucoencephalopathy among the cohort were compared with 16 patients without leucoencephalopathy. These patients were followed up for a mean duration of one year and reimaged. The patients with leucoencephalopathy had more severe illness and disability at baseline though the clinical features were similar except for higher prevalence of seizuresamongthosewithleucoencephalopathy.Thepatients with leucoencephalopathy had severe MRI scores. Their DTI showedincreasedMD,RDandADwithdecreasedFAandpoor therapeuticresponseduringthefollow-up. 152 / National Institute of Mental Health and Neuro Sciences Annual Report 29. Clinico-pathological correlation of peripheral neuropathy in the elderly. Dr. Anish L. Guides: Dr. AB Taly, Dr. Anita Mahadevan, Dr. Madhu N One-hundred elderly subjects with peripheral neuropathy who underwentnervebiopsy(2002-2011)wereanalysedforutilityof nervebiopsyinprovidingdiagnostic,therapeuticorprognostic information that aids clinical management. Nerve biopsy was ‘diagnostic’ in 24, and ‘essential’/ ‘helpful’ in therapeutic managementin81.Itconfirmedpre-biopsydiagnosisin29,and offerednewdiagnosisin25.Ahigheryieldofbiopsywasnotedin subjectswithasymmetric/multiplemononeuropathycompared tosymmetricneuropathies(32.7%vs17.7%).Nervebiopsyaided in detection of potentially treatable disorders and influenced patientmanagementin81%ofelderlysubjectswithneuropathy, includingasubsetwithoutapre-biopsyetiologicaldiagnosis. 2013-14 yieldofvarioustestswas:Neostigminetest55%,Icepacktest 89.4%,RNStest(Orbicularisoculi)40%,andAChRantibodies 55%. CT thorax was normal in 19/19 patients. SFEMG was abnormal in all patients (Frontalis 77.8%, Orbicularis oculi 72.2%).16/20patientswerestartedonPrednisolone(0.7mg/ kg).Duringfollow-up(4-12monthintervals),repeatSFEMGof themoreabnormalfacialmuscle(2-5studies/patient)showed normalizationofjitterat8-15monthsafterstartingtreatment – unlike reported in literature. 4/5 of these patients were on regular treatment. Patients with poor compliance tended to have relapses and abnormal SFEMG. In three other patients, SFEMGafterbecomingnormalworsenedagain. 31. Neurologic sequelae of neonatal hypoglycemic injury: A clinical, Electroencephalographic and imaging study. Dr. Dipesh Pimpale. Guides: Dr. Bindu PS, Dr. Rose Dawn Bharath Neonatalhypoglycemiaresultsinvariousformsofneurological disability in children which include mental retardation, visualimpairment,autisticspectrumdisordersandrefractory epilepsy.Acharacteristicpatternofparietooccipitalgliosison magneticresonanceimagingoftenpointstothediagnosis.This study intends to analyse the different clinical manifestations, EEG features and magnetic resonance imaging findings in a cohortofchildrenwithhistoryofneonatalhypoglycemia.This studyisexpectedtoderiveadataontheneurologicaldisability causedbyneonatalhypoglycemiawhichmaybeusedforbetter preventivemeasures. 32. Leukoencephalopathies in childhood: A phenotypic and magnetic resonance imaging study. Dr. Dipesh Pimpale. Guides: Dr. Bindu PS, Dr. Rose Dawn Bharath Clinico-Pathological Correlation of peripheral neuropathy in the elderly A-C: Definite Vasculitis, D.E: Inflammatory demyelinating polyneuropathy, F-H: Leprous neuritis, I,J: Ischemic Neuropathy 30. Ocular myasthenia gravis: Clinical evaluation, treatment response and prediction of outcome by single fiber electromyography. Dr. Devaraddi Navalli. Guide: Dr. M Veerendrakumar Twentyadultpatientswithsuspectedocularmyasthenia(OMG) were evaluated (October 2010 - January 2013). Diagnostic Leukoencephalopathies in childhood encompass a wide spectrum of disorders in which predominantly or exclusively white matter is affected and usually lead to progressive intellectual and neurological deterioration. Inspite of a high incidenceofleukoencephalopathiesinSouthIndia,thereareno systematicstudiesonthissubjectinIndiancontexttillnow.This studyaimstoanalysethephenotypicandmagneticresonance imagingcharacteristicsofvariousleukoencepahlopathiesseen inchildren. Thedataisexpectedtogiveanoverviewofthedifferenttypes of leukoencephalopathies seen in children from South India whichmaybeusefulintheearlydiagnosis,prognosticationand geneticcounselinginthesechildren. National Institute of Mental Health and Neuro Sciences / 153 Annual Report 2013-14 33. Phenotypic and genotypic correlation of POLG related disorders. Dr. Chetan Kashinkunti. Guides: Dr. Bindu PS, Dr. Gayathri N, Dr. Thangaraj POLG (Polymerase gamma) mutation has recently evolved as oneofthemostcommoncauseofmitochondrialdysfunction. Itpresentswithawiderangeofphenotypes,complicatingthe scenarioforaclinician.Thiscallsforgeneticvalidationofthe suspected phenotype to affirmatively diagnose POLG related disorders.Inatertiarysetupsuchasours,withmitochondrial research growing fast, it would be one more step forward, to studythegenotypicandphenotypiccorrelatesofPOLG related disorders. Investigator: Dr. R Ravikumar (Collaborative project with IOB, Bangalore and SDS TRC & Rajiv Gandhi Institute of Chest Diseases) 7. Proteomic analysis of chronic and acute meningitis using mass spectrometry-based approach. Investigators: Dr. R Ravikumar (Collaborative project with IOB, Bangalore) 8. Comparison between SACETT and SETT on the incidence of VAP in Neuro ICU. Investigators: Dr. Sri Ganesh, Dr. R Ravikumar, Dr. Veena Kumari HB 9. Confirmation and characterization of HA-MRSA and CA-MRSA. Investigators: Dr. Veena Kumari HB, Dr. Nagarathna S (Funding by ICMR) 10. Neuroleptospirosis-study of microbiological and clinical aspects-viral meningitis, Is it neuroleptospirosis? Investigators: Dr. Nagarathna S, Dr. Veena Kumari HB (Funding by ICMR) 11. Neurobrucellosis-microbiological and clinical evaluation. Investigators: Dr. Nagarathna S, Dr. Veena Kumari HB (Funding by ICMR) Neuromicrobiology 1. 2. Whole genome sequencing analysis of Mycobacterium tuberculosis clinical isolates from extra pulmonary tuberculosis patients. Investigators: Dr. R Ravikumar, Dr. P Satishchandra, Dr. Keshava Prasad, Dr. Akhilesh Pandey (Funding by DBT) Genomic and proteomic analysis of chronic meningitis. Investigators: Dr. R Ravikumar (Funding by DBT) Neuropathology 3. Etiopathogenesis of chronic meningitis: Biochemical analysis and molecular characterization of M. tuberculosis and C. neoformans in CSF of patients. Investigators: Dr. R Ravikumar (Funding by ICMR) 1. 4. Phenotypic identification and molecular characterization of blandm-1gene in multidrug resistant Gram negative bacilli isolated from clinical and environmental samples in a tertiary neurocare centre. Investigator: Dr. R Ravikumar 5. Development of novel antimicrobial agents to overcome microbial resistance. Investigator: Dr. R Ravikumar (Collaboration with JNCASR, Bangalore) The different aspects of glioblastoma pathogenesis which are being studied include: Role of epigenetics in glioblastoma development: Genome-wide methylation profiling of glioblastoma, deregulated MicroRNAs in glioblastoma; Identification of molecular signatures specific to tumor infiltrating region relative to tumor core using Magnetic Resonance Image (MRI) guided site specific biopsies; Histology-based evaluation of novel glioblastoma markers by a high-throughput methodology to establish the utility of biomarkerdiscovery. 6. Identification of mycobacterium tuberculosis antigens of diagnostic potential in body fluids using high resolution mass spectrometry. 2. 154 / National Institute of Mental Health and Neuro Sciences Multi-institutional-network programme in molecular Neuro-oncology. Investigators: Dr. Vani Santosh, Dr. Yasha TC, Dr. Arivazhagan, Dr. Paritosh Pandey, Dr. Thennarasu, Dr. Rose Dawn (Funding by DBT) Blood safety. Investigator: Dr. Sundar Periyavan (Funding by Karnataka State AIDS Control Society) Annual Report 3. Blood component separation unit and optimising availability of blood use. Investigator: Dr. Sundar Periyavan (Funding by Karnataka State AIDS Control Society) 4. Molecular and histological analysis of neurological disorders associated with Mitochondrial DNA mutations. Investigators: Dr. Gayathri N, Dr. AB Taly, Dr. Yasha TC, Dr. Nalini A (Funding by DBT) Patients with clinical and magnetic resonance imaging (brainstem, cerebellar basal and ganglia involvement and bilateral symmetrical hypertrophic olivary degeneration) evidence of Leighs syndrome were analysed. Mutation in the SURF1isoneofthemostcommonnuclearmutationsassociated with Leigh syndrome and cytochrome c oxidase deficiency. The study included four patients with Leigh syndrome and SURF1mutationsidentifiedfromacohortof25childrenwith Leighsyndromeseenoveraperiodofsixyears(2006–2012). SequencingofthecompletemitochondrialgenomeandSURF1 wascarriedout.Sequencingoftheentiremitochondrialgenome didnotrevealanyknownornovelvariationsinthesepatients. SURF1 sequencing revealed previously unreported mutations inall.Twopatientshadsamemutationnamelyfourbasepair (TAAA)deletion(c531-533del).Insertionofcytosinec152Cins wasseeninonepatientwhileoneshowedamissensemutation G180R in SURF1. Thus, SURF1 analysis identified previously unreportedmutationsinallthepatients. 5. Protein aggregate myopathies- A clinical, pathological, immunohistochemical, molecular genetics and proteomic investigation. Investigators: Dr. Gayathri N, Dr. Nalini A (Funding by DST) ProteinAggregateMyopathies(PAM)areanemergingsubgroup ofcongenitalmyopathies,whicharemarkedbyaccumulation of diverse proteins within the muscle fibre as a morphologic hallmark,whichnowcomprisediverseentities.PAMaffectthe skeletalmuscleshowever,cardiacmusclemayalsobeaffected occasionally as in Nemaline myopathy and desmin related myoptahies. Most of the disorders share generalized clinical andpathologicalfeatures,suchasmuscleweakness,hypotonia, reduced muscle mass, defective mitochondria, excessive proteinaccumulation,etc.However,variabilityinthefeatures is also observed even amongst different alleles of the same protein. Amongst the several proteins known in the skeletal muscletissue,proteinssuchasmyosin,actin,desmin,vimentin aggregatecausingdiversedisorders.Musclebiopsiesfromfive 2013-14 cases with age ranging from 6 to 58 years analysed showed aggregates of material on MGT staining which on oxidative stains showed absence of enzyme activity in those regions. Detailedworkupforimmunohistochemistrytocategorizethe typeofproteinaggregatesandelectronmicroscopytostudythe morphological appearance of the aggregates was carried out. TwocaseswithaprobablediagnosisofMyosinopathyarebeing analysed. 2D gel electrophoreses carried out in one case of Nemaline rod myopathy identified two spots not seen in the normal muscle. The molecular weight corresponds to troponin and actin. Further confirmation by mass spectrometric analysis is underway. 6. Studies on the seasonal variation in the ultrastructure of the renal sex segment of the lizard, Mubuya carinata. Investigators: Dr. M Bhagya, University of Mysore, Dr. BK Chandrasekhar Sagar (Funding by UGC) The information on Renal Sex Segment (RSS) which is an important accessory sexual organ of squamate reptiles is scarceandfragmentary.ThesecretionsoftheRSSofthemale lizard might have a role in the sustenance and maintenance of spermatozoa in the female genital tract. There is a need for understanding the structure and function of the RSS and other organs including brain during breeding and non breedingseasonsinsquamatereptiles.Thepresentstudyhas been designed to examine ultrastructural seasonal variations of the cells and sexual granules, in terms of development, maintenanceandregressioncorrelatedwithplasmaandrogen concentration in the lizard Mubuya carinata. This study will provide comparative data for expanding knowledge of the ultrastructural variation of the RSS in male squamates, particularly lizards. The chemical characterization of the RSS secretionswillbeofgreatevolutionarysignificance. 7. Genomic proteomic and transcriptomic profiling of tuberculous meningitis. Investigators: Dr. Akhilesh Pandey, Institute of Bioinformatics, Bangalore, Dr. Keshav Prasad, Institute of Bioinformatics, Bangalore, Dr. SK Shankar, Dr. Anita Mahadevan (Funding by DBT) The investigators used a quantitative proteomics approach to discoverproteinbiomarkersfortuberculousmeningitis.Protein isolationfrompathologicallyprovenautopsycasesofTBMand ageandsexmatchedbraintissuesofheadinjurycasesascontrols National Institute of Mental Health and Neuro Sciences / 155 Annual Report 2013-14 weresubjectedtoquantitativeproteomicanalysisusingiTRAQ labelingandLC-MS/MSanalysisofSCXfractionatedpeptideson Agilent’saccuratemassQTOFmassspectrometer.Bothknown and novel differentially regulated molecules were identified. Those described previously included signal-regulatory protein alpha(SIRPA)andproteindisulfideisomerasefamilyA,member 6 (PDIA6), which have been shown to be overexpressed at the mRNAlevelintuberculousmeningitis.Thenoveloverexpressed proteinsidentifiedinthestudyincludedamphiphysin(AMPH) and neurofascin (NFASC) while ferritin light chain (FTL) was found to be downregulated in TBM. The investigators validated amphiphysin, neurofascin and ferritin light chain usingimmunohistochemistrywhichconfirmedtheirdifferential expressionintuberculousmeningitis.Overall,thedataprovides insightsintothehostresponseintuberculousmeningitisatthe molecular level in addition to providing candidate diagnostic biomarkersfortuberculousmeningitis. 8. Toxoplasma gondii genotypes in cerebral and extracerebral toxoplasmosis. Investigators: Dr. RS Jayshree, Professor, Dept. of Microbiology, KIDWAI Memorial Institute of Oncology, Bangalore, Dr. SK Shankar, Dr. Anita Mahadevan (Funding by ICMR) The objective of the study is to investigate the genotypes of Toxoplasma gondii (T.gondii) in two groups of immunocompromised patients viz. (a) HIV positive patients with a confirmed diagnosis of Toxoplasma Encephalitis and (b)PatientswithHematologicalMalignanciespresentingwith extracerebraltoxoplasmosis.MultilocusnestedPCR(MnPCR) forgenotypingT.gondii wasperformedfrombraintissuesfrom toxoplasma lesions from 25 autopsied cases. The PCR results arebeinganalysed. 9. Characterization of host response to C. neoformans through quantitative proteomic analysis of cryptococcal meningitis co-infected with HIV infection. Investigators: Dr. Akhilesh Pandey, Institute of Bioinformatics, Bangalore, Dr. Keshav Prasad, Institute of Bioinformatics, Bangalore, Dr. SK Shankar, Dr. Anita Mahadevan (Funding by DBT) The investigators performed an iTRAQ based comparative proteomeprofilingoffivefrontallobebraintissueseach,from cryptococcal meningitis patients and age and sex matched controls. Theyidentified273proteinstobedifferentiallyexpressed(≥2 fold)fromatotalof3,423humanproteins.Theyfoundproteins involved in immune response and signal transduction to be differentiallyexpressedinresponsetocryptococcalinfectionin humanbrain.ProteinslikeICAM1,CAV1,ACTA2andHMMR protein were upregulated in infection. Increase in Fibrinogen betachain(FGB)proteinandfibrinogendegradationproducts observed in CSF is essential for altering the blood brain barrier. Complement proteins such as C1QB and C1QC and majorhistocompatibility proteins are upregulated and have a role in host protectionImmunohistochemistry (IHC)-based validation was performed for five proteins, three of which wererelativelyoverexpressedincryptococcalmeningitisbrain tissues-Caveolin1,[caveolaeprotein,22kDa,(CAV1)],Major histocompatibility complex, class I, B (HLA-B), Actin, [aortic smoothmuscle(ACTA2)],andtwoshowedreducedexpression in cryptococcal meningitis brain tissues - Peripheral myelin protein2(PMP2),andalpha-crystallinBchain(CRYAB). 10. Host response profile of human brain proteome in toxoplasma encephalitis. Investigators: Dr. Akhilesh Pandey, Institute of Bioinformatics, Bangalore, Dr. Keshav Prasad, Institute of Bioinformatics, Bangalore, Dr. SK Shankar, Dr. Anita Mahadevan,(Funding by DBT) In comparison of frontal lobe of the brain from patients diagnosedwithtoxoplasmaencephalitistocontrolbraintissues, 3,496 proteins were identified, out of which 607 proteins were differentially expressed (≥ 1.5-fold). The investigators validated differential expression of three proteins through immunohistochemistry, confirmed to be consistent with mass spectrometry results. Pathway analysis of differentially expressedproteinsindicatedderegulationofpathwaysinvolved in antigen processing, immune response, neuronal growth, neurotransmittertransportandenergymetabolism. Global quantitative proteomic approach provided the comparativeproteomeprofileofbraintissuesfromtoxoplasma encephalitispatients.Differentiallyexpressedproteinsincluded several new proteins in the context of T. gondii infection, to be further investigated to enhance the understanding of pathogenesisintoxoplasmaencephalitis. 11. 156 / National Institute of Mental Health and Neuro Sciences Understanding mechanism of HIV- associated opportunistic infections of the CNS. Investigators: Dr. Akhilesh Pandey, Institute of Bioinformatics, Bangalore, Dr. Keshav Prasad, Institute of Annual Report 2013-14 Bioinformatics, Bangalore, Dr. SK Shankar, Dr. Anita Mahadevan (Funding by DBT) Theinvestigatorscarriedoutextensivegenomicandproteomic analysis of brain tissues from HIV-associated opportunistic infections of the CNS including cryptococcal meningitis, tuberculous meningitis and toxoplasma encephalitis. Brain tissues from patients of these diseases and corresponding age-sex matched controls were obtained from archives of the Human Brain Bank at NIMHANS. iTRAQ-based quantitative proteomics strategy using high-resolution Fourier transform massspectrometrywasemployedtoidentifytheproteinswhose expression is altered in the brain tissues in response to these diseaseswhencomparedtothatofcontrolbrain.Differentially expressedproteinswereclassifiedbasedonbiologicalprocesses andmolecularfunctionsusingGeneOntology(GO).Functional and pathway analysis using GeneSpring revealed several differentiallyregulatedproteinsinvolvedinbloodbrainbarrier breach,immuneresponse,calciumsignaling,neurotransmitter release, neuronal degeneration, energy metabolism and regulationofactincytoskeletonpathway. 12. Establishment of skin punch biopsy for evaluation of peripheral neuropathies. Investigators: Dr. Anita Mahadevan, Dr. P Satishchandra, Dr. AB Taly, Dr. SK Shankar (Funding by DBT) This is a pilot project aiming to establish the technique of skin punch biopsy as a relatively non-invasive technique for diagnosis of small fibre neuropathies. Normative data of intraepidermal nerve fibre density will be collected from skin biopsiesfromcontrolatdifferentagegroups. Skin biopsies from controls (collected postmortem), patients with neuropathies of varied etiology (hereditary sensory autonomic neuropathy, Guillain Barre Syndrome with autonomicinvolvement,smallfibreneuropathyandHIV/AIDS) have been collected as per established protocol after taking informedconsentofpatients/closerelativeswhencollectedat autopsy.Biopsiesweretakenfromthreestandardsitesinthe lower limb. Cryoprotected samples have been cryoprotected according to the guidelines of the European Federation of Neurological Societies (EFNS), and immunostained by indirect immunoperoxidase with panaxonal marker PGP 9.5 and intreaepidermal nerve fibre density quantitated on serial sections under brighfield microscopy. Determining normative data in the patient population is in progress. The technique has helped in diagnosis of hereditary sensory autonomic neuropathies in children thereby avoiding invasive nerve biopsiesinthesechildrenwithitsattendantcomplications. Normal IENFD in control (3.8/mm) 13. Reduced IENFD in control (2.0/mm) in patient with small fibre neuropathy Role of CNS opportunistic infections in subsequent development of HIV Encephalitis. Investigators: Dr. Carlos Pardo, John Hopkins University, USA, Dr. SK Shankar, Dr. Anita Mahadevan, Dr. P Satishchandra (Funding by NIH) Theprojectaimedatdeterminingextentofglialactivationand neuronal injury in HIV patients with opportunistic infections such as Toxoplasma encephalitis, cryptococcal meningitis and tuberculous meningitis. Quantitative distribution of HIV-1 viruses within different anatomical compartments in brain comparison with non-neural compartments (lymph node, spleen) is under study by estimation of pro-viral DNA copy number by real-time PCR (collaboration with Dr. Ranga Uday Kumar, JNCASR, Bangalore) and determine viral compartmentalization in brain, lymph node and spleen. All the infections were of subtype C and in some cases genetic compartmentalization among brain and non-brain sequenceswereseen.Insomeofthecompartments,switchin receptor usage from R5 to R5/X4 or X4 was found. Pro-viral DNA concentration in frontal cortex was highest and may correlate with development of neurolocognitive impairment in these individuals. In addition, proinflammatory cytokines, chemokinesandTh1/Th2/Th17cytokinesinCSFwasevaluated with BD Cytometric Bead assay to understand pathobiology. Using an indigenously developed “syndrome evaluation system”–DNAchip(M/sXcytonDiagnostics)co-existenceof VZV,HSV,CMV, JCV,was found inpathologically confirmed cases of cerebral toxoplasmosis, crytpococcal meningitis and tuberculosisreflectingco-existenceofotherpathogens. 14. Subregional cytoarchitectural changes and cell cycle dysregulation in the hippocampus in patients with temporal lobe epilepsy. Investigators: Dr. Lily Pal, Dept. of Pathology, SGPGI, Lucknow, Dr. SK Shankar, Dr. P Satishchandra (Funding by DST) Hippocampal Sclerosis (HS), also called Ammon’s horn sclerosisisthemostcommonpathologicalsubstrateinTLEwith National Institute of Mental Health and Neuro Sciences / 157 Annual Report 2013-14 characteristicpatternofneuronallossinprimarilyinCA1and hilarsubfields.Pathologicfindingsmaybewidespreadinsevere caseswithrelativesparingofCA2region.Neuronaldegeneration isaccompaniedbyastrogliosis,lossofmossyfibresinthehilus and mossy fibre sprouts into the supragranular layer of the dentate gyrus. Another frequently associated phenomenon is granule cell migration into the supragranular layer. It is not clear whether granule cell proliferation and dispersion has any relationship with the degree of neuronal loss and gliosis. It is known that p75NTR induces neuronal apoptosis in TLE. However, its association with granule cell proliferation and migration into molecular layer of dentate gyrus is unclear. In this study, the investigators plan to determine neuronal density in inner and outer layer of dentate gyrus, undertsand pattern of granule cell dispersion and its correlation (if any) withdegreeofneuronalloss,estimateMIB1countingranular andsupragranularzone(doesneurogenesisoccurinresponse to therapy?) and study role of p75 NTR expression (is there anyrelationshipexistbetween p75NTRexpressionandabove parameters?) 16. 15. Proteinmisfoldingleadingtoaggregationiswidelyimplicated in the pathologies of such late-onset diseases as Alzheimer’s, Parkinson’s and Huntington’s diseases, amyotrophic lateral sclerosis, type II diabetes and many other systemic and localisedamyloidoses, which are associated with degeneration processes. They all arise from a generic accumulation in the body of unnecessary and potentially hazardous proteinaceous amyloidproducts.InAlzheimer’sdiseasetheamyloidplaques formed from Aβ peptide spread through hippocampus and corticalareasofthebrain.InParkinson’sdiseaseα-synuclein formstheamyloiddepositsknownasLewybodiesinsubstantia nigra. The investigators have shown that inflammation and inflammatory protein S100A9 in particular, whose level significantlyincreasedduringinflammation,maysignificantly acceleratetheamyloidcascade,seedingtheamyloidsofmajor proteinaceousdenominatorofthecorrespondingdisease. Development of the human auditory cortex. Investigators: Dr. Soumya Iyengar, Additional Professor and Scientist V, NBRC, Manesar, Gurgaon, Dr. SK Shankar, Dr. Anita Mahadevan The investigators had earlier found that axons in all layers of the auditory cortex were immunoreactive for heavy and medium chain neurofilaments by 25 GW and the density of the neurofilament-rich plexus in the cortical wall became adult-likeduringthefirstpostnatalyearinhumans.Although neurofilament-positive axons are found throughout the developing auditory cortex, their origins (whether corticocortical or thalamocortical) are not known. To answer this question,theinvestigatorsstudiedtheexpressionofvesicular glutamate transporter (type 1 isoform, VGLUT1 and type 2 isoform, VGLUT2) in the auditory cortex of postmortem humanbrainsatdifferentages.Earlierstudieshaveshownthat VGLUT1 is expressed in the supragranular and infragranular layersprimarilyincortico-corticalsynapseswhereasVGLUT2 isknowntopredominateinlayersIVandVIofthecortexand actsasamarkerforthalamocorticalsynapses.Theinvestigators foundthatmRNAforbothVGLUT1andVGLUT2waspresentin thepresumptivehumanauditorycortexinthesecondtrimester andduringthepostnatalperiod(1year-adulthood).Further, supragranular and infragranular layers of the developing auditory cortex were immunoreactive for VGLUT-1 whereas LayerIVoftheauditorycortexwaslabeledwithVGLUT-2from 25GWonwards. Immunohistochemical studies of involvement of proinflammatory protein S100A9 in traumatic brain injury conditions. Investigators: (Collaboration of HBTR) Dr. SK Shankar, Dr. Anita Mahadevan, Prof. Ludmilla A MorozovaRoche, Professor in Medical Biophysics, Sweden TheaimoftheprojectistostudyifproinflammatoryS100A9 proteinformsamyloiddepositsandserveastriggerforamyloid cascade leading to neurodegeneration. The human brain tissuesfromtraumaticbraininjuryarecurrentlyexaminedon thepresenceofamyloidinclusionsofS100A9andotherrelated inflammatory proteins by immunohistochemistry including singleandsequentialstainingwitharangeofantibodiesapplied in a sequence to the same tissue. The working hypothesis is that the traumatic brain injury may serve as a precursor stateandsignificantlyincreasestheriskofneurodegenerative diseases such as Alzheimer’s and Parkinson’s. Therefore, the immunohistochemical analysis together with in vitro experimentsonS100A9willshedlightonthisissue. 17. Diagnosis of Alzheimer’s disease using fluorescent probes. Investigators: Dr. T Govindaraju, Assistant Professor, Bio-organic Chemistry Laboratory, JNCASR, Bangalore, Dr. Anita Mahadevan Diagnosis of Alzheimer’s disease is possible only at late stage based on behavioral tests or cognition in patients while confirmative diagnosis is achieved only by post-mortem examination of brain. Therefore, AB aggregates are attractive target for developing diagnostic molecular probes to monitor 158 / National Institute of Mental Health and Neuro Sciences Annual Report progressionoftheAlzheimer’sdiseaseaswellastoachievethe early detection of AD. To address this issue the investigators have come up with a fluorescent probe to detect amyloid aggregatescausingAlzheimer’sdisease.Theinvestigatorshave performed all in vitro studies showing binding affinity and selectivity of the probe to amyloid aggregates. Further, the probeoncerebralspinalfluid(CSF)samplesandbrainsample ofAlzheimer’spatientwillbetestedtolocateamyloidplaques inCSF,whichwillbeusefulinearlydetectionofADandalsoin post-mortemexaminationofbrain. 18. In vivo protein interaction network of P.falciparum from severe cerebral malaria patients. Investigators: (Collaboration of HBTR) Dr. SK Shankar, Dr. Anita Mahadevan, Dr. Namita Surolia, Molecular Biology and Genetics Unit, Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore Sequestrationofparasitizederythrocytesinthemicrocirculation of tissues is thought to be important in the pathogenesis of severe falciparum malaria. A major variant surface antigen, var/Plasmodiumfalciparumerythrocyte membraneprotein1, expressedonthesurfaceoftheinfectederythrocyte,mediates cytoadherence to vascular endothelium. To address the question of tissue-specific accumulation of variant types, the investigators propose to analyze ‘var’ gene transcription in braintissueofpatientsdyingwithfalciparummalaria. The investigators also plan to analyze ‘var’ gene transcription fromlung,kidneyandspleenofpatientswhohavesymptomsof ‘multiorgandysfunctions’(MOD)andnotof‘cerebralmalaria’ per say. This analysis would provide the evidence of organspecificaccumulationofP.falciparumvarianttypessuggesting thatparasitizederythrocytescanexhibitpreferentialbindingin the body, supporting the hypothesis of cytoadherence-linked pathogenesis. 19. Identification of Cav 1.3 splice variants in SNpc in Parkinson’s disease. Investigators: (Collaboration of HBTR) Dr. SK Shankar, Dr. Anita Mahadevan, Prof. Vijayalakshmi Ravindranath, Centre for Neuroscience, Indian Institute of Science, Bangalore Parkinson’sdisease(PD)isamovementdisordercharacterized byrestingtremors,bradykinesiaandrigiditycausedbydeathof dopaminergicneuronsinsubstantianigraparscompacta(SNpc) ofthebrain.ThereistheselectivedegenerationofSNpcneurons 2013-14 andtheirterminalsinstriatum.Amongtheseveralhypotheses put forth to address cell death, mitochondrial dysfunction, oxidative stress and accumulation of misfolded proteins in the cytosol (Lewy body) have been studied extensively. More recently it has been shown that SNpc neurons exhibit L-type calcium channel, Cav1.3, assisted autonomous pace-making, which could potentially result in increased cytosolic calcium resulting in neurotoxicity. Thus, Cav1.3 channels could play a role in the selective susceptibility of SNpc neurons in PD. A short splice variant of Cav1.3, Cav1.3-42A has been shown topromotecalciuminfluxintothecellincontrasttothelong variantCav1.3.ThusthepresenceofgreateramountsofCav1.342A relative to Cav1.3 could lead to increased intracellular calcium. The investigators measured the relative levels of Cav1.3andtheshortsplicevariantCav1.3-42Ainmousebrain regions.Concomitantly,levelsofCav1.3weresignificantlyless in ventral midbrain. These results indicate that the presence of Cav1.3-42A in significantly higher concentration in ventral midbrain,couldcontributenotonlytoamplifiedpace-making butalsoresultinincreasedcytosoliccalciumlevelsinneurons thuscontributingtodegenerationoftheseneurons. 20. A retrospective study to evaluate genes expressed in Notch Pathway, prognosis and treatment response in gliomas (Provided Control brain tissues only). Investigators: (Collaboration of HBTR) Dr. SK Shankar, Dr. Anita Mahadevan, Dr. Rajeswari Narayanappa, Department of Biotechnology, DSCE, Bangalore Theobserveddifferencesinclinicaloutcomesinpatientswith histologicallyidenticaltumorsofsimilargradeandsizeislikely to be depend on the sort of molecular differences mentioned above. The identification of these differences at the time of initial surgery will permit the individualized tailoring of therapeuticapproaches. Thisstudyisdesignedtoevaluatedifferentiallyexpressedgenes ofNotchpathwayfromgliomapatientsamples.Retrospective studywillbecarriedoutusingparaffinembeddedtissueblocks. RNA will be extracted after de paraffinization and proteinase K digestion using standard molecular biology techniques. Integrity and quantity of RNA retrieved will be determined by NanoDrop. l Jg of RNA from each sample will be reverse transcribed to cDNA using High capacity cDNA reverse transcriptionkit(AppliedBiosystems). RNAlevelsofthecandidategeneschosenfromNotchpathway willbeassessedbyquantitativereversetranscriptasePCR(RT- National Institute of Mental Health and Neuro Sciences / 159 Annual Report 2013-14 PCR)onaRealTimethermocycler.Quantitativereal-timePCR will be performed using SYBR green PCR Core Reagents to analyzetheamplificationstatusofNotchpathwayrelatedgenes andthreeendogenouscontrolsintriplicate.cDNAmadefrom RNA isolated from normal brain samples will be used at as a controlforeachoftheexperiments. 21. Molecular stratification of adult anaplastic (Who Grade- III) lobar gliomas. Lt Col Dr. KS Rajmohan. Guides: Dr. Vani Santosh, Dr. Paritosh Pandey (Funding by DBT) Theaimofthisstudyistomolecularlystratifyadultanaplastic WHO Grade III lobar gliomas (anaplastic astrocytoma, anaplastic oligodendroglioma and anaplastic mixed oligoastrocytoma)withrespecttotheirexpressionofmolecular markerssuchas1pand19qdeletion,EGFRamplification,p53 mutation. IDH-1 mutation. MGMT methylation, expression of novel biomarkers, INA,GADD45a,YKL40, and to correlate the molecular profiles with histological subtype of AG, thus aimingtoreduceinter-observersubjectivityinhistopathology reporting of adult anaplastic lobar gliomas. Global gene expressionprofilingofAOtumorswillbecarriedoutinorder to identify novel biomarkers of diagnostic and prognostic significance. The study has so far yielded clinically relevant resultsandisinprogress. 22. Paired sample analysis of glioblastoma biomarkers – generating a predictive model for expression at recurrence. Ms. Sharmistha Naskar. Guide: Dr. Vani Santosh In order to understand the molecular genetic changes that occurfollowingrecurrenceandtheircontributiontoincreased aggressiveness,theproteinexpressionofselectedbiomarkers; i.e.;p53,EGFR,IGFBP3,IGFBP5wereevaluatedin30paired samples of GBM and SOX2 protein expression was evaluated in 17 paired samples of GBM that recurred. Interestingly, the investigatorsnotedthatthep53expressionremainsunalteredin thepairedGBMsamples,suggestinganabsenceofapreferential clonalexpansionofp53positiveornegativepopulationfollowing exposuretoradiochemotherapy.Importantly,thepresentstudy demonstratedasignificantincreaseintheexpressionofEGFR (p=0.001)andSOX2(p=0.003)intherecurrentsamplewhen compared to the initial sample of GBM suggesting a possible roleplayedbythesemoleculescontributingtoradioresistance, chemoresistance, increased invasiveness and stemness of the recurrent tumor. Thus, these may be viewed as potential targetsinthemanagementofGBMrecurrence.Usinganovel mathematicalapproach,theinvestigatorshavetriedtogenerate amodeltoassesstheclonalexpansionofgliomastemcellsand thelevelofbiomarkerexpressionatrecurrence. 23. Analysis of gene expression profiles in the peritumoral regions of glioblastoma and functional characterization of novel biomarkers. Ms. Kruthika BS. Guide: Dr Vani Santosh In the current study, the investigators intend to identify genesthatarehighlyregulatedintheperipheryofthetumour compared to the core using the available Microarray data and validate selected genes at RNA and protein levels. Genes thatvalidateatRNAlevel,proteinlevelandalsoexpressedin gliomacelllinesalongwithastrongliteraturebackupwillbe selected for functional characterisation in cell lines by overexpression and/or knockdown studies. The investigators are alsointerestedinlookingattheinvolvementofselectedgenes inChemo-sensitivityandRadio-resistance. 24. Effects of temozolomide and its combination with lonidamine on proliferation, cytotoxicity, ultrastructure and radiation response of malignant human glioma cells. Ms. Kalyani Kumari. Guides: Dr. Vijay K Kalia, Dr. BK Chandrasekhar Sagar, Dr. Jagath Lal G Primary cells of high grade gliomas obtained from tumour biopsies were cultured in EMEM + 20% FBS. Ultrastructural studies(TEM)showedthattheuntreatedgliomacellsshowed roundednucleuswithaprominentnucleolus,plasmamembrane andlotsofmicrovillilikeprocesses.TMZ(10and20µM,4hrs) treatedcellsshowednucleardamage(indentednuclei,nuclear fragments and smooth plasma membrane. Exponentially growingcellsasmonolayerwerefixedinMethanol-AceticAcid andstainedwith0.002%AcridineOrange.Thesecellsshowed variable frequencies and cells, and micro nucleation, even without any cytotoxic treatments. The damage was increased afterTMZandirradiation(1-2GyCo60γray) 25. The role of aquaporin antibodies in the diagnosis and management of neuromyelitis optica and other central demyelinating disorders. Dr. Deepa N. Guides: Dr. P Satishchandra, Dr. Anita Mahadevan, Dr. Rose Dawn (Funding by IAN) 160 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 ALS(NALS-CSF).Quantitativeanalysisofexpressionofvarious proteinsinresponsetoALS-CSFwasstudiedinAstrocytesby immunocytochemistry.Thestudiesrevealedadown-regulation oftrophicfactorsVEGFandGDNFinALS,whileinflammatory markers like IL6, and TNF-α were found to be significantly upregulated, suggesting the role of neuroinflammation in the exacerbationofthedisease. Future studies are directed towards the expression of BDNF, and iNOS in astrocytes, as well as all the aforementioned proteinsinmicroglia. Aquaporin 4 antibodies positive tested in serum of a patient with neuromyelitis optica (Immunfluorecence assay using transfected cell lines) Neuromyelitis optica (NMO) an idiopathic, severe, demyelinating disorder of the central nervous system that preferentially affects the optic nerve and spinal cord. It is being encountered more frequently from India with a significant proportion being earlier diagnosed as Asian variety of optico spinal MS. Discovery of AntiAquaporin 4 antibody serum as specific biomarker for for diagnosis of NMO has been fortuitous. Rigorous studies of the prevalence of Anti-Aquaporin 4 antibodies in NMO and its utility in distinguishing NMO from other CNS inflammatory demyelinating disorders (CIDD) are lacking intheliterature.Thisstudyaimstoestablishtheprevalence of Aquaporin 4 antibodies in patients of NMO and CIDD and to study its utility in differentiating between these two entities and its therapeutic implications. Phenotypic characterization, imaging profile of diagnosed cases of NMOisbeinganalysed. Neurophysiology 1. Glial responses in sporadic amyotrophic lateral sclerosis. Investigators: Dr. TR Raju, Dr. Phalguni Anand Alladi, Dr. Sathyaprabha TN, Dr. Nalini A, Mr. Dinesh Dhull (JRF), (Funding by DBT) Primary astrocyte were exposed to CSF from ALS patients (ALS-CSF)andcomparedwiththeNormalcontrolsandNon- Figure 1: Representative Confocal photomicrographs of cultures stained for the IL-6 (Green) and TNF-α (Red). Note the upregulation of both the proteins in the cultures exposed to ALS-CSF as compared to the Normal controls and NALS, shown quantitatively in the graph(*p<0.5 NC v/s ALS, #p<0.5, NALS v/s ALS for IL-6, and **p<0.01 NC v/s ALS, #p<0.01, v/s ALS for TNF-α) Figure 2: Representative Confocal micrographs of cultures stained for the VEGF (Green) and GDNF (Red). Note the down regulation of both the trophic factors in the cultures exposed to ALS-CSF as compared to the Normal controls and NALS-CSF, shown quantitavely in the graph(*p<0.01 NC v/s ALS for VEGF, and *p<0.05 NC v/s ALS for GDNF) National Institute of Mental Health and Neuro Sciences / 161 Annual Report 2013-14 Mitochondrial Health in Sporadic ALS model Histogram showing Mitochondrial viability in control, control CSF (NC) and ALS groups. Note the significant reduction (21%) in mitochondrial viability in the ALS group. Reactive Oxygen species (ROS) in-vivo Representative Confocal micrographs of cultures stained for the VEGF (Green) and GDNF (Red). Note the down regulation of both the trophic factors in the cultures exposed to ALS-CSF as compared to the Normal controls and NALS-CSF, shown quantitavely in the graph(*p<0.01 NC v/s ALS for VEGF, and *p<0.05 NC v/s ALS for GDNF) 2. Isolation and characterization of toxic factor(s) present in the CSF of amyotrophic lateral sclerosis patients. Investigators: Dr. TR Raju, Dr. Nalini A, Dr. Sathyaprabha TN, Dr. Phalguni Anand Alladi, Dr. MM Srinivas Bharath, Dr. Aparna Sharma (PDF), (Funding by DBT) The present study was designed to investigate mitochondrial dysfunction in the sporadic model of ALS. The mitochondrial damageinlumbarregionofspinalcordinanimalmodelofALS wasevaluatedbyMTTassay,whichshowedsignificantreduction followingALS-CSFinjection.Theoxidativestressassaystoevaluate the reactive oxygen species levels showed an increase in ROS (DCFDAassay).ThesestudiespointoutthatALS-CFSaffectedthe mitochondria.Further,proteomicsofthemitochondrialproteins fromthespinalcordsofALS-CSFinjectedanimalsrevealedupregulation and down-regulation of several key proteins, thereby identifyingthepathwayswhichleadtomitochondrialdysfunction. Histogram showing Reactive oxygen species in spinal cord tissue extract in all the experimental groups. Note the significant increase in released reactive oxygen species shows oxidative stress in the ALS group. Total mitochondrial proteins detected were 965 in the proteomics profile to study the alteration of mitochondrial proteins(spinalcord)insporadicALSmodelofwhich11were up-regulatedand60down-regulated. Proteomics Profile to study the alteration of mitochondrial proteins (spinal cord) in sporadic ALS model Total Mitochondrial Proteins detected - 965 Up-regulated -11 Down-regulated-60 (Critically up-regulated and down-regulated proteins listed below) 162 / National Institute of Mental Health and Neuro Sciences Annual Report Up-regulated proteins Gene Symbol Description (Rattus norvegicus) ALS/NC ALS/C Bnip3I BCL2/adenovirus E1B 19 Kda 2.327 1.799 protein-interacting protein 3-like mt-Co2 cytochrome c oxidase subunit 2.202 1.766 mt-ND2 NADH dehydrogenase subunit 2 2.106 1.732 (mitochondrion) 2013-14 Proteomics analysis revealed up-regulation of Chitotriosidase (CHIT-1)inALS-CSFcomparedtoN-CSF.ThelevelofCHIT-1 wasfurtherevaluatedbyELISAinalargercohortofpatients’ CSF,whichshowed17foldincreaseintheCSFsofALSpatients. CHIT-1didnothaveadirecteffectonviabilityofNSC-34cells asshownbyMTTassay. Down-regulated proteins ALS/NC ALS/C 0.546 0.550 0.472 0.647 0.384 0.382 0.630 0.793 0.788 0.773 0.763 0.762 0.758 0.791 0.788 0.567 0.525 Histogram showing Reactive oxygen species in spinal cord tissue extract in all the experimental groups. Note the significant increase in released reactive oxygen species shows oxidative stress in the ALS group. 4. A study on the profiles of neurotrophic factor in the rat spinal motor neurons following exposure to cerebrospinal fluid from patients with sporadic Amyotrophic Lateral Sclerosis. Investigators: Dr. TR Raju, Dr. Sathyaprabha TN, Dr. Nalini A, Mis. Sumitha (SRF), (Funding by ICMR) Isolation and characterization of toxic factor(s) present in CSF of patients suffering from Amyotrophic Lateral Sclerosis. Ms. Anu Mary Varghese. Guides: Dr. TR Raju, Dr. MM Srinivas Bharath, Dr. Nalini A (Funding by CSIR Senior Research Fellow) Mean Fluorescence intensity (0-255) 250 200 150 100 50 0 NA NC 3. ALS-CSF reduced viability of NSC-34 cells by 40% (** p< 001, ALS-CSF vs NC). CHIT-1 did not have any effect on NSC-34 cells. A B AL S 0.582 SC Description (Rattus norvegicus) cyb5b cytochrome b5 type B precursor RGD 1304982 Quinone Oxidoreductase-like protein 2 ND2 NADH dehydrogenase subunit 2 COX2 cytochrome c oxidase subunit II Atp 5sl ATP synthase subunit s-like protein LOC100910689 cytochrome c oxidase assembly protein COX11, Cox7b cytochrome c oxidase subunit 7B, mitochondrial precursor Uqcr11 Ubiquinol-cytochrome c reductase, complex III subunit XI Sdhd succinate dehydrogenase (ubiquinone) cytochrome b small subunit, mitochondrial Neu4 sialidase-4 LS Gene Symbol C Confocal photomicrographs showing reduced expression of VEGF (approximately 16%) in the motor neurons and also in the extracellular matrix of the ventral horn of the spinal cord of ALS- CSF injected rats compared to the normal control (compare A with B; Also note the reduction depicted in the Histogram ‘C’). * $$ Mean Fluorescence intensity (0-255) 60 # 40 20 A CHIT-1 was up-regulated by 17 folds in ALS-CSF compared to N-CSF. Values are expressed as Mean ± SEM. ***p<0.0001 ALS-CSF vs N-CSF. n = N-CSF:19, ALS-CSF:32 B AL S LS NA SC NC 0 C Quantification of the immunoflourescence intensity showed increased expression of MCP-1 compared to normal control (compare A with B; histogram ‘C’) (*p<0.05, v/s NC, $$p<0.01, v/s SC, #p<0.05, v/s NALS). One-way ANOVA followed by Tukey’s post-hoc test. National Institute of Mental Health and Neuro Sciences / 163 Annual Report 2013-14 Thisstudyinvestigatedtheexpressionofneurotrophicfactors in the spinal cord of rat model of sporadic Amyotrophic lateral sclerosis, using quantitative Real Time PCR and Immunohistochemistry.Asignificantdecreasewasobserved in expression of BDNF, FGF2, IGF1 and VEGF in neonatal rat spinal cords following exposure to ALS-CSF. Down regulationofBDNFmRNAwasmaximum(6.8folds)andthe expressionofBDNFreceptorTRK-Bwasalsodown-regulated followingALS-CSFexposure.Theinflammatoryresponseviz. increasedexpressionofMCP-1was notedfollowingALS-CSF injection.Further,BDNFsupplementationhadasignificant neuroprotectiveeffectontheNSC-34cellsexposedtoALSCSF. 5. Effect of ALS-CSF on the expression of neurofilament subunits in NSC-34 cells. Investigators: Dr. TR Raju, Dr. Sathyaprabha TN, Dr. Nalini A, Dr. Phalguni Anand Alladi, Dr. Vijayalakshmi K (Funding by NIMHANS) the neurofilament sub-units, NF-H and NF-Lin NSC-34 cells upon exposure to ALS-CSF by immunocytochemistry and Westernblottingwasexamined.Theinvestigatorsfoundstable expressionofNF-HinNSC-34cellsuponexposuretoALS-CSF. However,ALS-CSFinducedtheenhancedexpressionofNF-L inthesecellscomparedtothecontrolgroupsviz.Cellsgrown undernormalconditionsandthoseexposedtononALS-CSF. A Nimmunoblot showing bands of phosphorylated and non-phosphorylated epitopes of NF-H. Note, the 70kDa band of NF-L depicted an increase in cells exposed to ALS-CSF (*p<0.05 vs. NC and #p<0.05 vs. NALS-CSF). 6. Expression of NF-H&L in NSC-34 cells. Representative Confocal micrographs of NSC-34 cells Immunolabeled for neurofilament sub-units (NF-H, Green and NF-L, Red). Note that only NF-L (red) shows increased intensity in cells exposed to ALS-CSF. Aggregation of phosphorylated neurofilaments leading to disruptionofaxonaltransportis apathologicalhallmarkofALS. Toinvestigatethepossibilitythataggregationofphosphorylated neurofilaments might have occurred due to the deranged expression of the neurofilament subunits, the expression of Neural correlates of well-being associated with mindfulness meditation: A neuropsychophysiological and neuroimaging study. Investigators: Dr. Bindu M Kutty, Dr. John P John, Dr. Seema Mahrothra, Dr. Nirmala M (SRF), Dr. Jyothi K (JRF) (Funding by DST-CSI) EEG and ERP studies have been completed for 63 subjects; the senior meditators with more than three years of daily meditationexperience(n=23,meanage43yearsand0.3SEM), thenovicemeditatorswith<2yearsofmeditationexperience (n=19,meanage39yearsand0.7SEM)andcontrolgroup(n= 20, mean age 33 years and 0.5 SEM). There were significant differencesinthepeakamplitudeandlatencyofP300studied across groups. The senior meditators showed significantly reducedlatencyforbothstandardandtargetstimulusfromthat of controls and novice meditators. Novice meditators did not showanysignificantdifferencebetweentheothertwogroups. Representative P300 wave form recorded from CZ electrode location 164 / National Institute of Mental Health and Neuro Sciences Annual Report Latency and amplitude of P300 from different electrode locations in Controls, Novice and Senior meditators for target stimulus 2013-14 VSLratsshowedsignificantimpairmentinspatiallearningand navigational abilities in Morris water maze task. Long-term exposure (6 hours per day for 2 months) to CT significantly enhanced the learning performances in Morris water maze task in VSL (Ventral subicular lesion) rats. The rats showed significant differences in their learning performances, both rateoflearningandthetrendoflearninghavebeenenhanced followingexposuretoCT.ThestudysupporttheabilityofCTin establishingfunctionalrecoveryinVSLrats. Latency and amplitude of P300 from different electrode locations in Controls, Novice and Senior meditators for standard stimulus. Figure R1: Represents the latency to reach the platform in Morris Water Maze task using 60 days old rats . (A) During the acquisition from D1-D9; and (B) Ten days after the last acquisition from Normal control (NC), Vehicle control (VC) and Ventral SubicularLesioned (VSL) rats. Graph plots the Mean±SEM (n=12) Note the decrease in escape latency during 9 days (D1-D9) of acquisition of the task followed by retention (R) after 10days between the VSL and normal control (*p <0.05vs NC); and VC (#p<0.05vs VC).and .*p<0.05 was considered as statisticallysignificant. Power spectral density plots of three different meditative states of an advanced meditatorand a novice meditator. 7. Efficacy of behavioral strategies of enriched environment and physical exercise with dietary supplements on establishing a sustained functional recovery in ventral subicular lesioned rats. Investigators: Dr. Bindu M Kutty, Dr. Laxmi T Rao, Dr. Preethi Hegde (RA), Mr. Vijay Kumar K (SRF) (Funding by DBT) ThespatialnavigationalstudyusingMorriswatermazetaskwas usedtoinvestigatetheefficacyofcombinationtreatment(CT)of enrichedenvironment(EE)withphysicalexerciseanddietary supplementation on behavioral and cognitive performances inratswithCNSdegenerationandcognitiveimpairment.The investigatorshavedevelopedtheratmodelwithhippocampal degenerationandcognitiveimpairmentbyselectivelylesioning the ventral subiculum bilaterally (VSL) using ibotenic acid. Figure R2: Latency to reach the platform in Morris Water Maze task in the same rats ( >90 days old ) when tested after 30 days of exposure to CT for VSL rats . Rats from different groups were trained for 9 days . Graph plots the Mean±SEM of latency of the rats to reach the platform from Normal Control (NC), Vehicle Control (VC) and Ventral Subicularlesioned (VSL) rats. Note a significant increase in the latency to reach the platform in the VSL rats in comparison with Normal Control (***p<0.001) and Vehicle group (p###<0.001). Additionally, Nose Poke Operant Task has been carried out to assess the importance of attention and working memory properties of cognition and to investigate whether ventral subicular lesioning (VSL) affect these attributes of cognition. Preliminarystudieshaveshownthatventralsubicularlesioning produced considerable degree of attention and working memory deficits and thus showed significant impairment in National Institute of Mental Health and Neuro Sciences / 165 Annual Report 2013-14 performing the five-hole nose poke operant task. Studies are ongoing to evaluate whether exposure to CT would enhance thecognitiveperformancesinfiveholenosepokeoperanttask. The investigators have standardized the immunostaining for immaturenewbornneuronsexpressingDoubleCortin(DCX). Photomicrograph depicting the DAB stained immature newborn neurons expressing Double Cortin (DCX) positive adult hippocampal progenitors within the subgranular zone (SGZ) of the dentate gyrus Mean percentage of correct responses in a two-choice serial reaction time performance in an operant conditioning task. Both VSL(10 days) and VSL(30 days) rats showed poor performance on day 8 when compared to NC and VC group of rats.NC: Normal control, VC: Vehicle control, VSL (10 days): Ventral subicularlesionedrats (10 days post surgery), VSL(30 days): Ventral subicularlesioned rats (1 month post-surgery). Data is represented as Mean+SE, P<0.0001 Acquisition performance in Nose poke to light stimuli in operant conditioning paradigm on day 8 between groups. Here the comparisons were made between groups showing poor performance in both VSL (10 days) and VSL(30 days) group of rats even after 8 days of training. NC: Normal control, VC: Vehicle control, VS (10 days)L: Ventral subicularlesioned rats (10 days post surgery), VSL(30 days): Ventral subicularlesioned rats (1 month post surgery). Data is represented as Mean+SE, p=<0.0001. 8. Evaluation of EEG dynamics and sleep in long term vs short term practitioners of vipassana meditation. Investigators: Dr. Bindu M Kutty, Dr. S. Sulekha, Dr. TR Raju (Funding by ICMR) 9. Role of amygdala in the modulation of hippocampal and prefrontal cortical functions in stress: Implications for the treatment of affective disorders. Investigators: Dr. BS Shankaranarayana Rao, Dr. TR Raju (Funding by DBT) Severe, traumatic stress or repeated exposure to stress can result in long-term deleterious effects, including cell atrophy and death, which in turn result in memory impairments and behavioral abnormalities. The hippocampus, amygdala and prefrontal cortex are essential components of the neural circuitry mediating stressresponses.Thehippocampusandmedialprefrontal cortex,whichprovidesnegativefeedbackregulationofthe stressresponse,areparticularlyvulnerabletodegenerative changes caused by chronic stress. In contrast, amygdala whichpositivelyregulateshypothalamo-pituitary-adrenal axis undergoes hypertrophy after stress. Several studies havedemonstratedthattheamygdalaiscriticallyinvolved in mediating stress-induced affective behaviors and modulating hippocampal function. Thus, the project was focused to evaluate the role of amygdala in mediating/ modulating stress effects on hippocampal and prefrontal corticalfunctions.Thiswasachievedbyeitherpermanently or temporarily inactivating the basolateral amygdala during stress. The results show that both permanent inactivation of amygdala and the temporary inactivation could prevent chronic stress induced dendritic atrophy 166 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 and volumetric alterations in the hippocampus. Further, itwasalsoobservedthattheamygdalainactivationcould alsopreventstressinducedspatialmemoryanddecreased hippocampal synaptic plasticity. The results show that modulating amygdala can be a potential tool in treating stressinducedcognitivedeficits. Effect of 6h EE on depression-induced anhedonia (A) and behavioural despair (B). Depressed rats exposed to 6h of EE show increased sucrose preference and reduced immobility in the forced swim test indicating a reduction of depressive-like behaviour. Data expressed as Mean ± SEM. One-way ANOVA Followed by Tukey’s post hoc test, ***p < 0.001 vs. NC and ##p < 0.01, ###p<0.001 vs. DEP. NC = Normal control (n = 10), DEP = Depression (n = 10), SA = Saline administered (neonatal) (n = 12), DEP + 6h EE = Depressed rats exposed to 6h of EE for 14 days (n = 12), 6h EE per se = Normal rats exposed to 6h of EE for 14 days (n = 10). Prevention of stress-induced impaired long-term potentiation by inactivation of basoloateral amygdala during stress. Stressed animals showed decreased longterm potentiation when compared with normal animals after high frequency stimulation (HFS). However, BLA inactivation during stress prevented this impairment. Representative fEPSP’s are shown in the inset. Data expressed as Mean ± SEM. Normal control (n=13 slices), ST= Rats subjected to 10 days of immobilisation of stress (n=14 slices), LI+ST= lidocaine inactivation + stress (n=13 slices), VC (SAL) +ST= vehicle control (0.9% saline) + stress (n=14 slices) and SC= sham control (n=12 slices). Bar graphs depicting the magnitude of LTP before and after high frequency stimulation. Stress-induced impaired hippocampal synaptic plasticity is blocked by temporary inactivation of BLA during stress. fEPSP slope values from 0-20 minutes was taken for the before HFS analysis and fEPSP slope between 20-80 minutes was taken for after HFS analysis. Data expressed as Mean ± SEM. Normal control (n=13 slices), ST= Rats subjected to 10 days of immobilisation of stress (n=14 slices), LI+ST= lidocaine inactivation + stress (n=13 slices), VC+ST= vehicle + stress (n=14 slices) and SC= sham control (n=12 slices). One-way ANOVA followed by Tukey’s post hoc test. ***p<0.001, vs. NC; $$$p<0.001 vs. ST. 10. Cellular and molecular basis of endogenous depression induced cognitive deficits. Investigators: Dr. BS Shankaranarayana Rao, Dr. TR Raju (Funding by DBT) Effect of EE on depression-induced learning deficits in the radial arm maze. (A) Depressed rats exposed to 6h EE for 14 days show complete recovery of spatial learning and memory. Depression-induced learning impairment in the last block is completely reversed after EE exposure (B). Data expressed as Mean ± SEM. Two-way ANOVA followed by Bonferroni’s post hoc test, ***p<0.001 vs. NC; ##p<0.01, ###p<0.001 vs. DEP. NC = Normal control (n = 14), DEP = Depression (n = 14), SA = Saline administered (neonatal) (n = 11), DEP + 6h EE = Depressed rats exposed to 6h of EE for 14 days (n = 10), 6h EE per se = Normal rats exposed to 6h of EE for 14 days (n = 10). Depression is the most prevalent forms of chronic mental illness.Currenttreatmentsfordepressionareinadequateand progress in understanding the neurobiology of depression is slow. Depression is known to cause several deficits includingcognitiveimpairments.Severalclinicalstudieshave demonstrated that chronic depression has many deleterious effects on hippocampal,cortical and amygdalar structure and functionthatleadstolearningandmemorydeficits.Although there are structural and functional evidences from human studiesindicatingcognitivedysfunctionindepression,noneof thestudieshaveexaminedtheneuralbasisofcognitivedeficits in depression. Studying cognitive deficits in animal models often helps to discern the cellular and molecular pathologies underlying the disease and develop suitable therapeutic strategies.Accordingly,intheproposedstudytheinvestigators are planning to evaluate the effects of newer antidepressants escitalopram, reboxetine treatment and enriched enrichment on depression-induced cognitive deficits comprehensively at multiple level of neural organization namely, morphological, biochemical, electrophysiological, molecular and behavioral levels.Also,currentstudywillexploreeffectofantidepressant treatmentandexposuretoenrichedenvironmentoncognitive National Institute of Mental Health and Neuro Sciences / 167 Annual Report 2013-14 functions in depressive condition. Neonatal clomipramine exposureresultedinbehavioraldepressionandimpairedspatial learning. Enriched environment ameliorated both behavioral depressionandcognitivedeficitsindepressedrats. The chronic temporal lobe epilepsy rat model has been developed using the chemoconvulsant pilocarpine, and has beenvalidatedbothelectrophysiologicallyandbehaviorally. 12. 11. Evaluation of antiepileptic activity of medicinal plants in animal models of epilepsy. Investigator: Dr. BS Shankaranarayana Rao (Funding by DST) Epilepsy is the third most common neurological disorder and in many cases, even multi-drug therapy is not effective and neurosurgical procedures may be indispensable. The current therapeutictreatmentofepilepsywithmodernantiepilepticdrugs (AEDs) is associated with side-effects, dose-related and chronic toxicity,andteratogeniceffects.Drugsalsohavelowtherapeutic window so it need continuous therapeutic drug monitoring and approximately30%ofthepatientscontinuetohaveseizureswith currentAEDstherapy.Further,alargenumberofdruginteractions seen with almost all current antiepileptic drugs make it more difficult to attain easy control on seizures. Traditional systems ofmedicine have beenexploringnumberofmedicinalplantsas an effective treatment of epilepsy over the past centuries but so far have not got the place among the standard anticonvulsant medication because their efficacy has not been established. The idealanti-seizuredrugwouldsuppressallseizureswithoutcausing majoradverseeffects.Thus,researchforfindingnewdrugswith less adverse effects and more efficacy, seems to be essential. Accordingly,thestudyfocusesontheevaluationofantiepileptic potentialofmedicinalplantstofindoutthemechanismofaction responsibleforitsantiepilepticactivityalongwithpossibleactive constituents responsible for the same. Extractions of plants Eclipta albaandPistacia integerrimawillbeusedforevaluation of antiepileptic activity and also in combination with standard antiepileptic therapy. Further evaluation of effect of particular fraction of the extract for effects of synaptic plasticity in the hippocampuswouldbestudied. Temporal alteration in EEG power spectrum from the sensory motor cortex. Baseline (A), SE (B), 24h post SE (C), 48h post SE (D), 5days post SE (E) and 10 days post SE (F). X axis: Frequency bands: low Delta (0.5-2.5Hz), Delta (0.5-4Hz), Theta (4-8Hz), Alpha1 (8-10Hz), Alpha2 (10-13Hz), Beta (13-30Hz), Gamma (30-45Hz), Theta-Alpha (6-10Hz), Sigma (11-14Hz); Y axis: Absolute power (µV2). n=4. Effect of celestrus paniculatus on cognitive deficits in chronically stressed rats: A behavioral, neurochemical, structural and electrophysiological approach. Investigator: Dr. BS Shankaranarayana Rao (Funding by DST) Chronic stress impairs spatial learning in radial arm maze and chronic Celastrus paniculatus treatment to stressed rats ameliorated learning impairments. (A) Acquisition of the RAM task across trails (B) Show performance in blocks 7 and 8. Data is represented as mean ± S.E.M. NC: normal control. ST: rats subjected to restraint stress for 21 days (6h/day). ST+ VE, ST + CP-400 and ST + CP-600: stressed rats subjected to 14 days of treatment with vehicle, Celastrus paniculatus 400 or 600 mg/kg, i.p., respectively. One-way ANOVA followed by Tukey’s post-hoc test. ***p<0.001 Normal vs stress. $$p<0.01 stress vs stress + drug treatment. Severe,traumaticstressorrepeatedexposuretostresscanresultin long-termdeleteriouseffects,includinghippocampalcellatrophy anddeath,whichinturnresultinmemoryimpairments.Chronic stressisknowntoprecipitateseveralaffectivedisordersincluding depression,posttraumaticdisorderandanxiety.Drugsofnatural originareknowntopossesseffectsonthecentralnervoussystem and are emerging as promising alternative therapies in the treatment of psychiatric disorders. Accordingly, the aim of the presentstudywastoevaluatetheeffectofCelastrus paniculatus oil treatment on stress-induced spatial learning and memory impairment, changes in acetylcholinesterase (AChE) activity and synaptic plasticity in the hippocampus. Male Wistar rats were subjectedtorestraintstressfor21days(6h/day).Stressedratswere treatedwithCelastrus paniculatusoilfor14days.Theinvestigators observed that chronic restraint stress impaired spatial learning in partially baited radial arm maze.Interestingly, Celastrus paniculatustreatmentamelioratedstress-inducedspatiallearning impairmentinradialarmmazetask.Thus,thestudyindicatesthat Celastrus paniculatusisapotentialnaturaldrugforthetreatment ofstress-inducedspatiallearningimpairment. 13. 168 / National Institute of Mental Health and Neuro Sciences Cellular and molecular basis of epilepsyinduced cognitive deficits. Investigator: Dr. B.S. Shankaranarayana Rao, Dr. Meghna Saxena (Funding by DBT) Annual Report 2013-14 modeled depressive-like phenotype in adult male Wistar rats and validated depressive-like behaviour using the sucrose preference and forced swimming tests. Depressive animals demonstrated enhanced anxiotypic behaviour in the openfield test and reduced dendritic arborization was observed in hippocampalCA1neuronsusingtheGolgi-coxtechnique.Itis possiblethatthisstructuralalterationcontributestoimpaired learning and poor synaptic plasticity. The aim of the study is to use the knowledge from these experiments in developing effectivestrategiestotreatdepressiveillnesses. Epilepsy-induced reduction in the volumes of the hippocampus. Alterations in hippocampal and dentate gyrus volumes following 24h, 40d and 54d following status epilepticus. (a) left hippocampus, (b) right hippocampus, (c) left dentate gyrus and (d) right dentate gyrus. **p≤0.0001 compared with respective control group (student-t test). About 1% of human population worldwide suffers from epilepsy.Otherconditionsassociatedwithepilepticseizuresare learning and memory impairments. Among different types of epilepsy,temporallobeepilepsyisthemostcommononeandis characterizedbyrecurrentseizures,whichisoftenrefractoryto drugtherapy.Ithasbeenreportedthatenrichedenvironment is shown to be helpful in treating animal model of stress, Alzheimer’s,Parkinson’sandHuntington’sdisese.Inaddition, enriched environment is shown to be effective in enhancing hippocampal neuronal plasticity and improves hippocampal dependent learning and memory functions in animal models. Therefore,thecurrentstudyassessestheeffectofantiepileptic drug and influence of enriched environment on cellular and molecularchangesassociatedwithepilepsy-inducedcognitive deficits.Theinvestigatorsareusingthreedifferentinterventions for this study: (a) new generation antiepileptic drugs, (b) enriched environment, (c) the combination of anti-epileptic drugs and enriched environment. Lithium-pilocarpine model wasusedtoinducetemporallobeepilepsyinWistarrats.Cellular and molecular changes in terms of morphological alteration, glial response, neuronal death, synaptic plasticity, calcium binding proteins, proliferation, survival and differentiation of neuronsfollowingepileptogenesisisbeingstudied. 14. Cellular, molecular and electrophysiological basis of depression-induced cognitive deficits. Investigator: Dr. BS Shankaranarayana Rao, Dr. Mahati Krishna, (Funding by CSIR) Thecurrentprojectwasdesignedtounderstandthebiological basis of major depressive disorder. The investigators Depressive-like animals have fewer intersections on apical (left) and basal dendrites (right) in CAi pyramidal neurons of the hippocampus. Sholl’s analysis of pyramidal neurons showed that depressive like animals had lesser dendritic arborization compared to normal animals. Data expressed as Mean ± SEM. repeated measures Two-way ANOVA followed by Bonferroni’s post-hoc test **p≤0.01, ***p≤0.001 vs. NC. 15. Maternal separation anxiety and fear learning/ memory: Effects on sleep architecture in adulthood. Investigators: Dr. Laxmi T Rao, Dr. Bindu M Kutty, Ms. Shravanthy (JRF), (Funding by CSIR ) The impact of early maternal separation and isolation stress during stress hyporesponsive period (SHRP) on fear memory retention and sleep in rats were studied. Since REM sleep is important to integrate newer information with previously stored emotional experiences, neuronal replay during REM sleep was analyzed in a greater detail. Rats were subjected to maternalseparationandisolationstressduringpostnataldays 5-7timesdailyforsixhoursforaperiodofthreedays.Thesleep studyandfearmemoryretentiontestwerecarriedoutintwomonth-old rats. The neuronal replay during REM sleep was analyzed using different parameters.The investigators found that MS rats had showed increased time in sleep and REM sleepperse.Thiswasassociatedwithincreased fearmemory retentionandfeargeneralization.Thedetailedanalysisofthe local field potentials during REM sleep across different time period of REM sleep showed increased theta oscillations (612Hz)inthehippocampus,amygdalaandcorticalcircuits.The increased fear generalization and increased REM sleep with variationsinneuralreplayinMSratscouldbepossiblyrelated tothepersistentactivityoftheHPAaxisduringtheSHRP. National Institute of Mental Health and Neuro Sciences / 169 Annual Report 2013-14 16. A multimodal approach to evaluate the efficacy of enriched environment in ameliorating early maternal separation induced changes in brain function: A morphological, biochemical and behavioural study in rats. Investigators: Dr. Laxmi T Rao, Dr. Bindhu OS, Jain University, Bangalore (Funding CSIR and ICMR) 17. Evaluation of age-related synaptic changes in human substantia nigra pars compacta. Investigator: Dr. Phalguni Anand Alladi, Dr. TR Raju, Ms. Jyothi HJ (JRF), (Funding by ICMR) The investigators have earlier found that the synaptic proteins synaptophysinandsynaptotagminshowedonlyamildreductionwith ageinthenigraofAsianIndianssuggestingfairextentofpreservation. Synaptogamin being a calcium sensor, the investigators further studied the expression of the glial calcium binding protein S100β toevaluatetheroleofgliaincalciumsequestration.Densitometric analysisperformedineachofthesubsectionsi.e.medial,intermediate and ventrolateral regions of human nigra revealed that the glial calcium binding protein did not show significant alterations in expression with age, possibly suggesting absence of active calcium overloadwithaginginthispopulation. A representative photomicrograph showing S100b expression in the glia in human substantia nigra pars compacta. The scatter plot shows stable expression of the protein with age. 18. dopaminergic (DA) neurons during development, adulthood andagingcouldelucidatetheetiopathogenesisofPD.However, suchstudiesinhumansarenotfeasible;thereforetwodistinct micestrainsandtheirF1crossbredswereusedasexperimental models to understand the phenomenon seen in these ethnic populations. The differentiation and survival associated proteinsarebeingstudiedinthem. Confocal images of Tyrosine hydroxylase (TH) expression (A&B, Red) in the substantia nigra of C57BL/6 mice. The neurons were labeled with TUNEL to identify apoptotic cells (arrows, C) and Bax (D). On a Western blot (E) note the higher expression of TH in the adult CD1 mice (which have more number of dopaminergic neurons), compared to the C57Bl/6 mice. 19. Glial responses in Sporadic Amyotrophic Lateral Sclerosis: An in-vitro experimental study. Ms. Pooja Shree Mishra. Guides: Dr. TR Raju, Dr. Sathyaprabha TN, Dr. Nalini A (Funding by UGCCSIR Senior Research Fellowship) Primary astrocyte and microglial cultures were exposed to CSF from ALS patients (ALS-CSF) and compared with the Normal controls and Non-ALS (NALS-CSF). Quantitative analysisofexpressionofvariousproteinsinresponsetoALSCSF was studied in Astrocytes by immunocytochemistry. Thestudiesrevealedanup-regulationofPGE2andCOX-2, suggestingneuroinflammation.Themicroglialcellsshowed morphological transformation from ramified to amoeboid, increased proliferation, and enhanced Iba1 expression suggesting neuroinflammatory activation in response to ALS-CSF. Evaluation of developmental apoptosis and nigral neuronal response in two mice strains with differential sensitivity to 1-methyl-4-phenyl-1, 2,3,6- tetrahydropyridine (MPTP) and their crossbreds. Investigator: Dr. Phalguni Anand Alladi, Dr. TR Raju, Mr. S Niranjan (JRF), (Funding by Science and Engineering Research Board, DST) SeveralepidemiologicalstudiessuggestthatParkinson’sdisease (PD) is less prevalent in Indians compared to Caucasians. In Anglo-Indians,anadmixedpopulationofEuropeanandAsianIndianorigins,itisfivetimeslessprevalentthanIndiansrather thantheexpectedaveraging.Studiesinthesepopulations,on 170 / National Institute of Mental Health and Neuro Sciences Annual Report Representative Confocal micrographs of cultures stained for the COX-2 (Green) and PGE2 (Red). Note the upregulation of both the proteins in the cultures exposed to ALS-CSF as compared to the Normal controls and NALS-CSF, shown quantitatively in the graph(*p<0.5 NC v/s ALS, #p<0.5, NALS v/s ALS for COX2, and *p<0.05 NC v/s ALS, #p<0.05, NALS v/s ALS for PGE2) In this study, the expression of microRNA-206 (miR-206), a key regulator in the muscle regeneration process was analysed. QuantitativeRealTimePCRwasperformedtoassessthechanges in the gastrocnemius and biceps brachii of ALS-CSF injected neonatalrats.The3.7foldup-regulationinthegastrocnemiuscould beacompensatorymechanismasitrepresentsthere-innervation processfollowingdenervation.However,inthebicepsbrachii,miR206 showed a 2-fold down-regulation, indicating a difference in theprogressionofthediseaseinthedifferentlimbs.Theseresults highlighttheinvolvementofmusclesinthediseasepathology. 21. Pathophysiology of Skeletal muscle in Amyotrophic Lateral Sclerosis (ALS)- An experimental study in a rat model. Ms. Shruthi S. Dr. TR Raju, Dr. Gayathri N, Dr. Phalguni Anand Alladi, Dr. Nalini A (Funding by CSIR) Normal Control Phase contrast images of the Microglial cultures. Note the transformation of Microglia from the ramified (resting) to amoeboid (activated) morphology. Iba1 expression was also increased in ALS-CSF groups as compared to NC. The graph shows the increased viability of microglia in ALS-CSF group as compared to NC and NALS-CSF groups (**p<0.01 NC v/s ALS) 2013-14 ALS-CSF injected Representative confocal images showing fragmented and extrajunctional NMJ in ALS-CSF injected group as compared to normal. 20. Altered expression of miR-206 in the gastrocnemius and biceps brachii of ALS-CSF injected Wistar rats. Dr. R Sumitha. Guides: Dr. T R Raju, Dr. Phalguni Anand Alladi, Dr. Nalini A (Funding by NIMHANS and CSIR ) Effect of ALS-CSF on expression of microRNA-206 in rat gastrocnemius and biceps brachii. The fold change is calculated following normalization to the endogenous gene (SRP9) relative to the value of normal control. microRNA-206 expression was increased by 3.7 fold in the gastrocnemius and reduced by 2 fold in the biceps brachii of rats injected with ALS-CSF compared to the normal control. Normal Control ALS-CSF injected Representative confocal images of skeletal muscle stained for BDNF (green) and IGF-1(red). Note the down regulation of both BDNF and IGF-1 in ALS-CSF injected group as compared to normal control. National Institute of Mental Health and Neuro Sciences / 171 Annual Report 2013-14 The aim of the study was to investigate the changes induced by AmyotrophicLateralSclerosis-CerebrospinalFluidintheskeletal muscles of rat. The extensor digitorum longus muscle showed distinctpathologicalchanges.Theα-bungaratoxinstainedNMJs appearedpretzel-likeincontrolanimalswhereasthoseinALS-CSF group were extrajunctional and fragmented into small clusters; thusweredysmorphic.Theexpressionoftheneurotrophicfactors namely,IGFandBDNFwasdown-regulated. The cognitive function being assessed include a component of visual ‘gestaltperception’andauditory‘corollarydischargemechanism’.Sleep studyhasbeencarriedoutin45schizophreniapatientsand27controls, sofar.Ofthese,ERPstudywasdonein23schizophreniapatientsand7 controls.fMRIstudyhasbeeninitiatedin7schizophreniapatientsand8 controls.Thefollowingtabledepictssomeofthepreliminaryresultsfrom sleepstageanalysisfromPolysomnographydataof15controlsand21 schizophreniapatients.Thepatientgroupclearlyhasashorterfirstsleep cycleandoverallwakeupmoreoftenfromthemiddleofsleep,thanagematchedcontrolsubjects. 22. Neural correlates of well-being in long term rajayoga practitioners - A multimodal study. Mr. Ajay Kumar Nair. Guides: Dr. Bindu M Kutty, Dr. John P John, Dr. Seema Mehrotra Meditationandspiritualpracticesareknowntoenhancewell-being. However, the underlying neural correlates and processes are not well understood. The study uses Psychological assessments,EEG, ERP and fMRI for correlating well-being in long term Rajayoga practitioners(BrahmaKumaristradition).Analysisofsurveydata from over 1000 Rajayoga practitioners, from across the country, has been completed. High density EEG, ERP recordings and Psychologicalassessmentdatafromover50Rajayogapractitioners havebeenacquiredandfMRIacquisitionshavebegun. Sleep stage distribution across first 3 sleep cycles in Healthy controls and Schizophrenia patients 24. Behavioral validation of cognitive dysfunction in a rat model of schizophrenia. Ms. Neethi Prem. Guides: Dr. Bindu M Kutty, Dr. Laxmi T Rao, Dr. John P John (Funding by NIMHANS) N2PC (N2 Posterior Contralateral ERP) at PO7 shown for the “Who” intermediate level of the ANGEL task: As expected, the contralateral waveform (blue, indicated with a | mark that denotes latency and amplitude) shows a greater negative dip compared to the ipsilateral presentation. 23. Examination of aberrant neural synchrony in schizophrenia – A multi-modal EEG, fMRI and polysomnography study. Mr. Arun. Guides: Prof. Bindu M Kutty, Dr. John P John (Funding by ICMR) The study is an effort to find a correlation between EEG and fMRI parameters of cognitive functions,and sleep EEG parameters in schizophreniapatients,minimallyexposedtoanti-psychoticmedications. The neurodevelopmental theory of schizophrenia (Murray & S.W.Lewis,1987;Weinberger,1987,1995)postulatesthatthe pathogenic conditions leading to schizophrenia occur in the middlestageofintrauterinelife,longbeforetheformalonset ofsymptoms.Anumberofmodelshavebeendevelopedbased on this theory and one such model is the Neonatal Ventral HippocampalLesion(NVHL)Modelwhichisthefocusofthe currentstudy. Thisstudyaimstoassessthecognitivedeficitsassociatedwith neural circuitry between prefrontal cortex, hippocampus and amygdala, the brain regions that are shown to be implicated in schizophrenia. Changes in neural circuitry between these regionswillbeassessedbyelectrophysiologicalstudies–single unitactivityinmedialprefrontalcortexduringdecisionmaking task. Pathophysiologicalchangessuchascellularandmorphological changes in prefrontal cortex, hippocampus and amygdala are observedinpostmortemstudies.Thesestudieshavealsoshown 172 / National Institute of Mental Health and Neuro Sciences Annual Report lossofGABAergicneuronsintheseregions.Thus,celldensity andvolumetricanalysisoftheseregionswillbeundertakenin NVHLratsandimmunohisotologicalassessmentofGABAergic neurons using Glutamic Acid Decarboxylase 67 (GAD 67) as markerisbeingperformed. NeonatalVentralHippocampalLesion(NVHL)modelhasbeen standardized and NVHL rats have been obtained. Behavioral experimentssuchasopenfield,socialinteractionandpre-pulse inhibitionareongoingusingNVHLrats.GAD67immunohistologicalstudieshavealsobeeninitiatedinexperimentalrats. Representative images of Immunohistological staining of Glutamic Acid Decarboxylase 67 (GAD67). Arrows show GAD 67 + neurons. 25. Role of enriched environment and antiepileptic drugs on epilepsy-induced Cognitive deficits. Ms. Vrinda M. Guides: Dr. BS Shankaranarayana Rao, Dr. Bindu M Kutty (Funding by CSIR) 2013-14 Temporallobeepilepsy(TLE)isthemostcommonformoffocal epilepsy and is often intractable. Cognitive impairments are thehallmarkofTLE,butareoftenassociatedwithcomorbid conditionslikeanxietyanddepression.Inthepresentstudy, the investigators have used a rat model of chronic TLE to assess the spatial learning and memory. Conventional Antiepileptic drugs (AEDs) reduce seizure frequency but not the cognitive deficits and behavioral abnormalities. On the other hand, newer AEDs are thought to be better in this regard. Moreover, animal studies have shown promising results with exposure to the Enriched Environment (EE) as a therapeutic intervention in neurodegenerative disorders. Accordingly,theroleofEE,newerAED(Levetiracetam)and combination of EE and AED on epilepsy-induced cognitive impairmentswereevaluated.Chronictemporallobeepilepsy (TLE,Lithiumpilocarpine)modelwasdevelopedandepilepsy was characterised electro-physiologically by studying EEG and behavioral validation by Racine’s scale of epilepsy. In the present study cognitive deficits were evaluated using Morriswater maze(MWM),awell-established testtoassess hippocampus-dependent spatial learning and memory in rodents.Epilepticratsshowedimpairedspatiallearningand memory compared to normal rats by displaying increased latency to reach the hidden platform, spending less time in thetargetquadrantandincreasedthigmotacticbehaviourin theMWM.EEexposureshowedonlypartialrestoration,AED (Levetiracetam)treatmentshowednearcompleterestoration, whereascombinationofEEandAEDtreatmentshowedbest restorationofcognitiveimpairment Combination of EE and AED treatment showed best restoration of cognitive impairment when assessed using Morris Water Maze (MWM) test. 26. Depression-induced cognitive deficits: Effect of modulation of glutamatergic transmission and brain stimulation reward. Ms. Suwarna Chakraborty. Guides: Dr. BS Shankaranarayana Rao, Dr. TR Raju (Funding by NIMHANS) National Institute of Mental Health and Neuro Sciences / 173 Annual Report 2013-14 Depressionischaracterizedbyanhedonia,decreaseinsynaptic plasticity,enhancedanxiety,memorydeficitsandglutamatergic imbalance leading to excitotoxicity in the brain. Strategies thatcombatexcitotoxicityandenhancefunctioningofreward pathwaysmaybebeneficialintreatingdepression.Thepresent studywillexaminetheeffectofmodulationofbrainstimulation reward and glutamatergic system at different levels of neural organization to rescue endogenous depression-induced cognitiveinrats.Itwasobservedthatdepressedanimalsshow anhedonia and increased behavioral despair compared to normalanimals. Depressed animals show elevated immobility and anhedonia. A. Depressed animals exhibit enhanced immobility indicating behavioural despair as compared to control. B. Depressed animal were more anhedonic as compared to control. Data expressed as Mean ± SEM. *p<0.05 **p<0.01 vs. Normal control, Student’s t- test. 27. Role of Celastrus paniculatus on hypobaric hypoxia induced oxidative stress and cognitive deficits in Wistar rats. Mr. Vijaya Kumar K. Guide: Dr. BS Shankaranarayana Rao (Funding by NIMHANS) anxiolytic activity. However, it is not known whether CP can produce its beneficial effects in hypobaric hypoxic condition. Even though hypobaric hypoxia causes brain dysfunctions at differentlevelsofneuralorganization,thetreatmentstrategies areyettobeevolved.Accordingly,thepresentstudyisdesigned to investigate the role of Celastrus paniculatus on hypobaric hypoxiainducedcognitivedeficitsandassociatedbiochemical alterations. The study demonstrates that exposure to seven days of hypobaric hypoxia induced working memory deficits and enhanced anxiety like behavior. Markers of oxidative damageinvariousbrainregionswerealsostudiedanditwas found that hypoxia exposure differentially impacts oxidative status.ChronicCelastrus paniculatustreatmentcouldrestore hypobarichypoxiainducedcognitivedeficitswithoutrestoring oxidativestressindiscretebrainregions. 28. Role of amygdala in stress-induced cortical plasticity. Mr. Sunil J Tripathi. Guides: Dr. BS Shankaranarayana Rao, Dr. TR Raju (Funding by DBT) Chronicstresscausesdeleteriouseffectonlearningandmemory and integrity of prefrontal cortex. The amygdala is critically involved in mediating stress-related effects on behavior and modulating frontal cortical function. The current study was designed to investigate the role of temporary inactivation of basolateralamygdala(BLA)onchronicimmobilizationstressinduceddeficitsinprefrontalcorticaldependentlearningand memory.TheresultsshowedthatBLAinactivationsignificantly prevented stress-induced deficits in novel object recognition task.Theoutcomeofpresentstudyprovidesstrategiestotreat stress-induceddeficitsbymodulatingBLA-mPFCcircuitry. Restoration of hypobaric hypoxia induced enhanced anxiety. Thereductioninbarometricpressureandtheconsequentfall in the partial pressure of oxygen at higher altitudes lead to hypobaric hypoxia (HBH). HBH caused alterations in mood, psychomotorperformance,perceptiveprocessesandcognitive deficits. However, the neurobiological mechanisms that underlie these impairments are poorly understood and more importantlycombatingHPHinducedbraindysfunctionsisnot yetfullyestablished.Manystudieshaveusedsyntheticaswell asherbalinterventionstocombathypobarichypoxia-induced brain dysfunctions. Hypobaric hypoxia results in oxidative stress,impairedlearningandmemoryandenhancedanxiety.On theotherhand,CPpossessesantioxidantandneuroprotective activities, improves learning and memory, and demonstrates Temporary inactivation of BLA prevents the stress induced learning and memory deficits in novel object recognition test. 29. Role of enriched environment and antidepressants treatment on chronic stressinduced cognitive deficits. Ms. Shilpa BM. Guide: Dr. BS Shankaranarayana Rao (Funding by CSIR) Chronicstressresultsincognitivedeficitsincludinganxiogenesis and depressive symptoms. The neural basis of amelioration of 174 / National Institute of Mental Health and Neuro Sciences Annual Report these deficits is not completely understood. Accordingly, the investigatorsevaluatedtheroleofantidepressantdrug,reboxetine (SNRI-aselectivenoradrenergicreuptakeinhibitor)inalleviating chronicstress-induceddepressionandcognitivedeficits.Thestudy showed chronic immobilisation stress (CIS) induced behavioral depression along with learning deficits and decreased dentate gyrus(DG)andhippocampalvolume.CISanimalsdemonstrated high anxiety and hypertrophy of basolateral amygdala (BLA) volumes. Reboxetine, treatment ameliorated CIS-induced behavioraldepression,spatiallearningandmemorydeficitsalong withtherestorationofDGandhippocampalvolumes. 2013-14 Mr. Pradeep Kumar Mishra. Guides: Dr. Laxmi T Rao, Dr. Bindu M Kutty (Funding by ICMR) Single units (green, yellow, blue, red) were differentiated from the multiunit activity; These units were recorded from infralimbic cortex (ILC) during extinction recall of fear memory in NC and EMS rats. Reboxetine treatment ameliorates stress-induced spatial learning and memory impairments in partially baited radial arm maze task: 30. Combined role of dietery genistein and CIMT on modulation of synaptic plasticity in intracortical ischemic stroke. Ms. Sabitha K Rajesh. Guide: Dr. Laxmi T Rao (Funding by ICMR) Preclinical study provided evidence that diet enriched in soy isoflavonesthatactasphytoestrogensisneuroprotectiveinstoke. Constraint-InducedMovementTherapy(CIMT)isanintensive neurorehabilitation therapy that aims to retrain the brain by constraining the unaffected arm and forcing the use of the weakenedarm.Asaresultofrepetitiveexerciseswiththeaffected limb,thebraingrowsnewneuralpathways.Constraint-induced movement therapy (CIMT) coupled with pharmacological genestein treatment may be effective in modulating synaptic plasticity and improve the recovery in stroke patients The major objective of the study is to evaluate the combined effect of genistein and constraint induced movement therapy in ET-1 induced stroke model of ischemic brain damage using morphological, immunohistochemical and electrophysiological studies. The intracortical Endothelin-1 model of ischemic stroke was standardized.Morphologicalstudiestodeterminetheinfarctvolume wasdonebyTTCstaining.Thegaitanalysisshowedabnormalityin gaitpatterninischemicstrokegroupcomparedtocontrolrats. 31. Impact of Early Life Stress on the Behavioral, Electrophysiological and epigenetic factors in rats. In the present study the electrophysiological studies were undertaken to understand the neural mechanisms of mPFC neuronsinvolvedinretentionandextinctionoffearmemory. The study report is from two-month-old rats: normal control ratsandratsexposedtoearlymaternalseparationandisolation stress.Theratswereimplantedwithbundlesofwiresof25µm diameterintheinfralimbiccortexofmedicalprefrontalcortex (ILC). Seven-eight days after the surgical recovery, these rats were subjected to fear conditioning and extinction trials. The unitactivitywasrecordedinfreelymovingratduringdifferent stages of the fear conditioning – acquisition, retention and extinctiontrainingandextinctionrecall. 32. Prenatal valproic acid exposure in rats: The neural mechanism of changes in attention. Ms. Kumari Anshu. Guides: Dr. Laxmi T Rao, Dr. Shoba Srinath (Funding by UGC) The project aims to study attention in a prenatally induced Valproic acid (VPA) rat model of autism by examining long- rangeneuronalsynchronybetweenthemedialprefrontalcortex (mPFC) and posterior parietal cortex (PPC). Additionally, alteredexpressionofsynapticproteinssuchasGABAreceptors andGephyrinwillbeevaluated. The prenatal Valproate model of autism was standardized and validated for autism like symptoms using different behavioural tasks.Theanimalswereevaluatedforsocialcognitionin3-chamber social interaction test, anxiety-like behavior using light-dark test, National Institute of Mental Health and Neuro Sciences / 175 Annual Report 2013-14 Maltesh Kambali. Guides: Dr. Laxmi T Rao, Dr. Ravi Muddashetty (Funding by NIMHANS) repetitivebehaviorusingmarbleburyingtestandstartleresponse anditsinhibitioninprepulseinhibitiontest. A B Prepulse Inhibition (PPI) under different prepulse intensity and interstimulus intervals. Time spent in the compartment with a new rat versus time spent in the compartment with a familiar rat over 10 minutes in 3-Chamber social interaction test. 33. The role of Constraint Induced Movement Therapy (CIMT) in cortical plasticity in animal model of intracortical ischemic stroke. Ms. Nesin Mathew. Guides: Dr. Laxmi T Rao, Dr. Anupam Gupta (Funding by UGC) Constraint Induced Movement Therapy (CIMT), a recent physiotherapywhichinvolvestherestrainingofnon-impaired arm and physiotherapy for the impaired arm, has shown to improve the recovery in stroke patients. In this study, the investigators try to understand the role of inter-hemispheric crosstalkinrecoveryfromischemicstrokebyCIMT.Alsothey willlookintoNMDAandAMPAreceptormodulationpreand postapplicationofCIMT. 35. Ontogenesis of nigral dopaminergic neurons and electrophysiological assessment of substantia nigra of crossbreds of two mice strains with differential susceptibility to 1-Methyl-4Phenyl-1, 2, 3, 6-Tetrahydropyridine (MPTP). Mr. Vidyadhara DJ. Guides: Dr. Phalguni Anand Alladi, Dr. TR Raju (Funding by NIMHANS) The investigators intend to unravel the mechanisms for ethnicitybaseddifferencesinprevalenceofParkinson’sdisease usinganimalmodels.Immunoperoxidasestainingfortyrosine hydroxylase(TH)inthemidbraininadultsgroupiscompleted (for C57BL6, CD1 & F1 of C57BL6 female X CD1 male). Preliminarydatasuggeststhatthenigraldopaminergicneurons oftheCD1strainarelargercomparedtoC57BL6.Further,the neuronsofF1crossbredswereobservedtobelargerthanthat oftheCD-1strains.Furtherassessmentofnumberofneurons isbeingconducted. The intracortical Endothelin-1 model of ischemic stroke was standardized and validated with different motor performance task and TTC staining. Rotarod data was taken for vehicle control, sham control and ischemic stroke groups and the ischemicstrokegrouphasshownadeclineintheperformance. Thegaitanalysiswasalsoshowntheabnormalityingaitpattern inischemicstrokegroup. Low magnification photomicrograph showing immunoperoxidase staining of TH +ve neurons in C57BL6 mouse midbrain section. SN = Substantia nigra, VTA = Ventral Tegmental Area A B Stride length of hind-limb and forelimb was calculated for normal control(n=3) and ischemic stroke group(n=3). 4 walking cycle of each side of every rat was taken into consideration. Figure B: TTC staining confirms the infarct area white in colour. 34. Early maternal separation stress-induced anxiety and its relation to anterior cingulate cortex functions in processing of emotional tasks. Mr. High Magnification representative photomicrograph showing THimmunoreactiveneuronsinsubstantianigraparscompacta of adult C57BL6, CD-1 and F1 crossbred of C57BL6 female X CD-1male.Notethecellsofthecrossbreed(C57/Bl6XCD1) arelargerthanthoseoftheparentstrain. 36. Assessment of developmental apoptosis and mitochondrial responses in F1 crossbreds of two mice strains with differential sensitivity to 1-Methyl-4-Phenyl-1, 2, 3, 6-Tetrahydro-Pyridine. 176 / National Institute of Mental Health and Neuro Sciences Annual Report Mr. H Yarriephang. Guides: Dr. Phalguni Anand Alladi, Dr. TR Raju, Dr. BK Chandrasekhar Sagar populationwerefoundtobeinHardy-Weinbergequilibrium. TherewasnoassociationbetweenthegenevariantsandsSAH or large and small aneurysms. Plasma NOx was significantly associatedwithdevelopmentofvasospasm.PlasmaNOxlevels were found to be significantly decreased patients with aSAH whencomparedtocontrols.Furthermore,itwassignificantly reduced in patients with angiographic cerebral vasospasm. There was no significant association between the alleles and plasmaNOxlevelsaswellasallelesandevidenceofvasospasm. Furtherstudiesarebeingconductedtostudytheassociation betweenaboveallelesandplasmatotalantioxidantstatuswith developmentofvasospasm. 2. Representative Laser Scanning Confocal images showing co-localization of Bax (A, FITC, green), Bcl-2 (B, Cy3, red) and TH (C, Cy5, blue) in the substantia nigra of adult C57BL6. Thestudyinvolvesevaluationofdevelopmentalapoptosisofthe dopaminergicneuronswithinthesubstantianigra,oftwomice strainsi.e.C57/Bl6andCD1whiteandtheirF1crossbreds.Thisis becausethetwostrainshavedifferencesintotalnigralneuronal numbers at adulthood and are differentially susceptible to the neurotoxinMPTP.Expressionofvariousproteinsassociatedwith cell death and survival, like Bcl-2, Bax and Caspases are being studied, during the ontogenesis of both the mice strains and theircrossbreds,tounderstandthebalancesoftheseproteinsin establishingthefinalnumberofneuronsatadulthood. Neurosurgery 1. Evaluation of the role of endothelial nitric oxide synthase gene variants in the natural history of aneurysmal subarachnoid hemorrhage. Investigators: Dr. Indira Devi B, Dr. Nagaraja D, Dr. Rita Christopher (Funding by ICMR, New Delhi) Theobjectivesofthisstudyweretodeterminewhethergenetic variants of the endothelial nitric oxide synthase gene are associated with increased risk for aneurysmal subarachnoid hemorrhage (aSAH), elucidate whether the gene variants alterthebioavailabilityofnitricoxide(NOx) inthevascular system and lead to vasospasm and to identify whether the genevariantsdistinguishgeneticallybetweensmallandlarge ruptured aneurysms. A total of 250 aSAH patients and 250 healthyageandgender-matchedcontrolshavebeenrecruited for the study and genotyped for eNOS4ab, 894G>T and -786T>C.Allelefrequencydistributionsincontrolsandpatient 2013-14 Cortical Plasticity following intercostals musculocutaneous nerve transfer: A functional magnetic reasonance imaging study. Investigators: Dr. Dhanjaya I Bhat, Dr. B Indira Devi, Dr. HR Arvinda (Funding by DST) Following neurotisation for brachialplexus injury, reorganizationofthecorticalcentresoccurs.Thestudyaimsto findoutthetimeoccurrenceofthereorganisation. 3. Surgical trial in traumatic lntracerebral haemorrhage. Investigators: Dr. S Sampath, Dr. Jagath lal G, Dr. KVL Narasinga Rao, Dr. Dhaval Shukla, Dr. Nupur Pruthi (Funding by NHS, New Castle University) 4. Chromosomal aberrations in a typical and anaplastic meningiomas: prognostic implications. Investigators: Dr. Dwarakanath Srinivas, Dr. Vani Santosh, Dr. Sampath S (Funding by DBT) Theobjectivesoftheprojectare:a)Tostudypatientoutcomeand investigatefactorsthatpredictprogressionandrecurrenceofGrade IIandIIImeningiomas.b)Tostudytheimmunohistochemical expression of cell cycle proliferative markers (Ki 67 antigen, Topoisomerase),angiogenesisandinvasionassociatedmarkers (VEGF, tenacin and other ECM proteins), Tuomor suppressor and oncogenic proteins (p53, EGFR), apoptosis regulation proteins (Fas-APO1-CD95) and progesterone receptor protein and correlate the dadt generated with tumor progression and recurrence.c)Tostudytheestablishedchromosomalaberrations suchasdeletionof22q,deletionofprotein4.1Bgeneon18p11, codeletion of chromosomal regions 1p32 and 14q32 and other relevant chromosomes by using the FISH (fluorescence in situ hybridization)techniqueandchromosomespecificandcorrelate theresultswithtumorprogressionandrecurrence. National Institute of Mental Health and Neuro Sciences / 177 Annual Report 2013-14 5. Atypical and anaplastic meningiomas: prognostic implications of clinicopathological features. Investigators: Dr. Dwarakanath Srinivas, Dr. Mohd. Abdul Majid, Dr. Vani Santosh (Funding by NIMHANS) 6. Development of virtual human brain and skull model using Autodesk MAYA 2012. Investigators: Dr. V. Vikas, Dr. S. Sampath (Funding by NIMHANS) Theprojectaimstodevelopavirtualatlasofthehumanbrain using Autodesk Maya which is an internationally acclaimed animation package. The atlas can be used for teaching across variousdisciplines.Commercialpackageswhichareavailableat presentareessentiallybasedonviewingplatformswhichlimits theutilizationoftheatlastoapictographicatlas.Anindigenous 3-D atlas developed at NIMHANS would be customized into a 3-D platform which would make the process of learning neuroanatomy easier and also would form a platform for furtheranatomicandsurgicalstudies. 7. Glioma serum biomarker discovery through proteomic approaches. Investigator: Dr. Arivazhagan A, Multi institutional Project involving NIMHANS and IISc (Funding by DBT) ThestudyhasidentifiednovelproteinsbyLCMS/MStechnique whicharedifferentiallyexpressedinseraofGBMpatientswhen comparedtocontrolsamples.Furtherfunctionalstudiesarein the process to understand the biological significance of these findings. 8. Training in micro-vascular anastamoses on Rat blood vessels (Central Animal Research Facility, NIMHANS).Investigator: Dr. Nupur Pruthi. 9. Image processing for improving diagnostic accuracy in gliomas by Magnetic Resonance Imaging (MRI) and histopathology. Investigators: Dr. Suresh Nair N, Sri Chitra Tirunal Institute for Medical Sciences & Technology, Thiruvananthapuram, Dr. V Vikas (Funding by Kerala State Council for Science, Technology and Environment) histopathology as yet are subjective with significant interobservervariability.Imageprocessingtechniquesthough significantly advanced in several fields have only recently become standardized for medical images. Image processing thus offers an avenue to objectively evaluate and extract information from medical information be it MR sequences or histopathologic images. The study has two arms, one of which analyses the possibility of integrating information across various MR sequences, another arm focuses on extracting histopathologic features to classify the lesion into variousgrades.Themethodologyaimstodevelopindigenous paradigmsnotbasedoncommercialpackages.Thesepackages aimtoindependentlysupplementinformationobtainedfrom humanreadingofMRimagesandhistopathologicimages. 10. Thestudydemonstratedthatdexmedetomidineinfusionduring epilepsy surgery did not suppress the electrocorticographic activity unlike many other anaesthetics. The spikes increased during the dexmedetomidine infusion which persisted till 10 minutes after stopping the drug. The findings indicated that spike rates during Dexmed infusion were higher compared to preDEX (MAX CH B: p=0.007 and MAX CH A: p=0.079) and PostDEX (MAX CH B: p=0.17,MAX CH A:p=0.79) phases.Thespikerateincreasedin67.6%ofthepatientswhile the others showed a decreasefrom preDEX to DEX phases. The hemodynamic parameters were stable throughout the procedure.Toconclude,Dexmedisusefulduringintraoperative ECoG recording to enhance the epileptiform activity without anymajoruntowardeffects. 11. Gliomas are the most important primary CNS malignancies. Accurate grading of gliomas has prognostic implications. Accurate grading of gliomas preoperatively by Magnetic Resonance Imaging (MRI) and postoperatively by Effect of Dexmedetomidine on intra operative electrocorticogram during surgery for medically refractory epilepsy. Investigators: Dr.A Arivazhagan, Dr KR Madhusudan Reddy, Dr. Sanjib Sinha (Funding by NIMHANS) Effect of dexmedetomidine on electrocorticography in patients with medically refractory seizures. Investigators: Dr. Arivazhagan, Dr. KR Madhusudan Reddy, Dr. Sanjib Sinha (Funding by NIMHANS) DexmeditomedinehasavariableeffectonEEGduringmesial temporalsclerosispatientswhoundergosurgery.EEGshowed decreaseinthespikesinmajorityofcases,andtherewasalso anincreaseintheEEGspikesinsomecases. 12. 178 / National Institute of Mental Health and Neuro Sciences Expression of Cathepsin B, K, S and Elastin in intracranial aneurysmal walls. Mr. Arun Babu. Guides: Dr. Dwarakanath, Dr. Vani Santosh Annual Report This study is the first gene expression study of intracranial aneurysm performed in the Indian population and we have gotthefollowinguniqueresultswhichhavenotbeenevaluated in the previous studies. Collagen1A2 and CTSB genes are overexpressed and the TIMP4 gene is underexpressed in the aneurysmal sac compared to the normal superficial temporal artery taken from the same patient. In the present study, the investigators have shown differential expression of COL1A2, TIMP4andCTSBintheaneurysmalwallcomparedtonormal artery similar to the previous studies published so far. They have also shown the association or correlation of various clinico-radiologicalfactorswiththeexpressionlevelwhichhas notbeenreportedinthepreviousstudies. 13. Molecular stratification of pediatric infratentorial ependymoma – correlation with clinical parameters. Dr. Nagarjun MN. Guides: Dr. S Sampath, Dr. Vani Santosh, Dr. Jagath Lal G Theaimsofthisstudyweretostratifypediatricinfratentorial ependymomaswiththefollowingnovelmolecularbiomarkers such as CBX7, LAMA-2, NELL-2, CDKN-2A, CHI3L1 and to correlate molecular sub groups with disease progression and overall outcome which could guide therapeutic strategies and trendsinthetreatmentofependymoma. 14. Proteome profile of medulloblastoma correlation with histology, molecular subtypes and clinical parameters. Dr. Vinayak Narayan. Guides: Dr. S Sampath, Dr. Vani Santosh, Dr. Arivazhagan A Identification of candidate biomarkers of diagnostic and prognosticsignificanceinmedulloblastomathroughintegrated Proteomic and phosphoproteomic profiling. The investigators proposetostudytheproteomicandphosphoproteomicprofile ofmedulloblastomathroughanintegratedapproach,inorder toidentifynovelcandidatebiomarkers.Thesewillbeevaluated fordiagnosticandprognosticimplicationsbycorrelatingwith histology, molecular subtypes and clinical parameters, taking two cohorts of patients. The study envisages a new approach forthediscoveryofnovelbiomarkersofclinicalandprognostic significance in medulloblastoma. The study is being done in collaborationwithInstituteofBioinformatics,Bangalore,India. Neurovirology 1. Inflammation in Japanese encephalitis: Role of IL2. Investigators: Dr. Tom Solomon, Dr. V Ravi, Dr. Anita Desai (Funding by MRC, UK) 2. 2013-14 Immunopathogenesis of rabies: experimental studies in mice. Investigators: Dr. SN Madhusudana, Dr. Abhay Chowdhury (Funding by DBT) Theimmuneresponsesthatoccurafternaturalinfectiontofixed andstreetrabiesviruseswereinvestigatedintermsofcytokines andchemokinesproduced,phenotypingofdifferentTcellsin infectedmousebrainandantibodyresponseinperipheralblood. Itwasfoundthatalltheimmuneparameterswereexaggerated inmicewhosuccumbedtorabiesfollowingdelayedvaccination incontrasttomicewhichwerenotvaccinated.Markedincrease inCD4,CD8anddoublenegativecellswerefoundinthebrain ofthesemice.Also,levelsofcytokinessuchasIFNgamma,IL 6 and IL4 and chemokines such as RANTES and IP-10 were drastically elevated in mice which got delayed vaccination. These observations show that immune responses play a dual role in rabies encephalitis. They offer complete protection against encephalitis if given soon after the exposure but may exaggeratethediseaseprocessifgivenlateaftertheexposure has occurred. The study is ongoing to further understand the criticalroleplayedbyinnateandadaptiveimmuneresponses inrabiesencephalitis. 3. To investigate the antiviral property of an herbal extract against rabies virus by in vitro and in vivo studies. Investigators: Dr. SN Madhusudana, Dr. Anita Desai (Funding by ICMR) TheherbalextractformulatedbyDr.RajeshGhanjuwasprovided by ICMR. The crude extract and its fractions were tested for antiviral property against rabies virus (CVS) and street viruses bothbyinvitrotestingbyinfectionofBHK21cellsandNeuro2 acellsaswellaschallengingexperimentsinSwissAlbinomice. Though the original herbal extract and its fraction C13 and F4 had strong ability to inhibit viral replication for up to 8 hours post- infection, they failed to protect mice with intramuscular, intra-peritonealandoralroutesofinoculation.Itwasconcluded thatthebioavailabilityoftheactiveingredientinmicemaynot besufficienttoclearthevirusfromthebrainofmice. 4. To study the neutralizing efficacy of 5 human rabies monoclonal antibodies produced by Celltrion, Korea. Investigators: Dr. SN Madhusudana, Dr. Reeta Mani (Funding by Celltrion, Korea) Passiveimmunizationisoneofthemostimportantparameter of post-exposure prophylaxis. In recent times, several multinational companies have developed human rabies monoclonalantibodiesforpassiveimmunization.Fivehuman National Institute of Mental Health and Neuro Sciences / 179 Annual Report 2013-14 MabsprovidedbyCelltrion,SouthKorea,weretestedagainst differentantigenicsitesofrabiesGproteintotesttheirefficacy for neutralization of 6 different street viruses prevalent in India.Theinvestigatorsarenowundertakinginvitrostudies inNeuro2aCellline.Theinitialscreeningispromisingand thestudyisinprogress. 5. Th1 and Th2 Immune responses to different schedules of rabies vaccination. Investigators: Dr. SN Madhusudana, Dr. Manjunath A systematic evaluation of Th1 and Th2 immune responses to Intradermal and intramuscular rabies vaccination was conducted in people who have taken pre and post exposure rabies vaccination. The levels of interferon gamma (Th1) and IL 4 (Th2) was determined by ELISPOT assay. It was found that both types of vaccination induced strong Th1 and Th2 armsofimmuneresponseswhichlastsforoneyear.Therewas significant elevation following a booster dose of vaccination. Further, the levels of both IFN gamma and IL 4 significantly correlated with levels of rabies virus neutralizing antibodies. Further studies are ongoing to determine each response in preventionofrabiesinhumans. 6. Understanding the biology of Chikungunya virus infection in permissive cell lines and mosquito vectors. Investigators: Dr. Anita Desai, Dr. Brij Kishor Tyagi, CRME-ICMR, Madurai, Dr. SN Madhusudana (Funding by DBT) Indirect immunofluorescence assay using a polyclonal Chikungunya antibody confirmed successful infection in cell lines C6/36 and C2C12. Identification of the cellular components involves intermediate steps like growing cells to extract cell membrane proteins, resolving the proteins on a SDS-PAGE, Western Blotting and probing with antibodies to detect a “band” corresponding to a protein(s) that bind to CHIKV.Thesestepswerestandardisedtogivethebestresults withoptimaluseofresources.Themoresensitivesilverstaining method was utilized to detect the same. The excised protein from the gel for C6/36, has been submitted to the Molecular Biophysics Department, IISc Bangalore for MALDI-TOF to characterise the protein, followed by MASCOT SEARCH to identifyit. Three mosquito species Aedes aegypti, Aedes albopictus and Culex quinquefaciatus are being reared at CRME, Madurai. Mosquito midguts from all the three species were dissected andcollectedinordertopreparemosquitomidgutmembrane proteins for SDS-PAGE and VOPBA experiments. Mosquito midgutbrushbordermembranefraction(BBMF)proteinshave beenisolatedandresolvedonaSDS-PAGE. 7. Strengthening surveillance for Japanese encephalits in India. Investigators: Dr. V Ravi, Dr. Anita Desai, Dr. Reeta Mani (Funding by Centre for Disease Control, USA) This project has the following objectives of (i) Evaluation of the designated JE sentinel laboratories in India using a standardized tool (ii) Identification of the gaps, if any, in the effective functioning of the designated laboratories and suggestionofmeasurestofillthegaps(iii)Conductingtraining workshops for staff from the designated laboratories (State, DistrictandNCDC)onstandardizedproceduresforlaboratory diagnosis of JE (iv) Identification of laboratories within the network which have capacity for testing other bacterial/viral pathogens of AES and preparation of a training module for providing hands on training for other bacterial pathogens (v) Developmentandimplementationofaprotocoltoensurethe quality of the laboratory network through an external quality assurance program involving JE proficiency testing and cross checking a proportion of positive and negative samples (vi) Provision of onsite support to the laboratories whenever problemsariseand(vii)InconsultationwithCDC,Indiaoffice, arrangement of shipment of all samples of unknown etiology to Center for Disease Control and Prevention, Fort Collins, Atlanta, USA, for further testing. Work has been initiated on identifying10laboratoriesinIndia. 8. Immune signatures in Dengue virus infection. Investigators: Dr. V Ravi, Dr. Anita Desai, in collaboration with University of Yale (Funding by Indo USA Vaccine Action Program Grant) This is a collaborative investigation between Yale University School of Medicine’s U19 and National Institute of Mental Health and Neurosciences (NIMHANS) to examine immune mechanisms prevailing in the Indian population against Denguevirus(DENV).DENVhasbeenaseriouspublichealth problem in India since the first widespread epidemic in 1996 and currently causes more than 10,000 cases per year. The investigators propose to investigate individual immune responses to DENV with a systems immunology focus and taking advantage of recent technical advances in use in our HIPCcores.FromDENVpatientsandasymptomaticDENVexposedsubjectstheywillquantifyfunctionalresponsesofall majorarmsoftheimmunesystem(theinnatecells,Tcellsand 180 / National Institute of Mental Health and Neuro Sciences Annual Report B cells), gene expression profiles in response to DENV, and genetic determinants that have been implicated in defining theoutcomeofresponsetoDENVinfection.Resultsofthese investigations will be analyzed, integrated, and combined withclinicalhistoryandresultsfromotherflaviviralimmune responses to gain insights into the architecture of the immunologicalresponsetoDENVandtoprovideinsightinto hostimmuneandgeneticparametersthatdefinethecourseof Denguepathogenesisinhumans. 9. Immunological aspects of Chikungunya virus infection with special reference to pathogenesis. Mr. R Vijayalakshmi. Guides: Dr. Ravi Vasanthapuram, Dr. Anita Desai The study was undertaken to address some of the gaps that existinthepathogenesisandimmunologyofCHIKVinfection. Plasma viral loads of CHIKV and presence of CHIKV IgM antibodieswerecorrelatedtohumancytokine/chemokinelevels during acute CHIKV infection. Predominant inflammatory responses were seen during acute phase mediated by IL-6, IL-8, IP-10, MCP-1 and MIG. IL-6 and MCP-1emerged as biomarkers of high viral loads. The occurrence of molecular mimicrywasshownbetweenCHIKVE1andHLA-B27molecule andVonWillibrandFactordomainofC3.Thephenomenonof ADE in CHIKV infection in-vitro using P388D1 cell line was demonstrated. 10. A comparative study of innate and cell-mediated immune responses in human immunodeficiency virus infected individuals with and without neurotuberculosis. Ms. Deepashri Rao. Guides: Dr. Anita Desai, Dr. V Ravi, Dr. P Satish Chandra Attheendof2012therewere35.3millionHIV-infectedpeople aroundtheworldand1.6milliondeathsduetoAIDSin2012 alone. In individuals with neurologic disorders associated withHIV/AIDS,TBofthecentralnervoussystemisthemost common opportunistic neuroinfection. However, not all individualswithtuberculosismanifestneurologicalsymptoms. Understandingtheroleplayedbyhostimmunefactorsinsuch individualsisnecessarytobetterunderstandthehostresponse and address the issue of predisposition of certain individuals to neurotuberculosis for more effective treatment strategies. Innateandcellmediatedimmuneresponsesinsuchindividuals arebeinginvestigatedinthisstudy. 11. Study on molecular aspects of the pandemic Influenza A 2009 (H1N1) virus with special 2013-14 reference to host immune factors. Investigators: Ms. Maria Thomas. Guides: Dr. V Ravi, Dr. Anita Desai Influenza A 2009 (H1N1) is the first pandemic of the 21st century. While the overall global case fatality rate of the 2009 pandemic H1N1 appears to be low, the fatality rate in India was relatively higher. The host responses play a crucial role in defense against influenza but in some instances they may contribute to immunopathogenesis. Understanding the pathogeniceventsleadingtoseverityisimportantfordesigning better strategies for prevention and treatment. In this study, themolecularaspectsofthevirusandthehostimmunological factors that lead to the severity of the disease in comparison withseasonalInfluenzavirusesarebeinginvestigated. 12. mechanisms involved in The molecular chikungunya virus – Host cell interaction. Mr. Ayushman Ghosh. Guides: Dr. Anita Desai, Dr. SN Madhusudana, Dr. N Gayathri TheselectivetropismofCHIKVforboneandjointassociated connectivetissuesandskeletalmusclescellsrequireagreater understandingofthisinfection.Theidentity,distributionand behaviourofcellularcomponents(virusspecificcellreceptors) on permissive cells at the primary level would help delineate a crucial step in virus-host interaction. The virus–receptor interactionisamulti-stepprocessinitself;multipleattachment receptors may be used sequentially or in a cell type specific mannerandadditionallyco-receptorsmayalsobeinvolved. The virus induces certain changes in the host cell replication machinerytoaiditslifecyclewithinitshost.Thisstudyaimsto illuminate fundamental aspects of these intricate phenomena in order to acquire more information about them which have notbeenreportedcomprehensivelyinliterature. 13. Clinical and immunological profile of patients with subacute sclerosing pan encephalitis. Dr. Lt. Col. Nandita Hazra. Guides: Dr. V Ravi, Dr. Sanjib Sinha, Dr. SN Madhusudana. Subacute Sclerosing Panencepalitis (SSPE) is a devastating “slow virus” brain disease which affects young children and adultswhohadmeaslesabout5-15yearsearlier. Although, SSPE has been reduced to sporadic cases due to massimmunizationformeasles,thediseasestillholdsfirmin countrieswheremeaslesimmunizationisinadequate. National Institute of Mental Health and Neuro Sciences / 181 Annual Report 2013-14 Thepreciseimmunologicalmechanismbehindthepathogenesis of Subacute Sclerosing Panencepalitis (SSPE) is not clearly understood.Despiteabriskhumoralimmuneresponse,thehost isunabletoclearthevirus,whichpersistsasaresultofeither host or viral factors. Although the involvement of cytokines/ chemokineshasbeenreported,theroleofTh1/Th2responses hasnotbeeninvestigatedindetail.Thestudyofhostimmunity mayprovideaclueabouttheroleofalteredhostimmunityin determiningthepersistenceofmeaslesvirusinSSPEpatients. This prospective case control study aims to research the host cell mediated and humoral immunological responses in patientsofSSPEandanalysethefindingswithrelationtoage ofonset(childhoodonsetandadultonsetSSPE),clinicalstage, progressionofillnessandradiologicalfindings. Nursing 1. Development and evaluation of the effectiveness of integrated audio visual aided interactive relapse prevention (IAVARP) intervention among individuals with alcohol dependence at peripheral and tertiary care. Investigators: Dr. Prasanthi Nattala, Dr. Pratima Murthy, Dr. Jayashree Ramakrishna, Ms. Sreevani Rentala (Funding by NIMHANS) Amajorconcernwithteachingrelapsepreventionisthatalcohol use triggers/high-risk situations operate in real life, and are difficult to demonstrate within the confines of the treatment center.Inthisproject,anintensiveIntegratedAudioVisualAided InteractiveRelapsePrevention(IAVARP)interventionhasbeen developed,withtheaimofhelpingpatientsandfamilymembers tovisualizelifeafterdischargeinaveryrealmanner,andequip themselves with various relapse prevention skills while still in theprotectiveconfinesofthetreatmentsetting. TheIAVARPmakesuseofliveactionvideosemployinghuman characterstoportrayvariousrelapsepreventionstrategiesfor individuals with alcohol dependence, which are designed to simulate real life situations as much as possible. Some of the relapse prevention components demonstrated include coping skills, diversionary techniques, assertiveness skills, adaptive communicationpatterns. TheIAVARPispresentlybeingtestedatthetertiarylevel(Center forAddictionMedicine,NIMHANS),andinaStateGovernment setting (DIMHANS, Dharwad). Follow-up assessments are scheduled during the first 6 months after discharge to assess effectiveness of the IAVARP on three outcomes: quantityfrequency of alcohol consumption; number of drinking days; meantimetakenforrelapse. 2. GFATM Project – Strengthening institutional capacity for nursing training on HIV/AIDS in India. Investigator: Dr. Ramachandra (Funding by GFATM) The training project was planned under the them ‘A World free of burden of AIDS, TB and Malaria’. During Phase II as well as in Extended Phases II of GRATM project, 157 ANM’s/JHA’s in 6 sessions and 110 Nurses in 4 sessions from seven districts of Karnataka(BangaloreRural,Tumkur,Chikkaballapur,Chitradurga, Ramanagara, Manday and Bagalkote), have been trained. Two refresher/retrainingsessionsoftwodaysdurationwerealsotaken up for 55 nurses who had undergone training in HIV/AID’s in PhaseIandtheearlystageofPhaseIIofGFATAMproject.About 65 nurses who had undergone training on HIV/AIDs previously, were supervised for their skills and knowledge under supportive supervisionprogrammebythetrainersinTumkurdistrict. 3. Attitudinal factors influencing adherence and non-adherence to antipsychotic medications in patients with schizophrenia and BPAD. Ms. Ann Deva Priya, J Guides: Dr. Ramachandra, Dr. Suresh Bada Math Ensuring adherence to prescribed treatment is a major challenge in the management of almost all chronic medical conditions.Conveniencesamplingwasusedforthestudy.The MINImentalstatusexaminationandClinicalGlobalSeverity Scale and Clinical Global Improvement Scale were used to screenthepatientstoascertaintheirsuitabilitytoparticipate in the study. Data were collected through a semi-structured interview using socio-demographic and clinical profiles. Morisk’s 8 item Medication Adherence Questionnaire was used to assess medication adherence pattern. The rating of MedicationInfluencesScalewasusedtoassesstheattitudinal factors influencing the adherence and non adherence to antipsychoticmedications.Theadherencepatternwasfound to be better in patients with Schizophrenia than in patients with BPAD. The attitudinal factors such as “perceived daily benefit”, “fear of relapse”, “side effect relief with the current medicationsand”“enablingthemtofulfilllifegoalswhenon medications”,“deferencetoauthority”,“positiverelationwith staff”stronglyinfluencedtheiradherence;whereasnotbeing awareofillness,embarrassmentabouttakingmedicationsand stigmaofillnessandmedicationsinfluencednonadherence. There was a statistically significant association between 182 / National Institute of Mental Health and Neuro Sciences Annual Report the duration of illness and adherence pattern in patients with Schizophrenia (p = 0.029). Change in appearance with medication also had significant association (p= 0.019) with the adherence pattern in patients with Schizophrenia. The attitudinal factors were largely perceived by both groups of patientsinasimilarmanner. 4. Dyadic perception of recovery from schizophrenia at NIMHANS, Bangalore. Ms. Diksy Jose, Dr. Sailaxmi Gandhi, Dr. Geetha Desai Theaimofthestudywastoidentifytheperceptionofpatients diagnosed with schizophrenia and their caregivers regarding recovery from schizophrenia, to identify the convergence and divergence in the perceptions and to formulate a theory based on the findings. The main research questions were aboutmeaningofrecovery,indicatorsofrecovery,andfactors affectingrecoveryfromschizophrenia. The study adopted a qualitative grounded theory approach. Thedatawerecollectedfrom18patientsandcaregiversbased ontheoreticalsamplingtechnique,fromNIMHANSOPD,IPD and PRS settings. Semi-structured interview was conducted to collect the data and the interviews were audio recorded after obtaining informed consent from the participants. The recordeddataweretranscribed,translatedandcoded. Six main themes were emerged after the data analysis. The themeswere,meaningofillness,meaningofrecovery,attributes ofrecovery,indicatorsofrecoveryandfacilitatorsandbarriers of recovery. There were convergence and divergence in the perceptionofpatientandcaregivergroups;mainlydueto the subjectiveandobjectiveinterpretationofsymptoms.Atheory wasformulatedbasedonthefindings. 5. Effectiveness of pranayama on depression, anxiety and stress among residential elderly in selected old age home at Bangalore. Mr. Kannan K. Guides: Dr. Ramachandra, Dr. Naveen Kumar C A pre-experimental study was conducted to evaluate the effectivenessofpranayamaindecreasingthelevelofdepression, anxiety and stress among residential elderly in a selected old age home at Bangalore. The subjects were allotted to the experimentalgroup(n=40)usingcomputergeneratedrandom numbers.ThedatawerecollectedbyusingDepression,Anxiety andStressScale(DASS-42).Thestructuredinterventionswere carriedoutoveraperiodof90daysfor20minutesonadaily basistotheexperimentalgroup.Theposttestwasconducted 2013-14 after 93 days. Data analysis revealed statistically significant reductioninthemeanandstandarddeviationscoresonDASS 42.Overall,depression,anxietyandstressreducedsignificantly among the residential elderly. Thus, the research hypotheses were retained. Therefore, pranayama techniques are highly effectiveinreducingthedepression,anxietyandstressamong residentialelderly. 6. Effectiveness of progressive muscle relaxation programme on the occupational stress seen among house keeping staff in NIMHANS. Ms. Keerthini J. Guide: Dr. K Lalitha This present study was designed with an aim to reduce occupationalstressbyprogressivemusclerelaxationprogramme on housekeeping staff on contract basis in NIMHANS. The sample included sixty housekeeping staff working in various psychiatric wards. A true experimental design was adopted for the study. The study subjects were recruited into the experimental and control group; pretest to assess the level of occupational stress were administered to both the groups. Progressive muscle relaxation programme consisting of 30 sessionswasadministeredbytheresearchertotheexperimental group only. Analysis revealed statistically significant decrease in the level of occupational stress in the experimental group. The control group had statistically significant increase in the levelofoccupationalstressintheabsenceoftheintervention. The study indicated that the progressive muscle relaxation programmewaseffectiveindecreasingthelevelofoccupational stressamonghousekeepingstaff. 7. Effectiveness of nursing intervention on social and occupational functioning ability of patients diagnosed with schizophrenia at NIMHANS. Ms. Lija KL. Guide: Dr. Lalitha K The study adopted the experimental, pre test and post test design with control group with the aim to improve the social and occupational functioning ability of patients diagnosed with Schizophrenia. Using stratified random sampling, 30 femalesubjectswithschizophreniawereselectedfromfemale psychiatricwardsofNIMHANS.Thedatawascollectedthrough observationmethod,usingSocioDemographicDataSheetand aRatingScalepreparedbytheresearcherandwithestablished reliability and validity. The experimental group was exposed to10sessionsofnursinginterventionforimprovingsocialand occupationalfunctioningingroups.Thecontrolgroupreceived 10 sessions of health talk on various topics like interpersonal relationship, communication and adherence to medication National Institute of Mental Health and Neuro Sciences / 183 Annual Report 2013-14 etc. The data was analysed using descriptive statistics, Mann Whitney U test and paired T test. Results indicated a significantimprovementinthelevelofsocialandoccupational functioning ability in all dimensions. The finding showed statistically significant difference between the experimental groupandcontrolgroup.Thefindingsindicatedthattherewas a significant difference between the scores obtained on social and occupational functioning ability of patients diagnosed with Schizophrenia, before and after the exposure to nursing intervention. 8. Assessment of knowledge regarding post discharge care among caregivers of patients with BPAD and Schizophrenia. Ms. Mrudula G. Guides: Dr. Prasanthi Nattala, Dr. Santhosh Loganathan Thedescriptivestudywasconductedinagovernmenttertiary mental health centre. The aim was to assess the primary caregiver’s knowledge regarding post discharge knowledge about the care of patients diagnosed with schizophrenia and bipolar affective disorder. Additional aim was to provide themwithaninformationbooklet.Atotalof50subjectswere recruited through convenience sampling; 25 had a diagnosis ofschizophreniaand25werediagnosedwithbipolaraffective disorder. A structured interview schedule was prepared and wasusedtoassesstheprimarycaregiver’spostdischargecare knowledge.Theresultsindicatedthatprimarycaregiversthey hadmoderatelyadequateknowledgeaboutpost-dischargecare. 9. Family emotional climate as perceived by outpatients with schizophrenia and their caregivers at NIMHANS, Bangalore. Ms. Rajitha P. Guides: Dr. Sailaxmi Gandhi, Dr. Jagadisha Tirthalli ThestudyaimedtoexploreandcomparetheperceptionofFEC as perceived by the patients and caregivers. The study was a quantitative,non-experimentalcomparativestudy. Thetoolsfor theassessmentofperceivedFECbythepatientsandcaregivers were developed by the researcher; validity and reliability were establishedbeforethemainstudy.Datacollectionwasdonein the outpatient setting at NIMHANS, Bangalore. Analysis was doneusingappropriatedescriptiveandinferentialstatistics.The hypothesesofthepresentstudywere:(i)therewillbesignificant difference in the perceived FEC by subjects of both groups (ii) therewillbesignificantassociationofperceivedFECwiththeir socio-demographic variables and (iii) there will be significant association of the caregivers’ personality with the perception of FEC by caregivers. The results suggested that there was no significantdifferenceintheperceptionofvariousdomainsofFEC bysubjectsofbothgroupsexceptwarmth.Thefirsthypothesis wasnotaccepted.PerceptionofFECbypatientshadsignificant association with their diagnosis. Caregivers’ perception of FEC had significant association with their education. No other socio-demographic and illness variables had association with perceivedFECofbothgroups.Thesecondhypothesiswasalso notaccepted.Caregivers’perceivedpositiveFEChadsignificant positive correlation with extroversion and negative correlation with neuroticism, similarly perceived negative FEC was found to have significant positive correlation with extroversion, psychoticismandneuroticism,andhencethirdhypothesiswas accepted.Aninformationbookletonthemaintenanceofoptimal familyemotionalclimatewasdevelopedbytheresearcherbased ontheexpertopinionandsuggestions.Thiswasdistributedto thestudysubjectsduringthefollow-upvisittohospital. 10. The effectiveness of structured teaching programme on knowledge regarding stress management among caregivers of patients diagnosed with schizophrenia, admitted to selected psychiatric wards, NIMHANS. Ms. Alphy Thomas. Guides: Dr. K Lalitha, Dr. Mahendra Sharma, Dr. Geetha Desai 11. Effectiveness of structured teaching programme on the knowledge about human rights of mentally ill among the primary caregivers of inpatients with schizophrenia. Ms. Amrita Kuriakose. Guides: Dr. Sailaxmi Gandhi, Dr. Naveen Kumar 12. A pre-experimental study to assess the effectiveness of structured teaching programme on knowledge regarding the management of violent behavior among caregivers of patients diagnosed with schizophrenia at inpatient facility, NIMHANS. Ms. Arpitha Elizabeth Jolly. Guides: Dr. K Lalitha, Dr. Shivarama Varambally 13. Job satisfaction of nursing personnel in an organization. Mrs. Rebecca K. Guides: Dr. Ramachandra, Dr. R Parthasarathy 14. A study to assess knowledge and attitude towards epilepsy among primary caregivers diagnosed with epilepsy. Mrs. Lavanya D. Guide: Dr. Prasanthi Nattala 15. Comparative study to assess quality of life among tobacco user and non-tobacco user adults in NIMHANS Campus. Ms. Rituparna Samanta Guides: Dr. Ramachandra, Dr. Vivek Benegal 184 / National Institute of Mental Health and Neuro Sciences Annual Report 16. A comparative correlational study to assess knowledge and attitude towards E-hospital among nurses working in psychiatry and neurology wards at NIMHANS, Bangalore. Mrs. Sheeba Sara Daniel. Guides: Dr. Sailaxmi Gandhi, Dr. VL Sateesh 17. A study to assess caregivers’ satisfaction of the services at inpatient setting of the Department of Child and Adolescent Psychiatry. Mrs. Usha SN. Guides: Dr. Prasanthi Nattala Psychiatry 1. Parental consanguinity among schizophrenia patients living in a rural community of south India: A clinical and genetic investigation. Investigators: Dr. Jagadisha Thirthalli, Dr. Rita Christopher, Dr. Gangadhar BN, Dr. Naveen Kumar C (Funding by DBT) Thestudyaimsatevaluatingtheextentofparentalconsanguinity amongpatientswithschizophrenialivinginaruralcommunity. Thiswillbecomparedwithparentalconsanguinityofthegeneral population in the same community. Parental consanguinity will be assessed using both family history method and an establishedgeneticmethod.160patientsand270controlshave been recruited. Data collection is nearing completion and the geneticdataistobeanalysed.Thisstudyhaspotentialtoyield novelcluestothegeneticetiologyofschizophrenia. 2. Neuroimmunogenetic and functional MRI correlates of smooth pursuit eye movement deficits: an imaging genomics study of a novel composite biomarker for schizophrenia. Investigators: Dr. G Venkatasubramanian, Dr. BN Gangadhar, Dr. V Ravi, Dr. Shivarama Varambally (Funding by DBT) Thisprojectaimstoexplorethepossibilityofanovelcomposite biomarkerforschizophreniaphenotypeinvolvingnicotinergic abnormalitiesandeyemovementabnormalitiesbyexamining theirclinical,immunopathogeneticaswellasendophenotypical correlates.Preliminaryobservationshaverevealedsignificantly greater eye movement deficits in schizophrenia patients that correlatewithDLPFCvolumedeficit.Ongoinganalysesattempt toexaminetherelationshipbetweentheeyemovementdeficits and immunological abnormalities in schizophrenia involving plasma interleukin-6 levels/lymphocyte gene expression as wellasothercytokines. 3. 2013-14 Augmentation of cognitive remediation in schizophrenia with transcranial magnetic stimulation: A randomized controlled trial. Investigator: Dr. Jagadisha Thirthalli, Dr. C Naveen Kumar, Dr. BN Gangadhar, Dr. SK Chaturvedi, Dr. Jitender Saini, Dr. A Sham Sundar (Funding by DST) ThisprojectwillexaminetheeffectofneuronavigatedTMSon cognitiveretraininginpatientswithschizophrenia.Thisproject hasjustbegun.Theinvestigatorsareintheprocessofacquiring equipmentandrecruitmentofsubjectswillbedonesoon. 4. Neuro-imaging endophenotypes in obsessive compulsive disorder. Investigator: Dr. YC Janardhan Reddy, Dr. Venkatasubramanian, Dr. Chandrajit Prasad, Dr. Naren P Rao, Dr. Biju Vishwanath (Funding by DBT) Endophenotype validity for neuroimaging biomarkers is yet to be established comprehensively in OCD. The study aimed to establish this with the examination of treatment-naïve patients and concurrent assessment of unaffected siblings in comparison with matched healthy controls. This research project has completed evaluation of 35 treatment-naïve OCD patients and their unaffected siblings in 22 patients and 35 healthycontrols. Obsessive Compulsive Disorder (OCD) is characterized by cognitive deficits involving response inhibition and error monitoring. These abnormalities have been demonstrated convincingly in the neurocognitive models of OCD. In this interim analysis, the investigators sought to examine this cognitive deficit using an fMRI Go/No-go task in medicationnaïve, comorbidity free subjects with OCD in comparison to healthycontrols.Theyhypothesizedthattheregionsinvolving the fronto-striatal circuit viz. orbitofrontal cortex (OFC), dorsolateral prefrontal cortex (DLPFC), anterior cingulate cortex (ACC), caudate and putamen would show differential activationsinpatientswithOCDcomparedtohealthycontrols. Thirty-right-handedsubjectswithDSM-IV-OCDand25healthy controls were examined during E-Sys delivered Go/No-Go performance in 3-Tesla MRI. fMRI analysis [Go and No-Go events]wasdoneusingSPM8[SmallVolumeCorrected(SVC) FWE (Family Wise Error) <0.05 for the individual masks] usingageasacovariate.Duringresponseinhibitioncondition (No-Go), patients with OCD demonstrated significantly deficient activation in the left ACC (BA-24), left DLPFC (BA9), and left caudate regions in comparison to HC whereas National Institute of Mental Health and Neuro Sciences / 185 Annual Report 2013-14 in the Go condition, left putamen had deficient activation in patients in comparison to HC. Response inhibition is one of the characteristic cognitive impairments seen in OCD. Study observations suggest “fronto-cortical-striatal” network model for response inhibition in OCD. Significant hypoactivation in patientscomparedtohealthycontrolsduringtheGoandNo-Go tasksdepicttheinvolvementofthesestructuresasmarkersthat moderatethiscriticalcognitivefunctionandthuscouldunderlie thepathogenesisofOCD. 5. Real-world functioning in patients with schizophrenia in a rural South Indian setting. Investigator: Dr. Naveen Kumar C This study was conducted in a rural community cohort of schizophrenia patients. Groningen Social Disability Schedule (GSDS) was used to assess social functioning of 156 patients from this cohort. GSDS assesses functioning of individuals across8roles,includingpersonalcare,family,kinship,partner, parent, citizen, social and occupational. Mean GSDS score of 0indicatesnodisabilityandthescores1-3indicateincreasing severityofthedisability.ThosewithmeanGSDSscoreof1or less(indicatingmildornodisability)werecategorisedas‘notdisabled’andtherestas‘disabled’.Patientstakingmedications for > 75% of the time since recruitment were categorized as ‘adherent’andtherestas‘poorly-adherent’. Mean age was 42.5 years; the average duration of education was 6 years. Mean duration of illness was 166 months. Mean totalbaselinePANSSscorewas71.8.Afteranaverageofeight years of follow-up, the mean GSDS score was 1.1. Among the adherent patients, 43/115 (37.4%) were disabled. In contrast, 29/41(70.7%) of the poorly-adherent patients were disabled (Chi-square=13.5;p<0.01;Oddsratio=4.0;95%CI=1.9–8.8). Asadherencetomedicationsaloneisassociatedwithfairlylow levelofdisabilityinthereal-worldfunctioningofschizophrenia patients in rural communities, ensuring adherence should be the priority of mental health professionals working towards rehabilitation. 6. Prospective study of metabolic abnormalities in schizophrenia patients living in a rural South Indian Community. Investigators: Dr. Naveen Kumar C, Dr. Gangadhar BN, Dr. Jagadisha Thirthalli, Dr. Rita Christopher, Dr. Kishore Kumar KVC (Funding by NIMHANS) The study was conducted in rural community at Turuvekere. The study aimed to assess the cross-sectional prevalence of metabolic abnormalities and compare this among randomly selectedcontrolsubjectsresidinginthesamecommunity.Italso aimedtoexaminethechangeinthesemetabolicabnormalities inpatientsoversixmonthsoffollowup. Atotalof169patientsparticipatedinthestudyand108ofthem were followed-up for a period of 6 months of antipsychotic treatment. The results indicated that 36% had not received any treatment before their entry into this study. Risperidone wasthemostcommonlyusedantipsychoticwithameandose of 5.68 mg/day. Central obesity (CO) was significantly more in women in both patients (64.8%) and controls (40%). The prevalence of diabetes was 8.7% and 9.1% in patients and controlsrespectively.After6monthsoftreatment,prevalence of MS was not 35.2% which was not significantly different from the baseline prevalence of 28.7%, nor was it different from general population where it was 27.8%. Non-significant increase in central obesity from 38% to 44% and metabolic syndromefrom28.7%to35.2%werealsonoted.Itiscommonto experienceincreaseinmetabolicabnormalitiesafter6months of antipsychotic medication among schizophrenic patients. However,therewerenosignificantdifferencesinprevalencein comparisonwithhealthycontrols. 7. Development of a partner focused intervention for alcohol dependence and assessment of impact on couples’ outcome. Investigator: Dr. Pratima Murthy (Funding by ICMR) Inthefirstphase,needsassessmentandfocusgroupdiscussions werecarriedout.Theneedsassessmentwascarriedoutamong 50 women partners of men with alcohol dependence. The interventionwasdevelopedandtestedin58womenpartners. Thewomenshowedsignificantpre-postimprovementsonlife satisfaction, self-esteem, symptoms of emotional distress and perceivedsocialsupportfollowingtheintervention. 8. Development of manuals to address risk factors for non-communicable diseases. Investigator: Dr. Pratima Murthy (Funding by WHO) Aspartoftheproject,trainingmanualstoaddressriskfactorsfor non-communicable diseases, with a focus on tobacco, alcohol, diet,exercise,stressandweightmanagementaretobedeveloped forcounsellors,communityworkersanddoctors.Ameetingof expertstodiscussthesalientcomponentswasheldatNIMHANS inFebruary.Thedevelopmentofthemanualsareinprogress. 9. 186 / National Institute of Mental Health and Neuro Sciences A naturalistic study of clinical and sociodemographic characteristics of patients Annual Report attending psychiatric rehabilitation services for rehabilitation. Investigators: Dr. Sivakumar T, Dr. Chaturvedi SK, Dr. Thirthalli J, Dr. Nirmala BP, Dr. Bhola P, Dr. Desai G, Dr. Gandhi S, Dr. Kumar CN, Dr. Waghmare A, Dr. Udgiri S Assessment of factors affecting psychiatric rehabilitation is necessary to plan services and fame policies conducive to recovery of persons with psychiatric disorders. There is a paucity of studies examining factors affecting psychiatric rehabilitation in the Indian setup. NIMHANS runs a unique psychiatricrehabilitationservicesforpatientswithpsychiatric disorders. The investigators would study the clinical and socio-demographic profile of patients attending psychiatric rehabilitation services and factors influencing rehabilitation. The study would help in the process of understanding rehabilitationneedsinpersonswithpsychiatricdisordersand factorsinfluencingrehabilitationinthesetup.Theservicescan be tuned to address felt needs and barriers interfering with successful rehabilitation. The experience can help in making policies and programs which can be used across the country. This will help in reintegration of patients with psychiatric disabilitywithmainstreamsociety. 10. International Prevalence and Treatment of Diabetes and Depression (INTERPRET-DD) study. Investigators: Dr. SK Chaturvedi, Dr. S Srikanta, Dr. Harish T, Dr. Manoj Sharma, Dr. Ameer Hamza Theproject,basedin16countries,looksattheprevalenceand incidence of depression in adult onset diabetes mellitus. The pilot phase is over and the data collection for final phase is ongoing.Patientshavingdiabetesmellitusarebeingincluded fromtheSamatvamDiabetesCentre,Bangalore. 11. Effectiveness of a youth friendly mental health Intervention to reduce and prevent common mental disorders and enhance resilience among at risk young women in an urban slum – the MOGGU (Mental Health of Girls Growing Up) study. Investigators: Dr. Prabha S Chandra, Dr. Geetha Desai, Dr. Thennarasu, Dr. Girish N Rao (Funding by Department of Health Research) Thestudyrevealedthatthereispoormentalhealthliteracyamong youngwomenfromlowincomesituations: Correctlabellingof thedisorderwaslow-4.5%foranxietyand8%fordepression. Though suicidality was labelled correctly by the majority of 2013-14 participants(63%),theywerenotabletoidentifytheseverityof thesituationinthevignetteasoneneedingurgentintervention. Majorityoftheparticipantsreportedtheywouldseekhelpfroma friendorparent.Mentalhealthprofessionalswereconsideredby onlyfewaspossiblesourcesofhelp(by9.7%oftheparticipants foranxiety,22%fordepressionand2.6%forselfharm).Stigma andlackofawarenesswerethefrequentlycitedreasonsfornot seekingprofessionalhelp. Thestudyalsoresultedinthedevelopmentofatool-Checklist for Assessment of Gender Disadvantage (CAGED). This 15item tool which assesses four different domains of gender disadvantagewasfoundtohavegoodinternalconsistencyand adequatetestretestreliability. The study also assessed the feasibility and acceptability of Mobile health interventions among young women from low incomegroupsintheformoftextmessages. 12. Preventing and treating HIV co-morbidities in India: Multi-tiered strategy for women. Investigators: Dr. Prabha S Chandra, Dr. Veena A Satyanarayana (Funding by ICMR) 13. Clinical, cognitive and neuroimaging correlates of apolipoprotien E (APOE) genotype in elderly with late onset depression: A prospective study. Investigators: Dr. PT Sivakumar, Dr. Sanjeev Jain, Dr. Thennarasu, Dr. Venkatasubramanian G, Dr. Jitendra Saini (Funding by ICMR) Depressioninelderlywithonsetabove50yearsage(lateonset) is associated with reduced hippocampal volume. APOE4 allele and depression are considered as important risk factors for dementia. Thisstudy evaluates the effect of APOE 4 allele and Late onset depression on cognitive function and hippocampal volume.Genotyping,baselineMRIscan,Clinicalandcognitive assessment of 33 subjects with late onset depression has been completed. Follow-up assessment of cognitive function and measurementofhippocampalvolumewillbedoneafteroneyear. 14. Alcohol: Harms to others-India. Investigators: Dr. Vivek Benegal, Dr. Girish N (Funding by WHO) 15. Double blind-randomized control study of the efficacy of baclofen in the long-term treatment of alcohol dependence. Investigator: Dr. Vivek Benegal (Funding by Sun Pharmacological Advanced Research Centre) National Institute of Mental Health and Neuro Sciences / 187 Annual Report 16. 2013-14 Cortical inhibition in unipolar and bipolar depression compared to healthy subjects: A TMS-EEG study. Investigators: Dr. Muralidharan K, Dr. Lakshmi Yatam, Canada (Funding by CIHR through UBC) Depressive episodes can occur in both unipolar major depression and bipolar disorder. Unipolar major depression (UD)hasbeendemonstratedtobesignificantlydifferentfrom bipolar depression (BD) in symptomatology, course, family historyofbipolardisordersaswellasresponsetoantidepressant treatment and ECT. There is an urgent need to identify biomarkers to differentiate UD from BD. This can prevent a misdiagnosisofUDinatleast60%ofpatientspresentingwith a depressive episode for treatment, with a potential risk of manicswitch.Thecurrentstudyattemptstoinvestigatecortical inhibitionasrecordedbyEMGandEEGusingTMSaspotential bio-markers to cross-sectionally distinguish unipolar from bipolardepression. 17. Childhood abuse and self-harm among women presenting with psychiatric disorders. Investigators: Dr. Kavitha V Jangam, Dr. Muralidharan K, Dr. N Janardhanan, Dr. K Thennarasu (Funding by NIMHANS) A large body of empirical evidence has documented high prevalenceanddevastatingpsychologicaleffectsofphysicaland sexualabuseofwomen.Onlyrecently,however,haveresearchers investigatedviolentvictimizationofseriouslymentallyill(SMI) women.However,thereisabsolutelynoliteraturewithrespect to prevalence of childhood abuse among women with major psychiatricdisordersinIndia.Also,thereisinadequateresearch in the area of childhood abuse and its adult manifestations in Indiathoughithastherapeuticimplications.Withthisreference, the present research study aims to study the prevalence of childhoodabuseamongwomenwhoareadmittedforpsychiatric problemsinthepsychiatricfacility.Theresearchstudyalsoaims at studying the prevalence of self harm among this population and analyze the relationship between childhood abuse, self harmandpsychiatricdisordersintheadulthood.Thestudydata collectionwillbedoneinanin-patientfacilitywherewomenwith severementalillnesshavebeenadmittedforthetreatment.The studywillbedoneintwophasestostudytheprevalenceofthe childhood abuse among women with psychiatric illness. In the first phase, data collection will be done in the period of three months to get the estimation of sample required for the main datacollection.Basedonthethispilotdatacollection,thesample sizeforthemainprevalencestudywillbedecidedwhichwould beasecondphaseofthestudy. 18. Persistent delusional disorder: A retrospective chart review. Investigators: Dr. Muralidharan K, Dr. Rashmi A Delusional disorder or Persistent Delusional Disorder (PDD) is a psychiatric illness characterized by stable and persistent delusions which are relatively encapsulated and leaves much of the personality intact, with a resultant high-functionality. Research on PDD is limited and poor operational criteria havemadeitdifficulttodistinguishitfromotheroverlapping psychiatric disorders like schizophrenia and psychotic depression. In addition, the diagnosis of PDD itself is often complicated by the fact that patients with PDD rarely seek psychiatrichelp. Despite the long history of PDD as a psychiatric diagnosis, relatively little is known about the demographic and clinical profileofpatients,thefrequenciesofitssubtypesortreatment response and outcomes. Further, the literature from India on these aspects is limited. Given the paucity of literature on this important yet under-researched psychiatric condition, a chart review of patients who have been treated for PDD is planned. Thisincludesthesocio-demographicandclinicalcharacteristics ofpatients,co-morbidities,familyhistory,treatmentandfollowup. 19. Effect of yoga on heart rate variability and cortical inhibition in anxiety disorder and major depressive disorder: An open trial. Investigators: Dr. BN Gangadhar, Dr. S Varambally, Dr. Muralidharan K Thisstudyattemptstoinvestigatetheimpactofyogaonheart rate variability and TMS measures of cortical inhibition in patientswithanxietydisordersandmajordepression. 20. Functional MRI: A diagnostic tool for amnestic minimal cognitive impairment and early Alzheimer’s dementia. Investigators: Dr. Srikala Bharath, Dr. John P John, Dr. Keshav Kumar, Dr. Jitender Saini (Funding by DST) Afterstandardization,thedatacollectionstartedinSep2012. 42clientswithMildAlzheimer’sDementia,33clientswithMCI and21matchedcontrolshavebeenrecruitedintheprojectwith informed consent. All have undergone detailed clinical and neuropsychologicalevaluationandfMRI. 21. 188 / National Institute of Mental Health and Neuro Sciences Neural and immunological predictors of SSRI response in obsessive compulsive disorder: Annual Report Search for a composite biomarker. Investigators: Dr. Janardhanan CN, Dr. YC Janardhan Reddy, Dr. G Venkatasubramanian (Funding by DST) This project aims to unravel a composite neuroimaging and neuroimmunebasedbiomarkerforSSRIresponseinOCD.The pilotphaseforthisprojecthasbeencompletedinthefirstyear andthedatacollectionisongoing. 22. Endocannabinoid-glutamate interactions in obsessive compulsive disorder: cognitive translational implications. Investigators: Dr. Janardhanan CN, Dr. YC Janardhan Reddy, Dr. G Venkatasubramanian (Funding by DBT) 23. Eye tracking abnormalities in obsessive compulsive disorder: A comparison with bipolar disorder and healthy controls. Dr. Janardhanan CN, Dr. G Venkatasubramanian 24. Neurobiological correlates of symptom modulation using transcranial direct current stimulation in schizophrenia. Investigators: Dr. G Venkatasubramanian, Dr. Janardhanan CN 25. White matter alterations in obsessive compulsive disorders and its relationship with symptom dimensions: A diffusion tensor imaging study. Investigators: Dr. YC Janardhan Reddy, Dr. G Venkatasubramanian, Dr. Janardhanan CN (Funding by DST) Previous diffusion tensor imaging (DTI) studies in patients with obsessive-compulsive disorder (OCD) have reported abnormalities of fractional anisotropy (FA). However these results have been inconsistent. Confounding effect of medicationscouldbeanimportantreasonforthisinconsistency as pharmacological treatment could modify the structure of cellmembranesand myelinsheaths.Asapreliminaryanalysis underthisproject,whitematterintegrityabnormalitiesindrug naïveOCDpatientswerecomparedwiththoseamonghealthy controls.17drug-naïveOCDpatientsand18unrelatedhealthy volunteers from the general population participated in the study.Imageswereacquiredusing64directionsDTIsequence in a 3T MRI scanner and analysed using Tract-Based Spatial Statistics (TBSS) pipeline. Compared to controls, the patients had lower fractional anisotropy (FA) values in left anterior capsule (anterior limb, posterior limb and retrolenticular), left external capsule and left superior corona radiata. There 2013-14 was no region in which patients had increased FA compared tocontrols.Subsequentanalysesexaminingthewhitematter correlates of treatment response examining patients that are classified as SRI responders (N=15), SRI non-responders (N=18) and healthy controls (N=33) revealed increased fractional anisotropy in SRI responders as compared to both non-responders and healthy controls with peak clusters localisedtorightsuperiorlongitudinalfasciculus.Resultsofthe study provide further evidence that widespread white matter abnormalities are present in OCD patients. Presence of these abnormalities in drug naïve status indicates the possibility of theirroleinpathogenesisofOCDaswellasinSRItreatment response. 26. Empowering adolescents with life skills – A school based approach for promotion of health and psychosocial competence – Preparatory Phase. Investigators: Dr. Srikala Bharath, Dr. Kishore Kumar, Dr. Seema Mehrothra, Dr. John Vijayasagar (Funding by Navajbai Ratan Tata Trust – small grant scheme) Thepreparatoryphasefocusedonre-assessingtheneedsand concernsoftheadolescents,familiesandschoolsbysixfocus groupdiscussions.Reviewofthemanualsandtrainingmodel for Life Skills Educators by the investigators were done. The Manualswererevisedandprinted–PsychosocialCompetence withLifeSkillsinAdolescents–LifeSkillsEducators’Activity Manual Level I, II, III. A training CD was also prepared. A LifeSkillsFacilitators’Manualwaspreparedandprinted.The education department has been approached and permission soughtforimplementingtheprogramin25governmentrural schoolscontinuouslyoverthreeyearsinacomparativemanner. InstitutionalEthicalClearancehasbeenobtained. 27. A study of telomere length in dementias. Investigators: Dr. Srikala Bharath, Dr. Sanjeev Jain, Dr. Meera Purushotham (Funding by ICMR) 28. Augmentation effect of low frequencyrepetitive transcranial magnetic stimulation over supplementary motor area in obsessive compulsive disorder: a randomized controlled trial. Investigators: Dr. Shyam Sundar A, Dr. YC Janardhan Reddy, Dr. Jagadisha Thirthalli (Funding by NIMHANS) Around40-60%ofpatientswithOCDdonotrespondadequately to first-line treatment. Repetitive transcranial magnetic National Institute of Mental Health and Neuro Sciences / 189 Annual Report 2013-14 stimulation (rTMS) is a relatively safe and non-invasive brain stimulation technique, found to be effective in many neuropsychiatric conditions. In this study, the investigators willevaluatetheefficacyofrTMSasanaugmentationstrategy in OCD for people who have poorly/partially responded to standard treatment. It is a placebo controlled trial with a projectedsamplesizeof70.Thirtypatientshavebeenrecruited tilldatewithnoreportsofanyseriouscomplications. 29. Effect of repetitive transcranial magnetic stimulation on motor cortical excitability of patients with obsessive compulsive disorder. Investigators: Dr. Shyam Sundar A, Dr. YC Janardhan Reddy, Dr. Jagadisha Thirthalli This is an add-on project to the NIMHANS-funded project “Augmentationeffectoflowfrequency-repetitivetranscranial magnetic stimulation over supplementary motor area in obsessive compulsive disorder: a randomized controlled trial”. In the current study, the investigators plan to assess the motor cortical excitability of the consenting subjects from the former trial, both before and after completion of thecourseofrTMS.Thecorticalexcitabilityparametersthat willbestudiedincludeshortintervalintracorticalinhibition, intracorticalfacilitationandcorticalsilentperiod,whichwill bemeasuredusingTMS.Corticalexcitabilityhasbeenfound tobealteredinpeoplewithOCDcomparedwhentohealthy controlsandhasbeenlinkedtothepathophysiologyofOCD. ThestudyaimstoexaminewhetherrTMShasaneffecton corticalexcitabilityinOCDpatientsandhowthiscorrelates with improvement in symptoms. Twenty four patients have been recruited in this project till date with no serious complications/adverseeffects. 30. A long term naturalistic follow-up study of obsessive compulsive disorder (OCD) patients with good and poor insight. Investigators: Shyam Sundar, Dr. YC Janardhan Reddy, Dr. Suresh Bada Math, Dr. Janardhanan C, Dr. Narayanaswamy, Dr. Malvika Ravi, Dr. Arun Gadad Naturalistic follow-up studies have shown that the long term course and outcome of OCD is highly variable. Insight is one of the factors that have been shown to be associated with outcome of OCD. Very few studies have assessed insight in a systematicmannerandassesseditscorrelationwithlong-term outcome.Hencethecurrentstudyhasbeenplannedtoassess theoutcomeofgoodandpoorinsightOCDoverlong-termina catch-uplongitudinalstudy. AllconsecutivepoorinsightOCDpatientswhohaveregistered intheOCDclinicofNIMHANSfrom2004to2012willbetraced alongwithanequalnumberofgoodinsightpatientswhowillbe randomlyselectedfromtheOCDclinicdatabase.Thesepatients havetheirbaselineassessmentswithstandardizedinstruments used in the OCD clinic. Their follow-up assessment will be conductedinthecurrentstudyusingstandardizedinstruments to assess their current symptomatic status, insight level and functioning status. This will help in comparing the long-term courseofgoodandpoorinsightOCD.Sevenpatientshavebeen assessedinthisprojecttilldate. 31. An Imaging Genomics Study of the Neurometabolic & Neuroimmunological Effects of Interleukin-6 in Schizophrenia. Investigators: Dr. Venkat Subramanian, Dr. BN Gangadhar, Dr. V. Ravi (Funding by DBT) The background research project established support for interleukin-6abnormalitiesinantipsychotic-naïveschizophrenia andameliorationoftheseabnormalitieswithtreatment.Plasma profile of various cytokines (antipsychotic-naïve schizophrenia patients versus healthy controls) - Interleukins [IL] -2, 4, 6, 10,17AandTumornecrosisfactor[TNF],Interferon-γ[IFN-γ] were assessed using commercial “cytometric bead array” kit (BD Biosciences, San Jose, USA) as recommended by the manufacturer. Plasma IL-6 levels were significantly higher whereas IL-17 and IFN-γ levels were significantly lower in schizophreniapatientscomparedtohealthysubjects.Theeffect sizesweresmalltomoderatewithestimatesasfollowsIL-6:η2= 5.6%,Cohen’sd=0.48;IL-17:η2=3.7%,Cohen’sd=0.39and IFN-γ:η2=3.2%,Cohen’sd=0.36. 32. Structural and functional connectivity of hippocampus in schizophrenia: Evaluation of neuroimmunological and neurotrophic factors interactions using diffusion tensor imaging and functional magnetic resonance imaging studies. Investigators: Dr. G Venkatasubramanian, Dr. BN Gangadhar, Dr. V Ravi, Dr. MS Keshavan, (Funding by Wellcome Trust / DBT India Alliance) Schizophrenia, a complex neuropsychiatric disorder, is characterized by delusions, hallucinations, disorganized behaviour and progressive cognitive deficits, whose pathophysiology remains unclear. It is ranked among the top ten disabling disorders by the World Health Organization. A compelling hypothesis with translational potential, investigatedintheseniorfellowshipresearch,isthat“complex 190 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 interactions between neuroimmunological/neutrophic factors and hippocampus might underlie the pathogenesis of schizophrenia”. Ascertaining evidence for these pathogenetic interactionswillenhanceourunderstandingofthisintriguing disorderandcanpotentiallyopennoveltherapeutictargetsfor schizophrenia. Interim findings of this research project have demonstrated deficient serum BDNF in antipsychotic-naïve schizophrenia patients and as well as trend level significant deficiency in HR subjects partially support the postulated endophenotypes basis of BDNF in schizophrenia. In subjects athighriskforschizophrenia,therewasapathophysiologically relevant and significant correlation between plasma IL-6 and hippocampus activation during the performance of learned irrelevancetask. cellswerelysedandclearedbyadditionoflysingsolution.The remaining pellet obtained after centrifugation was suspended instainingsolutionandanalysedbyflowcytometry. 33. Translational Research on the Neuroimmunopathology of Schizophrenia [Center of Excellence and Innovation in Biotechnology – Institutional Programme Support]. Investigators: Dr. Ganesan Venkatasubramanian, Dr. BN Gangadhar, Dr. V Ravi, Dr. SK Shankar, Dr. DK Subbakrishna, Dr. Anita Desai, Dr. Anita Mahadevan, Dr. Shivarama Varambally, Dr. Jitender Saini, Dr. Mariamma Philip (Funding by DBT) 35. Indo-US training program on chronic noncommunicable disorders (CNCD) and diseases across the life span. Investigator: Dr. Mathew Varghese (Funding by Fogarty International Center) Schizophrenia is perhaps one of the most puzzling mental disorders whose etiopathogenesis is yet to be ascertained. Substantial research evidence from various lines of studies argues towards a compelling role for gene-environment interaction as a promising causal model for schizophrenia. genetic, immunological as well as epidemiological studies implicate a robust role for immune-mediated pathogenesis in schizophrenia. Indeed, immune disturbances mediated pathogenesis is among the most comprehensive & integrative models to understand the pathogenesis of schizophrenia. Immune mediated pathogenesis has also been described in bipolar disorder. This research on one of the component projects on DBT-Center of Excellence for Translational Research on the Neuroimmunopathology of Schizophrenia seeks to evaluate diagnostic utility of immune markers in psychosestodifferentiateschizophreniapatientsfromthoseof bipolardisorderandhealthycontrols. 37. As a part of preliminary analysis, 15 antipsychotic-naïve schizophreniabloodsamplesandequalnumberofcontrolswere subjectedtoadvancedFACSanalysis.About100uloftheblood was labelled with antibodies against CD3, CD16, CD56, CD4, CD8,CD25,CD28,CD127,andCD45indimlightconditions. This was followed by incubation in 40ºC for 20 min. RBC Fresh brain tissues and CSF from clinically characterized autopsied cases of schizophrenia are being studied by proteomic approach to identify candidate biomarkers. In additioncytokine-chemokinelevelsarebeinganalysedinCSF bybeadassay. 34. Default mode network as a predictor of cognitive ageing. Cognitive science research initiative (CSI). Investigators: Dr. Varghese M, Dr. John JP, Dr. Jain S, Dr. Bagepally BS (Funding by DST) 36. Shradha: A multimodel interface to desktop for elderly user group. Investigators: Dr. Sreekanth NS, CDAC, Bangalore, External consultant, Dr. Varghese M (Funding by DST) Targeted generation and interrogation of cellular models and networks in neuro-psychiatric disorders using candidate genes. Investigators: Dr. Sanjeev Jain, Dr. Preeti Joshi, Dr. M Panicker, NCBS, Bangalore, Dr. Mathew Verghese, Dr. Meera Purushottam, Dr. Odity Mukherjee, NCBS, Bangalore, Dr. Mukund Thattai, NCBS, Bangalore, Dr. Ashwin Sheshasayee, NCBS, Bangalore (Funding by DBT) Aspartoftheproject,10casesand10controlshavebeensampled. Protocol for generation of lymphoblastoid cell lines from peripheral blood lymphocytes has been standardised. Twenty LCLlineshavebeengenerated.Preliminarytranscriptomedata by RNA sequencing has been generated for 2 LCL lines. The methodforgeneconversionisbeingstandardised. 38. Genetics of movement disorders. Investigators: Dr. Sanjeev Jain, Dr. Pramod Pal, Dr. Meera Purushottam (Funding by ICMR) Patients and relatives are counselled prior to collecting the bloodsampleforgeneticdiagnosisofHuntington’sdiseaseand dominantataxias,ofwhichSCA1,2,3arebeingpredominantly National Institute of Mental Health and Neuro Sciences / 191 Annual Report 2013-14 tested for. Tables below give the numbers who have tested positive of the total cases tested. After adequate samples are collected,thegenotypeinformationwillbecorrelatedwiththe availableclinicalinformationforrecruitedsubjects.Haplotype analysis is being done for Huntington’s disease to look for regionspecificgeneticassociations. IMPRESSION CLINICAL IMPRESSION Degenerative Ataxias Huntington’s disease NUMBERSSAMPLED/NUMBEROF POSITIVES NUMBERSSAMPLED/NUMBEROF POSITIVES 40. Novel gene modifiers of penetrance of Alzheimer’s disease in carriers of apolipoprotein E (APO E) E4 alleles. Investigators: Dr. Sanjeev Jain, Dr. Mathew Varghese, Dr. Odity Mukherjee (Funding by ICMR) Individualswithdiagnosisofdementiahavebeensampledalong withagematchedcontrolsubjects.TheDNAisolatedfromblood hasbeenusedforgenotypingattheAPOE,CLUandPICLMloci. ThefindingsindicateassociationforAPOEbutnottheCLUand PICALMpolymorphisms.Tablewithresultsbelow: 90/29 34/21 Rangeof RangeofNormal Expandedallele S. Clinical No.of alleleRepeatsin No Impression Positives Repeatsin positivesamples positivesamples 1. SCA1 12 21-31 38-58 2. SCA2 13 19 31-57 3. SCA3 1 21 72 4. SCA12 3 10 5. HD 21 13-24 40-69 39. A multimodal imaging-genomics approach to investigating the link between impaired word generation and aberrant glutamatergic function in schizophrenia. Investigators: Dr. John P John, Dr. Sanjeev Jain, Dr. Bindu M Kutty, Dr. Jitender Saini (Funding by DST — CSI) Schizophrenia subjects were shown to have excessive functional magnetic resonance imaging (fMRI) brain oxygen-level dependent (BOLD) activations and deficient deactivations underlying their impaired performance of word generation in our previous research. On the basis of existing findings, these aberrant activations/deactivations may be understood to reflect an underlying hyperglutamatergic state secondary to NMDAhypofunction in the GABA-ergic interneurons in schizophrenia. Thus, using aberrant activations/deactivations during word generationasaputativeneurophysiologicalmarkerofunderlying glutamatergic dysfunction in schizophrenia, the investigators propose to investigate its neurophysiological, neurochemical, neuroanatomical and molecular genetic correlates, using a multi-modal imaging-genomics approach for obtaining in vivo confirmation of the role of glutamate in schizophrenia pathophysiology.Thestudyproposestousemulti-modalimaging toolsincludingfMRI,magneticresonancespectroscopy(MRS)at rest and functional MRS, P50 suppression paradigm, diffusion tensorimaging(DTI)in32gradientdirections;aswellasmolecular geneticapproachestostudytheDTNBP1andNRG1genes. Allparticipants(AD,n=243,control,n=164) Genotype Frequency 23 APOE 24 33 34 44 Allele frequency E2 E3 E4 CC CLU rs1113600 CT TT Allele frequency C T PICALM AA rs3851179 GA GG Allele frequency A G Gene,SNP 41. 11(0.04) 11(0.04) 131(0.53) 75(0.30) 15(0.06) 2n=486 Control(n, ChiP %) Square 17(0.10) 1(0.006) <0.001* 32.68 123(0.75) 22(0.13) 1(0.006) 2n=328 0.04 0.71 0.23 136(0.56) 92(0.38) 15(0.06) 2n=486 0.05 0.86 0.07 85(0.51) 63(0.38) 16(0.1) 2n=328 0.74 0.25 47(0.193) 104(0.428) 92(0.379) 2n=486 0.71 0.29 32(0.195) 79(0.482) 53(0.323) 2n=328 0.40 0.59 0.43 0.56 AD(n,%) <0.001* 34.79 0.48 1.45 0.25 1.30 0.54 1.21 0.54 0.46 Prevalence of anxiety and depression among pregnant women and association with antenatal healthcare utilization, antenatal health behaviour and with pregnancy outcomes – a prospective study. Investigators: Dr. Chandra PS, Dr. Satyanarayana VA, Dr. Kavita Jangam (Funding by DHR/ICMR) The aim of the study is fourfold. The primary objective is to prospectively assess both anxiety and depression among 650 womenfromtheirfirsttrimesterofpregnancytothethird,and within4weeksofchildbirth.Inaddition,variouspsychosocial 192 / National Institute of Mental Health and Neuro Sciences Annual Report and psychiatric factors that might be a risk factor for poor mentalhealthduringpregnancywillbesystematicallyassessed. Next,theimpactofmentalhealthandpsychosocialfactorson antenatalhealthbehaviourssuchasantenatalclinicattendance, immunizationduringpregnancy,anemiaandnutritionwillbe assessed.Finally,therelationshipbetweenanxiety/depression and pregnancy outcomes controlling for other psychosocial and obstetric variables will be examined. The study will be a prospective longitudinal study of perinatal depressive and anxiety symptoms among women in three slums of urban Bangalore.Thepopulationofthestudywillcomprisepregnant women. A cohort of 650 consecutive eligible and consenting women will be studied from the first trimester of pregnancy to six weeks of the postpartum period. This is a very recently fundedprojectandthestudyrelatedactivitieswillbeinitiated shortly. 42. Incidence and determinants of metabolic complications of antipsychotics in community dwelling schizophrenia patients in India. Investigators: Dr. Gangadhar BN, Dr. Naveen Kumar C, Dr. Rita Christopher (Funding by American Psychiatric Association) The study is aimed at determining the incidence and determinants of metabolic complications of antipsychotics amongpatientswithschizophrenialivinginaruralcommunity. Among the 250 patients and 270 healthy controls who were recruited from Turuvekere, the metabolic parameters were determined and genotyping for -759C/T polymorphism of 5HT2creceptor,-2548G/ApolymorphismofLeptingene,and -1291C/Gpolymorphismforalpha2adrenergicreceptorswere carriedout.Inaddition,estimationofserumleptinlevels,serum insulin levels and serum prolactin levels were also completed bothatbaselineandat6monthsoffollow-up. 43. Neural correlates of symptoms provocation in drug-naïve patients with obsessive compulsive disorder – A functional MRI study. Dr. S Mahavir Agarwal. Guides: Dr. CR Chandrasekar, Dr. G Venkatasubmramanian. 44. Rapid assessment of mental health and needs and planning of mental health services for the transgender (Hijra) community. Dr. Satish Kumar Budania. Guides: Dr. Shekar Seshadri, Dr. BM Suresh. 45. Household cost of dementia – An exploratory study, an estimation of costs for the care of 2013-14 dementia to families in an urban setting. Dr. Vinutha R. Guides: Dr. Srikala Bharath, Dr. Girish N Rao 46. Predictive value of fluoxotine induced early antidepressant improvement to late antidepressant improvement in depression. Dr. Shree Mishra. Guides: Dr. RS Pandey, Dr. Naveen Kumar C 47. Association of plasma protein clusterin with Alzheimer’s disease. Dr. Kavita Nagpal. Guides: Dr. Mathew Varghese, Dr. Sanjeev Jain 48. Bipolar disorder comorbidity in patients with a primary disgnosis of GOD. Dr. Gayathri Saraf. Guides: Dr. YC Janardhan Reddy, Dr. BM Suresh. 49. A study on outcome of opioid dependence treatment. Dr. Sissira VS. Guides: Dr. Prabhat K Chand, Dr. Pratima Murthy. 50. A study of clinical correlates of high suicidal intent among psychiatric inpatients. Dr. Hemendra Singh. Guides: Dr. Prabha S Chandra, Dr. Senthil K Reddi. 51. Relationship between cognitive function and metabolic parameters in patients with schizophrenia. Dr. Kapil Jhamnani. Guides: Dr. G Venkatasubramanian, Dr. BN Gangadhar 52. Prevalance and correlates of chronic paion with alcohol dependence syndrome. Dr. Jitendra Rohilla. Guides: Dr. Geetha Desai, Dr. Prabhat K Chand 53. Integrated brief tobacco cessation and alcohol intervention in a primary health care setting in Karnataka. Dr. Sabari Sridhar OT. Guides: Dr. Pratima Murthy, Dr. Kishore Kumar 54. An exploratory study of the link between Adenssine Deaminase level and sleep abnormalities in schizophrenia. Dr. Sunil Kumar. Guides: Dr. John P John, Dr. Sanjeev Jain 55. Study of gastrointestinal symptoms and atopy in children with autism spectrum disorder. Dr. Suresh VC. Guides: Dr. John Vijay Sagar, Dr. Geetha Desai National Institute of Mental Health and Neuro Sciences / 193 Annual Report 2013-14 56. Heritability of substance alcohol and nicotine seeking behavior. Dr. Prabhu Kiran. Guides: Dr. Sanjeev Jain, Dr. Prabhat K Chand 57. Social cognition in patients with bi-polar disorder in remission and its association with their functioning. Dr. Punith M. Guides: Dr. Jagadisha, Dr. YC Janardhan Reddy 58. Retrospective evaluation of the course of bipolar disorder in hospitalized patients. Dr. Sushma BR. Guides: Dr. Sanjeev Jain, Dr. YC Janardhan Reddy 59. Apolipoprotein E-Epsilon frequency and late onset psychosis. Dr. Kumbhar Mahesh Ananda Rao. Guides: Dr. Srikala Bharath, Dr. Sanjeev Jain 60. Stability of social cognitive deficits in patients with schizophrenia and its correlates – A prospective study. Dr. Shashidhara HN. Guides: Dr. Jagadisha, Dr. Naveen Kumar C 61. The relationship of OCD to reproductive life events among women with OCD. Dr. Imon Paul. Guides: Dr. Prabha S Chandra, Dr. YC Janardhan Reddy 62. Repititive transcranial magnetic stimulation as add on treatment for schizophrernia – A randomized double blind sham controllers study. Dr. Rajendra KM. Guides: Dr. Ravi S Pandey, Dr. Jagadisha 63. Vulnerability for schizophrenia clinical neurocognitive and neuroimaging correlates. Dr. Virupaksha HS. Guides: Dr G Venkatasubramanian, Dr. PT Sivakumar 64. Schizophrenia and body constitution (prakrit) : An exploration study. Dr. Rashmi A. Guides: Dr. BN Gangadhar, Dr. Shivaram V 65. Longitudinal course of cannabis induced psychotic disorders. Dr. Shah Dharav Sunil. Guides: Dr. Prabhat K Chand, Dr. Pratima Murthy 66. Differentiating schizophrenia and bipolar affective disorder – A study of functional brain symmetry amd emotion recognition. Dr. Saravanakumar A. Guides: Dr. BN Manjula Devi, Dr. G Venkatasubramanian 67. Word generation and sentence formation: a lesion-based multimodal imaging study. Dr. Aniruddh Narasimha. Guides: Dr. John P John, Dr Sanjeev Jain, Dr. Paritosh Pandey, Dr. Jitender Saini, Dr. Senthil Reddi 68. An exploratory study of the link between white matter integrity and serum levels of S100-B, a peripheral biomarker of neuronal integrity in schizophrenia. Dr. Nitin Ambekar. Guides: Dr. John P John, Dr. Sarada Subramanian Schizophrenia is a severe mental illness with significant anatomical disruption in white matter integrity. Diffusion tensor imaging, can measure the white matter abnormality intermsoffractionalanisotropy.Studieshaveshownaltered Th2/Th1 immune response and activation of microglia and astrocytes in schizophrenia resulting in release of certain proteinssuchasS100-B.Measuringthisproteincouldreflect whitematterabnormalitiesatperipherallevel.Inthisstudy, subjects will be scanned with 3.0 Tesla MRI system and Diffusiontensorimagewillbeacquired.Bloodwillbecollected forassessmentofS100-Blevelsintheserumwhichwouldbe measuredbyELISA. 69. An exploratory study of resting state brain functional connectivity and its association with S100B in major depression. Dr. Venkata Lakshmi Narasimha. Guides: Dr. John P John, Dr. Sarada Subramanian Dysregulationinbrainregionsassociatedwithaffectiscentral in the etiology of Major Depressive Disorder (MDD). This functionaldisconnectivitycanresultinreleaseoffactorssuch asS100-B. Subjectswillbescannedwith3.0TeslaMRIsysteminresting statefor6minutesandMagneticresonanceimagingdatawillbe acquired.SerumwillbeusedforassessmentofS100-B.ELISA will be carried out for the assessment of above mentioned biomarker. 194 / National Institute of Mental Health and Neuro Sciences Annual Report 70. Supportive CSF biomarker evidence to enhance the specificity of criteria for diagnosis of Alzheimer’s dementia. Dr. Chandrashekar B. Huded. Guides: Dr. Srikala Bharath, Dr. Chandra SR, Dr. Sarada Subramanian This study was undertaken to validate the measurement of biomarkersassupportiveevidenceinincreasingthespecificity ofthecurrentdiagnosticcriteriaofAD.CSFAβ42concentration wassignificantlylowinallADcases.Thereweredifferencesin ratioofp-tau/t-taubetweenADcasesandcontrolgroup.The CSF Aβ-42/ p-tau ratio showed significant differences in the meanbetweencases(probableandpossibleAD)comparedto normativedataindicatingthediscriminativevalueoftheCSF Aβ-42/ P-tau ratio in differentiating AD cases from normal controls. This study made an attempt to validate NIA-AA AD diagnosticcriteriaintheIndianset-up. 71. Role of copper in Alzheimer’s dementia- a controlled study. Dr. Siddhesh S Shere. Guides: Dr. Srikala Bharath, Dr. Sarada Subramanian, Dr. Meera Purushottam Understanding the molecular alterations responsible for Alzheimer disease (AD) has become imperative in order to developefficientstrategiesforthetherapy.Mountingevidence suggests that copper homeostasis is disturbed in affected individuals,leadingtooxidativestressandneurodegeneration. Patients with Alzheimer’s Dementia who fulfill the inclusion and exclusion criteria will be assessed on the study variables andcomparedwithmatchedhealthycontrols.Thestudywould provide us important insights into the role of copper in a neurodegenerativedisorderlikeAlzheimer’sDementiaandthis wouldhaveimplicationsfordiagnosing,severityprognosisand therapy. 72. Insulin resistance in Alzheimer’s dementia. Dr. Sreelakshmi Thankappan. Guides: Dr. Srikala Bharath, Dr. Sarada Subramanian, Dr. Preeti Sinha, Dr. Meera Purushottam Alzheimer’s dementia is considered as the most common dementia worldwide. Disturbances in the insulin signalling pathwaysisconsideredastheconnectinglinkbetweendiabetes andAlzheimer’sdementia. Thestudyproposestofindtherelationbetweeninsulinresistance andAlzheimer’sdementia.Thesubjectswillbeevaluatedusing 2013-14 sociodemographicprofoma,cognitivescreeningbattery(CSB), everydayabilityscaleforIndia(EASI),clinicaldementiarating scale(CDR).Bloodsugarandlipidprofile,insulinlevel,HbA1c, andApoEgenotypingwillbecarriedout. Psychiatric Social Work 1. Psychosocial competencies for children in difficult circumstances. Investigator: Dr. K Sekar (Funding by Everychild, UK) 2. Adaptation of psychosocial support materials for children with disabilities. Investigator: Dr. K. Sekar (Funding by SAMA) 3. Prevention of HIV among persons in central prison in Karnataka. Investigators: Dr. K Sekar, Dr. Jayashree R, Dr. Prathima Murthy (Funding by UNODC) 4. Promotion of mental health skills and psychological well-being of adolescents in schools-a district model. Investigator: Dr. Vranda MN (Funding by District Administration, Kolar) Theprojectaimedatpromotionofmentalhealthandpsychological well-being of rural high schools students using teachers as trainers.Asapartoftheproject,needassessmentwasconducted using focus groups discussions and in-depth interviews with teachers, mental health professionals, educational officers, studentsandtheirparents.Thishelpedtounderstandtheissues ofadolescentstobeaddressedinthepromotivementalhealthand psychologicalwell-beingmodules.Basedontheneedassessment and triangulation with existing literature, a draft manual was developed. The draft manual was field tested with 288 higher primaryandhighersecondaryschoolteachersfrom6taluksof Srinivasapura, KGF, Kolar, Malur, Mulbgal, and Bangarapet of Kolar District. In the training programme, teachers were trainedonfacilitatorymethods,conceptsofpromotionofmental healthskillsandwell-being,useofthemodules,andplannedfor implementationoftheprogrammeintheclassovertheyear.A totalofsixworkshopswereconducted.Currentlytheexpertpeer reviewfordraftmanualisunderway.Thesuggestionsofthepeer reviewers and teachers will be included in final manual before printing.Theprogrammewillbeimplementedintheschoolsby trainedteachersinthepresentacademicyear(May2014)forone year. National Institute of Mental Health and Neuro Sciences / 195 Annual Report 5. 6. 2013-14 Efficacy of brief yoga programme for caregivers of outpatients with schizophrenia. Investigators: Dr. Shivaram V, Dr. Md. Ameer Hamza (Funding by AYUSH, MH&FW) Developing training manual on adolescence sexuality, reproductive health and Gender discrimination to capacitate post graduate Social Work students trainees in India. Investigators: Dr. Md. Ameer Hamza, Dr. R Parthasarathy, Dr. N. Janardhana (Funding by ICMR) The main objective of the project was developing culture sensitive training manual to educate adolescents on sexuality and reproductive health. Mixed method was used during the development of this manual. Review of literature was collected on adolescence sexuality, reproductive health and gender discrimination during the first three months from varioussources.Followedbythisfocusgroupdiscussionswas conductedwithexpertsfromalloverIndiatodevelopamanual withparticipatorytrainingmethodology.Theparticipantswere selected based on their experience in the areas of teaching, research, publication, or research projects. The draft manual was prepared with the help of these experts. Subsequently, a review of university syllabi of 12 post graduate schools of SocialWorkwasconductedtoidentifylacunaeintheexisting coursecontent.Thedraftmanualwaspreparedwithnecessary modifications and need of the post graduate social work students.The6postgraduatesocialworkcollegesofBangalore Citywerecontactedfortheirwillingnesstosendtheirstudents for the training programme. From each college, 15 students were randomly selected to participate in a three-day training programme.Duringthetrainingprogramme,thestudentswere trained in areas of sexuality, reproductive health and gender discrimination. In the total of three workshops of three days durationeach,thetrainingprogrammeswerefieldtestedand finalized.Thedraftmanualwasmodifiedaccordingtotheneed and requirement of the workshop participants. Subsequently, feedback from the workshop participants were incorporated in the manual. The structured manual was prepared and the titlemodifiedfromadolescencesexuality,reproductivehealth andgenderdiscriminationtoreproductivehealth,adolescence sexuality and gender equality, based on the reviewers’ suggestion. 7. Development of the counseling manual and Capacity building for the counselors dealing with relationship issues of FSWs. Investigators: Dr. N Janardhana, Dr. Md. Ameer Hamza, Dr. Jayshree Ramakrishna, Dr. N Krishna Reddy (Funding by Karnataka Health Promotion Trust) The main aim of the project was to develop a counseling training manual and capacity building of counselors dealing with relationship issues of FSWs. The need assessment was carried out with counselors, staffs of KHPT, and FSWs through interviews and Focus Group Discussions. Based on these findings, the major themes were taken for training and manual development. The training programme and hand holding support for counselors were carried out in Bagalokot andBijapurdistricts.Inthepilotphaseoffirstsixmonths,the manual was drafted and field tested in the later stage. Nearly 18counsellorsweretrainedandreceivedhand-holdingsupport in the field. The draft manual was given to the experts in the fieldforreview.Thenecessarymodificationsweremadebased onthereviewerscomments.Thefinalmanualwasgiventothe fundingagencyforprint. 8. Psychosocial interventions for children in difficult circumstances under the care and protection of Child Welfare Committee, Bangalore. Investigators: Dr. N Janardhana, Dr. BP Nirmala, Dr. N Krishna Reddy, Dr. Md. Ameer Hamza, Dr. H Uma, Dr. Roopesh, Dr. John Vijaya Sagar (Funding by KHPT, Govt. of Karnataka) The main aim of the project is to provide psycho-social interventions for children under care and protection and counseling training for counselors. This particular project is fundedbyKarnatakaStateIntegratedChildProtectionSociety, Dept. of Women and Child Development, Govt. of Karnataka. Through this project psycho-social interventions are being providedtochildrenatShishuGruhas(Governmenthomes)and childrenwhocomeforcareandprotectionthroughchildwelfare committee. Preventive and promotive mental health activities arebeingcarriedoutintheinstitutions.Childrenwhoareinneed ofcurativetreatmentarebeenreferredtoChildandAdolescent Psychiatry OPD. Supervision and hand-holding support is ongoingforcounselorsinGovernmentChildrenHomes. 9. A Study on psychosocial correlates and problems of caregivers of person living with cancer. Investigators: Dr. A Thirumoorthy (Funding by ICSSR) This study aims to assess the quality of life, coping styles, the burden experienced and the social support available to caregiversofpersonslivingwithcancer. 196 / National Institute of Mental Health and Neuro Sciences Annual Report 10. Psychosocial problems of patients with Parkinson’s disease. Investigator: Dr. Prakashi Rajaram 11. Childhood abuse and self harm among women hospitalized for psychiatric disorders. Investigator: Dr. Kavita Jangam, Dr. Muralidharan K, Dr. N Janardhana, Dr. Thennarasu (Funding by NIMHANS) Themainaimoftheprojectistostudytheprevalenceofchildhood physical,sexual,emotionalabuse,intimatepartnerviolenceand selfharmamongwomenwithpsychiatricdisorders.Theproject wasinitiatedwithNIMHANSfundinginJune2013.Thesample forthestudywascollectedfromNIMHANS.Womenabovethe ageof18to50wererecruitedforthestudyfrombothinpatient andoutpatientsetting.Anonclinicalsampleofwomenwasalso recruitedforthecomparisonpurpose.Totalsamplecomprised 200womeninpatients,409womenoutpatientsand100nonclinical sample of women. Data collection was completed in April 2014 and currently, data analysis and report writing is in progress. The report of the project will be submitted to NIMHANSinJune2014. 12. wide range of issues of children in difficult circumstances, counselingaspects,childprotectionmechanism,legalaspects, and care for these children. These topics were introduced in the training programmes based on the nature of work of childprotectionpersonnellikecounselors,protectionofficers, probation officers, social workers, house parents, institution heads from all the districts of Karnataka. Totally 13 training programmesconductedintheDepartmentcoverednearly425 childprotectionpersonnel.Allthetrainingprogrammeswere completed,andthehandbookofcounselingisbeingprepared. 15. Intensive case management for persons with severe alcohol dependence – A feasibility study. Mr. Arthur Julian Anthony Joseph. Guides: Dr. R. Dhanasekara Pandian, Dr. Pratima Murthy (Funding by NIMHANS) 16. Efficacy of psychosocial intervention with siblings of persons with schizophrenia. Mr. Amaresha. Guides: Dr. D Muralidhar, Dr. DK Subbakrishna (Funding by Wellcome Trust/DBT India Alliance) 17. Psychosocial needs, distress, social support, quality of life and functionality of newly diagnosed malignant brain tumor patients. Mr. Biruduraju. Guide: Dr. NK Krishna Reddy , Dr. Vani Santosh, Dr. Paritosh Pandey (Funding by DBT ) An investigation into the patterns of out patient follow up treatment and the influencing factors for follow-up among patients with severe mental illness in NIMHANS: A mixed method study. Investigators: Dr. Kavitha Jangam (NIMHANS intramural funding) 13. Comparision of antipsychotics for nonneurological adverse effects- Pilot naturalistic study. Investigator: Dr. Kavita Jangam (NIMHANS intramural funding) 14. Capacity building and counselling training programme for field functionaries of Integrated Child protection Scheme in Karnataka. Investigators: Dr. N Janardhana, Dr. K Sekar, Dr. R Parthasarathy, Dr. D Muralidhar, Dr. Shekhar P Seshadri (Funding by Karnataka State Integrated Child Protection Society, Dept. of Women and Child Development, Govt. of Karnataka) Themainaimoftheprojectwastoconductcapacitybuildingand counselingtrainingprogrammeforchildprotectionpersonnel in Karnataka and to develop a Handbook on Counseling. Initiallytopicswerepreparedforcounselingtrainingcovering 2013-14 Psychopharmacology 1. Electroconvulsive seizure-induced neuroplasticity changes in the rat brain. Investigators: Dr. Chittaranjan Andrade, Dr. Sumantra Chatarji, Dr. BK Chandrasekhar Sagar, Ravi Prabhakar Hegde (Funding by DBT and ICMR) Neuroplasticity in the brain, which is influenced by inputs from environment, is a complex phenomenon which includes neurogenesis, new synapse formation, dendritic arborization, long-term potentiation, long-term inhibition, andotherphenomena.Plasticityoccursonavarietyoflevels, ranging from cellular changes involved in learning, to largescale changes involved in cortical remapping in response to injury. Neuroplasticity changes also underlie improvement in or recovery from depression, stroke, and possibly certain neurodegenarative diseases. Neuroplasticity changes have been proposed as a mechanism of action of electroconvulsive therapy(ECT).Electroconvulsiveshock(ECS)hasbeenshown to induce nerve cell proliferation in the hippocampus. The National Institute of Mental Health and Neuro Sciences / 197 Annual Report 2013-14 Investigators: Dr. Vandana VP, Dr. Preeti Sinha, Dr. M Jayaram Dr. Pamela Enderby, University of Sheffield (NIMHANS intramural funding) presentstudyhasbeendesignedtodeterminetheroleofECS insynaptogenesisintherathippocampus. 2. 3. Study of visuospatial memory in an animal model of ECT. Investigators: Dr. Chittaranjan Andrade Meta-analysis of ar/modafinil in schizophrenia. Investigator: Dr. Chittaranjan Andrade The meta-analysis indicated that ar/modafinil produced a smallimprovementinnegativesymptomswithoutfavorablyor adverselyinfluencinganyotheraspectofpsychopathologyand withoutcausingsignificantadverseoutcomes. 4. Efficacy of herbal cognition enhancers in learning and ECS-induced amnesia. Investigator: Dr. Chittaranjan Andrade The study indicated that the herbal formulations improved learningandreducedECS-inducedretrogradeamnesticdeficits. 5. Investigation of ECS-induced oxidative stress and retrograde amnesia. Investigator: Dr. Chittaranjan Andrade 6. A study to evaluate the effectiveness of an educational module on knowledge about, experiences with, and attitudes towards antidepressant drugs in antidepressantnaïve depressed patients. Investigators: Dr. Chittaranjan Andrade The educational module significantly improved knowledge without influencing attitudes or outcomes. Patients receiving educationexperienced/noticedmoredrugadverseeffects. 7. Alteration of heart rate variability and cardiac electrophysiological variables in a rodent model of brain stimulation. Mr. Nagendra Madan Singh. Guides: Dr. Chittaranjan Andrade, Dr. Jagadisha T (Funding by ICMR) This study mathematically models heart rate variability as a functionofdifferentelectricaldosesinananimalmodelofECT. Speech production deficits are frequently associated with the use of psychotropic drugs, with the symptoms manifesting within three to six months or within an year of initiation of medication. Majority of these symptoms are associated with the use of old generation antipsychotics. These side effects occur when antipsychotic drugs are taken in isolation or combined with other medications. At present, there is a lack ofwell-controlledstudiesexaminingantipsychoticmedicationrelated speech outcomes, particularly as associated with atypical antipsychotic drugs. The objective of the proposed researchistoprovidetheprevalenceofadversesideeffectson speech production from use of atypical antipsychotic drugs; to determine if impairments in speech motor function were specific to any atypical antipsychotic drug and to see if there areanychangesinspeechproductioncharacteristicsassociated withuseofatypicalantipsychoticdrugaloneorincombination withantidyskineticsliketrihexyphenydylandbenzodiazepine. Theresultsofthestudymaypossiblyrevealthemedicationsthat mayormaynotbeassociatedwithspeechproductiondeficits andalsothetypeofspeechproductiondeficitsassociatedwith use of atypical antipsychotic drugs. By adding a thorough knowledge of adverse drug effects to psychopharmacological training,professionalscanprovidehigherqualitymentalhealth care,providepositivelongtermoutcomeswithbettertreatment efficiencyandreductioninoverallhealthcarecosts. 2. The scope of this study is to focus on the articulatory kinematicsinbothbulbaronsetandspinalonsetpatientswith Amyotrophic Lateral Sclerosis. Patients and matched healthy controlsarebeingrecruitedandtestedonaseriesoftasksusing thearticulograph. Ayurveda 1. Clinical evaluation of brahma rasayana in the management of “Manasamandata” (Mental Retardation) – An open clinical Trial. 2. Clinical evaluation of a Comprehensive Ayurvedic intervention in the management of Manodwega (GAD). Speech Pathology & Audiology 1. Articulatory kinematics in patients with amyotrophic lateral sclerosis. Investigators: Dr. BK Yamini, Dr. N Shivashankar, Dr. A Nalini (Funding by DBT) Prevalence and nature of speech disorders in persons on atypical antipsychotic drugs. 198 / National Institute of Mental Health and Neuro Sciences Annual Report 3. Clinical evaluation of sarasvata ghrita in the management of cognitive deficit. 4. 5. 2013-14 6. A comparative study of ayurvedic treatment vs allopathic treatment inpatients with moderate to severe dementia (Smriti bramsa). Ayurvedic coded drug (AYUSH MANAS) in the management of Manasa Mandata (Mental Retardation). 7. Effectiveness of the role of astangalavana and srikhandasava as add on treatment on madatyaya (Alcohol Dependence) – An open level clinical trial. Clinical evaluation of panchagavya ghrita and jyotishmati taila in the management of vishada (Depression). 8. Clinical evaluation of ayurvedic intervention in the management of Gridhrisi vata (Sciatica). Number of Research Projects A. Newly Sanctioned Projects i) National 36 ii) International 02 B Ongoing Projects i) National ii) International iii) Training Schemes C.COMPLETED & CLOSED 220 29 02 Total Projects Total Amount Involved (in `) Total Amount Per Annum (in `) 8,92,36,824.00 35,49,333.00 445,70,816.00 35,49,333.00 52,68,44,695.00 3,70,26,607.00 3,40,56,294.00 19,13,87,612.00 2,09,31,012.00 14,09,483.00 289 69,07,13,753.00 26,18,48,256.00 15 1,32,45,681.00 46,08,274.00 38 251 National Institute of Mental Health and Neuro Sciences / 199 Annual Report 2013-14 PhotoCourtesy:JasminMaitreya 200 / National Institute of Mental Health and Neuro Sciences Annual Report Publications A. INTERNATIONAL JOURNALS 1. 2. 3. 4. Abhishekh HA, Kumar NC, Thirthalli J, Chandrashekar H, Gangadhar BN, Sathyaprabha TN. Prolonged reaction to mental arithmetic stress in first degree relatives of schizophrenia patients. Clin Schizophr Relat Psychoses. 2013; 1-14. Abhishekh HA, Nisarga P, Kisan R, Meghana A, Chandran S, Raju T, Sathyaprabha TN. Influence of age and gender on autonomic regulation of heart. J Clin Monit Comput. 2013; 27: 259-264. Abhishekh HA, Thirthalli J, Manjegowda A, Phutane VH, Muralidharan K, Gangadhar BN. Ictal EEG fractal dimension in ECT predicts outcome at 2 weeks in schizophrenia. Psychiatry Res. 2013; 209: 155-159. Agarwal SM, Shivakumar V, Bose A, Subramaniam A, Nawani H, Chhabra H, Kalmady SV, Narayanaswamy JC, Venkatasubramanian G. Transcranial direct current stimulation in Schizophrenia. Clin Psychopharmacol Neurosci. 2013; 11: 118-125. 5. Amaresha AC, Arthur JAJ, Venkatasubramanian G. Letter to the editor. Intl J Soc Psychiatry. 2013; 59: 619-620. 6. Anadure RK, Nagaraja D, Christopher R. Plasma factor VIII in non-puerperal cerebral venous thrombosis: A prospective case-control study. J Neurol Sci. 2014; 339: 140-143. 7. Andrade C. Antenatal exposure to selective serotonin reuptake inhibitors and duration of gestation. J Clin Psychiatry. 2013; 74: e633-e635. 8. Andrade C. Antidepressant use in pregnancy and risk of autism spectrum disorders: a critical examination of the evidence. J Clin Psychiatry 2013; 74: 940-941. 9. Andrade C. Antidepressants and testicular cancer: cause versus association. J Clin Psychiatry 2014; 75: e198-e200. 10. Andrade C. Augmenting selective serotonin reuptake inhibitors with clomipramine in obsessive-compulsive disorder: benefits and risks. J Clin Psychiatry. 2013; 74: e1128-e1133. 2013-14 11. Andrade C. Famotidine augmentation in schizophrenia: hope or hype? J Clin Psychiatry 2013; 74: e855-e858. 12. Andrade C. Learning from history: How to swallow a pill. J Clin Psychiatry 2013; 74: e949-e951. 13. Andrade C. Levothyroxine in psychiatry: issues related to absorption after oral dosing. J Clin Psychiatry 2013; 74: e744-e746. 14. Andrade C. Low dose amisulpride and elevation in serum prolactin. J Clin Psychiatry 2013; 74: e558-e560. 15. Andrade C. Primary prevention of cardiovascular events in patients with major mental illness: a possible role for statins. Bipolar Disord. 2013; 15: 813-823. 16. Andrade C. Selective serotonin reuptake inhibitor drug interactions in patients receiving statins. J Clin Psychiatry 2014; 75: e95-e99. 17. Andrade C. Signal to noise ratio, variability, and their relevance in clinical trials. J Clin Psychiatry 2013; 74: 479-481. 18. Andrade C. Transcranial direct current stimulation for refractory auditory hallucinations in schizophrenia. J Clin Psychiatry 2013; 74: e1054-e1058. 19. Aniruddha TJ, Arivazhagan A, Chandramouli BA. Supratentorial extradural hematoma secondary to intracranial hypotension following spinal cerebrospinal fluid release: A case report and review of literature. Neurol Asia. 2013; 18 : 33-336. 20. Anish C, Dhanasekara P, Suresh B, Thennarasu K, Reddy YCJ. Clinical predictors of family accommodation in obsessive-compulsive disorder: a study from India. Int J Psychiatr Clin Prac. 2013; 17: 38-38. 21. Arimappamagan A, Somasundaram K, Thennarasu K, Peddagangannagari S, Srinivasan H, Shailaja BC, Samuel C, Patric IR, Shukla S, Thota B, Prasanna KV, Pandey P, Balasubramaniam A, Santosh V, Chandramouli BA, Hegde AS, Kondaiah P, Rao MRS. A fourteen gene GBM prognostic signature identifies association of immune response pathway and mesenchymal subtype with high risk group. PLoS One. 2013; 8: e62042. National Institute of Mental Health and Neuro Sciences / 201 Annual Report 22. 23. 2013-14 Arivazhagan A, Subhas K, Mohammed MA, Arvinda HR, Paritosh P. Successful surgical management of vertebral artery aneurysm in a patient with Takayasu disease with a single vessel intracranial circulation: A case report and literature review. Neurosurgery Quarterly 2014; doi: 10.1097/WNQ.0b013e3182a2fb33 Arora P, Baena A, Yu KO, Saini NK, Kharkwal SS, Goldberg MF, Kunnath-Velayudhan S, Carreño LJ, Venkataswamy MM, Kim J, Lazar-Molnar E, Lauvau G, Chang YT, Liu Z, Bittman R, Al-Shamkhani A, Cox LR, Jervis PJ, Veerapen N, Besra GS, Porcelli SA. A single subset of dendritic cells controls the cytokine bias of natural killer T cell responses to diverse glycolipid antigens. Immunity. 2014; 40: 105-116. 24. Arumugham SS, Reddy YC. Commonly asked questions in the treatment of obsessive-compulsive disorder. Expert Rev Neurother. 2014; 14: 151-163. 25. Arun S, Sarwat N, Balaram T, Thennarasu K, Arivazhagan A, Sampath S, Vani S, Paturu K. Therapy resistance and survival in glioblastoma -the role of Stat-1. Neurooncol. 2013; 15:162-163. 26. Aswathy PM, Jairani PS, Verghese J, Gopala S, Mathuranath PS. Microtubule-associated protein tau genetic variations are uncommon cause of frontotemporal dementia in south India. Neurobiol Aging. 2013; 35: e23-e24. 27. Aziz ZA, Saini J, Bindu PS, Sharath Kumar GG. Demonstration of different histological layers of the pachygyria/agyria cortex using diffusion tensor MR imaging. Surg Radiol Anat. 2013; 35: 427-433. 28. 29. 30. Babu CS, Satishchandra P, Mahadevan A, Pillai Shibu V, Ravishankar S, Sidappa N, Udaykumar R, Ravi V, Shankar SK. Usefulness of stereotactic biopsy and neuroimaging in management of HIV-1 Clade C associated focal brain lesions with special focus on cerebral toxoplasmosis. Clin Neurol Neurosurg. 2013; 115: 995-1002. Babu GN, Thippeswamy H, Chandra PS. Use of electroconvulsive therapy (ECT) in postpartum psychosis-a naturalistic prospective study. Arch Womens Ment Health. 2013; 16: 247-251. Babu K, Kini R, Philips M, Subbakrishna DK. Clinical profile of isolated viral anterior uveitis in a south Indian patient population. Ocul Immunol Inflamm. 2013; doi:10 .3109/09273948.2013.841482 [Epub ahead of print]. 31. Babu K, Philips M, Subbakrishna DK. Perspectives of quantiferon TB GOLD test among Indian practitioners: a survey. J Ophthalmic Inflamm Infect. 2013; 3: 9. 32. Bagepally BS, John JP, Varghese M, Halahalli HN, Kota L, Sivakumar PT, Bharath S, Jain S. Relationship of clinical and cognitive variables with brain morphometric abnormalities in Alzheimer’s disease: a voxel based morphometric study using 3-tesla MRI. Aging Dis. 2013; 4: 1-9. 33. Baldawa S, Kasegaonkar P, Vani S, Kelkar G. Primary intraventricular gliosarcoma. Clin Neuropathol. 2013; 32: 525-528. 34. Bansal S, Ramesh VJ, Rao GS, Surve RM. Anaesthesia and orphan disease: failed airway management in a case of Smith-McCort Dysplasia. Eur J Anaesthesiol. 2013; 30: 775-776. 35. Bansal S, Surve RM, Venkatapura RJ. Anesthetic management of a paraparetic patient with multiple lung bullae. J Neurosurg Anesthesiol. 2014; 26: 85-86. 36. Banu H, Chakrabarthy N, Michael RJ, Kumar R, Sudhir PM, Sharma MK, Mehrotra S. Two wheeler riding patterns, perceptions and aggressive riding behavior among college youth. Int J Innov Res Sci Eng Technol. 2013; 2: 4250-4256. 37. Basagoudanavar SH, Hosamani M, Tamil Selvan RP, Sreenivasa BP, Saravanan P, Chandrasekhar Sagar BK, Venkataramanan R. Development of a liquid-phase blocking ELISA based on foot-and-mouth disease virus empty capsid antigen for seromonitoring vaccinated animals. ArchVirol. 2013; 158: 993-1001. 38. Benegal V, Viswanath B, Narayanaswamy JC, Jose SP, Chakraborty V, Sankar D, Kandavel T, Kesavan M. The efficacy of atomoxetine as adjunctive treatment for co-morbid substance use disorders and externalizing symptoms. Asian J Psychiatr. 2013; 6: 544-547. 39. Benegal V. Gambling experiences, problems and policy in India: a historical analysis. Addiction. 2013; 108: 2062-2067. 40. Bener A, Dafeeah EE, Chaturvedi SK, Bhugra D. Somatic symptoms in primary care and psychological morbidities in Qatar. Neglected burden of disease. Intl Review Psychiatry 2013; 25: 100-106. 202 / National Institute of Mental Health and Neuro Sciences Annual Report 41. 42. 43. 44. 45. Bennet CN, Rajeswaran J, Christopher R, Sampath S. The right to write: EEG neurofeedback training in frontal lobe agraphia—a case report. J Neurother. 2013; 17: 162-165. Bertelli MO, Salvador-Carulla L, Scuticchio D, Varrucciu N, Martinez-Leal R, Cooper SA, Simeonsson RJ, Deb S, Weber G, Jung R, Munir K, Adnams C, Akoury-Dirani L, Girimaji SC, Katz G, Kwok H, Walsh C. Moving beyond intelligence in the revision of ICD-10: specific cognitive functions in intellectual developmental disorders. World Psychiatry. 2014; 13: 93-94. Bhadrinarayan V. Airway management in a child with a large retropharyngeal mass - A lesson learned: how conventional rules of endotracheal tube fixation can be deceptive. Anesthesiology 2013; 119: 448. Bhaganagare AS, Sudhendra TR, Mahadevan A. Cauda equina aspergilloma in an immunocompetent individual: A case report. J Craniovertebr Junction Spine. 2013; 4: 35-36. Bhalsing KS, Saini J, Pal PK. Understanding the pathophysiology of essential tremor through advanced neuroimaging: a review. J Neurol Sci. 2013; 335: 9-13. 47. Bhalsing KS, Sowmya V, Netravathi M, Jain S, Pal PK. Spinocerebellar ataxia (SCA) type 2 presenting with chorea. Parkinsonism Relat Disord. 2013; 19: 1171-1172. 48. Bhalsing KS, Upadhyay N, Kumar KJ, Saini J, Yadav R, Gupta AK, Pal PK. Association between cortical volume loss and cognitive impairments in essential tremor. Eur J Neurol. 2014; 21: 874-883. 49. Bharat S, Ramakrishna J, Heylen E, Ekstrand ML. Gender-based attitudes, HIV misconceptions and feelings towards marginalized groups are associated with stigmatization in Mumbai, India. J Biosoc Sci. 2014; 1-16. 50. 51. reductase C677T polymorphism in cerebral veno-sinus thrombosis. Clin Appl Thromb Hemost. 2014; 20: 78-83. 52. Bhat M, Prasad C, Bindu PS, Aziz Z, Christopher R, Saini J. Unusual imaging findings in brain and spinal cord in two siblings with maple syrup urine disease. J Neuroimaging. 2013; 23: 540-542. 53. Bhola P, Rekha DP, Sathyanarayanan V, Daniel S, Thomas, T. Self-reported suicidality and its predictors among adolescents from a pre-university college in Bangalore, India. Asian J Psychiatr. 2014; 7: 38-45. 54. Bindu PS, Taly AB, Kothari S, Christopher R, Gayathri N, Sinha S, Nagappa M, Bhatt M, Bharath RD. Electroclinical features and magnetic resonance imaging correlates in Menkes disease. Brain Dev. 2013; 35: 398405. 55. Bindu PS, Taly AB, Sonam K, Govindaraju C, Arvinda HR, Gayathri N, Bharath MM, Ranjith D, Nagappa M, Sinha S, Khan NA, Thangaraj K. Bilateral hypertrophic olivary nucleus degeneration on magnetic resonance imaging in children with leigh and leigh-like syndrome. Br J Radiol. 2014; 87. 56. Bücker J, Muralidharan K, Torres IJ, Su W, Kozicky J, Silveira LE, Bond DJ, Honer WG, Kauer-Sant’anna M, Lam RW, Yatham LN. Childhood maltreatment and corpus callosum volume in recently diagnosed patients with bipolar I disorder: data from the systematic treatment optimization program for early mania (STOPEM). J Psychiatr Res. 2014; 48: 65-72. 57. Bucker J, Popuri S, Muralidharan K, Kozicky JM, Baitz HA, Honer WG, Torres IJ, Yatham LN. Sex differences in cognitive functioning in patients with bipolar disorder who recently recovered from a first episode of mania: data from the systematic treatment optimization program for early mania (STOP-EM). J Affect Disord. 2014; 155: 162168. 58. Buss S, Noone ML, Tsai R, Johnson B, Pradeep VG, Salam KA, Mathuranath PS, Verghese J. Objective cardiac markers in dementia: Results from the Kerala–Einstein study. Int J Cardiol 2013; 167: 595-596. 59. Chaitanya G, Sinha S, Reddy, Madhusudhan KR, Arivazhagan A, Rao MB, Thennarasu K, Chandramouli BA, Satishchandra P. Dexmedetomidine anesthesia during intraoperative electrocorticography (ecog) recording: Bhagyavathi HD, Mehta UM, Thirthalli J. The relationship between empathy, emotion processing and clinical insight in remitted schizophrenia patients. Eur Arch Psychiatry Clin Neurosci. 2013; doi: 10.1007/s00406-013-0484-2 [Epub ahead of Print]. 46. Bharath S. Carer burden in dementia: an Indian perspective (Editorial) Neurodegenerative Disease Management. 2013; 3: 191-193. Bharatkumar VP, Nagaraja D, Christopher R. Hyperhomocysteinemia and methylenetetrahydrofolate 2013-14 National Institute of Mental Health and Neuro Sciences / 203 Annual Report 2013-14 promising, safe and enhances spike generation. Epilepsia 2013; 54: 91-92. 60. Chand P, Thirthalli J, Murthy P. Substance use disorders among treatment naïve first-episode psychosis patients. Compr Psychiatry 2014; 55: 165-169. 61. Chandra PS, Doraiswamy P, Padmanabh A, Philip M. Do newspaper reports of suicides comply with standard suicide reporting guidelines? A study from Bangalore, India. Intl J Soc Psychiatry. 2013; 22: 1-8. 62. Chandra PS, Satyanarayana VA. ‘I’m more sick than my doctors think’: ethical issues in managing somatization in developing countries. Intl Rev Psychiatry. 2013; 25: 77-85. 63. Chatterjee S, Naik S, John S, Dabholkar H, Balaji M, Koschorke M, Varghese M, Thara R, Weiss HA, Williams P, McCrone P, Patel V, Thornicroft G. Effectiveness of a community-based intervention for people with schizophrenia and their caregivers in India (COPSI): a randomised controlled trial. Lancet. 2014; 383: 13851394. 64. Chaturvedi SK, Desai G. Measurement and assessment of somatic symptoms. Intl Rev Psychiatry. 2013; 25: 31-40. 65. Chaturvedi SK. Many faces of somatic symptom disorders. Intl Rev Psychiatry. 2013; 25: 1-4. 66. Chauhan N, Chaunsali L, Deshmukh P, Padmanabhan B. Analysis of dimerization of BTB-IVR domains of Keap1 and its interaction with Cul3, by molecular modeling. Bioinformation 2013; 9: 450-455. 67. 68. 69. Cherian AV, Math SB, Kandavel T, Reddy YCJ. A 5-year prospective follow-up study of patients with obsessivecompulsive disorder treated with serotonin reuptake inhibitors. J Affect Disord. 2014; 152-154: 387-394. Cherian AV, Narayanaswamy JC, Viswanath B, Guru N, George CM, Math SB, Kandavel T, Janardhan Reddy YC. Gender differences in obsessive compulsive disorder: Findings from a large Indian sample. Asian J Psychiatr. 2014; 9: 17-21. Cherian AV, Pandian D, Math SB, Kandavel T, Reddy YCJ. Family accommodation of obsessional symptoms and naturalistic outcome of obsessive-compulsive disorder. Psychiatry Res. 2014; 215: 372-378. 70. Chikkannaiah P, Mahadevan A, Gosavi M, Kangle R, Anuradha, Shankar SK. Sirenomelia with associated systemic anomalies: An autopsy pathologic illustration of a series of four cases. Pathol Res Pract. 2014; 210: 444-449. 71. Christopher R, Majumdar V, Nagaraja D. Association of the functional kl-vs variant of klotho gene with ischemic stroke in the young. Cerebrovasc Dis. 2013; 36: 2-3. 72. D’Souza DC, Radhakrishnan R, Perry E, Bhakta S, Singh NM, Yadav R, Abi-Saab D, Pittman B, Chaturvedi SK, Sharma MP, Bell M, Andrade C. Feasibility, safety and efficacy of the combination of d-serine and computerized cognitive retraining in schizophrenia: an international collaborative pilot study. Neuropsychopharmacology. 2013; 38: 492-503. 73. Dahale AB, Narayanaswamy JC, Venkatasubramanian G, Bagewadi VI. Successful use of agomelatine and venlafaxine combination in major depression. Gen Hosp Psychiatry. 2014; 36: e3. 74. de Souza A, Madhusudana SN. Survival from rabies encephalitis. J Neurol Sci. 2014; 339: 8-14. 75. De T, Christopher R, Nagaraja D. Influence of vitamin K epoxide reductase complex 1 gene polymorphisms on anticoagulation with acenocoumarol in patients with cerebral venous thrombosis. British J Med Medical Res. 2014; 4: 1069-1080. 76. De T, Christopher R, Nagaraja D. Influence of CYP2C9 polymorphism and phenytoin co-administration on acenocoumarol dose in patients with cerebral venous thrombosis. Thromb Res. 2014; 133: 729-735. 77. Debnath M, Venkatasubramanian G. Recent advances in psychoneuroimmunology relevant to schizophrenia therapeutics. Curr Opin Psychiatry. 2013; 26: 433-439. 78. Deepika A, Munivenkatappa A, Devi BI, Shukla D. Does isolated traumatic subarachnoid hemorrhage affect outcome in patients with mild traumatic brain injury? J Head Trauma Rehabil. 2013; 28: 442-445. 79. Deepika A, Reddy M, Shukla D. Paroxysmal sympathetic hyperactivity in a child with moyamoya disease. J Neurosurg Anesthesiol. 2014; 26: 87-88. 204 / National Institute of Mental Health and Neuro Sciences Annual Report 80. Desai G, Chaturvedi SK. Do ‘numbers’ count?! British J Psychiatry. 2014; 204: 322-324. 81. Desai G, Chaturvedi SK. Gender and Somatoform disorders: Do subtypes of somatoform disorders differ? Asian J Psychiatry 2013; 6: 609-610. 89. Dubey R, Chakrabarty B, Gulati S, Sharma MC, Deopujari S, Baheti N, Santosh V, Pai G, Kabra M. Leukodystrophy presenting as acute-onset polyradiculoneuropathy. Pediatr Neurol. 2014; 50: 616-618. 90. Ekstrand ML, Ramakrishna J, Bharat S, Heylen E. Prevalence and drivers of HIV stigma among health providers in urban India: implications for interventions. J Int AIDS Soc. 2013; 16: 18717. 91. Fadnis P, Ravi V, Desai A, Turtle L, Solomon T. Innate immune mechanisms in Japanese encephalitis virus infection: effect on transcription of pattern recognition receptors in mouse neuronal cells and brain tissues. Viral Immunol. 2013; 26: 366–377. 92. Ganesan M, Pal PK, Gupta A, Sathyaprabha TN. Modulation of blood pressure variability and baroreflex sensitivity following partial weight supported treadmill gait training in patients with Parkinson’s disease. Clin Auton Res. 2014. [Epub ahead of print]. 93. Ganesan M, Pal PK, Gupta A, Sathyaprabha TN. Treadmill gait training improves baroreflex sensitivity in Parkinson’s disease. Clin Auton Res. 2014; 24: 111-118. 94. Ganesan M, Satyaprabha TN, Gupta A, Pal PK. Effect of partial weight supported treadmill gait training on balance in patients with Parkinson’s disease. PM R. 2014; 6: 22-33. 95. Dhiman V, Sinha S, Rawat VS, Chaturvedi SK, Satishchandra P. Semiological characteristics of adults with psychogenic nonepileptic seizures (PNESs): an attempt towards a new classification. Epilepsy Behav. 2013; 27: 427-432. Ganjekar S, Desai G, Chandra PS. A comparative study of psychopathology, symptom severity, and short-term outcome of postpartum and nonpostpartum mania. Bipolar Disord. 2013; 15: 713-718. 96. Dhiman V, Sinha S, Rawat VS, Vijaysagar KJ, Thippeswamy H, Srinath S, Chaturvedi SK, Satishchandra P. Children with psychogenic non-epileptic seizures (PNES): A detailed semiologic analysis and modified new classification. Brain Dev. 2014; 36: 287-293. Ghorpade DS, Holla S, Kaveri SV, Bayry J, Patil SA, Balaji KN. Sonic hedgehog-dependent induction of microRNA 31 and microRNA 150 regulates Mycobacterium bovis BCG-driven toll-like receptor 2 signaling. Mol Cell Biol. 2013; 33: 543-556. 97. Ghorpade DS, Leyland R, Karowska–Stolaraska M, Patil SA, Balaji KN. Micro RNA 155 is required for Mycobacterium bovis BCG mediated apoptosis of macrophages. Mol Cell Biol. 2012; 32: 2239-2253. 98. Ghosh S, Laxmi TR, Chattarji S. Functional connectivity from the amygdala to the hippocampus grows stronger after stress. J Neurosci. 2013; 33: 7234-7244. 82. Dhandapani A, Narayanaswamy JC, Venkatasubramanian G. Adjuvant raloxifene treatment for negative symptoms of schizophrenia. Asian J Psychiatr. 2013; 6: 254-255. 83. Dhargave P, Nalini A, Abhishekh HA, Meghana A, Nagarathna R, Raju TR, Sathyaprabha TN. Assessment of cardiac autonomic function in patients with Duchenne muscular dystrophy using short term heart rate variability measures. Eur J Paediatr Neurol. 2014 [Epub ahead of print]. 84. 85. 86. 87. 2013-14 Dhiman V, Rao S, Sinha S, Arimappamagan A, Mahadevan A, Bharath RD, Saini J, Jamuna R, Keshav Kumar J, Rao SL, Chandramouli BA, Satishchandra P, Shankar SK. Outcome of lesionectomy in medically refractory epilepsy due to non-mesial temporal sclerosis (non-MTS) lesions. Clin Neurol Neurosurg. 2013; 115: 2445-2453. Dhiman V, Rao Sudhanva, Sinha S, Arivazhagan A, Mahadevan A, Bharath RD, Saini J, Keshav J, Rao SL, Shankar SK, Chandramouli BA, Satishchandra P. Outcome of lesionectomy in medically refractory epilepsy due to non-mesial temporal sclerosis (non-MTS). Clin Neurol Neurosurg 2013; 115: 2445-2453. 88. Dolan BM, Duron SG, Campbell DA, Vollrath B, Rao BSS, Ko HY, Lin GG, Govindarajan A, Choi SY, Tonegawa T. Rescue of fragile x syndrome phenotypes in Fmr1 KO mice by the small molecule PAK inhibitor FRAX486. Proc Natl Acad Sci USA. 2013; 110: 56715676. National Institute of Mental Health and Neuro Sciences / 205 Annual Report 99. 2013-14 Govindaraj P, Nalini A, Krishna N, Sharath A, Khan NA, Tamang R, Devi MG, Brown RH, Thangaraj K. Mitochondrial DNA variations in Madras motor neuron disease. Mitochondrion. 2013; 13: 721-728. 100. Gowda MR, Meena KS, Srinivasa P, Harish B. Quality of life of persons with mental illness staying in a psychiatric rehabilitation centre and home: a comparative study. Intl J Sci Res.2013; 2: 8-10. 101. Gundamaneni SK, Ganesh CV, Mahadevan A, Madhugiri VS, Sasidharan GM, Kumar VR. Non-infantile desmoplastic cerebellar ganglioglioma in a patient with multiple congenital anomalies: a rare association. Pediatr Neurosurg. 2013; 49: 105-109. 102. Haddadi M, Jahromi SR, Sagar BK, Patil RK, Shivanandappa T, Ramesh SR. Brain aging, memory impairment and oxidative stress: a study in drosophila melanogaster. Behavioural Brain Res. 2014; 259: 60-69. 109. Jadav RH, Sinha S, Yasha TC, Aravinda H, Gayathri N, Rao S, Bindu PS, Satishchandra P. Clinical, electrophysiological, imaging and ultrastructural description in 68 patients with neuronal ceroid lipofuscinoses and its subtypes. Pediatr Neurol. 2014; 50: 85-95. 110. Jagannathan A, Thirthalli J, Hamza A, Nagendra HR, Gangadhar BN. Predictors of family caregiver burden in schizophrenia: Study from an in-patient tertiary care hospital in India. Asian J Psychiatr. 2014; 8: 94-98. 111. Jhunjhunwala K, Netravathi M, Purushottam M, Jain S, Pal PK. Profile of extrapyramidal manifestations in 85 patients with spinocerebellar ataxia type 1, 2 and 3. J Clin Neurosci. 2014; 21: 1002-1006. 112. Jhunjhunwala K, Prashanth DK, Netravathi M, Jain S, Purushottam M, Pal PK. Alterations in cortical excitability and central motor conduction time in Spinocerebellar Ataxias 1, 2 and 3: A comparative study. Parkinsonism Relat Disord. 2013; 19: 306-311. 103. Harinarayan CV, Arvind S, Joshi S, Thennarasu K, Vedavyas V, Baindur A. Improvement in pancreatic β cell function with vitamin d and calcium supplementation in vitamin D deficient non-diabetic subjects. Endocr Pract 2013; 1-33. 113. Jhunjhunwala K, Prashanth DK, Netravathi M, Nagaraju BC, Pal PK. Alterations of cortical excitability and central motor conduction time in Wilson’s disease. Neurosci Lett. 2013; 553: 90-94. 104. Hegde S, Thirthalli J, Rao SL, Raguram A, Philip M, Gangadhar BN. Cognitive deficits and its relation with psychopathology and global functioning in first episode schizophrenia. Asian J Psychiatr. 2013; 6: 537-543. 114. Joshi H, Balachandar R, John JP, Bharath S, Varghese M. Comparative study of white matter integrity between mild Alzheimer’s dementia and mild cognitive impairment. Alzheimer’s & Dementia, 2013; 9: 425-426. 105. Hegde S. Music based cognitive remediation therapy for patients with traumatic brain injury. Front Neurol. 2014; 5: 34. 115. Jothimani G, Nagarajaiah, Joseph J, Ramachandra. Attitude of nursing professionals and caregivers towards the rights of the mentally ill person: Comparative study. Intl J Nursing, 2013; 1: 33-37. 106. Imon Paul MD, Basavaraju V, Narayanaswamy JC, Math SB. Clozapine induced pericarditis. Clin Schizophr Relat Psychoses 2014: 1-6. [Epub ahead of print]. 107. Jacob P, Seshadri S, Girimaji SC, Srinath S, Sagar JV. Clinical characteristics of aggression in children and adolescents admitted to a tertiary care centre. Asian J Psychiatr. 2013; 6: 556-559. 108. Jadav J, Saini J, Sinha S, Bagepally B, Rao S, Taly AB. Diffusion tensor imaging (DTI) and its clinical correlates in drug naïve Wilson’s disease. Metab Brain Dis 2013; 28: 455-462. 116. Kakati A, Devi BI, Bhadrinarayan V, Kalra P, Shukla D. Endocrine dysfunction following traumatic brain injury in acute stage. Indian J Neurotrauma 2013; 10: 92-96. 117. Kalita J, Chandra S, Bhoi SK, Agarwal R, Misra UK, Shankar SK, Mahadevan A. Clinical, nerve conduction and nerve biopsy study in vitamin B12 deficiency neurological syndrome with a short-term follow-up. Nutr Neurosci. 2014; 17: 156-163. 118. Kalmady SV, Agarwal SM, Shivakumar V, Jose D, Venkatasubramanian G, Reddy YCJ. Revisiting 206 / National Institute of Mental Health and Neuro Sciences Annual Report Geschwind’s hypothesis on brain lateralization: a functional MRI study of digit ratio (2D:4D) & sex interaction effects on spatial working memory. Laterality. 2013; 18: 625-40. 119. Kalmady SV, Venkatasubramanian G, Shivakumar V, Jose D, Ravi V, Gangadhar BN. Relationship between brain-derived neurotrophic factor and schneiderian first rank Symptoms in antipsychotic-naïve Schizophrenia. Front Psychiatry. 2013; 4: 64. 120. Kannangai R, Sachithanandham J, Mahadevan A, Abraham AM, Sridharan G, Desai A, Ravi V, Shankar SK. Association of neurotropic viruses in HIV infected individuals died of secondary complications of tuberculosis, cryptococcosis or toxoplasmosis in south India. J Clin Microbiol. 2013; 51: 1022-1025. 2013-14 a comprehensive study using clinical profile and cardiac autonomic functions. Intl J Yoga. 2014; 7: 126-132. 128. Konar S, Pandey P, Yasha TC. Solitary juvenile xanthogranuloma in cervical spine: case report and review of the literature. Turk Neurosurg. 2014; 24: 102107. 129. Krishnamurthy K, Mehta B, Singh M, Tiwari BP, Joshi PG, Joshi NB. Depalmitoylation preferentially downregulates AMPA induced Ca2+ signaling and neurotoxicity in motor neurons. Brain Res 2013; 1529: 143-153. 130. Krishnan P, Sinha S, Taly AB, Ramachandraiah CT, Rao S, Satishchandra P. Altered polysomnographic profile in juvenile myoclonic epilepsy. Epilepsy Res. 2014; 108: 459-467. 121. Karkare K, Sinha S, Taly AB and Rao S. Sleep abnormalities in Guillain Barre syndrome: A clinical and polysomnographic study. Sleep Disorders Ther. 2013; 2: 1-6. 131. Kulkarni GB, Mustare V, Abbas MM. Profile of patients with cerebral venous sinus thrombosis with cerebellar involvement. J Stroke Cerebrovasc Dis. 2014; 23: 1106-1111. 122. Karkare K, Sinha S, Taly AB, Rao S. Prevalence and profile of sleep disturbances in Guillain Barre syndrome: a prospective questionnaire-based study during 10 days of hospitalization. Acta Neurol Scand. 2013; 127: 116-123. 132. Kulkarni PS, Sapru A, D’costa PM, Pandit A, Madhusudana SN, Yajaman AB, Mangrule S, Gunale B, Bavdekar AR. Safety and immunogenicity of a new purified vero cell rabies vaccine (pvrv) administered by intramuscular and intra-dermal routes in healthy volunteers. Vaccine 2013; 31: 2719-2722. 123. Karthik N, Sinha S, Taly AB, Kulkarni GB, Ramachandraiah CT, Rao S. Alteration in polysomnographic profile in ‘migraine without aura’ compared to healthy controls. Sleep Med. 2013; 14: 211-214. 124. Kashyap H, Kumar JK, Kandavel T, Reddy YC. Neuropsychological functioning in obsessive-compulsive disorder: Are executive functions the key deficit? Compr Psychiatry. 2013; 54: 533-540. 125. Khaleel N, Roopa R, Smitha JSM, Andrade C. Electroconvulsive therapy attenuates dendritic arborization in the basolateral amygdala. J ECT. 2013; 29: 156-157. 126. Khan NA, Govindaraj P, Soumittra N, Srilekha S, Ambika S, Vanniarajan A, Meena AK, Uppin MS, Sundaram C, Taly AB, Bindu PS, Gayathri N, Thangaraj K. Haplogroup heterogeneity of LHON patients carrying the m.14484T>C mutation in India. Invest Ophthalmol Vis Sci. 2013; 54: 3999-4005. 127. Kisan R, Sujan MU, Adoor M, Rao R, Nalini A, Kutty BM, Murthy BTC, Raju TR. Effect of yoga on migraine: 133. Kumar CN, Thirthalli J, Suresha KK, Arunachala U, Gangadhar BN: Metabolic syndrome among schizophrenia patients: Study from a rural community of south India. Asian J Psychiatr 2013; 6: 532-536. 134. Kumar D, Rao M, Raveendranathan D, Venkatasubramanian G, Varambally S, Gangadhar B. Metacognitive training for delusion in treatment resistant schizophrenia: A case report. Clin Schizophr Relat Psychoses, 2013: 1-11. 135. Kumar S, Narasimha A, Holla B, Viswanath B, Narayanaswamy JC, Math SB, Chandrasekar CR. Reversible dementia in the young due to cobalamin deficiency. J Neuropsychiatry Clin Neurosci. 2013; 25: E62-E63. 136. Kumar UA, Jayaram M. Speech perception in individuals with auditory dys-synchrony: Effect of lengthening of voice onset time and burst duration of speech segments. J Laryngol Otol. 2013; 127: 656-665. National Institute of Mental Health and Neuro Sciences / 207 Annual Report 2013-14 137. Kumar VRP, Sehgal P, Thota B, Patil S, Santosh V, Kondaiah P. Insulin like growth factor binding protein 4 promotes GBM progression and regulates key factors involved in EMT and invasion. J Neurooncol. 2014; 116: 455-464. 146. Madhusudana SN, Mani RS. Intradermal vaccination for rabies prophylaxis: Conceptualizations, evolution, present status and future. Expert Rev Vaccines. 2014. [Epub ahead of print]. 138. Lakshmaiah KC, Viveka BK, Anil Kumar N, Saini ML, Sinha S, Saini KS. Gastric diffuse large B cell lymphoma presenting as paraneoplastic cerebellar degeneration: Case report and review of literature. J Egypt Natl Canc Inst. 2013; 25: 231-235. 147. Mahadevan A, Ramalingaiah AH, Parthasarathy S, Nath A, Ranga U, Krishna SS. Neuropathological correlate of the “concentric target sign” in MRI of HIV-associated cerebral toxoplasmosis. J Magn Reson Imaging. 2013; 38: 488-495. 139. Laxmi CC, Satyaprabha TN, Shripad Patil, Udaya IB, Raju TR. Heat shock protein response to chronic cold exposure in antarctic expedition members: Intl J Sci Res Publications. 2250-3153 148. Maiti TK, Singh VK, Pandey P. Providencia rettgeri: an unusual cause of central nervous system infections. Am J Med Sci 2013; 346: 158-159. 140. Lokesh P, Cherian AV, Viswanath Biju, Kandavel T, Suresh BM, Reddy YCJ. Symptom dimensions in OCD and their association with clinical characteristics and comorbid disorders. J Obsessive Compulsive Relat Disord. 2013; 2: 14-21. Elsevier 141. Madhugiri VS, Bhagavatula ID. Congenital anomalies at the craniovertebral junction-posterior fossa region: report of two cases. J Neurol Surg A Cent Eur Neurosurg. 2013; e279-e283. 142. Madhugiri VS, Gundamaneni SK, Santosh V, Jagadisan B, Sasidharan GM, Roopesh Kumar RV, Yadav AK, Singh M, Ananthakrishnan R, Pariarath N, Biswal N. Acute pyogenic necrotizing encephalomyelitis: a fulminant and fatal infection. J Neurosurg Pediatr. 2013; 11: 591-595. 143. Madhusudana SN, Ashwin BY, Sudarshan S. Feasibility of reducing rabies immunoglobulin dosage for passive immunization against rabies: Results of In vitro and In vivo studies. Hum Vaccin Immunother. 2013; 9: 1914-1917. 144. Madhusudana SN, Malavalli BV, Thankappan UP, Sundramoorthy S, Belludi AY, Pulagumbaly SB, et al. Development and evaluation of a new immunohistochemistry-based test for the detection of rabies virus neutralizing antibodies. Hum Vaccin Immunother. 2014; 10: 1359-1365. 145. Madhusudana SN, Mani R, Ashwin YB, Desai A. Rabid fox bites and human rabies in a village community in southern India: epidemiological and laboratory investigations, management and follow-up. Vector Borne Zoonotic Dis. 2013; 13: 324-329. 149. Malavé S, Ramakrishna J, Heylen E, Bharat S, Ekstrand ML. Differences in testing, stigma, and perceived consequences of stigmatization among heterosexual men and women living with HIV in Bengaluru, India, AIDS Care. 2014; 26: 396-403. 150. Mani RS, Madhusudana SN, Mahadevan A, Reddy V, Belludi AY, Shankar SK. Utility of real-time Taqman PCR for antemortem and postmortem diagnosis of human rabies. J Med Virol. 2013; 1-9. doi: 10.1002/jmv.23814. [Epub ahead of print]. 151. Mani RS, Madhusudana SN. Laboratory diagnosis of human rabies: recent advances. Scientific World J. 2013; 569712. 152. Manjula M, Prasadarao PS, Kumaraiah V, Raguram R. Temporal patterns of change in panic disorder during cognitive behaviour therapy: an Indian study. Behav Cogn Psychother. 2013; 1-13. [Epub ahead of print] 153. Manjula NG, Girish CM, Patil SA, Subhashchandra MG, Channappa TS. Incidence of urinary tract infections and its aetiological agents among pregnant women in Karnataka region. Adv in Microbiol. 2013; 3: 473-478. 154. Mathew M, Sagar BKC, Subramanian S. Identification of small molecule inhibitors against amyloid β (Aβ) oligomerization and toxicity from nootropic Ayurvedic herbal extracts. Int J Pharm Sci Res. 2013; 4: 4685-4691. 155. Mathew M, Subramanian S. In vitro screening for anticholinesterase and antioxidant activity of methanolic extracts of ayurvedic medicinal plants used for cognitive disorders. PLoS One. 2014; 9: e86804. 208 / National Institute of Mental Health and Neuro Sciences Annual Report 156. Mathew M, Sudhir PM, Mariamma P. Perfectionism, interpersonal sensitivity, dysfunctional beliefs, and automatic thoughts: the temporal stability of personality and cognitive factors in depression. Int J Ment Health. 2014; 43: 1. 157. Mehrotra S. Feeling good and doing well? Testing efficacy of a mental health promotive program for Indian youth, Int J Psychol Stud. 2013; 5: 28-42. 158. Mehta UM, Agarwal SM, Kalmady SV, Shivakumar V, Kumar CN, Venkatasubramanian G, Thirthalli J, Gangadhar BN, Pascual-Leone A, Keshavan MS. Enhancing putative mirror neuron activity with magnetic stimulation: a single-case functional neuroimaging study. Biol Psychiatry 2013; 74: e1-e2. 2013-14 166. Mehta UM, Thirthalli J. Distinctiveness of social and meta-cognition in schizophrenia across cultures. Acta Psychiatr Scand 2013; 127: 494. 167. Mehta UM, Thirthalli J. External validity of the social cognition rating tools in Indian Setting. Asian J Psychiatr. 2014; 8: 106-108. 168. Mishra J, Mishra S, Udupa K, Sathyaprabha TN. Heart rate variability in prolonged head up tilt in healthy adults. Int J Biol Med Res. 2013; 4: 3057- 3061. 169. Mohanty CB, Rao KV, Sampath S. Pediatric cervical intraosseous schwannoma. Pediatr Neurosurg. 2012; 48: 364-370. 159. Mehta UM, Basavaraju R, Thirthalli J. Mirror neuron disinhibition may be linked with catatonic echo-phenomena: a single case TMS study. Brain Stimul. 2013; 6: 705-707. 170. Mohanty CB, Shukla DP, Devi BI. Brain tumors of infancy – an institutional experience and review of literature. Pediatr Neurosurg. 2014 [Epub ahead of print]. 160. Mehta UM, Bhagyavathi HD, Kumar CN, Thirthalli J, Gangadhar BN. Cognitive deconstruction of parenting in schizophrenia: The role of theory of mind. Aust N Z J Psychiatry 2013; 48: 249-258. 171. Munivenkatappa A, Bagepally BS, Saini J, Pal PK. In vivo age-related changes in cortical, subcortical nuclei, and subventricular zone: a diffusion tensor imaging study. Aging Dis. 2012; 4: 65-75. 161. Mehta UM, Kumar CN, Venkatasubramanian G, Thirthalli J. Multimodal sensory distortions in postpartum exacerbation of Schizophrenia. Clin Schizophr Relat Psychoses 2013:1-9. 172. Munivenkatappa A, Deepika A, Prathyusha V, Devi I, Shukla D. Can an abnormal CT scan be predicted from common symptoms after mild head injury in children? J Pediatr Neurosci. 2013; 8: 183-187. 162. Mehta UM, Thirthalli J, Basavaraju R, Gangadhar BN, Pascual-Leone A. Reduced mirror neuron activity in schizophrenia and its association with theory of mind deficits: evidence from a transcranial magnetic stimulation study. Schizophr Bull 2013; doi: 10.1093/ schbul/sbt155. [Epub ahead of print]. 173. Munivenkatappa A, Devi BI, Shukla D, Subbakrishna DK, Neeraj U, Jamuna R. Quantitative evidence of brain volume changes during early weeks of mild head injury and its cognitive consequences: A longitudinal study. J Neurotrauma. 2013; 30: 183. 163. Mehta UM, Thirthalli J, Kumar CN, Kumar JK, Keshavan MS, Gangadhar BN. Schizophrenia patients experience substantial social cognition deficits across multiple domains in remission. Asian J Psychiatr 2013; 6: 324-329. 164. Mehta UM, Thirthalli J, Naveen Kumar C, Kumar JK, Gangadhar BN. Negative symptoms mediate the influence of theory of mind on functional status in schizophrenia. Soc Psychiatry Psychiatr Epidemiol 2013; 41: 1151-1156. 165. Mehta UM, Thirthalli J, Subbakrishna DK, Gangadhar BN, Eack SM, Keshavan MS. Social and neuro-cognition as distinct cognitive factors in schizophrenia: a systematic review. Schizophr Res. 2013; 148: 3-11. 174. Munivenkatappa A, Jamuna R, Devi BI, Niranjana B, Neeraj U. EEG Neurofeedback therapy: can it attenuate brain changes in TBI? J Neurotrauma. 2014; 31: 73. 175. Muralidharan K, Ali M, Silveira LE, Bond DJ, Fountoulakis KJ, Lam RW, Yatham LN. Efficacy of second generation antipsychotics in treating acute mixed episodes in bipolar disorder: a meta-analysis of placebo-controlled trials. J Affect Disord. 2013; 150: 408-414. 176. Murthy GN, Ponnuvel KM, Awasthi AK, Rao CG, Chandrasekhar Sagar BK. The Indian isolate of Densovirus-2 – Impact of infection and mechanism of resistance in Bombyx mori L. J Invertebrate Pathol. 2014; 115: 48-50. National Institute of Mental Health and Neuro Sciences / 209 Annual Report 2013-14 177. Nadkarni A, Dabholkar H, McCambridge J, Bhat B, Kumar S, Mohanraj R, Murthy P, Patel V. The explanatory models and coping strategies for alcohol use disorders: an exploratory qualitative study from India. Asian J Psychiatr. 2013; 6: 521-527. 178. Nadkarni A, Murthy P, Crome IB, Rao R. Alcohol use and alcohol-use disorders among older adults in India: a literature review. Aging & Mental Health, 2013; 17: 979991 179. Nagappa M, Chickabasaviah YT, Bharath RD, Bindu PS, Sinha S, Taly AB. Intraneural perineurioma of unilateral radial and median nerves manifesting with longstanding focal amyotrophy in a 14-year-old-boy. J Clin Neuromuscul Dis. 2013; 15: 52-57. 180. Nagappa M, Sinha S, Taly AB, Rao SL, Nagarathna S, Bindu PS, Bharath RD, Murthy P. Neurosyphilis: MRI features and their phenotypic correlation in a cohort of 35 patients from a tertiary care university hospital. Neuroradiology, 2013; 55: 379-388. 181. Nagappa M, Taly AB, Sinha S, Bharath RD, Mahadevan A, Bindu PS, Saini JS, Prasad C, Shankar SK. Tumefactive demyelination: clinical, imaging and follow-up observations in thirty-nine patients. Acta Neurol Scand. 2013; 128: 39-47. 182. Nagappa M, Taly AB, Sinha S, Gayathri N, Bindu PS, Mahadevan A, Yasha T. Efficacy and limitations of pulse cyclophosphamide therapy in polymyositis and dermatomyositis. J Clin Neuromuscul Dis. 2013; 14: 161-168. 183. Nair RR, Gayathri N, Mishra S, Sunitha B, Mythri RB, Nalini A, Subbannayya Y, Harsha HC, Seetharam UK, Bharath MMS. Mitochondrial alterations and oxidative stress in an acute transient mouse model of muscle degeneration: implications for muscular dystrophy and related muscle pathologies. J Biol Chem. 2014; 289: 485-509. 184. Nalini A, Pandraud A, Mok K, Houlden H. Madras motor neuron disease (MMND) is distinct from the riboflavin transporter genetic defects that cause Brown-VialettoVan Laere syndrome. J Neurol Sci. 2013; 334: 119-122. 185. Nandakumar DN, Hurmath FK, Palaniswamy R. Interleukin-1β micro-environment promotes viability and proliferation of malignant glioma cell U87MG. Front. Immunol. doi: 10.3389/conf.fimmu.2013.02.00263 186. Nanjappa V, Thomas JK, Marimuthu A, Muthusamy B, Radhakrishnan A, Sharma R, Ahmad Khan A, Balakrishnan L, Sahasrabuddhe NA, Kumar S, Jhaveri BN, Sheth KV, Khatana RK, Shaw PG, Srikanth SM, Mathur PP, Shankar S, Nagaraja D, Christopher R, Mathivanan S, Raju R, Sirdeshmukh R, Chatterjee A, Simpson RJ, Harsha HC, Pandey A, Prasad TS. Plasma proteome database as a resource for proteomics research: 2014 update. Nucleic Acids Res. 2014; 42: D959-D965. 187. Narayana DHA, Madhusudana SN, Sampath G, Tripathy RM, Sudarshan MK, Gangaboraiah, Ravish HS, Satapathy DM, Gowda G, Holla R, Ashwin BY, Padhi A, Manjula S, Patel PM. Safety and immunogenicity study of a new purified chick embryo cell rabies vaccine Vaxirab-N (Pitman Moore strain) manufactured in India. Hum Vaccin Immunother. 2014; 10: 120-125. 188. Narayanaswamy JC, Jose D, Kalmady S, Venkatasubramanian G, Reddy YCJ. Clinical correlates of nucleus accumbens volume in drug-naïve, adult patients with obsessive-compulsive disorder. Aust N Z J Psychiatry 2013; 47: 930-937. 189. Narayanaswamy JC, Jose DA, Kalmady SV, Venkatasubramanian G, Reddy YCJ. Clinical correlates of caudate volume in drug-naïve adult patients with obsessive-compulsive disorder. Psychiatry Res. 2013; 212: 7-13. 190. Narayanaswamy JC, Kalmady SV, Cherian AV, Venkatasubramanian G, Reddy JY. Neuroanatomical correlates of naturalistic long-term outcome of obsessivecompulsive disorder treated with selective serotonin reuptake inhibitors. J Clin Psychopharmacol. 2014; 34: 282-285. 191. Narayanaswamy JC, Viswanath B, Reddy PV, Kumar KR, Thirthalli J, Gangadhar BN. Efficacy of ECT in bipolar and unipolar depression in a real life hospital setting. Asian J Psychiatr. 2014; 8: 43-46. 192. Nawani H, Bose A, Agarwal SM, Shivakumar V, Chhabra H, Subramaniam A, Kalmady S, Narayanaswamy JC, Venkatasubramanian G. Modulation of corollary discharge dysfunction in Schizophrenia by tDCS: preliminary evidence. Brain Stimul. 2014; 7: 486-488. 193. Nawani H, Kalmady SV, Bose A, Shivakumar V, Rakesh G, Subramaniam A, Narayanaswamy JC, 210 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 Venkatasubramanian G. Neural basis of tdcs effects on auditory verbal hallucinations in Schizophrenia: a case report evidence for cortical neuroplasticity modulation. J ECT. 2014; 30: e2-e4. 203. Patil SA, Katyayani S, Sood A, Kavitha AK, Marimuthu P, Taly AB. Possible significance of anti-heat shock protein (HSP-65) antibodies in autoimmune myasthenia gravis. J Neuroimmunol. 2013; 257: 107-109. 194. Naz S, Bashir M, Ranganathan P, Bodapati P, Santosh V, Kondaiah P. Protumorigenic actions of S100A2 involve regulation of PI3/Akt signaling and functional interaction with Smad3. Carcinogenesis. 2014; 35: 14-23. 204. Patil SA, Kavitha AK, Madhusudan AP, Netravathi M. Comparative evaluation of ELISA and dot-blot for the diagnosis of tuberculous meningitis. Immunoassay Immunochem. 2013; 34: 404-413. 195. Netravathi M, Mahadevan A, Satishchandra P, Shobha N, Mailankody P, Kandavel T, Jitender S, Anantaram G, Nagarathna S, Govekar S, Ravikumar BV, Ravi V, Shankar SK. Progressive multifocal leukoencephalopathy (PML) associated with HIV Clade C–is not uncommon. J Neurovirol. 2013; 19: 198-208. 205. Perumal AR, Rajeswaran J, Nalini A. Neuropsychological profile of duchenne muscular dystrophy. Appl Neuropsychol Child. 2014; 1-9. 196. New PW, Scivoletto G, Smith É, Townson A, Gupta A, Reeves RK, Post MW, Eriks-Hoogland I, Gill ZA, Belci M. International survey of perceived barriers to admission and discharge from spinal cord injury rehabilitation units. Spinal Cord. 2013; 51: 893-897. 197. Padmanabhan B, Yokoyama S, Bessho Y. Crystal structure of putative CbiT from Methanocaldococcus jannaschii: an intermediate enzyme activity in cobalamin (vitamin B12) biosynthesis. BMC Struct Biol. 2013; 13: 10. 198. Padmanabhan B. Identification of novel modulators for ionotropic glutamate receptor, iGluA2 by in-silico screening. Theor Biol Med Model 2013; 10: 46. 199. Pallavisarji U, Gururaj G, Girish RN. Practice and perception of first aid among lay first responders in a southern district of India. Arch Trauma Res. 2013; 1: 155-160. 200. Panda R, Bharath RD, George L, Kanungo S, Reddy RP, Upadhyay N, Thamodharan A, Rajeswaran J, Rao SL, Gupta AK. Unraveling Brain functional connectivity of encoding and retrieval in the context of education. Brain Cogn. 2014; 86: 75-81. 201. Pandey P, Westbroek EM, Gooderham PA, Steinberg GK. Cavernous malformation of brainstem, thalamus and Basal Ganglia: a series of 176 patients. Neurosurgery. 2013; 72: 573-589. 202. Patel M, Satishchandra P, Saini J, Bharath RD, Sinha S. Eating epilepsy: Phenotype, MRI, SPECT & video-EEG observations. Epilepsy Res. 2013; 107: 115-120. 206. Pijush Das, Bindu PS, Bharath RD, Saini JS, Prasad C, Sinha S. MRI observations in children with epilepsy: experience from a large cohort. J Pediatr Epilep. 2013; 2: 223-228. 207. Poreddi V, Nagarajaiah, Konduru R, Math SB. Euthanasia. The perceptions of nurses in India. Intl J Palliat Nurs. 2013; 19: 187-193. 208. Prabhakar P, Christopher R, Nagaraja D. Vitamin D Receptor (VDR) gene polymorphism and risk of ischemic stroke. Mol Cytogenetics. 2014; 7: 33. 209. Prabhakar P, De T, Nagaraja D, Christopher R. Angiotensin-converting enzyme gene insertion/deletion polymorphism and small vessel cerebral stroke in Indian population. Int J Vasc Med. 2014; 305-309. 210. Pradeep AN, Anitha J, Awasthi AK, Babu MA, Geetha MN, Arun HK, Chandrashekhar S, Rao GC, Vijayaprakash NB. Activation of autophagic programmed cell death and innate immune gene expression reveals immunocompetence of integumental epithelium in Bombyx mori infected by a dipteran parasitoid. Cell Tissue Res. 2013; 352: 371-385. 211. Pradeep K, Sinha S, Saini J, Mahadevan A, Arivazhagan A, Bharath RD, Bindu PS, Jamuna R, Rao MB, Chandramouli BA, Shankar SK, Satishchandra P. Evolution of MRI changes in Rasmussen’s encephalitis. Acta Neurol Scand. 2013 [Epub ahead of print]. 212. Pradhan N, Sharma K. UBL-RPN1 interactions: Docking approach to understand UBL-RPN1 intermolecular interaction. Int J Pharmaceutical Res Develop. 2013; 5: 109-110. National Institute of Mental Health and Neuro Sciences / 211 Annual Report 2013-14 213. Prasad P, Halahalli HN, John JP, Majumdar K. Singletrial EEG classification using logistic regression based on ensemble synchronization. IEEE J Biomed Health Inform. 2014; 18: 1074-1080. 214. Prem G, Shivashankar N, Girish N, Indira B, Srikanth SG, Shanmugham V. Temporal resolution in patients with cerebellopontine angle tumors. Res Otolaryngol. 2013; 2: 1-5. 215. Pruthi N, Dawn R, Ravindranath Y, Maiti TK, Ravindranath R, Philip M. Computed tomography-based classification of axis vertebra: choice of screw placement. Eur Spine J. 2014; 23: 1084-1091. 216. Raja JV, Rai P, Kumar NC, Khan M, Chandrashekar H. Psychiatric morbidity among patients with oral submucous fibrosis: a controlled study. Oral Health Dent Manag. 2013; 12: 85-94. 217. Rajeshwaran J, Nalini A. Neuropsychological deficites in amyotrophic lateral sclerosis (ALS): A south India experience. Neuropsychological trends. 2013; 4: 13. 218. Rakesh G, Abhishekh HA, Thirthalli J, Phutane VH, Muralidharan K, Candade VS, Gangadhar BN. Maximum fractal dimension of cerebral seizure remains constant through the course of electroconvulsive therapy. Clin EEG Neurosci 2013; 45: 122-125. 219. Rakesh G, Shivakumar V, Subramaniam A, Nawani H, Amaresha AC, Narayanaswamy JC, Venkatasubramanian G. Monotherapy with tDCS for Schizophrenia: A case report. Brain Stimul. 2013; 6: 708-709. 220. Ramachandra. Hypochondria – historical perspectives, diagnosis and treatment. Asian J Nursing Edu Res. 2014; 4: 216-219. 221. Ramakrishnan P, Dias A, Rane A, Shukla A, Lakshmi S, Ansari BK, Ramaswamy RS, Reddy AR, Tribulato A, Agarwal AK, Bhat J, Satyaprasad N, Mushtaq A, Rao PH, Murthy P, Koenig HG. Perspectives of Indian traditional and allopathic professionals on religion/spirituality and its role in medicine: basis for developing an integrative medicine program. J Relig Health. 2013; doi: 10.1007/s10943-013-9721-2. [Epub ahead of print]. 222. Ramalingiah AH, Prasad C, Sabharwal PS, Saini J, Pandey P. Transarterial treatment of direct carotico-cavernous fistulas with coils and Onyx. Neuroradiol. 2013; 55: 12131210. 223. Ramana GV. Ayurvedic management of cervical dystoniaA case study, IJRAP. 2014; 5: 1-2. 224. Ramana V. Importance of bastikarma in swasthapurusha. IJRAP. 2013; 4: 1-2. 225. Ramanan S, Kumar D. Prospective memory in Parkinson’s disease: A meta-analyses. J Int Neuropsychol Soc. 2013; 19: 1109-1118. 226. Ramaswamy P, Devi NA, Fathima KH, Nanjaiah ND. Activation of NMDA receptor of glutamate influences MMP-2 activity and proliferation of glioma cells. Neurol Sci. 2013 [Epub ahead of print]. 227. Ramesh AS, Arimappamagan A, Bhat D, Arvinda HR, Somanna S. Acute onset of hemiparesis after gamma knife radiosurgery for arteriovenous malformation caused by hyperacute thrombosis of draining vein: a case report. J Neurol Surg A Cent Eur Neurosurg. 2013; doi: 10.1055/s0033-1349334 [Epub ahead of print]. 228. Rangaprakasha D, Pradhan N. Study of phase synchronization in multichannel seizure EEG using nonlinear recurrence neasure. Biomed Signal Processing Control 2014; 11: 114-122. 229. Ranjan M, Dupre S, Honey CR. Trigeminal neuralgia secondary to giant Virchow-Robin spaces: a case report with neuroimaging. Pain. 2013; 154: 617-619. 230. Ranjan M, Konar SK, Somanna S, Bhagavatula ID, Ashwathnarayana CB. Endoscopic intervention for the fourth ventricular neurocysticercal cyst–What should be the optimum therapeutic approach? Br J Neurosurg. 2013 [Epub ahead of print]. 231. Rao SA, Arimappamagan A, Pandey P, Santosh V, Hegde AS, Chandramouli BA, Somasundaram K. MiR-219-5p inhibits receptor tyrosine kinase pathway by targeting EGFR in glioblastoma. PLoS One. 2013; 8: e63164. 232. Rao SA, Srinivasan S, Patric IR, Hegde AS, Chandramouli BA, Arimappamagan A, Santosh V, Kondaiah P, Rao MR, Somasundaram K. A 16-gene signature distinguishes anaplastic astrocytoma from glioblastoma. PLoS One. 2014; 9: e85200. 212 / National Institute of Mental Health and Neuro Sciences Annual Report 233. Ravish HS, Sudarshan MK, Madhusudana SN, Annadani RR, Narayana DH, Belludi AY, Anandaiah G, Vijayashankar V. Assessing safety and immunogenicity of post-exposure prophylaxis following interchangeability of rabies vaccines in humans. Hum Vaccin Immunother. 2014; 10: 1354-1358. 234. Reddy AK, Sriganesh K, Rao GSUM. Hypoxia and chest radiography changes following low dose, short duration carbamazepine therapy. J Neurosurg Anesthesiol 2013; 25: 210-12. 235. Reddy D, Vijayalaxmi P, Hamza A. Psychosocial interventions with children following disaster. J School Social Work. 2013; 9: 3-7. 236. Reddy V, Mani RS, Desai A, Ravi V. Correlation of plasma viral loads and presence of Chikungunya IgM antibodies with cytokine/chemokine levels during acute Chikungunya virus infection. J Med Virol. 2014 [Epub ahead of print]. 237. Reddy, Rajakumari P, Jamuna R, Devi BI, Thennarasu K. Neurofeedback training as an intervention in a silent epidemic: An Indian Scenario. J Neurotherapy 2013; 17: 213-225. 238. Roopesh BN, Reddy YCJ, Mukundan CR. Neuropsychological deficits in drug naïve non-depressed OCD patients. Asian J Psychiatr, 2013; 6: 162-170. 239. Rudhran V, Manjunatha N, John JP. High-Dose, Selfadministered modafinil-related psychosis: is it the pedal in the prodrome of psychosis? J Clin Psychopharmacol. 2013; 33: 576-577. 240. Rudhran V, Thippeswamy H, Chaturvedi SK. Phallicide: a case of auto penile amputation as a mode of suicide. Aust N Z J Psychiatry. 2013; 47: 491-492. 2013-14 243. Sahoo S, Rao BCS, Sudhakar D. Psychological problems of the aged and its management. IJRAP, 2013; 4: 656-660. 244. Saini J, Bagepally BS, Sandhya M, Pasha SA, Yadav R, Thennarasu K, Pal PK. Subcortical structures in progressive supranuclear palsy: vertex-based analysis. Eur J Neurol 2013; 20: 493-501. 245. Saini J, Gupta RK, Jain KK. Intracranial infections: key neuroimaging findings. Semin Roentgenol. 2014; 49: 8698. 246. Salam KPA, Manjula M, Sudhir PM, Sharma MP. Cognitive behavior therapy for patients with schizotypal disorder in an Indian setting: A retrospective review of clinical data. Ger J Psychiatr 2013; 16: 68-74. 247. Sandhya M, Bharath RD, Panda R, Chandra SR, Kumar N, George L, Thamodharan A, Gupta AK, Satishchandra P. Understanding the pathophysiology of reflex epilepsy using simultaneous EEG-fMRI. Epileptic Disord. 2014; 16: 19-29. 248. Sandhya VK, Raju R, Verma R, Advani J, Sharma R, Radhakrishnan A, Nanjappa V, Narayana J, Somani BL, Mukherjee KK, Pandey A, Christopher R, Prasad TS. A network map of BDNF/TRKB and BDNF/p75 NTR signaling system. J Cell Commun Signal. 2013; 7: 301-307. 249. Sankaranarayani R, Raghavan M, Nalini A, Laxmi TR, Raju TR. Reach task-associated excitatory overdrive of motor cortical neurons following infusion with ALS-CSF. J Neural Transm. 2014; 121: 49-58. 250. Sasidharan A, Sulekha S, Kutty B. Current understanding on the neurobiology of sleep and wakefulness. Int J Clin Exp Physiol. 2014; 1: 3-9. 241. Sadananda SK, Narayanaswamy JC, Srinivasaraju R, Math SB. Delirium during the course of electroconvulsive therapy in a patient on lithium carbonate treatment. Gen Hosp Psychiatry. 2013; 35: 678.e1-2. 251. Sastri BVS, Arivazhagan A, Sinha S, Mahadevan A, Bharath RD, Saini J, Jamuna R, Kumar JK, Rao SL, Chandramouli BA, Shankar SK, Satishchandra P. Clinicopathological factors influencing surgical outcome in drug resistant epilepsy secondary to mesial temporal sclerosis. J Neurol Sci. 2014; 340; 183-190. 242. Saddichha S, Chaturvedi SK. Clinical practice guidelines in psychiatry: More confusion than clarity? A critical review and recommendation, ISRN Psychiatry, 2014; 8. http://dx.doi.org/10.1155/2014/828917. 252. Satishchandra P, Rao SL, Ravat S, Jayalakhsmi S, Senapathy A, Shah U, Shunmukhi MS, Dutta A, Mukaddam Q, Naik M, Subbakrishna DK, Sinha S. The effect of phenobarbitone on cognition in adult patients National Institute of Mental Health and Neuro Sciences / 213 Annual Report 2013-14 with new onset epilepsy: A multi-centric prospective study from India. Epilepsy Res. 2014; 108: 928-936. 253. Selvan LD, Renuse S, Kaviyil JE, Sharma J, Pinto SM, Yelamanchi SD, Puttamallesh VN, Ravikumar R, Pandey A, Prasad TS, Harsha HC. Phosphoproteome of Cryptococcus neoformans. J Proteomics. 201; 97: 287-95. 254. Selvan LDN, Kaviyil JE, Nirujogi RS, Muthusamy B, Puttamallesh VN, Subbannayya T, Syed N, Radhakrishnan A, Kelkar DS, Ahmad S, Pinto SM, Kumar P, Madugundu AK, Nair B, Chatterjee A, Pandey A, Ravikumar R, Gowda H, Prasad TS. Proteogenomic analysis of pathogenic yeast Cryptococcus neoformans using high resolution mass spectrometry. Clin Proteomics. 2014; 11: 5. 255. Sendhilkumar R, Gupta A, Nagarathna R, Taly AB. Effect of pranayama and meditation as an add-on therapy in rehabilitation of patients with Guillain-Barré syndrome–a randomized control pilot study. Disabil Rehabil. 2013; 35: 57-62. 262. Sharma E, Rao NP, Venkatasubramanian G. Association between antipsychotic-induced metabolic side-effects and clinical improvement: A review on the Evidence for “metabolic threshold”. Asian J Psychiatr. 2014; 8: 12-21. 263. Sharma J, Mukherjee D, Rao SN, Iyengar S, Shankar SK, Satishchandra P, Jana NR. Neuronatin-mediated aberrant calcium signaling and endoplasmic reticulum stress underlie neuropathology in Lafora disease. J Biol Chem. 2013; 29: 9482-9490. 264. Sharma MP, Manjula M. Behavioural and psychological management of somatic symptom disorders: An overview. Int Review Psychiatr.2013; 25: 116-124. 265. Sharma U, Meena KS. Addressing the mental Health care needs of the frail elderly. Int J Sci Res. 2013; 2: 11-13. 256. Seshadri R, Bindu PS, Gupta AK. Teaching Neuro Images: Menkes kinky hair syndrome. Neurology. 2013; 81: e12-e13. 266. Shivakumar V, Bose A, Rakesh G, Nawani H, Subramaniam A, Agarwal SM, Kalmady SV, Narayanaswamy JC, Venkatasubramanian G. Rapid improvement of auditory verbal hallucinations in schizophrenia after add-on treatment with transcranial direct-current stimulation. J ECT 2013; 29: e43-e44. 257. Shakeel MK, Halahalli HN, Kumar K, Jain S, John JP. Utility of a computerized, paced, semantic verbal fluency paradigm in differentiating schizophrenia and healthy subjects. Asian J Psychiatr. 2013; 7: 22-27. 267. Shivashankar N, Taly AB, Rose Dawn Bharath, Prem G. Telephonic conversational difficulty as the sole symptom in a patient with cerebellopontine angle epidermoid: A Case Report. Res Otolaryngology 2013; 2: 6-11. 258. Shanmugam V, Ramachandra, Kantharaj RS. Preoperative parental anxiety before elective surgery in children: developing countries perspective. Asian J Nursing Edu. Research. 2014; 4: 123-126. 268. Shukla A, Jayarajan RN, Muralidharan K, Jain S. Repetitive transcranial magnetic stimulation not beneficial in severe choreiform movements of Huntington’s disease. J ECT. 2013; 29: e16-e17. 259. Shanmugam V, Ramachandra, Sudhakar R. Parental knowledge and attitude towards child’s right. Asian J Nursing Edu Res. 2013; 3: 56-61. 269. Shukla D, Gangadharan J, Kakati A, Devi BI. Posterior clinoid process meningioma. Clin Neurol Neurosurg. 2013; 115: 1517-1519. 260. Shanthakumari RS, Chandra PS, Riazantseva E, Stewart DE. Difficulties come to humans and not trees and they need to be faced: A study on resilience among Indian women experiencing intimate partner violence. Intl J Soc Psychiatry. 2013 [Epub ahead of print]. 270. Shukla D, Sharma R, Devi BI, Sampath S. Rostral basilar artery syndrome following transsphenoidal surgery-a report of four cases. Acta Neurochir (Wien). 2013; 155: 1633-1636. 261. Sharma E, Venkatasubramanian G, Varambally S, Shivakumar PT, Gangadhar BN, Subbakrishna DK. 1336– Early metabolic side effects as predictors of antipsychotic treatment response: a 2-month prospective study. European Psychiatry. 2013; 28: 1. 271. Shukla S, Pia Patric IR, Thinagararjan S, Srinivasan S, Mondal B, Hegde AS, Chandramouli BA, Santosh V, Arivazhagan A, Somasundaram K. A DNA methylation prognostic signature of glioblastoma: identification of NPTX2-PTEN-NF-κB nexus. Cancer Res. 2013; 73: 65636573. 214 / National Institute of Mental Health and Neuro Sciences Annual Report 272. Shymal S, Sudha K, Gayathri N, Anil Kumar G. The Y-organ secretory activity fluctuates in relation to seasons of molt and reproduction in the brachyuran crab, Metopograpsus messor (Grapsidae): ultrastructural and immunohistochemical study. Gen Comp Endrocrinol. 2014; 196: 81-90. 273. Sibin MK, Bhat DI, Lavanya CH, Manoj MJ, Aakershita S, Chetan GK. CDKN2A exon-wise deletion status and novel somatic mutations in Indian glioma patients, Tumor Biol. 2014; 35: 1467-1472. 274. Singh H, Dahale AB, Sarmukaddam S, Chaturvedi SK. Readmission of psychiatric patients in India: socio demographic factors. Intl J Culture & Mental Health 2013, DOI: 10.1080/17542863.2013.835330 275. Sinha S, Satishchandra P, Kalband BR, Thennarasu K. New-onset status epilepticus and cluster seizures in the elderly. J Clin Neurosci. 2013; 20: 423-428. 276. Sivakumar T, Agarwal V, Sitholey P. Comorbidity of attention-deficit/hyperactivity disorder and bipolar disorder in North Indian clinic children and adolescents. Asian J Psychiatr. 2013; 6: 235-242. 277. Sivakumar T, Yadav A, Sood M, Khandelwal SK. Lorazepam withdrawal catatonia: a case report. Asian J Psychiatr. 2013; 6: 620-621. 278. Sivakumar T. Developing country perspective of social aspects of Psychiatry. E-Letter. British J Psychiatry. 279. Sonam K, Bindu PS, Gayathri N, Khan NA, Govindaraju C, Arvinda HR, Nagappa M, Sinha S, Thangaraj K, Taly AB. The “Double Panda” Sign in Leigh Disease. J Child Neurol. 2013; 29: 980-982. 280. Sonam K, Khan NA ,Bindu PS ,Taly AB, Gayathri N, Bharath MM, Govinduraju C, Aravinda HR, Nagappa M, Sinha S, Thangaraj K. Clinical and magnetic resonance imaging findings in patients with Leigh syndrome and SURF1 mutations. Brain Dev. 2013; 87: 201-205. 281. Soundravally R, Hoti SL, Patil SA, Cleetus CC, Zachariah B, Kadhiravan T, Narayanan P, Kumar BA. Association between proinflammatory cytokines and lipid peroxidation in patients with severe dengue disease around defervescence. Int J Infect Dis. 2014; 18: 68-72. 2013-14 282. Sriganesh K, Ranjan M, Ventataramaiah S, Somanna S. Transient brainstem anaesthesia following a diagnostic block for trigeminal neuralgia. Pain Physician. 2014; 17: E239-E240. 283. Sriganesh K, Saini J, Bhadrinarayan V. Targeted cervical epidural blood patch for the management of refractory headache in a patient with spontaneous intracranial hypotension. J Neurosurg Anesthesiol. 2014 Mar 21. [Epub ahead of print]. 284. Sriganesh K, Saini J. Exacerbation of involuntary movements after propofol anesthesia in a patient with Huntington’s disease. J Neurosurg Anesthesiol. 2013; 25: 212-214. 285. Sriganesh K, Vinay B, Bhadrinarayan V. Indocyanine green dye administration can cause oxygen desaturation. J Clin Monit Comput 2013; 27: 371. 286. Steiner TJ, Gururaj G, Andrée C, Katsarava Z, Ayzenberg I, Yu SY, Al Jumah M, Tekle-Haimanot R, Birbeck GL, Herekar A, Linde M, Mbewe E, Manandhar K, Risal A, Jensen R, Queiroz LP, Scher AI, Wang SJ, Stovner LJ. Diagnosis, prevalence estimation and burden measurement in population surveys of headache: presenting the HARDSHIP questionnaire. J Headache Pain. 2014; 15: 3. 287. Steiner TJ, Stovner LJ, Al Jumah M, Birbeck GL, Gururaj G, Jensen R, Katsarava Z, Queiroz LP, Scher AI, TekleHaimanot R, Wang SJ, Martelletti P, Dua T, Chatterji S. Improving quality in population surveys of headache prevalence, burden and cost: key methodological considerations. J Headache Pain. 2013; 14: 87. 288. Stovner LJ, Al Jumah M, Birbeck GL, Gururaj G, Jensen R, Katsarava Z, Queiroz LP, Scher AI, Haimanot RT, Wang SJ, Steiner TJ. The methodology of population surveys of headache prevalence, burden and cost: principles and recommendations from the global campaign against Headache. J Headache Pain. 2014; 15: 5. 289. Striley CW, Nattala P, Abdallah AB, Dennis ML, Przybeck T, Cottler LB. Enhanced case management versus substance abuse treatment alone among substance abusers with depression. Social Work Res, 2013; 37: 19-25. 290. Sumalatha KR, Abiramasundari G, Chetan GK, Divya T, Sudhandiran G, Sreepriya M. XIAP inhibitor and National Institute of Mental Health and Neuro Sciences / 215 Annual Report 2013-14 antiestrogen embelin abrogate metastasis and augments apoptosis in estrogen receptor positive human breast adenocarcinoma cell line MCF-7. Mol Biol Rep. 2014; 41: 935-946. 291. Taj M J RJ, Viswanath B, Purushottam M, Kandavel T, Reddy YCJ, Jain S. DRD4 gene and obsessive compulsive disorder: do symptom dimensions have specific genetic correlates? Prog Neuropsychopharmacol Biol Psychiatry 2013; 41: 18-23. 292. Taran R, Mamidi MK, Singh G, Dutta S, Parhar IS, John JP, Bhonde R, Pal R, Das AK. In vitro and in vivo neurogenic potential of mesenchymal stem cells isolated from different sources. J Biosci. 2014; 39: 157-169. 293. Tejas S Golhar, Srinath S. Global child and adolescent mental health needs: Perspectives from a National tertiary referral center in India. Adolescent Psychiatry. 2013; 3: 82-86. 294. Tetali S, Lakshmi JK, Gupta S, Gururaj G, Wadhwaniya S, Hyder AA. Qualitative study to explore stakeholder perceptions related to road safety in Hyderabad, India. Injury. 2013; S17-S23. 295. Thirunavukkarasu P, Vijayakumari AV, John JP, Halahalli HN, Paul P, Sen S, Purushottam M, Jain S. An exploratory association study of the influence of dysbindin and neuregulin polymorphisms on brain morphometry in patients with schizophrenia and healthy subjects from South India. Asian J Psychiatr. 2014; DOI: http://dx.doi. org/10.1016/j.ajp.2014.04.002 296. Thounaojam MC, Kundu K, Kaushik DK, Swaroop S, Mahadevan A, Shankar SK, Basu A. MicroRNA-155 regulates Japanese encephalitis virus induced inflammatory response by targeting src homology 2-containing inositol phosphatase 1. J Virol. 2014; 88: 4798-4810. 297. Ullas PT, Madhusudana SN, Desai A, Sagar BK, Jayamurugan G, Rajesh YB, Jayaraman N. Enhancement of immunogenicity and efficacy of a plasmid DNA rabies vaccine by nanoformulation with a fourth-generation amine-terminated poly (ether imine) dendrimer. Int J Nanomedicine. 2014; 9: 627-634. 298. Vandana VP, Chandra SR. Influence of AAC modes on speech intelligibility in a speaker with spastic-flaccid dysarthria due to amyotrophic lateral sclerosis. TAPI Journal. 2013; 5. 299. Varambally S, Vidyendaran S, Sajjanar M, Thirthalli J, Hamza A, Nagendra HR, Gangadhar BN. Yoga-based intervention for caregivers of outpatients with psychosis: a randomized controlled pilot study. Asian J Psychiatr. 2013; 6: 141-145. 300. Varghese AM, Sharma A, Mishra P, Vijayalakshmi K, Harsha HC, Sathyaprabha TN, Bharath SM, Nalini A, Alladi PA, Raju TR. Chitotriosidase – a putative biomarker for sporadic amyotrophic lateral sclerosis. Clin Proteomics. 2013; 10: 19. 301. Varghese T, Sheelakumari R, James JS, Mathuranath PS. A review of neuroimaging biomarkers in Alzheimer’s disease. Neurol Asia. 2013; 18: 239-248. 302. Varma DS, Chandra PS, O’Leary CC, Reich W, Cottler LB. Ethical issues in obtaining collateral information on alcohol and drug use: experience from Asia and Africa. Curr Opin Psychiatry. 2013; 26: 330-334. 303. Venkataramaiah S, Rao GSU, Vinay B. Unexpected intraoperative airway obstruction in a patient with mild head injury. J Neurosurg Anesthesiol. 2013; 25: 219-220. 304. Venkataramaiah S, Vinay B, Sriganesh K, Rao M. Pneumothorax with subcutaneous emphysema following cardio-pulmonary resuscitation. Minerva Anestesiol. 2013; 79: 824-825. 305. Venkatasubramanian R, Kumar CN, Pandey RS. A randomized double-blind comparison of fluoxetine augmentation by high and low dosage folic acid in patients with depressive episodes. J Affect Disord. 2013; 150: 644-648. 306. Venugopal AK, Ghantasala SS, Selvan LD, Mahadevan A, Renuse S, Kumar P, PawarH, Sahasrabhuddhe NA, Suja MS, Ramachandra YL, Prasad TS, Madhusudhana SN, Hc H, Chaerkady R, Satishchandra P, Pandey A, Shankar SK. Quantitative proteomics for identifying biomarkers for Rabies. Clin Proteomics. 2013; 10: 3. 307. Verghese T, Kumari RS, Mathuranath PS, Albert S. Evaluation of different stages of AD using unsupervised clustering techniques and VBM. IEEE Explore. DOI: 10.1109/WICT. 2012. 6409212 216 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 308. Vishwanath B, Maroky AS, Math SB, John JP, Cherian AV, Girimaji SC, Benegal V, Hamza A, Chaturvedi SK. Gender differences in the psychological impact of Tsunami. Intl J Soc Psychiatry. 2013; 59: 131-136. 4. Agarwal SM, Venkatasubramanian G. Metabolic syndrome in schizophrenia: theoretical, clinical and translational perspectives. Indian J Psychol Med. 2013; 35: 117-120. 309. Vishweswari G, Christopher R, Rajendra W. Phytochemical screening of active secondary metabolites present in Withania Somnifera root: Role in traditional medicine. Int J Pharm Sci Res. 2013; 4: 2770-2776. 5. Ambekar S, Ranjan M, Prasad C, Santosh V, Somanna S. Fourth ventricular ependymoma with a distant intraventricular metastasis: Report of a rare case. J Neurosci Rural Pract. 2013; 4: S121-S124. 310. Viswanath B, Chandra PS, Chaturvedi SK. Supervision as usual–is it enough? Asian J Psychiatr. 2013; 6: 488-493. 6. Andrade C, Rao STS. Childhood sexual abuse and the law: more problems than solutions. Indian J Psychiatry. 2013; 55: 214-215. 7. Andrade C. Anesthesiological training and certification for psychiatrists practising unmodified ECT. Indian J Psychiatry. 2013; 55: 98-99. 8. Andrade C. Depression: From psychopathology to pharmacotherapy. Indian J Med Res. 2013; 138: 10361037. 9. Andrade C. How to read a research paper: Ecological validity, apples, and oranges. Indian J Psychiatry. 2013; 55: 99. 10. Arthur JAJ, Dhanasekarapandian R. Quality of life of persons with alcohol dependence syndrome. Indian J Soc Psychiatry. 2013; 29: 69-74. 11. Arunbabu R, Mahadevan A, Sampath S, Indira Devi B, Pandey P. A single institutional series of intracranial teratomas. Indian J Neurosurg. 2013; 2: 162-169. 12. Ashok M, Indira Devi B, Shukla DP, Neeraj U, Shobini LR, Subakrishna DK, Jamuna R, Bharath RD. Brain morphometric changes and cognitive domain correlations in early mild to moderate traumatic brain injury. Indian J Neurotrauma. 2013; 10: 80-85. 13. Ashwath Narayana DH, Madhusudana SN, Sampath G, Tripathy RM, Sudarshan MK, Gangaboraiah, Ravish HS, Satapathy DM, Gowda G, Holla R, Ashwin BY, Padhi A, Manjula S, Patel PM. Safety and immunogenicity study of a new purified chick embryo cell rabies vaccine Vaxirab-N (Pitman Moore strain) manufactured in India. Hum Vaccin Immunother. 2014; 10: 120-125. 14. Asokan M, Lone IN, Mukthey AB, Siddhartha P, Mariappa G, Kotehal PK, Satish B, Wilson E, Sahayam S, Velayutham G, Perumal R, Baskaran K, Rengarajan D, 311. Viswanath B, Harihara SN, Nahar A, Phutane VH, Taksal A, Thirthalli J, Gangadhar BN. Battery for ECT related cognitive deficits (B4ECT-ReCoDe): development and validation. Asian J Psychiatr. 2013; 6: 243-248. 312. Viswanath B, Taj M J RJ, Purushottam M, Kandavel T, Shetty PH, Reddy YC, Jain S. No association between DRD4 gene and SRI treatment response in obsessive compulsive disorder: need for a novel approach. Asian J Psychiatr. 2013; 6: 347-348. 313. Wang C, Klechikov AG, Gharibyan AL, Wärmländer SK, Jarvet J, Zhao L, Jia X, Shankar SK, Olofsson A, Brännström T, Mu Y, Gräslund A, Morozova-Roche LA. The role of pro-inflammatory S100A9 in Alzheimer’s disease amyloid-neuroinflammatory cascade Acta Neuropathol. 2014; 127: 507-522. B. NATIONAL JOURNALS 1. Abhisek HA, Thirthalli J, Hegde A, Phutane VH, Kumar CN, Muralidharan K, Gangadhar BN. Seizure duration decreases over a course of bifrontal and not bitemporal electroconvulsive therapy. Indian J Psychol Med. 2014; 36: 45-47. 2. Achalia R, Andrade C. Ventricular premature contractions associated with iloperidone. Indian J Psychiatry. 2013; 55: 195-196. 3. Agarwal SM, Jose D, Baruah U, Shivakumar V, Kalmady SV, Venkatasubramanian G, Mataix-Cols D, Reddy YC. Neurohemodynamic correlates of washing symptoms in obsessive compulsive disorder: A pilot fMRI study using symptom provocation paradigm. Indian J Psychol Med. 2013; 35: 67-74. National Institute of Mental Health and Neuro Sciences / 217 Annual Report 2013-14 Muthusamy R, Philip M, Ravindra KC, Basha JN, Mizar P, Kaur G, Mehra NK, Kundu TK, Subbakrishna DK, Satish KS, Ranga U. Evident stabilization of the clinical profile in HIV/AIDS as evaluated in an open label clinical trial using a polyherbal formulation. Indian J Med Res. 2013; 137: 1128-1124 15. 16. 17. Babarao HD, Madhu N, Sinha S, Prasad C, Somasekhar N, Ahmad N, Bindu PS, Taly AB. Self-limiting symptomatic peri-ictal bradyarryhthmia due to junctional AV rhythm. J Neurosci Rural Pract. 2013; 4: S103-S105. Balamurugan G, Vijayarani M, Nagarajaiah. Alexithymia and somatization in primary care. Indian J Psychiatric Nursing. 2014; 7: 22-24. Bansal S, Surve R, Sriganesh K, Thirthalli J, Subbakrishna DK, Umamaheshwara Rao GS. Influence of acute haemodynamic changes on the oxygen saturation during electro-convulsive therapy. J Neuroanesthesiol Critical Care. 2014; 1: 46-49. 25. Bivin JB, Mathew P, Thulasi PC, Zacharia AJ. Nomophobia – Do we really need to worry about? Indian J Psychiatric Nursing. 2013; 1: 1-5. 26. Chakraborty S, Kommu JV, Srinath S, Seshadri SP, Girimaji SC. A comparative study of pathways to care for children with specific learning disability and mental retardation. Indian J Psychol Med. 2014; 36: 27-32. 27. Chand P, Naveen CK, Murthy P, Isaac MK. Addressing alcohol addiction: lessons from a hospital based audit. Indian J Med Res. 2013; 137: 394-396. 28. Chandra SR, Adwani S, Mahadevan. Acanthamoebic meningoencephalitis. Ann Indian Acad Neurol. 2014; 17: 108-112. 29. Chandra SR, Anilkumar S, Christopher R. Report of clinical and radiological features and outcome in a patient with propionic aciduria. TAPIJ. 2013; 20-23. 30. Chandra SR, Thomas GI, Ramakrishna A. Clinical and radiological spectrum of CSF anti-measles antibody associated encephalopathy. TAPIJ. 2013; 5: 1-6. 31. Chandra SR, Thomas Gregor Issac. Battered woman syndrome- An unusual case presentation of pseudodystonia, Case report. J Neurosci Rural Pract. 2014; 5: 35-37. 18. Bavle A, Andrade C, Vidhyavathi M. Rapid, illegible handwriting as a symptom of obsessive-compulsive disorder. Indian J Psychiatry. 2014; 56: 200-201. 19. Bavle A, Andrade, C. Prolonged, self-administration of ultra-high doses of quetiapine. Indian J Psychiatry. 2013; 55: 404-405. 20. Belodu R, Nagarathna S, Ravikumar R, Kumar R, Chandramouli BA. A pneumococcal brain abscess: a case report. J Clin Diagn Res. 2013; 7: 1694-1695. 32. Chari U, Hirisave U, Appaji L. Exploring play therapy in pediatric oncology: A preliminary endeavour. Ind J Pediatr. 2013; 80: 303-308. 21. Bharath RD. Functional MRI: Genesis, State of the art and the sequel. Indian J Radiol Imaging. 2014; 24: 6-12. 33. Dahale AB, Hatti S, Thippeswamy H, Chaturvedi SK. Factitious disorder – experience at a neuropsychiatric centre in southern India. Indian J Psychol Med. 2014; 36: 62-65. 22. Bhattacharya A, Mehrotra S. Personal growth initiative scale: how does it perform in Indian youth samples? J Ind Assoc Appl Pychol. 2014; 40: 122-129. 34. Desai G, Chaturvedi SK. Fibromyalgia and abnormal illness behavior: A catch-22. Indian J Pain 2014; 28: 51. 35. Desai G, Sharma M, Chaturvedi SK. Medically unexplained symptoms explained! A case of post orgasmic illness syndrome. Indian J Medical Case Reports, 2013; 2: 18-20. 36. DeSouza A, Nalini A, Srikanth SG. Solitary cerebral parenchymal cysticercosis: a prospective comparative study with computed tomography and magnetic resonance imaging. Neurol India. 2013; 61: 639-643. 23. Bhattacharya A, Mehrotra S. The journey of personal growth: a qualitative exploration of personal growth processes in young adulthood. Psychol Stud. 2013; 58: 456-463. 24. Bhola P, Kapur M. The development and role of the therapeutic alliance in supportive psychotherapy with adolescents. Psychol Studies. 2013. 218 / National Institute of Mental Health and Neuro Sciences Annual Report 37. 38. 39. 40. 41. 42. 43. 44. 45. 46. Devi PU, Ramachandra, Varambally S, Philip M, Gangadhar BN. Effect of yoga therapy on anxiety and depressive symptoms and quality of life among care givers of in-patients with neurological disorders at a tertiary care centre in India. Indian J Psychiatry. 2013; 55: S385-S389. 2013-14 47. Hariprasad VR, Varambally S, Shivakumar V, Kalmady SV, Venkatasubramanian G, Gangadhar BN. Yoga increases the volume of the hippocampus in elderly subjects. Indian J Psychiatry. 2013; 55: S394-S396. 48. Hariprasad VR, Varambally S, Sivakumar PT, Thirthalli J, Basavaraddi IV, Gangadhar BN. Designing, validation and feasibility of a yoga-based intervention for elderly. Indian J Psychiatry. 2013; 55: S344-S349. 49. Herbert HS, Manjula M, Philip M. Growing up with a parent having schizophrenia: experiences and resilience in the offsprings. Indian J Psychol Med. 2013; 35: 148-153. 50. Holla B, Viswanath B, Neelaveni S, Harish T, Kumar CN, Math SB. Karnataka state telemedicine project: utilization pattern, current, and future challenges. Indian J Psychol Med. 2013; 35: 278-283. 51. Issac TG, Chandra SR, Nagaraju BC. Transcranial magnetic stimulation in patients with early cortical dementia: A pilot study. Ann Indian Acad Neurol. 2013; 16: 619-622. 52. Girish N, Srikala B. Delusion or reality: Households costs of care for dementia in India. Indian J Public Health. 2013; 57: 71-77. Jacob P, Seshadri S, Srinath S, Girimaji SC, Sagar JV. Inpatient aggression at a tertiary care child and adolescent psychiatry centre: psychosocial variables and caregiver perspectives. J Indian Assoc Child Adolesc Ment Health 2014; 10: 31-46. 53. Gupta A, Taly AB. Urodynamic profile of patients with neurogenic bladder following non-traumatic myelopathies. Ann Indian Acad Neurol. 2013; 16: 42-46. Jacob P, Seshadri S. Parenting in children and adolescents with internalising disorders. J Indian Assoc Child Adolesc. Ment Health. 2013; 9: 136-148. 54. Gururaj G. Injury prevention and care: An important public health agenda for health, survival and safety of children. Indian J Pediatr. 2013; 80: S100-S108. Jacob P, Seshadri S. Parenting: Is there a method in the madness?! J Indian Assoc Child Adolesc Ment Health 2013; 9: 43-49. 55. Hariprasad VR, Koparde V, Sivakumar PT, Varambally S, Thirthalli J, Varghese M, Basavaraddi IV, Gangadhar BN. Randomized clinical trial of yoga-based intervention in residents from elderly homes: Effects on cognitive function. Indian J Psychiatry. 2013; 55: S357-S363. Jayabal V, Sinha S, Satishchandra P. Magneto encephalography (MEG) recording and Analysis. Ann Indian Acad Neurol. 2014; 17: 3-11. 56. Hariprasad VR, Sivakumar PT, Koparde V, Varambally S, Thirthalli J, Varghese M, Basavaraddi IV, Gangadhar BN. Effects of yoga intervention on sleep and quality-oflife in elderly: A randomized controlled trial. Indian J Psychiatry. 2013; 55: S364-S368. Jayaram N, Varambally S, Behere RV, Venkatasubramanian G, Arasappa R, Christopher R, Gangadhar BN. Effect of yoga therapy on plasma oxytocin and facial emotion recognition deficits in patients of schizophrenia. Indian J Psychiatry. 2013; 55: S409-S413. 57. John A, Sadasivan A, Sukumaran B, Bhola P, David NJ, Manickam LSS. Practice guidelines: learning disability. Ind J Clin Psychol. 2013; 40: 65-88. Divakaran A, Narayanaswamy JC, Kalmady SV, Narayanan V, Rao NP, Venkatasubramanian G. Parentof-origin effect in schizophrenia and non-affective psychoses: evidence from dermatoglyphics. Indian J Psychol Med. 2013; 35: 260-267. Gandhi S, Lalitha K, Thennarasu K, Nagarajaiah, Ramachandra. Nurses perception about a DVD module on mental status examination demonstration. Nurs J India. 2013; 104: 125-127. Ganesha S, Thirthalli J, Muralidharan K, Benegal V, Gangadhar BN. Heart-rate variability during sleep in detoxified alcohol dependent males: A comparison with healthy controls. Indian J Psychiatry. 2013; 55: 173-177. Gangadhar BN, Naveen GH, Rao MG, Thirthalli J, Varambally S. Positive antidepressant effects of generic yoga in depressive out-patients: A comparative study. Indian J Psychiatry 2013; 55: S369–S373. National Institute of Mental Health and Neuro Sciences / 219 Annual Report 2013-14 58. Jothimani G, Sunitha TS, Padmavathi M, Philip M, Nagarajaiah, Ramachandra. Dissociative experiences among the adolescents. Indian J Psychiatric Nursing, 2013; 6: 24-27. 59. Kademani PV, Shinde S, Shinde SS, Nagarajaiah. Prevalence, health consequences and prevention of tobacco use in India. Indian J Psychiatric Nursing. 2014; 7: 46-51. 60. 69. Kusuma N, Nagarajaiah, Shinde SS, Philip M. Stress among the care givers of traumatic brain injured patients. Indian J of Psychiatric Nursing. 2013; 6: 9-11. 70. Lakshmana G, Dhanasekarapandian R. Prabhat KC, Marimuthu P. Street children with substance abuse: enhancement of motivation and relapse prevention strategies. Indian J Soc Work. 2013; 74: 131-150. Kademani PV, Shinde S, Shinde SS, Nagarajaiah. Knowledge and attitude regarding mental illness among general public. Indian J Psychiatric Nursing. 2013; 5: 4-8. 71. Lalitha K, Babu S, Virginia Mary. Knowledge & attitude on learning of adjustment through sports and physical activities: A descriptive survey. KNF. 2013; 8: 24-28. 61. Kakati A, Indira Devi B, Bhadrinarayan V, Kalra P, Shukla D. Endocrine dysfunction following traumatic brain injury in acute stage. Indian J Neurotrauma 2013; 10: 2-96. 72. Machado T, Sathyanarayanan V, Bhola P, Kamath K. Psychological vulnerability, burnout, and coping among employees of a business process outsourcing organization. Ind Psychiatr J. 2013; 22: 26-31. 62. Kallollimath P, Nagappa M, Sinha S, Saini J, Bindu PS, Taly AB. Panda with “Bright eyes” in Wilson’s disease. Neurol India. 2013; 61: 100-101. 73. Madhavadas S, Kutty BM, Subramanian S. Development of non-transgenic animal model for Alzheimer disease. Indian J Physiol Pharmacol. 2013; 57: 248. 63. Khaleel N, Roopa R, Sagar BK, Andrade C. Images in electroconvulsive therapy: Pilot impressions suggesting that ECT reduces excitatory synapses in the basolateral amygdala. Indian J Psychiatry. 2013; 55: 204-205. 74. 64. Konar S, Indira Devi B, Yasha TC, Shukla DP. Clival tumor presenting with acromegaly. Neurol India. 2013; 61: 186-187. Majid M, Nupur P, Chandramouli B, Mahadevan A. Cervicomedullary hemagioblastoma presenting with subarachnoid and intraventricular hemorrhage in patient with von hippel-lindau syndrome: a case report and literature Review. Neurosurgery Quarterly. Post author corrections, 2013. 75. Mangalore S, Bharath RD, Panda R, George L, Thamodharan A, Gupta AK. Utility of Resting fMRI and connectivity in patients with brain tumor. Neurol India. 2013; 61; 144-151. 76. Mangalore S, Desai S, Mahadevan A, Kovoor JM, Vasudev LM, Taly AB, Shankar SK. Cerebral tubercular thrombophlebitis presenting as venous infarct: Magnetic resonance imaging and pathologic correlation. Ann Indian Acad Neurol 2014; 17: 130-134. 77. Manjunath RB, Varambally S, Thirthalli J, Basavaraddi IV, Gangadhar BN. Efficacy of yoga as an add-on treatment for in-patients with functional psychotic disorder. Indian J Psychiatry 2013; 55: S374-S378. 78. Manjunatha N, Jayarajan D, Benegal V. Assessment and management of acute alcohol intoxication. Indian J Psychiatry. 2014. 79. Manjunatha N, Reddy SK, Renuka Devi NR, Rawat V, Bijjal S, Kumar NC, Kumar KVK, Thirthalli J, Gangadhar 65. 66. Kulkarni GB, Kallollimath P, Subasree R, Veerendrakumar M. Intractable vomiting and hiccups as the presenting symptom of neuromyelitis optica. Ann Indian Acad Neurol. 2014; 17: 117-119. Kulkarni GB, Mustare V, Varghese V. Internal jugular, subclavian and brachiocephalic vein thrombosis associated with cerebral venous sinus thrombosis. Neurol India. 2013; 61: 526. 67. Kulkarni GB, Ravi Y, Nagaraja D, Veerendrakumar M. Lower motor neuron facial palsy in cerebral venous sinus thrombosis. J Neurosci Rural Pract. 2013; 4: 224-226. 68. Kulkarni GB, Roopa S, Madhu N, Saini J, Yadav R, Veerendrakumar M, Nagaraja D. Cystic cochleovestibular anomaly presenting with congenital deafness and recurrent bacterial meningitis in childhood. Ann Indian Acad Neurol. 2013; 16: 272-275. 220 / National Institute of Mental Health and Neuro Sciences Annual Report BN. Delusional procreation syndrome: report from TURUVECARE community intervention program. Indian J Psychol Med. 2013; 35: 214–216. 80. 81. Manoj N, Arivazhagan A, Bhat DI, Arvinda HR, Mahadevan A, Santosh V, Devi BI, Sampath S, Chandramouli BA. Stereotactic biopsy of brainstem lesions: Techniques, efficacy, safety and disease variation between adults and children: A single institutional series and review. J Neurosci Rural Pract. 2014; 5: 32-39. Manoj N, Arivazhagan A, Mahadevan A, Bhat DI, Arvinda HR, Indira Devi B, Sampath S, Chandramouli BA. Central nervous system lymphoma: Patterns of incidence in Indian population and effect of steroids on stereotactic biopsy yield. Neurol India. 2014; 62: 19-25. 82. Maramattom BV, Chickabasaviah YT. A new Indian family affected by gelsolin amyloidosis. Neurol India. 2013; 61: 673-675. 83. Mathew B, Nagarajaiah. Knowledge and attitude of school teachers regarding learning disabilities among children. Indian J Psychiatric Nursing. 2013; 5: 30-32. 2013-14 90. Munivenkatappa A, Kumarsamy AD, Prathyusha V, Devi BI, Shukla DP. Can an abnormal CT scan be predicted from common symptoms after mild head injury in children? J Pediatr Neurosci. 2013; 8: 183-187. 91. Munivenkatappa A, Shukla DP. Traumatic subarachnoid hemorrhage masquerading as aneurysmal subarachnoid hemorrhage. Indian J Neurotrauma 2014; 11: 87-88. 92. Murthy P, Sarin A and Jain S. International advisers to the Bhore Committee. Perceptions and visions for healthcare. Economic and Political Weekly. 2013; 48: 10. 93. Nagappa M, Atchayaram N, Narayanappa G. A large series of immunohistochemically confirmed cases of congenital muscular dystrophies Neurol India 2013; 61: 481-487. 94. Nagappa M, Bindu PS, Adwani S, Seshagiri SK, Saini J, Sinha S, Taly AB. Clinical, hematological, and imaging observations in a 25 year old woman with abetalipoproteinemia. Ann Indian Acad Neurol. 2014; 17: 113-116. 95. Nagappa M, Nayak C, Sinha S, Philip M, Taly AB. Relation of sleep related events and spontaneous arousals during slow wave & REM sleep in healthy individuals. Indian J Sleep Med 2013; 8: 51-55. 96. Nagappa M, Sinha S, Saini JS, Bindu PS, Taly AB. ‘Undulating Tongue’ in Wilson’s disease. Ann Indian Acad Neurol 2014;17; 225-26 97. Nagappa M, Nalini A, Narayanappa G. Major histocompatibility complex and inflammatory cell subtype expression in inflammatory myopathies and muscular dystrophies. Neurol India. 2013; 61: 614-621. 84. Mehrotra S, Elias JK, Chowdhury D, Gupta A. Feeling good & doing well: development of a mental health promotion program for youth. Psychol Stud. 2013; 58: 54-57. 85. Mehrotra S, Tripathi R. Besides symptoms: unheard narratives in research on schizophrenia. Indian J Psychol Med. 2013; 35: 108-109. 86. Menon RN, Jagtap S, Thakkar R, Narayanappa G, Nair M. Mucolipidosis and progressive myoclonus epilepsy: A distinctive phenotype. Neurol India. 2013; 61: 537- 539. 87. Mubeen K, Chandrashekhar H, Kavitha M, Nagarathna S. Effect of tobacco on oral health – an overview. JEMDS. 2013; 2: 3523-3534. 98. Nagapurkar U, Andrade C. Ejaculatory dysfunction associated with low dose amisulpride. Indian J Psychiatry 2013; 55: 97. 88. Muneshwar BD, Thirumoorthy A, Lalitha K. Effectiveness of a STP on the level of knowledge about psychiatric history taking procedures among trainee nurses. Indian J Psychiatric Nursing. 2013; 6: 12-15. 99. Nagaraj K, Taly AB, Gupta A, Prasad C, Christopher R. Depression & sleep disturbances in patients with multiple sclerosis and their correlation with associated fatigue. J Neurosci Rural Pract. 2013; 4: 387-391. 89. Munivenkatappa A, Indira Devi B, Gregor TI, Kumarsamy AD, Bhat DI, Shukla DP. Bicycle accident related head injuries in India. J Neurosci Rural Pract. 2013; 4: 262266. 100. Nagaraj K, Taly AB, Gupta A, Prasad C, Christopher R. Prevalence of fatigue in patients with multiple sclerosis and its effect on the quality of life. J Neurosci Rural Pract. 2013; 4: 278-282. National Institute of Mental Health and Neuro Sciences / 221 Annual Report 2013-14 101. Nagarajaiah, Macwan R, Shinde SS, Jothimani G. Stress and coping among adolescent college students. Indian J Scholarly Res. 2013; 2: 37-39. 102. Nagarathna S, Veenakumari HB, Kasi CI, Sunder P. Comparative study of ELISA and LAT techniques for the serological prevalence of anti-toxoplasma antibodies among immunocompetent population. JEMDS. 2013; 2: 4040-4043. 103. Naik KR, Saroja AO, Narayanappa G. Electromyographic and histological features of postpartum hypernatremia rhabdomyolysis. Ann Indian Acad Neurol. 2013; 16: 664-667 104. Nalini A, Gayathri N, Nishino I, Hayashi YK. GNE myopathy in India. Neurol India 2013; 61: 371-374. 105. Nalini A, Gayathri N, Richard P, Cobo AM, Urtizberea JA. New mutation of the desmin gene identified in an extended Indian pedigree presenting with distal myopathy and cardiac disease. Neurol India. 2013; 61: 622-626. 106. Nalini A, Ramakrishna A, Dekumoy P, Kumar RR, Pakdee W, Saini J, Hegde VS. Severe form of radiculo - myelo neuropathy with meningo – encephalitis secondary to Angiostrongylus cantonensis infection: unusual corpus callosal lesions and serial magnetic resonance imaging findings. Neurol India. 2013; 61: 414-418. 107. Nattala P, Nagarajaiah. Relapse prevention in alcohol dependence: a family-based approach. Indian J Psychiatr Nursing. 2013. 44-47. 108. Naveen GH, Rao MG, Vishal V, Thirthalli J, Varambally S, Gangadhar BN. Development and feasibility of yoga therapy module for out-patients with depression in India. Indian J Psychiatry 2013; 55: S350–S356. 109. Naveen GH, Sinha S, Girish N, Taly AB, Varambally S, Gangadhar BN. Yoga and Epilepsy: How do patients perceive? Indian J Psychiatry 2013; 55: S390-S393. 110. Naveen GH, Sinha S, Girish N, Varambally S, Rashmi A, Taly AB, Gangadhar BN. Yoga among patients with epilepsy: Awareness in 21st century. Indian J Psychiatry. 2013; 55(Suppl 3): S390-S393. 111. Naveen GH, Thirthalli J, Rao MG, Varambally S, Christopher R, Gangadhar BN. Positive therapeutic and neurotropic effects of yoga in depression: A comparative study. Indian J Psychiatry 2013; 55: S400-S404. 112. Nayak C, Nagappa M, Sinha S, Philip M, Taly AB. Association of sleep related events and arousals during light sleep in healthy individuals. Indian J Sleep Med. 2013; 8: 129-132. 113. Nebhinani M, Nebhinani N, Tamphasana L, Gaikwad AD. Nursing students’ attitude towards suicide attempters. A study from rural part of Northern India. J Neurosci Rural Pract. 2013; 4: 400-407. 114. Netto AB, Sinha S, Taly AB, Panda S, Rao S. Response to Sleep in Wilson’s disease: Questionnaire based study. Ann Indian Acad Neurol 2013; 16: 459-460. 115. Nirmala BP. Code of conduct for personnel working in child care institutions – A need unmet progressive outlook. 2013; 3. 116. Nupur P, Majid MA, Pandey P. Tubercular epidural abscess in cervical spine without bony involvement in a patient with HIV coinfection: case report and review of literature. Neurosurgery Quarterly 2013; post author corrections. 117. Padmavathi N, Lalitha K, Parthasarathy R. Effectiveness of conversational skills training of patients with schizophrenia. J Krishna Institute of Medical Sciences University. 2013; 2: 42-47. 118. Pandey P, Shetty R, Sabharwal P, Aravinda HR. Retrieval of a microcatheter from arteriovenous malformation after hemorrhage following ony embolization. Neurol India 2013; 61: 523-525. 119. Pandit L, Raghotham A, Chickabasaviah Y, Khandige G, Shetty RK. Neoplastic Parkinsonism: An illustrative case report. Ann Indian Acad Neurol. 2013; 16: 437-449. 120. Pillai RR, Parthasarathy R. Psychiatric social work services in family psychiatry unit – NIMHANS experience. Dysphrenia. Acad J Psychiatry. 2014; 5: 71-74. 121. Poreddi V, Ramachandra, Reddemma K, Math SB. People with mental illness and human rights – A developing countries perspective. Indian J Psychiatry. 2013; 55: 117-124. 222 / National Institute of Mental Health and Neuro Sciences Annual Report 2013-14 122. Prashantha DK, Sriranjini SJ, Sathyaprabha TN, Nagaraja D, Pal PK. Evaluation of the motor cortical excitability changes after ischemic stroke. Ann Indian Acad Neurol. 2013; 16: 394-397. 133. Ramana GV, Rao BCS, Tiwari SK, Gupta HK, Sahoo S, Sudhakar D. Herbo mineral drugs & panchakarma therapy in the management of pakshavatha (hemiplegia) – a comparative clinical evaluation, Aryavaidyan, 2013; 27: 22-29. 123. Princy R, Mathew B, Nagarajaiah. Knowledge and attitude of school teachers regarding learning disabilities among children. Indian J Psychiatric Nursing. 2013; 6: 41-43. 134. Ranjan M, Mahadevan A, Prasad C, Sommana S, Shankar SK. Kümmell’s disease – uncommon or under-reported disease: A clinicopathological account of a case and review of literature. J Neurosci Rural Pract. 2013; 4: 439-442. 124. Puneeth CS, Chandra SR, Yadav R, Sathyaprabha TN, Chandran S. Heart rate and blood pressure variability in patients with myasthenia gravis. Ann Indian Acad Neurol. 2013; 16: 329-332. 125. Radhakrishnan K, Rathore C, Rao MB. National Epilepsy surgery support activity. Ann Indian Acad Neurol 2014; 17: 132-133. 126. Raghunath, A, Pruthi, N, Bhatt, Dhananjay I, Aziz, Z, Saini, J. Giant and multiple intraparenchymal neurocysticercosis: Report on its surgical and medical management. Neurosurgery Quarterly. 2014; 24: 37-39. 127. Rajaram P, Thomas PT. Epilepsy attitude and awareness among students of professional Social Work. Artha J Soc Sci. 2013. 128. Rajasekaran A, Shivakumar V, Venugopal D, Kalmady S, Amaresha A, Agarwal M, Narayanaswamy JC, Venatasubramanian G, Manojit D. Association of HLA-G 14bp INS/DEL polymorphism with brain morphology in Schizophrenia. Molecular Cytogenetics. 2014; 7: P43. 129. Ramachandra, Bhaskar, Nagarajaiah. Utility of systematic literature review. Indian J Psychiatric Nursing. 2013; 6: 48-50. 130. Ramachandra, Girish N, Nagarajaiah. Epidemilogy and co-morbidity of somatoform disorder. Indian J Psychiatric Nursing. 2013; 5: 39-41. 131. Ramachandra, Girish N, Nagarajaiah. Meta Analysis: an overview. Indian J Psychiatric Nursing. 2014; 7: 26-30. 132. Ramakrishnan S, Narayanaswamy VR. Unilateral asterixis, thalamic astasia and vertical one and half syndrome in a unilateral posterior thalamo subthalamic paramedian infarct-an interesting case report. J Neurosci Rural Pract. 2013; 4: 220-223. 135. Rao BC, Sahoo S. Clinical evaluation of the role of vyoshadi guggulu along with sammer pannag ras in the management of amavata (rheumatoid arthritis), Reniassance, 2013; 11: 3- 9. 136. Rao BC. Ethical issues related to surrogate consent in research on mental development disabilities – a review Part-2, Aryavaidyan, 2013; 27: 8-15. 137. Rao MB, Arivazhagan A, Sinha S, Bharath RD, Mahadevan A, Bhat M, Satishchandra P. Surgery for drug-resistant focal epilepsy. Ann Indian Acad Neurol 2014: 17: S124-S131. 138. Rao MB, Radhakrishnan M. Dexmedetomidine for a patient with Hallervorden-spatz syndrome during magnetic resonance imaging: A case report. J Anaesth. 2013; 27: 963-964. 139. Rao MB. Images in Neurosurgery – Vein of Labbe. CNS Quarterly Spring 2014; 15: 33. 140. Rao MB. Surgery for drug resistant focal epilepsy. J Assoc of Physicians India. 2013; 61: 55-57. 141. Rao NP, Reddy MS, Reddy JY. Is there a role for immunological mechanisms in etiopathogenesis of obsessive compulsive disorder? Indian J Psychol Med. 2013; 35: 1-3. 142. Rao STS, Andrade C. Ethical issues in psychiatry: Special concerns for India. Indian J Psychiatry. 2013; 55: 1-2. 143. Rao STS, Andrade C. Moving psychopharmacological drug development to the developing world. Indian J Psychiatry. 2014; 56: 105-106. 144. Rao STS, Andrade C. Screening for disease, psychological testing, and psychotherapy: looking behind the mirror. Indian J Psychiatry. 2013; 55: 103-105. National Institute of Mental Health and Neuro Sciences / 223 Annual Report 2013-14 145. Rao STS, Nagpal M, Andrade C. Sexual coercion: time to rise to the challenge. Indian J Psychiatry. 2013; 55: 211213. 146. Ravi PB, Ravishankar GM, Andrade C. Bilateral peripheral edema as a rare adverse effect of escitalopram. Indian J Psychiatry. 2014; 56: 97. 147. Ravindran D, Parthasarathy R. Influence of life skills education on skills of coping with stress of high school students. Nat J Professional Soc Work. 2013; 14: 49-58. 148. Reddy KS, Thirthahalli J, Kumar N, Reddy NR, Renukadevi, NR, Rawat, VS, Ramkrishna J, Gangadahar BN. Schedule of factors influencing access to psychiatric treatment in persons with schizophrenia: Validity and pilot testing. Indian J Psychol Med. 2013; 35: 364 -367. 149. Reddy RP, Rajeswaran J, BhavagatulaI ID, Kandavel T. Silent epidemic: the effects of neurofeedback on qualityof-life. Indian J of Psychol Med. 2014; 36: 40-44. 150. Reddy SK, Thirthalli J, Channaveerachari NK, Reddy KN, Ramareddy RN, Rawat VS, Narayana M, Ramkrishna J, Gangadhar BN. Factors influencing access to psychiatric treatment in persons with Schizophrenia: A qualitative study in a rural community. Indian J Psychiatry. 2014; 56: 54-60. 151. Renjini R, Gayathri N, Nalini A, Bharath MMS. Analysis of Calpain 3 protein in muscle biopsies of different muscular dystrophies from India. Indian J Med Res. 2012; 135: 878-886. 152. Rupa M, Girimaji S, Muthuswamy S, Jacob P, Malavika R. The importance of emotional insight in cognitive behaviour therapy for anorexia nervosa: an adolescent case study. J Indian Assoc Child Adolesc Ment Health. 2013; 9: 13-18. 153. Rupa M, Hirisave U, Srinath S. Psychological intervention for a child exposed to murder. Indian J Pediatr. 2013; 81: 509-510. 154. Sadanand S, Shivakumar P, Girish N, Loganathan S, Bagepally BS, Kota LN, Reddy NN, Sivakumar PT, Bharath S, Varghese M. Identifying elders with neuropsychiatric problems in a clinical setting. J Neurosci Rural Pract. 2013; 4: S24-S30. 155. Sahoo S, Rao BC, Sudhakar D. Etipathogenesis of nidranasha, Renaissance, 2013; 10: 27-29. 156. Sahoo S, Rao BC, Sudhakar D. Nidranasha and its management. Ayushree, Vol 2012, 136-139. 157. Saligoudar P, Seshadri R, Pandey P. Rare presentation of pial arteriovenous malformation as proptosis: case report and review of literature. Neurol India 2013; 61: 200-201. 158. Santosh NS, Sinha S, Satishchandra P. Epilepsy: Indian Perspective. Ann Indian Acad Neurol. 2014; 17: S3-S11. 159. Saroja AO, Naik KR, Nalini A, Gayathri N. Bethlem myopathy: An autosomal dominant myopathy with flexion contractures, keloids, and follicular hyperkeratosis. Ann Indian Acad Neurol. 2013; 16: 712-715. 160. Sastri SB, Dwarakanath S, Aravinda HR, Sampath S. Double fenestration of the anterior communicating artery – ‘the figure- of- 8’ anomaly. Indian J Neurosurg. 2013; 2: 93-95. 161. Sastri SB, Dwarakanath S, Sampath S. Multiple aneurysms with meningiomas – coincidence or co-incidence? Indian J Neurosurg. 2013; 2: 99-101. 162. Sastri SB, Pandey P. Carotid endarterectomy: The procedure of choice for carotid stenosis. Indian J Neurosurg. 2013; 2: 9-17. 163. Sastri SB, Sadasiva N, Pandey P. Giant cavernous carotid aneurysm with spontaneous ipsilateral ICA occlusion: Report of 2 cases and review of literature. J Neurosci Rural Pract. 2013; 4: S113-S116. 164. Satishchandra P, Sinha S. Hot-water epilepsy: from bench to bedside. Ann Indian Acad Neurol. 2013; 16: 137-143. 165. Satishchandra P, Sinha S. Lafora Body Disease: NIMHANS experience. Current Science. 2013; 105: 808-814. 166. Satishchandra P. Yoga and neurobehavioural sciences: Indian perspective. Indian J Psychiatry. 2013; 55: 332-333. 167. Shankar SK, Mahadevan A, Harish G, Bharath MMS. Human brain tissue repository: a national facility fostering neuroscience research. Proc Natl Acad Sci India Sect B Biol. Sci. 2013. 224 / National Institute of Mental Health and Neuro Sciences Annual Report 168. Sharma J, Mukerjee D, Rao SN, Iyengar S, Shankar SK, Satishchandra P, Jana NR. Neuronatin – mediated aberrant calcium signaling and endeplasmic reticulum stress underlie neuropathology in Lafora Disease. J Biol Chem. 2013; 288: 9482-9490. 169. Sharma MK, Chandra PS, Chaturvedi SK. Objective structured clinical examination and its impact on clinical and interpersonal skill. Indian J Psychol Med. 2013; 35: 299-301. 170. Sharma MK, Chaturvedi SK. Pain in mental health setting and community: an exploration. Indian J Psychol Med. 2014; 36: 98-100. 171. Sharma MK, Marimuthu P. Prevalence and psychosocial factors of aggression among youth. Indian J Psychol Med. 2014; 36: 48-53. 172. Sharma MK, Raju M. Relationship of personality dimensions and aggression in romantic relationship among youth. Indian J Psychol Med. 2013; 35: 197-202. 173. Sharma R, Dwarakanath S, Somanna S. Giant cerebral cavernous malformation causing raised intracranial pressure in adult: A case report and review of the literature. Indian J Neurosurg. 2013; 2: 275-277. 2013-14 179. Singhal M, Vahali HO. Building broken sandcastles: Explorations in play therapy with a sexually abused child. J Indian Assoc Child Adolescent Mental Health. 2014; 10: 123-144. 180. Sinha S, Pramod MN, Dilipkumar S, Satishchandra P. Idiopathic generalized epilepsy: Phenotypic and Electroencephalographic observations in a large cohort from south India. Ann Indian Acad Neurol 2013; 16: 163-168. 181. Sowmya HS, Suman LN. Pathways to homelessness, psychological distress and perceived social support among married women in a shelter: Implications for trauma informed care. Ind J Clin Psychol. 2013; 40: 109-115. 182. Sriganesh K, Netto A, Kulkarni GB, Taly AB, Rao GSU. Seasonal variation in the clinical recovery of patients with Guillain Barré syndrome requiring mechanical ventilation. Neurol India 2013; 61: 349-354. 183. Sriganesh K, Pandey P. Transient cardiac asystole induced by electro-cautery during excision of a cerebello-pontine angle tumor. Neurol India. 2013; 61: 554. 184. Subramanian S. Metabolic dysfunction and cognitive decline in aging brain: Strategies to improve cognitive health. Indian J Physiol Pharmacol. 2013; 57: 26. 174. Shetty R, Sharma RM, Pandey P. Diaphragma sella meningioma presenting with posterior cerebral artery infarct: case report and review of literature. Neurol India 2014; 62: 77-78. 185. Sudheer A, Dwarakanath S, Pandey P, Sampath S, Chandramouli BA. Factors influencing shunt malfunction in patients with Tuberculous meningitis. Indian J Neurosurg. 2013; 2: 175-181. 175. Shinde SS, Kademani PV, Shinde SS, Nagarajaiah. Attitude of primary care givers of psychiatric patients towards human rights of mentally ill. Indian J Psychiatric Nursing. 2013; 6: 20-23. 186. Suman LN, Sesha BV. Loss, trauma and suicidal ideation among women living in a shelter. Indian J Clin Psychol. 2013; 40: 34-40. 176. Shukla D, Bhat DI, Indira Devi B. Visual loss due to anterior communicating artery aneurysm. J Neurosci Rural Pract. 2013; 4; 305-306. 177. Simha S, Noble S, Chaturvedi SK. Spiritual concerns in Hindu cancer patients undergoing palliative care: a qualitative study. Indian J Palliat Care. 2013; 19: 99-105. 178. Sindhu KCS, Chandra SR, Thomas Gregor Issac, Sanjith R, Radhamma H. Legal and clinical aspects in nursing Practice. TAPIJ. 2013; 5: 12-16. 187. Thamilselvan. P. Psychosocial issues of parents with children with cleft lip and palate. Indian Streams Research J. 2014; 4. 188. Thirthalli J, Naveen GH, Rao MG, Varambally S, Christopher R, Gangadhar BN. Cortisol and antidepressant effects of yoga. Indian J Psychiatry 2013; 55: S405–S408. 189. Tripathi R, Bharath S, Desai G, Mehrotra, S. Therapist concerns and process issues in grappling with functional autobiographical amnesia. Indian J Psychol Med, 2013; 35: 305-308. National Institute of Mental Health and Neuro Sciences / 225 Annual Report 2013-14 190. Tripathi R, Kumar JK, Bharath S, Marimuthu P, Varghese M. Clinical validity of NIMHANS neuropsychological battery for elderly: A preliminary report. Indian J Psychiatry, 2013; 55: 279-282. 191. Vandana VP, Chandra SR, Issac TG. Influence of AAC mode in speech intelligibility in a speaker with spastic flaccid dysarthria due to Amyotrophic lateral sclerosis. Tamil Nadu Academy of Physician of Indian J. 2013; 5: 1-7. 192. Vandana VP, Shyamala KC, Jahan, S. Adaptation and standardization of cognitive-linguistic quick test in Kannada (CLQT-K). Comparison between monolinguals (Kannada) and bilinguals (Kannada-English). Language in India. 2013; 13: 360-451. 193. Vandana VP. Articulatory patterns in dementia– Sequential speech motion rate measures. Research Thoughts: Multidisciplinary Res J, 2013; 3: 1-5. 194. Vandana VP. Perspectives on stuttering and social anxiety. Language in India. 2013; 14: 855-856. a capnograph artefact. J Clin Monit Comput. 2014; 28: 217-219. 202. Viswanath B, Maroky AS, Math SB, John JP, Cherian AV, Girimaji SC, Benegal V, Hamza A, Chaturvedi SK. Gender differences in the psychological impact of tsunami. Int J Soc Psychiatry. 2013; 59: 130-136. 203. Vranda MN. Exploring domestic violence in an Indian setting. Indian J of Gender Stud. 2013; 201: 135-146. 204. Vykuntaraju KN, Ramalingaiah AH. Disulfiram poisoning causing acute encephalopathy. Indian Pediatr. 2013; 50: 887-888. 205. Xu XD, Ren HY, Prakash R, Kumar R. Outcomes of neuropsychological interventions of stroke. Ann Indian Acad Neurol. 2013; 16: 319-328. 206. Zacharia AJ, Bivin JB, Nagarajaiah. Awareness about impact of mobile phone usage on health among adolescents. Indian J Psychiatric Nursing. 2013; 5: 14-17. C. BOOK CHAPTERS-CONFERENCE PROCEEDINGS 195. Vandana VP, Manjula R. Phonatory characteristics in subjects with focal cerebellar lesions: Preliminary findings. Language in India. 2013; 13: 460-504. 196. Var FA, Rajeswaran J. Quality of life and perception of illness in patients with traumatic brain injury Ind J Neurotrauma. 2013; 10: 115-119. 197. Varambally S, Naveen GH, Rao MG, Thirthalli J, Sharma R, Christopher R, Gangadhar BN. Low serum brain derived neurotrophic factor in non-suicidal out-patients with depression: Relation to depression scores. Indian J Psychiatry. 2013; 55: S397-S399. 198. Varghese RV, Bivin J B, Nagarajaiah. Knowledge and attitude towards end of life care among student nurses and staff nurses. Indian J Psychiatric Nursing, 2013; 5: 18-21. 1. Adoor M, Kisan R, Raju TR, Sathyaprabha TN. Conventional cardiovascular autonomic function testing. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects, NIMHANS, Bangalore.2013. p205-212. 2. Adoor M, Rukmani MR, Sujan MU, Raju TR, Sathyaprabha TN. Quantitative sudomotoraxon reflex test. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects, Bangalore, NIMHANS, 2013. p221-228. 3. Alladi PA, Mahadevan A, Shankar SK, Muthane U, Raju TR. Effects of aging in substantia nigra of Asian Indians. Parkinson’s disease education programme. A handbook Department of Neurophysiology, Bangalore, NIMHANS 2014. 4. Alladi PA, Vijayalakshmi K, Vidyadhara DJ, Yarreiphang H, Jyothi HJ, Sathyaprabha TN, Raju TR. Principles of immunohistochemistry. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 96-99. 199. Venkatesh MS, Pandey P. Endovascular therapy for acute stroke: Quo Vadis? Indian J Neurosurg 2013; 2: 119-123. 200. Vijayalakshmi S. Prevalence of depression among postpartum women. Nursing J India. 2013; 4: 156-158. 201. Vinay B, Sriganesh K, Gopalkrishna KN. An abrupt reduction in end-tidal carbon-dioxide during neurosurgery is not always due to venous air embolism: 226 / National Institute of Mental Health and Neuro Sciences Annual Report 5. 6. 7. 8. 9. 10. Alladi PA. Age effects in substantia nigra of asian Indians. In: Mouton PR (ed.) Neurostereology: unbiased stereology of neural systems, USA,Wiley-Blackwell Publishers, 2013. p39-51. Anshu K, Laxmi TR. Animal acoustic startle system: assessing startle response and prepulse inhibition. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 160-161. Anshu K, Merlin PB, TR Laxmi, Kutty BM. The five choice serial reaction time tasks (5csrtt): Assessing attentional processes in rats. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds). Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 157-159. Arunachala G, Thirthalli J. Sexual dysfunctions caused by psychotropic medications. In: Kar N, Kar GC (eds). Comprehensive textbook of sexual medicine. 2nd ed. New Delhi, Jaypee Brothers Medical Publishers (P) Ltd., 2014. p 317-332. Bhagya V, Christofer T, Mahati K, Shilpa BM, Tripathi SJ, Vrinda M, Vijayakumar K, Arun S, Hegde P, Raju TR, Kutty BM, Rao BSS. Assessment of learning and memory in rodents. In: Shankaranarayana Rao BS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p135-143. Bhagya V, Suwarna C, Mahati K, Christofer T, Shilpa BM, Vrinda M, Raju TR, Rao BSS. Assessment of anxiety and depressive-like behaviors. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS 2013. p149-156. 11. Bharath S, Varghese M. Geriatric mental health in south Asia – Ahuja Publishing House, In: Tiwari SC, Pandey NM (eds) Geriatric Mental Health at a Glance, New Delhi. p16-31. 12. Chandra SR, Vidhya Annapoorni CS, Rashmi Ranjan Mahapatra C. Metabolic encepahalopathy- diagnosis and management. In: Progress in clinical neurosciences Neurological Society of India 2013. 13. Chandrashekhar Meshram, Gagandeepy Singh, Guest Editor Satishchandra P, (Eds). Indian clinical updates 2013-14 – Neurology (published in Association with Indian Academy of Neurology), Special Edition on Epilepsy. 14. Chaturvedi SK, Parameswaran S. Conversion disorders. In: Dinesh Bhugra, Gin Malhi, Susham Gupta, (eds) Troublesome disguises: Managing Challenging disorders in psychiatry. 2nd ed. Wiley Blackwell, 2013. 15. Chaturvedi SK, Parameswaran S. History of somatotherapy. In: James Wright (ed.) International encyclopedia of social & behavioral sciences, 2nd ed. Elsevier, 2013. 16. Chaturvedi SK, Parameswaran S. Hysteria. In: James Wright (ed.) International encyclopedia of social & behavioral sciences, 2nd ed. Elsevier, 2013. 17. Chaturvedi SK, Parameswaran S. Psychosomatic Medicine. In: James Wright (ed.) International encyclopedia of social & behavioural sciences, 2nd ed. Elsevier, 2013. 18. Chaturvedi SK, Simha SN. Historical perspectives on endof-life care in global context – Indian sub continent. In: Mark Lazenby, Ruth McCorkle, Dan Sulmasy (eds) Safe passage for a good death - a global spiritual sourcebook. (eds), Oxford University Press, 2013. p85-100. 19. Chaturvedi SK. Psycho oncology – Indian experiences & research. In: Savita Malhotra & Subho Chakrabarti (eds) Developments in Psychiatry: a perspective from PGI. Springer Verlag 2013. (ii) Psychiatric rehabilitation – an introduction. In: Nirmala BP (ed) Handbook of Psychiatric Rehabilitation Services, Department of Psychiatric Rehabilitation Services, Bangalore, NIMHANS 2014. p1-4. 20. Christofer T, Bhagya V, Mahati K, Raju TR, Rao BSS. Recording of extra cellular field potentials from the hippocampal slices. In: Shankaranarayana Rao BS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p175-p180. 21. Christofer T, Ramkumar K, Deepti N, Raju TR, Rao BSS. Stereotaxy : A tool to manipulate brain functions. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p109-p120. 22. Deepti N, Ramkumar K, Srikumar BN, Titus ADJ, Bhagya National Institute of Mental Health and Neuro Sciences / 227 Annual Report 2013-14 V, Raju TR, Rao BSS. Chromatographic methods of quantification of neurotransmitters in the brain. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p123-130. 23. 24. 25. need for the day’ In: Nirmala (ed.) Rehabilitation Hand Book, Bangalore, NIMHANS, 2014. 31. Desai G, Chaturvedi SK. Mental Health in the Indian sub continent, In: Dinesh Bhugra, Samson Tse, Roger Ng, Nori Takei (eds). Routledge Handbook of Psychiatry in Asia. Taylor & Francis/Routledge. UK, 2014. Jangam KV. Problems and social work management in clinical [Neuro-Psychiatric disorders in children] and non-clinical perspectives. In Proceedings of National conference, Contemporary practices in social work. St. Joseph College, Chennai. 32. Dhull DK, Mishra PS, Varghese AM, Sharma A, Vijayalakshmi K, Alladi PA, Raju TR. The “bands” of the western. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (Eds.), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p62-66. Jeevitha K, Suman LN. Domestic violence victimization: perspectives from spouses of alcohol dependents. In: Jaishankar K, Ronel N (eds) Global criminology: crime and victimization in the globalized Era. CRC Press, FL, USA, Taylor and Francis Group, Boca Raton, 2013. p353-p364. 33. John Vijay Sagar K. Evaluation of sexual problems. In: Kar NM.(ed.) Comprehensive Textbook of Sexual Medicine. 2nd ed. New Delhi: Jaypee Publishers, 2014. 34. Jyothi HJ, Niranjan S, Vijalakshmi K, Raju TR, Alladi PA. Densitometry based analysis of stained images. Parkinson’s disease education programme. A handbook. Department of Neurophysiology, Bangalore, NIMHANS 2014. Gandhi S. Delirium, catatonia and specific drug toxicity. In: Gandhi S, Lalitha K, Ramachandra, Prasanthi Nattala, Sivakumar (eds). Psychiatric emergencies and its management. Monograph of the workshop on Psychiatric Emergencies and its Management, Bangalore, NIMHANS, 2014. p16-p23. 26. Gandhi S. Nursing management of substance intoxication and withdrawal. In: Gandhi S, Lalitha K, Ramachandra, Prasanthi Nattala, Sivakumar T (eds). Psychiatric emergencies and its management. Monograph of the workshop on psychiatric emergencies and its management. Bangalore, NIMHANS, 2014. p57-p62. 35. Kambli M, Mishra PK, Hegde P, Laxmi TR. Classical fear conditioning: A model for associative learning and memory. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 2013. p167-168. 27. Gandhi S. Psychiatric Rehabilitation Services – a nursing orientation. In: Nirmala BP (ed.) Handbok of psychiatric rehabilitation services. Bangalore, NIMHANS, 2014. p160-171. 36. Khanam F, Bhola P. Assessment of cognitive factors in a rehabilitation setting. In: Nirmala BP (ed.) Handbook of psychiatric rehabilitation services. Bangalore, NIMHANS, 2014. p122-136. 28. Gandhi S. Issues related to treatment and management in psychiatric rehabilitation services. In: Nirmala BP (ed.) Handbook of psychiatric rehabilitation services. NIMHANS, 2014; 72-93 37. Kumar CN. Understanding disability. In: Handbook of Psychiatric Rehabilitation. Bangalore, NIMHANS, 2013. 38. Kutty BM, Rao BSS, Raju TR. Neurophysiological basis of plasticity. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 2013. p24-p28. 39. Kutty BM, Ravindra PN. Neural substrates of sleep. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, p29-34. 29. 30. Gururaj G. Road traffic deaths, injuries, and disabilities in India : public health burden and impact. In: Das AK (ed.) Non communicable diseases in India – Burden and prevention. Manual of the Association of Physicians of India, Mumbai, 2013. p208-218. Janardhana N, Naidu DM, Nirmala BP. Community based rehabilitation and people with mental illness: A 228 / National Institute of Mental Health and Neuro Sciences Annual Report 40. Kutty BM, Ravindra PN. Significance of sleep: Towards energy conservation and memory consolidation. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, p35-38. 41. Kutty BM. Synchronizing research with medical education’ in the Proceedings of the ICMR sponsored CME on Challenges and opportunities in medical education. Bangalore, NIMHANS. 42. Kutty BM. Brain, mind, self and consciousness. Proceedings of 9th Nalanda dialogue on philosophical and scientific models of understanding consciousness, Navanalanda Mahavihara University, Nalanda, Bihar, 28-31 January 2014. 43. 44. Lalitha K. Patient rights and application of basic ethical principles in nursing practice. In: Jayanthi KN, Nagarajaiah (eds). Ethical and legal guidelines for nursing practice. Bangalore, 2013; 11-16. Lalitha K. Suicide and its management. In: Sailaxmi Gandhi, Lalitha K, Ramachandra, Prasanthi Nattala, Sivakumar (eds). Monograph of the Workshop, Psychiatric emergencies and its management. Bangalore, 2014. p1-p11. 2013-14 assay of acetylcholinesterase activity in the brain. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p131-134. 50. Mahati K, Veena J, Bhagya V, Christofer T, Raju TR, Rao BSS. Stereological methods to quantify cell densities and volumes in discrete brain regions. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p87-p95. 51. Maruthai N, Sasidharan A, Nair AK, Sathiamma S, Kutty BM. Polysomnography: A practical overview. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 192-196. 52. Mehrotra S, Tripathi R. Flourishing at work. In: Pestonjee DM, Pandey S, (eds). Stress & work: Perspectives on understanding and managing stress. Sage: New Delhi, 2013. p239-p263. 53. Mehrotra S. Understanding love. In: Kar N, Kar GC. (eds). Comprehensive textbook of sexual medicine. Quality of life foundation. 2nd ed. UK, 2014. p89-p102. 54. Mishra PK, Hegde P, Laxmi TR. Neural correlates of fear memory and fear extinction: single and multiunit recordings in freely moving rats. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS 169-171. 45. Madhu N, Sinha S. Autoimmune encephalopathy: Need to be considered more often in today’s practice! In: Singhal BS, Bansal AR (eds). Complicated cases in Epilepsy. Kontentwork, New Delhi, 2013. p61-p73. 46. Madhu N, Sinha S. Seizure as complication of systemic disease. Proceedings of CME, IANCON 2013. 55. Madhusudana SN, Mahmuda K, Mani RS. Rabies diagnosis: demonstration of immune complexes by capture ELISA. In: Rupprecht CE, Nagarajan T (eds). Current laboratory techniques in rabies diagnosis, research and prevention. Academic Press/Elsevier, San Diego, CA, 2014. Mishra PS, Dhull D, Varghese AM, Sharma A, Vijayalakshmi K, Alladi PA, Raju TR. Primary cultures and cell lines. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 41-47. 56. Madhusudana SN, Mani RS. Laboratory diagnosis of rabies in animals-an update In: Advanced diagnostic techniques in small ruminant diseases. Maharashtra Animal & Fishery Sciences University, Nagpur, Maharashtra, 2014. Mishra PS, Dhull DK, Yarreiphang H, Vidyadhara DJ, Vijalakshmi K, Alladi PA, Raju TR. Confocal laser scanning microscopy. Parkinson’s disease education programme. A handbook. Department of Neurophysiology, Bangalore, NIMHANS, 2014, 57. Mitra R, Gope ML, Gope R. Personalized genome, current status and the future of pharmacogenomics, In: Debmalya Barh, Dipali Dhawan, Nirmal Kumar Ganguly 47. 48. 49. Mahati K, Bhagya V, Raju TR, Rao BSS. Spectrophotometric National Institute of Mental Health and Neuro Sciences / 229 Annual Report 2013-14 (eds), Omics for personalized medicine; Springer, New York, USA, Chapter 2, 2013. p19-p37. physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p162-p164. 58. Murthy P, Prabhu L, Dhanasekarapandian R. Community interventions for substance use disorders. In: Community psychiatry in India, Publication Committee, Indian Psychiatric Society, Mega Mind Publication Pvt. Ltd, Ranchi, Jharkhand, 2013. p36-p49. 68. Nesin Mathew, Raju TR, Laxmi TR. Rotarod: Motor behavioral testing. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 165-166. 59. Murthy P. Contributor, SOLVE: Integrating Health Promotion into Work place OSH Policies: Participant’s Workbook / International Labour Office. - Geneva: ILO, 2012. 69. Netravathi M. Approach to CNS viral infections for the 6th edition of Prof KVKS text book of medicine for MD students 70. Netravathi M. Ataxia, API textbook of Medicine 2014. 60. Murthy P. Substance use among women in sex work. In: a manual for counselling women in sex work, 183200. Tata Institute of Social Sciences. A Publication of: Saksham – The global fund to fight AIDS, Tuberculosis and Malaria, Round -7 (GFATMr-7). 71. Pal PK, Netravathi M. Parkinson plus syndrome. In: Gupta SB (ed.). Postgraduate Medicine. APICON, 2014. p335-p346. 72. Pal PK, Robert Chen. Breathing and the nervous system. In: Aminoff (ed). Neurology and general medicine, 5th ed. Elsevier Publication. 2014. p1-p23. 73. Raju TR, Vijayalakshmi K, Phalguni Anand Alladi. Cellular models of neurological disorders. In: ShankaranarayanaRao BS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds). Current physiological techniques: from basic to applied aspects, Bangalore, NIMHANS, 3-5. 74. Ramachandra. Aggressive behaviour and its management. In: Gandhi S, Lalitha K, Ramachandra, Nattala P, Sivakumar T (eds). Psychiatric emergencies and its management. Bangalore, 2014; 12-15. 75. Ramachandra. Ethical Dilemma. In: Jayanthi KN, Nagarajaiah. (Eds). Ethical and legal guidelines for nursing practice. Bangalore, 2013; 17-20. 76. Rao BM, Arivazhagan A, Sinha S, Satishchandra P. Future directions in epilepsy surgery. In: Singh VP, Nair M (eds), Progress in clinical neurosciences. (Neurological Society of India), 2013. p 133-145. 77. Rao BSS, Raju TR. The ever changing brain: A tool to treat psychiatric and neurological disorders. In: ShankaranarayanaRao BS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 6-23. 78. Rao BSS. (i) New neurons in the old brains: Implications for treating neurological and psychiatric disorders. In: 61. Nagappa M, Sinha S. Autoimmune encephalopathy: Need to be considered more often in today’s practice! In: Singhal BS (eds). Clinical handbook on Complicated cases in Epilepsy. 62. Nagappa M, Sinha S. Seizures as a complication of systemic disease. Reviews in Neurology. 63. Nagarajaiah. Ethical and legal concepts relevant to nursing. In: Jayanthi KN, Nagarajaiah. (eds). Ethical and legal guidelines for nursing practice. Bangalore, 2013. p1-p10. 64. 65. Nagaveni, Janardhana N. Directory of mental health services in Karnataka’. In: Md. Ameer Hamza, Jagadisha T (eds). Directory of mental health care centers in South India, NIMHANS. Nair AK, Sasidharan A, Maruthai N, Kakumanu J, Sathiamma S, Kutty BM. Event related potentials: A practical overview. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: From basic to applied aspects, Bangalore, NIMHANS, p197-p201. 66. Nattala P. Substance intoxication and withdrawal and its management. In: Gandhi S, Lalitha K, Ramachandra, Nattala P, Sivakumar T (eds) Psychiatric emergencies and its management. Bangalore. 2014. p24-p27. 67. Nesin Mathew, Laxmi TR. Reach to grasp task: A model of skilled movement test. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.), Current 230 / National Institute of Mental Health and Neuro Sciences Annual Report Proceedings of the 59th National conference of assocation of physiologists and pharmacologists of India. “Decades of research in physiology and pharmacology: Reminders to remember and focus. 28-30 November 2013. NIMHANS, Bangalore, 27-46 (ii) The Golgi impregnation techniques. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.) Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 80-86 (iii)Histological techniques to stain neurons and fiber tracts. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.),Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013. p73-79. 79. Ravi Yadav, Pramod Kumar Pal, Psychosis in Parkinson’s disease. In: Ashok Kumar (ed.), Textbook of Movement Disorders: 1st ed. Jaypee Brothers Medical Publishers (P) Ltd, New Delhi. 2014; 76-83. 80. Sabitha KR, Laxmi TR. Microdialysis: An advanced technique to quantify endogenous biomolecules in brain. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds) Current physiological techniques: from basic to applied aspects, Bangalore, NIMHANS, 121-122. 81. Sabitha KR, Raju TR, Laxmi TR. Microelectrode array: a new valuable tool for electrophysiological measurements for pharmacological applications. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 172-174. 2013-14 Postgraduate medicine-advances in clinical medicine including prevention. The Association of Physicians of India, 2013.p 371-382. 86. Satishchandra P, Shankar SK, Mahadevan A. Cretzfeldt Jakob disease. In: Tripathi M (ed). Dementia decoded. Kontentworx, New Delhi, 2014. p235-254. 87. Shah A, Isaac R. Couple relationship and sexuality. In: Kar N (ed.). Comprehensive textbook of sexual medicine. 2nd ed. New Delhi. Jaypee Brothers, 2013. p103-110. 88. Sheeba Sara Daniel, Gandhi S, Samanta R, Jose D, Kannan K. Nursing management of delirium, catatonia and specific drug toxicity. In: Gandhi S, Lalitha K, Ramachandra, Nattala P, Sivakumar T (eds). Psychiatric emergencies and its management. Bangalore, NIMHANS, 2014. p46-56. 89. Shruthi S, Sumitha R, Sathyaprabha TN, Gayathri N, Alladi PA, Raju TR. Skeletal muscle patho-physiology in amyotrophic lateral sclerosis. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 58-61. 90. Sivakumar T, Chaturvedi SK. Mental health in India, In: Dinesh Bhugra, Samson Tse, Roger Ng, Nori Takei (eds) Routledge Handbook of Psychiatry in Asia. Taylor & Francis/Routledge, UK, 2014. 91. Sriranjini S Jaideep, Adoor M, Raju TR,Sathyaprabha TN. Analysis of blood pressure – blood pressure variability and baroreflex sensitivity. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (Eds.). Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 217-220. 92. Sriranjini S Jaideep, Kumarasamy D, Rukmani MR, Raju TR, Sathyaprabha TN. Assessment of heart rate variability. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current physiological techniques : From basic to applied aspects, Bangalore, NIMHANS, 213-216. 82. Saraf G, Chaturvedi SK. Psychiatry in oncology. In: Vyas JN (ed.) Postgraduate Textbook of Psychiatry, New Delhi, Jaypee Publishers, 2014. 83. Sasidharan A, Nair AK, Maruthai N, Kakumanu J, Sathiamma S. Human electroencephalography: A practical overview. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds). Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, p187-191. 84. Sathyaprabha TN, Kaviraja Udupa, Raju TR. Autonomic functions in Parkinson’s disease and other movement disorders, text book of movement disorder. Jaypee Publisher. 2013. p199-208. 93. Subasree R, Pal PK. Progressive dementia syndrome: Dementia with Lewy bodies. In: Tripathi M (ed.). Dementia Decoded, Kontentworx Publisher, New Delhi. 2014. p163-185. 85. Satischandra P, Nagappa M. Approach to Initiation and withdrawal of AEDs in epilepsy. In: ManotoshPanja (ed.). 94. Sudhir PM, Taksal A. Coping with stress. In: Pandey S. (ed). Stress and Work: The 21st Century Perspective. New Delhi, Sage Publications, 2013. p211-238. National Institute of Mental Health and Neuro Sciences / 231 Annual Report 2013-14 95. Suman LN. Ethical issues in forensic psychology. In: Nagle YK, Srivastava K, Gupta A (eds). Handbook of forensic psychology. Author house: A penguin random house company, Bloomington, IN, USA. 2014. p364-393. 96. Sumitha R, Shruthi S, Alladi PA, Sathyaprabha TN, Raju TR. Quantitative real time PCR. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, p53-57. 105. Venkatachalam P, Waghmare A, Desai G. International perspective on rehabilitation. In: Nirmala BP (ed.). Handbook of Psychiatric Rehabilitation Services. Bangalore, NIMHANS, 2014. p17-22. 97. Sumitha R, Vijayalakshmi K, Alladi PA, Sathyaprabha TN, Raju TR. Stem cells in neurodegenerative diseases. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.), Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, p48-52. 106. Vidyadhara DJ, Abhilash PL, Yarreiphang H, Vijayalakshmi K, Raju TR, Alladi PA. Immunohistochemical staining: principles and practice. In: Parkinson’s disease education programme. A handbook. Department of Neurophysiology, Bangalore, NIMHANS 2014. 98. Sydney M, Desai G, Chaturvedi SK. Mental Health in India II, In: Dinesh Bhugra, Samson Tse, Roger Ng, Nori Takei (eds) Routledge Handbook of Psychiatry in Asia. UK, Taylor & Francis/Routledge, 2014. 107. Vini V, Indramma V,Vranda MN. Life education for adolescents living in save our soul (sos) village. In: Elango P, Francis AP, Harries N(eds) Best practices and innovations in social work education and training, Bangalore. Nirupta Print Solutions. 73-82. 99. Taksal A, Khanam F, Bhola P. Social skills: assessment in recovery oriented services. In: Nirmala BP (ed.). Handbook of psychiatric rehabilitation services. Bangalore, NIMHANS, 2014. p137-146. 100. Thirthalli J, Kar N. Sexuality and psychopathology. In: Kar N, Kar GC (eds.). Comprehensive textbook of sexual medicine. 2nd ed. New Delhi, Jaypee Brothers Medical Publishers (P) Ltd., 2014. p579–589. 101. Titus DJ, Rao BSS, Srikumar BN. Evaluation of learning and memory in rodents. In: Jibu Thomas, RT, Narendhirakannan, MSA Muthukumar Nadar (eds.). Experimental animals ethical guidelines and bioefficacy studies for biotechnological applications. Coimbatore, Iris Publishers. 2014. p72-90. 104. Veena J, Raju TR, Rao BSS. Neurogenesis: Proliferation, survival and differentiation of new cells in the adult brain. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds). Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 2013. p100-108. 108. Vishwanatha K, Hirisave U. Silent voices: narratives in child mental health. In: Mishra A, Chatterjee SC (eds). Multiple voices and stories: Narratives of health and illness. Orient black swan, 2013. p318 -326. 109. Vrinda M, Arun S, Kutty BM, Rao BSS. Electroencephalographic characterization of epilepsy in rodents. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current physiological techniques: from basic to applied aspects. Bangalore, NIMHANS, 2013; 181-186. 110. Waghmare A, Thirthalli J. Psycho-education and educational material on selected psychiatric illnesses. In: Nirmala BP (ed.). Handbook of Psychiatric Rehabilitation Services. Bangalore , NIMHANS, 2014. p34-70. 102. Tripathi SJ, Raju TR, Rao BSS. Assessment of higher cognitive functions in rodents. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR (eds.). Current Physiological Techniques: From basic to applied aspects. Bangalore, NIMHANS, 2013. p 44-148 111. Yadav R, Pal PK. Psychosis in Parkinson’s disease. In: Ashok Singh (ed). Movement Disorders. 1st ed. New Delhi. Jaypee Brothers Medical Publishers (P) Ltd, 2013. p76-83. 103. Varghese AM, Sharma A, Alladi PA, Bharath SMM, Raju TR. Proteomics. In: Rao BSS, Sathyaprabha TN, Laxmi TR, Kutty BM,Raju TR (eds), Current physiological techniques: From basic to applied aspects. Bangalore, NIMHANS, 2013. p7-92. 112. Yarreiphang H, Vidyadhara DJ, Raju TR, Phalguni Anand Alladi. Stereological analysis for quantification of neuronal numbers in brain tissues. In: Parkinson’s disease Education Programme. A handbook. Department of Neurophysiology, Bangalore, NIMHANS 2014. 232 / National Institute of Mental Health and Neuro Sciences Annual Report D. MONOGRAPHS-MANUALS-REPORTS 1. 2. Amudhan RS, Girish N, Gururaj G. Developing a district roadmap for integrated child mental health services. Centre for Public Health, NIMHANS, Bangalore, 2014. Amudhan RS, Rajkumar N, Girish N, Gururaj G. Strengthening health management information system, for mental, neurological and substance use disorders in Kolar, Karnataka. Centre for Public Health, NIMHANS, Bangalore. 2013. 3. Bharath S, Kumar K, Vijayasagar J, Mehrothra S. Empowering adolescents using life skills for psychosocial competence: Life skills facilitators’ Guide. 2014. 4. Bharath S, Kumar K. Empowering adolescents using life Skills for psychosocial competence: Life skills educators’ activity manual level I, II, III (NIMHANS Publication). 2014. 5. Chandra P, Jangam K. Enhancing the power within facilitator’s guide: Training counsellors to manage the mental health impact of violence among women in sex work. KHPT, Bangalore. 6. Chandra SR. Invited author to write on autonomic functions in Myasthenia Gravis, author no. CroIn 139934. 7. Gandhi S, Lalitha K, Ramachandra, Nattala P, Sivakumar T. (i) Psychiatric emergencies and its management, Department of Nursing, NIMHANS, Bangalore. February 2014 (ii) Manual on psychiatric emergencies and its management. Copyright–Department of Nursing, NIMHANS. February 2014. 8. Gangadhar BN, Sundar AS, Thirthalli J, Varambally S, Muralidharan K, Kumar CN, Sinha P, Viswanath B. ECT administration manual (2nd ed.). NIMHANS publication, Bangalore, December 2013. 9. Gautham MS, Kupatira K, Gururaj G. Integration of mental health screening in annual medical examination of employees: An exploratory initiative. Report prepared for Toyota-Kirloskar Motor Private Limited, Bidadi, January 2014. 10. Gautham MS, Rajkumar N, Girish N, Gururaj G. Report of activity, Resources for mental health care in Kolar district. Report prepared for NIMHANS, Bangalore. January 2014. 2013-14 11. Gayathri N, Sagar BKC, Bharath MMS, Mythri R. Manual of 2nd Annual hands-on workshop in Neurochemistry and Electron Microscopy, NIMHANS, July 2013. 12. Girish N, Rajkumar N, Sunitha S, Gururaj G. District mental health care/ system assessment: Kolar-Karnataka. Centre for Public Health, NIMHANS, Bangalore. 2013 13. Gupta V, Gururaj G. Strengthening mental health education and promotion in Kolar: The way forward. Centre for Public Health, NIMHANS, Bangalore, 2013. 14. Gururaj G, Girish N, Ramasubramaniam C R, Mathew V, Sunitha S. District mental health care/ system assessment Tamil Nadu. NIMHANS, Bangalore, 2014. 15. Gururaj G, Rao GN, Pradeep BS, Gautham MS, Gupta V, Amudhan S, Singh S. Maters in public health – Students manual. Centre for Public Health, NIMHANS, Bangalore, 2013. 16. Gururaj G. World Health Organization best practice manual. Strengthening road safety legislation: A practice and resource manual for countries, August 2013, Geneva. 17. Hamza A, Parthasarathy R, Janardhana N, Reddy D, Mishra S. Training manual on adolescent sexuality reproductive health and gender equality to capacitate social work trainees in India, NIMHANS Publication, Bangalore, 2014. 18. Jayanthi KN, Nagarajaiah. Ethical and legal guidelines for nursing practice, Department of Nursing, NIMHANS, November 2013. 19. Kuriakose A, Gandhi S, Lavanya D, Priya JAD, Keerthini J, Arpitha Elizabeth Jolly, Rebecca K, Lija KL. Nursing management of patients with suicide tendency. In: Gandhi S, Lalitha K, Ramachandra, Nattal P, Sivakumar T (eds), Monograph of the Workshop on ‘Psychiatric Emergencies and its Management. Bangalore, 2014; 33-40. 20. Nattala P, Murthy P, Nagarajaiah. Relapse prevention in alcohol dependence. My work book. NIMHANS, 2013, Bangalore. 21. Nattala P, Murthy P, Nagarajaiah. Relapse prevention in alcohol dependence: A family-based approach - treatment provider’s manual. Helping persons with addiction Manual Series 3. Bangalore: Center for Addiction Medicine, NIMHANS, Publication 2013, No. 87, ISBN 8186436-00-X. National Institute of Mental Health and Neuro Sciences / 233 Annual Report 22. 23. 24. 2013-14 Rakesh G, Shivakumar V, Subramaniam A, Nawani H, Amaresha AC, Narayanaswamy JC, et al. Monotherapy with tDCS for Schizophrenia: A Case Report. Brain stimulation: Basic, translational, and clinical research in neuromodulation. 2013; 6: 708-709. Sagar BKC, Ravindrakumar M Thakkar, Gayathri N. An Introduction to Electron Microscopy, Department of Neuropathology, NIMHANS, Bangalore, 2014. Sebastian J, Hamza A, Chandra SR. Effective care giving in Dementia (A learning module for caregivers), NIMHANS Publication, Bangalore, 2013. E. NEWS LETTERS-SOUVENIRS 1. Bindu PS. Clinical clues to the diagnosis of leukodystrophies and neurometabolic disorders. Sovenir, ISNR-2013, 16th Annual Conference of Indian Society of Neuroradiology Bangalore, 27 September 2013. 2. Dhanasekarapandian, R, Antony S. Psychosocial interventions for addiction disorders. CARE foundation Souvenir - 2014. 3. Gupta A. Infantile spastic hemiparesis-A case scenario, article in Novartis monthly newsletter, December 2013. 4. Lalitha K. (i) (a) Overview of nursing theories, 12 July 2013, 7-11 (b) Application of theories in psychiatric nursing practice 12 July 2013, 47-56. Souvenirs, RVS College of Nursing, Coimbatore. Sponsored by ICMR, New Delhi & Co-sponsored by Tamil Nadu MGR Medical University, Chennai, (ii) Recent trends in nursing research for advanced nursing practice – A global challenge. Souvenir, 1st International Conference, PIMS, Puducherry, 26 July 2013 (iii) Nursing informatics is a new direction in nursing. Souvenir, 25th National Conference of the student nurses association of India and trained nurses association of India, TNAI Gujarat TNAI Branch, Surat. 2013; 46-48 (iv) Policies and programmes for senior citizens. Souvenir, Wake up calls – mental health & older persons. National Conference, Dhanalakshmi Srinivasan College of Nursing, Perambalur, Tamil Nadu, 12 October 2013 (v) Value based education in shaping future nurses – A basic intervention for behavioural crisis. Souvenir, 1st International Conference, Metamorphosis of nursing education confronting current health needs – a time to recuperate, Kasturba Gandhi Nursing College, Sri Balaji Vidyapeeth Mahatma Gandhi Medical College & Research Institute, Puducherry. 20-21 November 2013. 25. Sekar K. (i) Psychosocial care for children in difficult circumstances – Facilitator manual. 26. Sekar K, Kavitha P, Joseph SJ, Kumar MS. Psychosocial care for children in difficult circumstances – facilitator manual. NIMHANS Bangalore. 27. Sekar K. (i) (a) Life skills education for children in difficult circumstances. (b) Student enrichment program. (c) Enriching family life. 28. Sekar K. Enriching psychosocial competencies among children through NGOs in South India – Half yearly report for the period April 2013 to September 2013. 29. Sekar K. Kit material-Kit on student enrichment program. 30. Shankar SK, Mahadevan A, Parmar SK. Histological atlas of common infections of the nervous system with teaching slides. Department of Neuropathology, NIMHANS, Bangaluru, 28 March 2014. 31. Thomas A, Gandhi S, Usha SN, Rajitha P, Mrudula G. Nursing management of substance intoxication and withdrawal. In: Gandhi S, Lalitha K, Ramachandra, Prasanthi Nattala, Sivakumar T (eds). Psychiatric emergencies and its management. Monograph of the workshop on psychiatric emergencies and its management. Bangalore, NIMHANS, 2014; 57-62 5. Laxmi TR. Decades of research in physiology and pharmacology: reminders to remember and focus. Souvenir Chapter. 59th Annual National conference of the association of physiologists and pharmacologists of India. 28-30 November 2013 NIMHANS, Bangalore. Valliammal S, Poornima HN. Manual on Immediate New Born Care. NIMHANS College of Nursing Publications, Bangalore, July 2013. 6. Mrunal B, Ashok M. Does India need research in field of post traumatic brain injury addiction? Indian J Neurotrauma. 2013; 10: 139-140. 32. 234 / National Institute of Mental Health and Neuro Sciences Annual Report 7. 8. 9. Nagarajaiah. Recent advances in somatoform disorders. Souvenir. Annual National Conference of Indian Society of psychiatric nurses. Westfort College of Nursing, Thrissur, Kerala, March, 2013; 47-48. Rathnamma. What it means to care? Times of India (Bangalore edition), about Psychiatric rehabilitation services, Page 5, 21 December 2013. Sanjeev Jain, Pratima Murthy, Department of Psychiatry, NIMHANS. Integrated approaches to understanding to the brain and mind: a long tradition at NIMHANS. In APPICON 2013 souvenir. 10. Sivakumar T. Ethical and legal issues in emergency psychiatry. Souvenir, Psychiatric emergencies and its management. Department of nursing, NIMHANS (Funded by Dr. Ramachandra N Moorthy Foundation for Mental Health & Neurosciences). 11. Sundar Periyavan (i) Utilization of Rh negative Groups blood, Sankalp patrika, 2013; 3: 5 (ii) Can one donate blood with diabetes, cholesterol, controlled blood pressure and after cured tuberculosis? Sankalp patrika, 2013; 15. F. ARTICLES FOR GENERAL PUBLIC/IEC MATERIALS 2013-14 for the study of social exclusion and inclusive policy, University of Mysore, 2013. 7. Rajeswaran J, Sadana D. Week Magazine. Health supplement. Room with a brilliant View. November 2013. 8. Janardhanan CN. Crippling anxiety disorders on the rise. The New Indian Express, 26 February 2014. 9. Jayaram M. Article on stuttering in Vijaya Karnataka. Public. October 2013. 10. Sagar KJV. How to talk to children about rape- wall street journal. (ii) Student suicides steadily rising in city, Deccan Herald- 30 April 2013 (iii) Some can’t help it – The Hindu,28 May 2013 (iv) Gadgets for kids: Yes or no? Citizen Matters, 28 August 2013. (v) Raising a geniusBusiness Standard, 13 September 2013.(vi) The other side of sexual abuse: More boys victims. The New Indian Express, 12 October 2013. (vii) Special children too often malnourished – The New Indian Express, 10 January 2014 (viii) Van driver nabbed for rape bid on Toddler – Times of India, 10 January 2014. (ix) 2-year post-natal leave for autistic kids’ mothers –Bangalore Mirror, 17 January 2014 (x) Social media abetting cyber bullying: Doctors – DNA, 19 January 2014. 11. Setty K. Interview Internet addiction (whats app), Vijaya Karnataka, 9 February, 2014 (ii) Post partum disorders, Vijaya Karnataka, 20 February, 2014 (iii) Interview on sexual problems in couples, Vijaya Karnataka, 26 February, 2014. 1. Chand P, Murthy P. Why and how I quit tobacco. World No Tobacco Day, May 2013. 2. Chandra PS. MOGGU Leaflets - Mental health of girls growing up. Simple tips about handling emotions for young women. 12. Keshav Kumar J. Shaped by previous experiences. The Choice is yours, Really? Health supplement. 4th Week February. 3. Chandra PS. A short film on handling emotions effectivelya film for young women from low income settings. 13. 4. Chandra, PS, Satyanarayana V. Let the flower buds blossom- stories on well being for young women. DHR funded MOGGU Project Manjula M, Singhal M, Herbert HS. An information leaflet on dealing with academic stress (ii) An information leaflet on Peer relationships: why do we need friendships, NIMHANS Centre for Well Being, Bangalore. 14. Manjula M. Social media changing relationships: Expert. Deccan Herald, 7 November 2013. 15. Mehrotra S, Micahel RJ, Elias JK. (i) Youth pro tool kit: A compendium of activities and resource materials to be used by youth pro volunteers for conducting mental health promotion activities in the community. (ii) Motivational video on youth engagement. 5. 6. Girimaji SC. Contributed to the creation of resource materials for parents and professionals for the website devised by National Trust, Ministry of Social Justice and Empowerment, Govt of india . Gupta V, Rao GN. Public health in India: looking back to move forward. New Public Health Issues in India. Centre National Institute of Mental Health and Neuro Sciences / 235 Annual Report 16. 17. 2013-14 Mehrotra S. (i) Scripts for street plays on issues related to mental health for use in community programs, created by youth pro members.(ii) A short video clip on community engagement for persons with mental health issues created by the ‘On Fire creative group’ of youth volunteers (as part of youth pro activities). Michael RJ, Banu H, Merotra S. Video clips on promoting safe riding behaviors in youth. 18. Mrunal B, Ashok M. Does India need research in field of post traumatic brain injury addiction? Indian J Neurotrauma. 2013; 10: 139-140. 19. Nagarathna S. Hand hygiene and practices – Global Hand Washing Day, 15 October 2013. (ii) Bangalore public awareness programme and public education. 20. 21. 22. NIMHANS Centre for Well Being (NCWB), in coordination with the consultants who visited the centre developed Information Education Communication (IEC) leaflets in English on – Supporting our loved ones: What works, Enabling resilience, Learning how to relax, How to get good sleep, Effective parenting, Enhance your study skills, Managing your anger, Cell phone overuse and addiction, Dhat syndrome, Somatoform Disorder, Bipolar affective disorder, Social phobia, Panic disorder, Stress and coping, NCWB services. Padmavathy D. NCWB developed Information education communication leaflets in Kannada on: Managing your anger, Mental retardation, Harmful drinking and Alcohol Addiction, Stress and coping, Marital Enrichment services, How to get good sleep, Social phobia, Somatoform disorder, Effective parenting, Cell phone overuse and addiction, NCWB services. Physiotherapy Section: Posters for general public & visitors’ education purpose:Poster on core muscle strengthening exercise and supportive pamphlets of the same, coordination and balance exercises, gait and pathological gait and supportive pamphlets, respiratory management, Outcome measures booklet (scales reliability and validity), Treatment videos and articles, biomechanics of lumbar spine. Occupational therapy section: Poster on introduction to Occupational therapy, occupational therapy in geriatrics with physical deficits, occupational therapy in geriatrics with cognitive deficits, for single handed activities, ergonomics, therapeutic activities. 23. Nattala P, Murthy P, Ramakrishna J, Rentala S. New horizons: A short film on the journey of recovery after quitting alcohol (Funded by a NIMHANS research grant awarded to PrasanthiNattala). 24. Murthy P. Tobacco Control.Press meet organised by Institute of Public Health. Press. Print media. 6 June 2013 25. Gandhi S. Prepared video assisted teaching module on Specific psychiatric emergencies and their management, which can be used as a teaching aid for nursing students, newly recruited nurses and for caregivers of patients with mental illness. 26. Sekar K, Parthasaraty R, Kavitha P, Jospeh SJ. Student enrichment program-flip chart. NIMHANS, Bangalore (ii) Student enrichment program. Brochure in English, Kannada, Tamil. NIMHANS Bangalore. 2013. (iii) Enriching family life. Brochure in English, Kannada and Tamil. NIMHANS, Bangalore. 2013. 27. Shekhar S, Sowmya B, Arun V. The impatient ones, Viewpoint October 2013. 28. Shekhar S, Sowmya B. Enabling safety and freedom from abuse within the school. Learning curve, December 2013. 29. Shah A. Divorce rates in India. Indian Express, 19 July 2013.(ii) Women’s mental health. New Indian Express section on Ten Commandments in Women’s Health, 25 January 2014. 30. Shankar SK, Anita Mahadevan. Why Brain Banking? Silver jubilee function of Healthy heart association. 31. Rao BSS. Novel therapies to cure mental disorders are on the anvil. The Hans India. 19 December 2013. 32. Seshadri S, Ray A. (i) School bullying’ in newsletter of Amnesty International – December 2013. (ii) Positive mental health in children & adolescent’ Richmond fellowship society India. 23 February 2014. 33. Sivakumar T, Udgiri S, Chethan B, Devvarta K, Gandhi S, Kumar CN, Nirmala BP, Bhola P, Desai G, Thirthalli J, Chaturvedi SK. Welfare benefits for persons with psychiatric disability (English, Kannada and Hindi versions). Psychiatric Rehabilitation services, Department of Psychiatry, NIMHANS, Bangalore. (Funded by Dr Ramachandra N Moorthy Foundation for mental hesalth & neurosciences). 236 / National Institute of Mental Health and Neuro Sciences Annual Report 34. 35. Sivakumar T, Waghmare A, Chinnayya HP, Devvarta K, Gandhi S, Kumar CN, Nirmala BP, Bhola P, Desai G, Thirthalli J, Chaturvedi SK. (i) An information leaflet on FAQ’s in Psychiatric rehabilitation (English, Kannada and Hindi versions). (ii) Recovery oriented services. Psychiatric Rehabilitation services, Department of Psychiatry, NIMHANS, Bangalore. (Funded by Dr Ramachandra N Moorthy Foundation for mental hesalth & neurosciences). 9. Sailaxmi Gandhi, Lalitha K, Ramachandra, Prasanthi Nattala, Sivakumar T. Booklet, Psychiatric emergencies and its management, funded by Dr. Ramachandra N Moorthy Foundation for mental health and neurological sciences. 10. Setty VK, Shirlal S, Manasika kayilegalige vivida chikitsegalu in Kannada, Private publisher, Bangalore, 2013. 11. Shankaranarayana Rao BS, Sathyaprabha TN, Laxmi TR, Kutty BM, Raju TR. Current physiological techniques: from basic to applied aspects. NIMHANS, Bangalore, 2013. 12. Sheela Kumari R, Tinu Varghese, Kesavadas C, Albert Singh N, Mathuranath PS. A genetic algorithm optimized artificial neural network for segmentation of MR Images in FTD. Panigrahi BK et al. (Eds.): SEMCCO 2013, Part II, Lecture Notes on computer sciences, 8298, Springer International publishing Switzerland 2013; 268–276. 13. Sheela Kumari, Tinu Varghese, Kesavadas C, Albert Singh N, Mathuranath PS. Longitudinal evaluation of structural changes in frontotemporal dementia using artificial neural networks. In Satapathy SC, Udgata SK, Biswal BN (Eds.), FICTA 2013, Advances in intelligent systems and computing, 247, Springer international publishing Switzerland 2014: 165-172. 14. Subrath Mishra, Janardhana N, Saraswathy. Gender perception of families and communities in community mental health and development program (A BNI-NBJK study report of Loherdaga District of Jharkhand and Gaya District of Bihar). Gender and Mental Health, BNI publication. 15. Thomas PT, Rajaram P. MDA India. Psychosocial aspects of DMD. In: Standard of care in Duchenne Muscular Dystrophy. 2014 Available at URL: http://www.mdindia. org/index.php 16. Tinu Verghese, Sheela Kumari, Mathuranath PS, Albert Singh. Performance evaluation of bacterial foraging optimization algorithm for the early diagnosis and tracking of Alzheimer’s disease. In Panigrahi BK et al. (Eds.): SEMCCO 2012, Lecture notes in computer science 7677, Springer, Heidelberg 2012: 41-48. Thomas PT. ‘Ankuttikalude Rogham’ (Malayalam) Article on DMD Manorama Arogyam March 2014. G. BOOKS PUBLISHED 1. Andrade C. Critical readings in psychiatry, No. 7. Ahmedabad: Zydus Neurosciences, 2013. 2. Hamza A, Thirthalli J, Directory of mental health care centers in south India. NIMHANS Publication, Bangalore, 2013. 3. Jayanthi KN, Nagarajaiah. Booklet, Ethical and legal guidelines for nursing practice, funded by Dr. Ramachandra N Moorthy foundation for mental health and neurological sciences. 4. Jimmy Sebastian, Amir Hamsa M, Chandra SR. Effective care giving in dementia – A learning module for caregivers. 5. Kameshwar Prasad, Ravi Yadav. Bickerstaff’s neurological examination in clinical practice. 7th adapted edition, Wiley India Pvt. Ltd., New Delhi. 6. Lalitha. Mental health and psychiatric nursing: New Vision, Pub. By VMG Book House, Bangalore, 2013. 7. Nirmala BP. (i) Rehabilitation hand book, Nirmala (Eds), NIMHANS Publication, 2014. (ii) Handbook of Psychiatric rehabilitation services. NIMHANS Publication, India, 2013. 8. Prabha S. Chandra, Veena Satyanarayana. Let the flower buds blossom: stories on wellbeing for young women. NIMHANS Publication, Bangalore, 2014. (ii) Moggina manassu aralali. Hadihareyada hennumakkalu susthithiyalliralu kathegalu. NIMHANS Publication, Bangalore, 2014. 2013-14 National Institute of Mental Health and Neuro Sciences / 237 Photo Courtesy: Jasmin Maitreya Annual Report Contributions to Scientific Deliberations Meeting hosted by the society for Neuro Oncology, San Francisco, California, USA,21-24 November 2013. A. PRESENTATIONS IN INTERNATIONAL CONFERENCES 1. Abhishekh HA, Mehta UM, Thennarasu K, Thirthalli J. Cortical excitability in schizophrenia: a meta-analysis of transcranial magnetic stimulation studies. International congress on schizophrenia research. Florida, USA. 21-25 April 2013. 2. Alladi Phalguni Anand, Anita Mahadevan, Shankar SK, Raju TR. Expression of synaptic proteins in normally aging human substantia nigra pars compacta. 17th International Congress of Parkinson’s Disease and Movement Disorders. Sydney, Australia, 17-20 June 2013. 3. 4. 5. 6. 7. Andrade C, Chethan KB, Surya S, Nagesh KS, Hegde RP, Chandra JS. Stimulus variables as risk factors in spinal fracture with ECT: Clues from an animal model. Neuroscience CME, 6th Annual Chair Summit, Tampa, FL. 26-28 September 2013. Anil R. (i) Muscle magnetic resonance imaging (MRI) in patients with LGMD 2I confirm by immunohistochemistry and/or immunoblotting. (ii) Magnetic resonance imaging findings in immunohistochemically confirmed sarcoglycanopathies. 21st World Congress of Neurology, Vienna, Austria, 16-23 September 2013. Anilkumar Sivan, Ravi Yadav, Pramod Kumar Pal. (i) Comparison between early and late onset Parkinson’s disease: a profile of 1000 patients from India. (ii) Impulse control disorders in Parkinson’s disease: a case-control study. 20th World Congress on Parkinson’s Disease and Related Disorders. Geneva, Switzerland, 8-11 December 2013. Anisha Mary Abraham, Sudhir PM, Bantwal G. Barriers to self-care, illness perceptions and their relationship with self care, metabolic control and quality of life. 21st European Congress of Psychiatry, Nice, France, 6-10 April 2013. Arun Shastry, Sarwat Naz, Balaram Thota, Kandavel Thennarasu, Arimappamagan Arivazhagan, Sampath Somanna, Vani Santosh, Paturu Kondaiah. Therapy resistance and survival in glioblastoma – the role of STAT1.World Federation of Neuro Oncology. 4th Quadrennial 2013-14 8. Ashok M, Indira Devi B, Dhaval Shukla, Subbakrishna, Neeraj U, Jamuna R. Quantitative evidence of brain volume changes during early weeks of mild head injury and its cognitive consequences: A longitudinal study. 31st Annual National Neurotrauma Symposium, Nashville, USA, August 2013. 9. Ashok M, Jamuna R, Indira DB, Niranjana B, Neeraj U. EEG Neurofeedback therapy: Can it attenuate brain changes in TBI? 11th International Neurotrauma symposium, Budapest, Hungary, March 2014. 10. Ashwathnarayana DH, Madhusudana SN, Sudarshan MK, et al. Assessing safety and immunogenicity of rabipur and verorab. Results of randomized control trial using one week intradermal regimen in post-exposure cases. Rabies in Asia Conference, Bangkok, Thailand, 11-13 September 2013. 11. Balachandar R, Tripati R, Bharath S, Sivakumar PT, Kumar K, Loganathan S, Chandra SR, Varghese M. Amnestic MCI beyond memory. 28th International Conference of Alzheimer’s Disease International, 18-20 April 2013. 12. Bharath RD, Panda R, Reddy RP, Upadhyay N, George L, Thamodharan A, Rajeshwaran J, Rao SL, Gupta A. Unraveling the brain resting state in the contexts of gender, education and profession. American society of Neuroradiology 2014 Annual Meeting, Florida. 13. Bhaskar MV, Bharath RD, Gupta AK, Pal PK, Panda R, Jhunjhunwala K. Assessment of brain plasticity induced by rTMS in patient with writer cramp using resting state connectivity. American society of Neuroradiology 2014 Annual Meeting, Florida. 14. Bindu PS, Divyaraj R, Bharath RD. Central nervous system inflammatory demyelinating disorders of childhood – a clinical, magnetic resonance imaging and follow up study. 12th Asian & Oceanian Congress of Child Neurology 2013, Saudi Arabia, 17 September 2013. 15. Bindu PS, Shah MA, Mahadevan A, Gayathri N, Yasha TC, Sinha S, Nagappa M, Bharath RD, Kumar A, Taly AB. National Institute of Mental Health and Neuro Sciences / 239 Annual Report 2013-14 PLA2G6 associated neurodegeneration: A phenotypic, electrophysiological, radiological and histopathological study from South India, Asian & Oceanian Congress of Child Neurology, Saudi Arabia, 18 September 2013. 16. Bücker J, Muralidharan K, Torres IJ, Su W, Kozicky J, Silveira LE, Bond DJ, Honer WG, Kauer-Sant’anna M, Lam RW, Yatham LN. Childhood maltreatment and corpus callosum volume in recently diagnosed patients with bipolar I disorder. 28th Annual Research Day, UBC, Vancouver BC Canada, 6 June 2013. 17. Chaitanya G. Effects of dexmedetomidine on electrocorticography for temporal lobe surgeries. 30th International Epilepsy Congress, International League against Epilepsy, Montreal, Canada, June 2013. 18. Chaitanya G, Sinha S, Reddy M, Arivazhagan A, Rao MB, Thennarasu K, Chandramouli BA, Satishchandra P. Dexmeditomedine anesthesia during intra-operative electrocorticography recording: Promising, safe and enhances spike generation. 30th IEC 2013, Montreal, Canada, 27-30 June 2013. 19. Chandrasekhar Sagar BK, Ravi P. Hegde, Chittaranjan Andrade. Ultrastructural evidence reveals synaptic modulation in the rat brain – A preliminary study. The Annual Meeting of Nordic Microscopy Society, Copenhagen, Denmark, 10-14 June 2013. 20. Chaturvedi SK, Prasad Rao G. Chronic pain and depression: an Indian experience, psychiatrica 7.0, A Mental Health Academic Endeavor, Ho Chi Minh City, Vietnam, 4-7 August 2013. 21. Cherian AV, Dhanasekarapandian R, Suresh BM, Thennarasu K, Reddy YCJ. (i) Does family accommodation predict naturalistic out- come of obsessive compulsive disorders? International Conference of the Anxiety disorder association of America, San-Diego, USA, 4-7 April 2013. (ii) Clinical predictors of family accommodation in obsessive compulsive disorders. 13th Forum on Mood and Anxiety Disorders, Monte–Carlo, Moraco, 19-22 November 2013. 22. Chetan GK, Sibin MK, Lavanya Ch, Jeru Manoj, Dhananjaya Bhat. Exonwise deletion status of tumor suppressor P16 gene in high grade glioma in the Indian Population, ESHG, Paris, 8-11 June 2013. 23. Christopher R. (i) Experience of tandem mass spectrometry in India: feasibility and concerns. 8th Asia-Pacific Regional Meeting of the International Society for Neonatal Screening Conference, New Delhi, 28 September 2013 (ii) Newborn screening by tandem mass spectrometry, Results of a pilot study. International meeting on New Research and Advances in Prenatal Diagnosis and Fetal Medicine. Centre for Human Genetics, Bangalore. 9 November 2013 (iii) Principles of mass spectrometry. Pre-Conference Workshop, The Asia-Pacific Newborn Screening Conference. Laboratory Techniques in Newborn Screening, New Delhi, 26 September 2013. 24. De T, Nagaraja D, Christopher R. (i) Pharmacogenetics of acenocoumarol in patients with cerebral venous thrombosis. Miami Winter Symposium 2014. The Molecular Basis of Brain Disorders, Miami, USA, 2629 January 2014. (IBRO International Travel Award). (ii) Influence of CYP2C9 polymorphisms on acenocoumarol dose in patients with cerebral venous thrombosis. Asia Pacific Stroke Conference- 2013, Hong Kong, 1 September 2013. 25. Dhiman V, Sinha S, Rawat VS, Harish T, Chaturvedi SK, Satishchandra P. Outcome of adults with psychogenic non-epileptic seizures and to propose a modified semiological classification. 30th IEC 2013. Montreal, Canada, 27-30 June 2013 (Best Poster Award) 26. Divya Sadana, Jamuna Rajeswaran, Sanjeev Jain, Senthil Kumaran. Unravelling creativity: an fMRI study. 9th International Conference on Cognitive Science, Kuching, Sarawak, Malaysia, 27 -30 August 2013. 27. Gautham MS, Kowshik Kupatira, Gururaj G. Feasibility of integration of mental health screening in annual medical examination of employees in a motor industry. International Conclave of Occupational Health and 64th Annual Conference of Indian Association of Occupational Health. Panaji, Goa, 10-14 February 2014. 28. Gope R. Post translational modifications of proteins and their importance in drug development with special reference to human intracranial tumors. Genomics and Proteomics Research, organized by SELECTBIO. Sheraton, Bangalore. 27-28 September, 2013. 29. Gorky Medhi, Dutta HK. Sincipital Encephalocele: A Case Series. 99th Scientific Assembly and Annual Meeting of 240 / National Institute of Mental Health and Neuro Sciences Annual Report Radiological Society of North America 2013, McCormick Place, Chicago. 1-6 December 2013. 30. 31. 32. 33. 34. Gowda G, Kumar CN, Math SB. Patient perceptions of coercion in mental hospital admission: an exploratory study. 2nd Indo-European Symposium on Coercion, Mysore Medical College and Research Institute, Mysore, 24-25 March 2014. Gupta HK. Exploration of psychological distress among care givers in ayurvedic treatment setting. Annual National Conference of Indian Psychiatric Society, Pune, 16- 19 January 2014. Guruprasad D, Bhola, P. Autobiographical memory narratives of clients with borderline personality disorder in psychotherapy. Society for Psychotherapy Research UK Conference. Oxford, UK. 12-14 September 2013. Gururaj G (i) Case studies on improving road safety in India. International Injury Research Unit, Johns Hopkins University, Baltimore, USA, 12 April 2013 (ii) Challenges and barriers for implementing drink drive legislation and enforcement: A case study from Bangalore. International Council on Alcohol, Drugs and Traffic Safety. Brisbane, Australia, 23-28 August 2013 (iii) Deaths due to drowning in India: need for prevention policies and programmes. World Congress of Drowning Prevention, Potsdam, Germany, 20-23 October 2013 (iv) Rehabilitation needs of acquired brain injury survivors: results from the traumatic brain injury registry in Bangalore. 10th World Congress of Brain Injury, San Francisco, USA, 19-22 March 2014 (v) (a) Road Traffic injury is a public health problem (b) Road safety information systems in low and middle income countries. (c) International Road Safety Course, Effectiveness of seat belts (d) Challenges in implementing drink drive laws in low and middle income countries. Delft University. Delft, Netherlands, 16-22 September 2013. Harish G, Mahadevan A, Srinivas Bharath MM, Shankar SK. Alteration in glutathione content and associated enzyme activities in the synaptic terminals but not in the non-synaptic mitochondria from the frontal cortex of Parkinson’s disease brains. 20th World Congress on Parkinson’s disease and Related disorders, Geneva, Switzerland, 8-11 December 2013. 2013-14 35. Hazra N, Mani R, Desai A, Sinha S, Netra M, Taly AB, Satishchandra P, Ravi V. SSPE and HIV: Two rare case reports. 2nd International symposium on Infectious diseases, HIV SCIENCE 2014, conducted by YRG Care, Chennai, 30 January - 01 February 2014. 36. Hazra N, Sinha S, Madhusudana SN, Ravi V. Childhood and adult onset SSPE: Tale of two clinical perspectives. VIROCON 2013, AMITY International, Noida Campus 1720 December 2013. 37. Hirisave U. Attachment issues child perspective. 7th Congress of Asian Society for Child and Adolescent Psychiatry & Allied Professions and 12th Biennial Conference of Indian Association for Child and Adolescent Mental Health, New Delhi, 27 September 2013. 38. Jacob P, Kandasamy P, Seshadri SP. Practical management of child sexual abuse in the Indian setting. 7th Congress of Asian Society for Child and Adolescent Psychiatry and Allied Professions, New Delhi, 25-28 September 2013. 39. Jagath Lal G. Endoscopic surgery for suprasellar arachnoid cyst – the lesions learned. 6th World Congress of Neuroendoscopy, Mumbai, 8-10 December 2013. 40. Janardhan Reddy (i) Antidepressants in bipolar disorder. CME by the Psychiatric Association of Nepal, Kathamnadu, Nepal 2013 (ii) Poor insight in OCD and its clinical correlates. Mood Disorders Meeting organized by the Lundbeck Pte Ltd, Seoul, South Korea. March 2014. 41. Janardhana N. Mental health care with the institutionalized children. International seminar for the SARC countries, Udayan Care, 15-16 March 2014. 42. Jeetendra Kumar Singal, Jamuna Rajeswaran, Harikrishna Maiya, Divya Sadana, Hariom Sharma. Brain electrophysiological correlates of creativity. 9th International Conference on Cognitive Science, Kuching, Sarawak, Malaysia, 27-30 August 2013. 43. Jha M, Pal PK, Saini J, Kumar K J, Yadav R, Bagepally B. Cognitive profile in patients with Parkinson’s disease with and without freezing of gait and correlation with neuroimaging. 21st Annual Conference of Indian Academy of Neurology. Indore, 24-27 October 2013 (Awarded 1st Prize in Platform Award Paper Presentation) National Institute of Mental Health and Neuro Sciences / 241 Annual Report 44. 2013-14 Joshi S, Rynjah IL, Bhutani R, Paul I, Bada Math S, Shah A. Family therapy in a case of transgender. International Conference on Family at Cross Roads: 21st century, Bombay Psychological Association, Mumbai, 1-3 December 2013. 45. Joy SP, Sinha S, Pal PK, Panda S, Philip M, Taly AB. Quality of sleep in drug naive patients with early Parkinson’s disease and effect of dopaminergic treatment: A prospective study. 17th International Congress of Parkinson’s Disease & Movement Disorders, Sydney, Australia, 16-20 June 2013. 46. Joy SP, Sinha S, Pal PK, Panda S, Philip M, Taly AB. Polysomnographic study of sleep macrostructure in drug naïve Parkinson’s disease patients with follow up after starting levodopa treatment. SLEEP 2013, Baltimore, USA, 1 -5 June 2013. 47. Kandasamy A, Aneel R, Prabu J, Poornima S, Chand P, Benegal V, Murthy P. A study on substance use disorders in physicians. Young Asian Psychiatrist Meet, Bangkok. YAP-2013. 48. Ketaki Bhalsing, Ravi Yadav, Jitender Saini, Keshav Kumar, Arun Kumar Gupta, Pramod Kumar Pal, Neeraj Upadhyay. Lateralization of structural abnormalities in right cerebellum in essential tremor: an observation from voxel based morphometry study. 17th International Congress of Parkinson’s Disease and Movement Disorders, Sydney, Australia. 16-20 June 2013. 49. Ketan J, Netravathi M, Pal PK. Post-infectious MD, WFN2013, Vienna, Austria, September 2013. 50. Ketan Jhunjhunwala, Netravathi M, Saini J, Pal PK. A clinical and imaging profile of 35 patients with movement disorders associated with infection. 21st World Congress of Neurology, Vienna, Austria, 21-26 September 2013. 51. 52. Ketan Jhunjhunwala, Prashanth DK, Pramod Kumar Pal. Alterations of cortical excitability and central motor conduction time in patients with Wilson’s disease. 17th International Congress in Movement disorders in Sydney, Australia. Kumar CN. (i) (a) Experience of treating severe mental disorders in the rural communities. (b) Alcohol use in patients with schizophrenia: comparison with that of general population. Building a Collaborative Platform and Professional Training Workshops for Community Mental Health in Developing Countries, Taipei, Taiwan, 28 October - 4 November 2013. 53. Lalitha K. (i) Cognitive rehabilitation and memory enhancement for elderly. International Conference on Active Ageing - PSG College of Nursing, Coimbatore, 22 January 2014 (ii) Sampling techniques. International Conference on Quantitative Approaches in Nursing Research, Dayananda Sagar College of Nursing, Bangalore, 27 September 2013 (iii) Value based education in shaping future nurse – A basic intervention for behavioural crisis. 1st International Conference. Theme: Metamorphosis of nursing education and practice confronting current health care needs – A time to recuperate, Kasturba Gandhi Nursing College, Puducherry, 20 November 2013 (iv) Collaboration between theory and practice. International Conference, Group Dynamics, Krishna Institute of Nursing Sciences, Nellore, Andhra Pradesh. 26 July 2013 (v) Trends in nursing research for advanced nursing practice – a global challenge. First International Conference, Epidemiological Research for Advanced Nursing Practice – A Global Health Scenario, College of Nursing, Pondicherry Institute of Medical Sciences, Pondicherry, 27 July 2013. 54. Laxmi TR, Dayalan Sampath, Preethi Hegde, Sabitha Nair. Maternal deprivation affects information processing in sleep. Gordon research conference on amygdala in health and disease, Stonehill College, Easton, MA, USA. 28 July-2 August 2013. 55. Madhusudana SN, Manjunatha MV, Reeta Mani. Dual role of immune response in rabies encephalitis. Studies in murine model and its implications in humans. Rabies in Asia Conference, Bangkok, Thailand, 11-13 September 2013. 56. Madhusudana SN. Immunopathogenesis of rabies: New insights. 3rd International World Congress of Virology, Baltimore, USA, 22-24 November 2013. 57. Mahadevan A, Maya Bhat, Satishchandra P, Madhusudana SN, Shankar SK. Neuropathological correlation of neuroimaging features in rabies. Rabies in Asia Conference 2013, Bangkok, Thailand, 11-13 September 2013. 58. Malla Bhaskara Rao. NIMHANS Epilepsy Surgery Programme. King’s College Hospital and Institute of Neurology, London, UK, 11-13 March 2014. 242 / National Institute of Mental Health and Neuro Sciences Annual Report 59. Malvika R, Desai G, Chandra PS, Thippeswamy H. Course and outcome of bipolar disorder during pregnancy- a report from perinatal psychiatry clinic in India. Perinatal Mental Health Conference, Chicago, Illinois, USA. 6-8 November 2013. 60. Manjunath M, Nalini A, Christopher R. Fatty acid oxidation disorders presenting as primary myopathy and identified by tandem mass spectrometry. 14th Asian and Oceanian Congress of Neurology, Macao, China, 2-5 March 2014. 61. Manjunath M. Tipin cap polymorphisms (TCAP) associated with LGMD 2G among Indian patients with ARLGMD. (ii) Fatty acid oxidation disorder presents as primary myopathy & identified by tandem mass spectroscopy. Asian Oceanic Congress of Neurology (AOCN) 2014, Macao, China, 2- 5 March 2014. 62. 63. 64. 65. 66. 67. Manjunatha MV, Nandita Hazra, Shaheen Taj, Sampada Sanyal, Ashwin Belludi, Reeta Mani, Madhusudhana SN. Th1 and Th2 CD4 T cell responses to rabies vaccination – A preliminary study. Rabies in Asia Conference, Bangkok, Thailand, 11-13 September 2013. Marimuthu P. Challenges in determining threshold value/s from a battery of psychological tests for the diagnosis of dementia. A joint conference of International Symposium on the Evaluation of Clinical Trials and the International Biometric Society – East Asia Regional Biometric Conference, Renmin University of China, Beijing, 5-7 July 2013. Megha Rupa. Attachment in the context of parenting. 7th Congress of Asian Society for Child and Adolescent Psychiatry and Allied Professions and 12th Biennial Conference of Indian Association for Child and Adolescent Mental Health, New Delhi, 25-28 September 2013. Muralidharan K, Silveira LE, Kozicky JM, Bucker J, Fernando N, Torres IJ, Yatham LM. Do mood stabilizers affect cognition in early bipolar I disorder? Data from the STOP-EM study. 28th Annual Research Day, UBC, Vancouver BC Canada, 6 June 2013. Muralidharan K. Practice guidelines for ECT across the world: a comparison. ECT symposium 2013, Bangalore, 7 December 2013. Mythili D. Effectiveness of concept mapping in improving nursing student knowledge and attitude related to care of 2013-14 HIV & AIDS patients. NIMRCPPSYCON Conference on Training and Learning for the 21st Century Trainers in Psychiatry, 7-8 March 2014. 68. Nandakumar DN, K Hurmath Fathima, R Palaniswamy. Interleukin-1β micro-environment promotes viability and proliferation of malignant glioma cell U87MG. 15th International Congress of Immunology-ICI, Milan, Italy, 22-27 August 2013. (International Travel Award by ICMR and DBT). 69. Narasinga Rao KVL. Correlation of angiographic anatomy with intraoperative microsurgical anatomy – Lessons learnt. NEUROVASCON Conference, 21-23 September 2013. 70. Narayanaswamy JC, Anandan S, Rakesh G, Shivakumar V, Joseph B, Kalmady S, Agarwal SM, Venkatasubramanian G. A study of emotion processing strategies in bipolar disorder: novel evidence for the endophenotype status of labeling deficit. International Conference on Bipolar Disorder (ICBD), Miami, USA, June 2013 (Won the Samuel Gershon Award). 71. Nayak C, Nagappa M, Nagaraj K, Kulkarni GB, Kandavel T, Sinha S, Taly AB. Study of sleep microstructure in patients of migraine without aura. ICCN 2014, Berlin, Germany, 20- 23 March 2013. 72. Netravathi M. Post-traumatic movement disorders, correlation of clinical phenomenology with radiological and electrophysiological characteristics, AOCN 2014, Macao, China, 2- 5 March 2014. (Second Prize – Best Paper Award) 73. Padmavathy D, Ragesh G. A brief skill-based gatekeeper training program for suicide prevention, NIMRCPSYCON 2014, Second Joint Conference of the Department of Psychiatry NIMHANS, and the Royal College of Psychiatrists, UK, 7-8 March 2014. 74. Panda R, Bharath RD, Reddy RP, Upadhyay N, Thamodharan A, Kanungo S, Rao SL, Gupta A. Brain functional connectivity of learning memory: an fMRI study. American society of Neuroradiology 2014 Annual Meeting, Florida. 75. Panda R, Bharath RD, Sandhya M, Upadhyay N, Kanungo S, Thamodharan A, Rao SL, Gupta A. Effect of rajyoga meditation: a resting state simultaneous EEG-fMRI Study. American society of Neuroradiology, Annual Meeting, Florida. National Institute of Mental Health and Neuro Sciences / 243 Annual Report 76. 77. 2013-14 Prabha S Chandra. (i) Challenges in management of somatisation in Psychiatry Practice. Ho Chi Minh City, Vietnam, 5-6 August 2013 (ii) Use of psychotropics in cancer care. International Psycho-Oncology Society Academy on Psycho-Oncology. Tata Memorial Cancer Hospital and Research Centre, 29 November - 1 December 2013 (iii) Singing lullabies inside the bell jar- motherhood and mental illness, Indo Canadian Psychiatric Association. Annual Meeting of the Canadian Psychiatric Society, Ottawa, 27 September 2013. Pramod Kumar Pal (i) Neuropsychological and imaging profile of patients with Parkinson’s disease and freezing of gait. 20th World Congress on Parkinson’s disease and Related Disorders, Geneva, Switzerland, 8-11 December 2013 (ii) Treatment of autonomic disturbances in Parkinson’s disease. 21st World Congress of Neurology. Vienna, Austria, 21-26 September 2013. 78. Pratibha S, Anilkumar Sivan, Ravi Yadav, Pramod Kumar Pal. Treatment profile of 1000 patients with Parkinson’s disease at the time of referral to a tertiary care centre in India. 20th World Congress on Parkinson’s disease and Related Disorders, Geneva, Switzerland, 8-11 December 2014. 79. Pratima Murthy (i) Challenges for tobacco cessation in India. International Conference International Medical Sciences, Academy (Karnataka State branch), Royal College of Physicians and Surgeons, Glasgow, UK, 5 October 2013 (ii) Increasing effectiveness of tobacco cessation, International Conference on End Game for Tobacco, Hriday Shan, 11 September 2013, New Delhi (iii) Substance abuse in children and adolescents: current trends. 7th Congress of the Asian Society for Child and Adolescent Psychiatry and Allied Professions and 12th Biennial Conference of the Indian Association for Child and Adolescent Mental Health, New Delhi. 27 September 2013. 80. Rajakumari K, Jamuna Rajeswaran, Neeraj Upadhyay, Silpa Kanungo. Perspective taking and emotional contagion: glass brain view of empathy. 9th International Conference on Cognitive Science, 27 - 30 August 2013, Kuching, Sarawak, Malaysia. 81. Rajalakshmi R. Psychosocial care needs of parents having children with epilepsy. International Conference on Convergence of Science, Engineering and Management in Education and Research – Global Perspectives. 26-27 September 2013. 82. Rajeswaran J. (i) Creativity and Cognition. First International Conference on Neuro-Management Indian Institute on Management Ranchi, 9-11 December 2013 (ii) Working memory and creativity – EEG Study, 9th International Conference. Kuching, Sarawak, Malaysia, 27-30 August 2013. 83. Raju TR. Neurodegeneration-Amyotrophic lateral sclerosis – does CSF hold clues? International Conference on Adult Neurogenesis: From Stem Cells to Therapies. Tata Institute of Fundamental Research, Mumbai, 6-8 February 2014. 84. Ravi V. (i) A century of rise and fall of human viral infections- Asia Pacific Congress of Virology, VIROCON 2013, Amity University, New Delhi, 16-20 December 2013 (ii) Opportunities for research at NIMHANS. Launch of the Welcome Trust Scientific Alliance of University of Glasgow - University of Liverpool-NIMHANSEucador and Malawi, Glasgow, UK. 6 December 2013 (iii) Overview of basic sciences research at NIMHANS. Annual Welcome Trust Scientific meeting of University of Liverpool-NIMHANS and Malawi, Liverpool UK. 3-7 September 2013 (iv) Viral encephalitis - An update. Annual Conference of the Sri Lanka College of Medical Microbiologists, Colombo, Sri Lanka, 22-26 July 2013. (Keynote address) (v) Viral diagnostics in India-Where do we stand. International Conference on Innovations in Biotech and Medicine, Bangalore Medical College, 21-23 October 2013. 85. Ravikumar R, Jyothi EK. Present status of laboratory diagnosis of neurotuberculosis in a developing country: a perspective from a tertiary neurocare hospital, Bangalore, South India. 53rd Interscience Conference on Antimicrobial Agents and Chemotherapy, American Society of Microbiology, Denver, Colorado, USA, 10-13 September 2013. 86. Ravindra Thakkar, Chandrasekhar Sagar BK, Hemavathy U, Ramesh G, Yasha TC, Gayathri N, Bindu PS. Epidermolysis Bullosa – A diagnostic approach by Ultrastructural studies, International Conference on Electron Microscopy and 34th Annual meeting of the Electron Microscope Society of India, Kolkata, 3-5 July 2013. 87. Ravish HS, Sudarshan MK, Madhusudana SN et al. Interchangeability of route and type/brand of rabies vaccines in post-exposure prophylaxis. Safety and immunogenicity studies. Rabies in Asia Conference 244 / National Institute of Mental Health and Neuro Sciences Annual Report Congress on Parkinson’s Disease and Related Disorders, Geneva, Switzerland, 8-11 December 2013. (RIACON 2013), Bangkok, Thailand, 11-13 September 2013. 88. 89. 90. Reddi VSK. (i) Facilitating mutual learning and professional training on mental health issues. Building the Collaborative Research Platform and Professional Training Workshop for Community Mental Health in Southeast Asia, Taipei medical university Taipei, Taiwan, 29 October 2013. (ii) Liaison mental health services at NIMHANS, Taipei City Hospital, Songde Branch, Taipei, Taiwan, 31 October 2013. Reeta Mani, Ashwin YB, Madhusudana SN. Genetic characterization and assessment of purity of commercial human rabies vaccines available in India. Rabies in Asia Conference, Bangkok, Thailand, 11 -13 September 2013. Roopa R, Nagarchi Khaleel, Chandrasekar Sagar BK, Bindu M Kutty, Andrade C. Increased electroconvulsive shock dosing causes favourable neuroplastic shift in basolateral amygdala neurons even in normal rats. Amygdala in Health and Disease, Gordon Research Conferences, Easton, MA, USA, 28 August- 2 September 2013. 91. Roopesh BN, Siddharth, D, Prateeksha S, Sneha TS, Vijaysagar J. Just world belief of parents of children with conduct disorder. International Conference of Bombay Psychological Association, Mumbai, 1-3 December 2013. 92. Sadanand S, Kota LN, Bagepally BS, Shivakumar P, Balachander R, Loganathan S, Sivakumar PT, Bharath S, Varghese M. Cognitive test performance in persons with dementia in India. 16th Asia Pacific Regional Conference of Alzheimer Disease International, Hong Kong, 11-13 December 2013. 93. 94. Sailesh Modi, Atchayaram Nalini, Narayanappa Gayathri, Srinivas Bharath MM, Balaraju Sunitha, Kiran Polavarapu. (i) (a) Detection of limb girdle muscular dystrophy 2A (Calpainopathy) by Autocatalytic activity of Calpain and by quantification of Calpain bands by Densitometry (b) LGMD2I: immunohistochemical and immunoblot technique assisted identification of 51 cases with both Duchenne and Becker phenotype. World Congress of Neurology, Vienna, October 2013. Saini J, Jhavar K, Pal PK, Yadav R, Bagepally B. Subcortical gray matter abnormalities in patients of essential tremor revealed by MR volumetry and vertex analysis. 20th World 2013-14 95. Saini J, Yadav R, Bhalsing K, Pal PK. Subcortical structural abnormalities in essential tremor: MR volumetry and vertex based analysis. 20th World Congress on Parkinson’s disease and Related Disorders, Geneva, Switzerland, 8-11 December 2013. 96. Sathyaprabha TN, Ravikiran Kisan, Raghavendra Rao, Sujan, Nalini A, Raju TR. Immunological modulation by yoga therapy in migraine patients. 16th Congress of the International Headache Society, Boston, Massachusetts, USA, 27-30 June 2013. 97. Satishchandra P (i) What is good enough neurology for psychiatry trainees. 2nd Joint Conference – NIMRCPCON 2014, Bangalore, 7 March 2014 (ii) Vasculitis and stroke in CNS Tuberculosis. 21st World Congress of Neurology. Vienna, Austria, 19-23 September 2013. 98. Sekar K (i) Mental health and social work. International Social Work Conference 2014 Interdisciplinary Intervention and Cross Cultural Sharing in Social Work. Madras School of Social Work, Chennai. 8 February 2014 (ii) Social work professional associations and its role in India. International Conference on Realising Rights, Duties, Citizenship through Social Policy and Professional Social Work Practice. IRSES, European Union Seventh Framework Programme, Marie Curie, Loyola College, Chennai, 11 January 2014. 99. Shankaranarayana Rao BS, Veena J, Srikumar BN, Bhagya V, Mahati K, Raju TR. Activation of hippocampal neurogenesis ameliorates chronic stress-induced cognitive deficits and depressive-like behaviour in adult rats. International Conference on Adult Neurogenesis: From stem cells to therapies. Tata Institute of Fundamental Research, Mumbai, 6-8 February 2014. 100. Shankaranarayana Rao BS. (i) (a) Glia and neural plasticity: Implications for the treatment of neurological and psychiatric disorders. APSN-ISN Neuroscience School on Glia in Neuronal Health and Disease, 2730 January 2014 (b) Presenilins and aging brain: Molecular mechanisms underlying age-dependent neurodegeneration, memory loss and impaired synaptic plasticity. International conference on Neurochemistry of Ageing Brain CSIR-Indian Institute of Chemical Biology, Kolkata. 31 January - 1 February 2014 (ii) Innovative National Institute of Mental Health and Neuro Sciences / 245 Annual Report 2013-14 therapeutic strategies to treat depression. International Conference on Neurosciences: Brain Plasticity and Neurological Disorders, Revenshaw University, Cuttack, 9-11 November 2013 (iii) National and International higher education and career opportunities in Medical biotechnology. Proceedings of International workshop on Higher education and career opportunities in Biotechnology during First International and Third National Conference of Biotechnology, Bioinformatics and Bioengineering, Tirupati, 29 June 2013 (iv) Recent trends in neuroscience research and funding opportunities. IBRO-APRC Associate School of Neuroscience on Emerging Trends in Neuroscience: Molecular and Cellular Approches. Banaras Hindu University, Varanasi, 19-23 October 2013 (v) Rescue of symptoms of fragile X mental retardation syndrome in mice: Implications for treating autism and autism spectrum disorders. Proceedings of 1st International and 3rd National Conference of Biotechnology, Bioinformatics and Bioengineering. Tirupati, 28-29 June 2013 (vi) Restoration of hippocampal synaptic plasticity and cognitive functions in stress and depression. International symposium on Hippocampus: From Synapses to Behavior. Indian Institute of Science Education and Research, Pune, 1-3 December 2013 (vii) The ever changing brain: New challenges in treating brain disorders. IBRO-APRC Associate School of Neuroscience on Emerging Trends in Neuroscience: Molecular and Cellular Approaches. Banaras Hindu University, Varanasi, 19-23 October 2013 (viii) Innovative therapeutic strategies to treat depression. International Conference on Neurosciences: Brain Plasticity and Neurological Disorders, Ravenshaw University, Cuttack, India, 9-11 November 2013 (ix) Neural plasticity and repair of abnormal brain circuits: Challenges in treating neurological and psychiatric disorders. 5th Congress of Federation of Indian Physiological Societies (FIPS) on Physiology, Ethnopharmacology, Biotechnology and Health Therapeutics, Sri Venkateshwara University, Tirupati, 17-19 December 2013. 101. Sharma MK, Chaturvedi SK. Prevalence of pain and treatment seeking behavior in the community. Maxa Tria, Singapore Expo, Singapore, 2-5 May 2013. 102. Sharma R, Harsha HC, Prasad KTS, Pandey A, Nagaraja D, Christopher R. Proteins with altered levels in serum from acute ischemic and hemorrhagic stroke patients as revealed by iTRAQ-based differential proteomic analysis, Gordon Research Conference: Post translational Modification Networks, The Hong Kong University of Science and Technology, Hong Kong, SAR, China, 28 July-2 August 2013. 103. Shastry AH, Reshma Narayan, Balaram Thota, Sampath Somanna, Kandavel Thennarasu, Arimappamagan Arivazhagan, Vani Santosh. Expression patterns of insulin-like Growth Factor Binding Protein (IGFBP) isoforms in medulloblastoma subtypes and clinical correlation. 4th Quadrennial Meeting of the World Federation of Neuro-Oncology, San Francisco, California, USA, November 2013. 104. Shilpa BM, Mahati K, Bhagya V, Raju TR, Shankaranarayana Rao BS. (i) Enriched environment ameliorates stress-induced spatial learning deficits and depressive behavior without anxiety and amygdalar hypertrophy. (a) 12th Annual Molecular and Cellular Cognition Society Meeting, San Diego, USA, 7-8 November 2013 (b) 43rd Annual meeting of the Society for Neuroscience Conference, San Diego, USA, 9-13, November 2013. 105. Shivashankar N. Central auditory processing disorders in neurological population with special reference to MMND, 3rd Ventricular Tumor and TLE. 2nd Global CAPD Conference, Orlando, Florida, USA, 28-29 March 2014. 106. Shukla D, Chandramouli BA, Sastry KVR, Das BS. Sampath S. Does intraoperative rupture affect outcome of aneurysm surgery? World Congress of WFNS, Seoul, South Korea, 2013. 107. Silveira LE, Bond DJ, Torres IJ, Muralidharan K, Lam RW, Kozicky JM, Bucker J, Yatham LN. Neurocognitive function in overweight/obese patients with Bipolar Disorder: data from the systematic treatment optimization program for early mania. 28th Annual Research Day, UBC, Vancouver BC Canada, 6 June 2013. 108. Sinha S, Velmurugan J, Nagappa M, Taly AB, Satishchandra P. Localization and propagation of physiological sleep vertex transients with EEG & MEG using realistic head model. 30th International Congress of Clinical Neurophysiology, Berlin, Germany, 20- 23 March 2013. 109. Sowmyashree Mayur Kaku. Magnetic resonance spectroscopy – review and future trends in autism spectrum disorder. International Conference on Developmental Disabilities, Kolkata, 6-8 March 2014. 246 / National Institute of Mental Health and Neuro Sciences Annual Report 110. Sowmyashree Mayur Kaku, John Vijay Sagar, Shekhar Seshadri, Satish Chandra Girimaji, Shoba Srinath. Pervasive refusal syndrome – a nosological puzzle.World Psychiatric Association International Congress 2013, Vienna, Austria, 27-30 October 2013. 111. Srinath S, Jairam R, Kandasamy P. Affective disorders in children and adolescents: Current status and controversies. 7th Congress of the Asian Society for Child and Adolescent Psychiatry and Allied Professions, 25-28 September 2013. 112. Subasree R. Education program teaching course/ Workshop, Nerve and Muscle Ultrasound. WFN 2013, Vienna, Austria, September 2013. 113. Sudhakar D. Training programme. Organized by Department of Science and Technology, Govt. of India, New Delhi, Australia, 14-18 October 2013. 114. Taksal A, Sudhir PM, Keshav Kumar J, Jagadish, Deepashree. Does the Integrated psychological therapy improve neurocognition and social-functioning in patients with schizophrenia? ECSR Congress, Berlin, Germany, 26-28 September 2013. 115. Thirthalli J, Abhishekh HA, Kumar CN, Gangadhar BN. A novel method of altering stimulus parameters to induce seizures during electroconvulsive therapy. ECT Symposium, NIMHANS, Bangalore, 7 December 2013. 116. Thomas PT, Rajaram P, Nalini A. Psychosocial challenges in family care giving in duchenne muscular dystrophy. Myocon 2014 – International Conference on Neuromuscular Disorders, Chennai, 10-12 January 2014. 117. Thomas PT, Rajaram P, Chandra S. Supportive psychotherapeutic intervention in Dementia. Gerontology – A social work perspective. One day International Conference conducted in School of Social Work, Roshni Nilaya, Mangalore. 118. Urvakhsh M, Waghmare A, Thirthalli J, Venkatasubramanian G, Gangadhar B. Enhancing putative mirror neuron activity: a novel therapeutic application of repetitive transcranial magnetic stimulation (rTMS). 11th World Congress of Society for Brain Mapping and Therapeutics, Sydney, Australia, 17-19 March 2014. 2013-14 119. Vani Santosh. Conducted teaching sessions and delivered the following guest lecturers (a) Slide Session - Infections of CNS and Meningioma (b) Pathology of Meningeal Tumors (c) Update on pediatric and embroynal tumors (d) Slide sessions - tumors of the CNS (e) Molecular diagnosis in central nervous system tumors (f) Discussion on -Interesting cases in Neuropathology (g) Pathology of muscular dystrophies (h) Slide session-Neuromuscular disorders. Symposium-Neuropathology, Kuwait Institute for Medical Specialization, Kuwait, 23-26 September 2013. 120. Varghese M, Roy J. Making Dementia a public health priority – impact of the Dementia India report. The National Dementia Strategy Group of ARDSI. 28th International Conference of the Alzheimer’s disease, ADI 2013, Taipei, 18-20 April 2013. 121. Veerendrakumar Mustare (i) Serial single fibre EMG studies in myasthenia gravis. 30th International Congress of Clinical Neurophysiology 2013, Berlin, 20-23 March 2014 (ii) Normal single fibre electromyography of facial muscles in ocular /mild generalised myasthenia gravis. 5th Asia-Oceanian Congress of Clinical Neurophysiology 2013. Bali, Indonesia. 28-31 August 2013. 122. Velmurugan J, Sinha S, Nagappa M, Mariyappa N, Prasanth G, Bindu PS, Hazra N, Ravi V, Taly AB, Satishchandra P. Source localization and propagation of periodic complexes in subacute sclerosing pan encephalitis using MEG-EEG: A Novel approach towards understanding subcortical myoclonus. 30th International Congress of Clinical Neurophysiology 2014, Berlin, Germany, 20-23 March 2013. 123. Vijay K Kalia, Kalyani Kumari, Sai Shyam, Jennifer George, Chandrasekhar Sagar BK, Jagath Lal. Preclinical studies for increasing radiation response of malignant brain tumour. Proceedings of the International Conference on Radiation Biology and Clinical Applications Indian Society for Radiation Biology, Nitte University, Mangalore, 25-27 October 2013. 124. Vijay Kumar Kalia. Approaches for improving cancer radiotherapy. Proceedings of the International Workshop on Strategies in Radiation Research, KS Hegde Medical Academy, Nitte University, Mangalore, October 25, 2013. 125. Vivek Benegal. (i) (a) Neurobiology of vulnerability to addiction. Symposium on Substance Abuse in Children National Institute of Mental Health and Neuro Sciences / 247 Annual Report 2013-14 and Adolescents: Current Trends. (Keynote address) (b) Course on management of substance abuse in children and adolescents. 7th Congress of Asian Society for Child and Adolescent Psychiatry and Allied Professions and 12th National Biennial Conference of Indian Association for Child and Adolescent Mental Health. New Delhi September 2013 (ii) Treatment of alcohol dependence. CME, Alcohol (a) organized by the Sri Lanka college of psychiatrists. Ahungalla, Sri Lanka, October, 2013 (Keynote address) (b) Synapse Symposium. Nepal Psychiatric Society, Kathmandu, Nepal. September, 2013. (Keynote address) (c) Neurobiological aspects of vulnerability to alcohol dependence (iii) Alcohol and road safety. International Workshop on Public Health Approaches for Improving Road Safety of Heavy Vehicle Fleets in India organized by the Institute of Road Traffic Education and Centers for Disease Control and Prevention, New Delhi. November 2013 (iv) Behavioral sciences research at NIMHANS. University of Liverpool, Liverpool, October 2013 (v) Burden of alcohol misuse in India. Workshop on Public Health Communication, Social Media and Advocacy Campaigns on Preventing Harmful Effects of Alcohol Use, organized jointly by Public Health Foundation of India and the Swedish National Institute of Public Health. New Delhi, December 2013. (Keynote address) (vi) Social cost of alcohol misuse in India. Global Alcohol Policy Conference 2013. Seoul, Korea, October, 2013. 126. Wesley MS, Manjula M. Early maladaptive schemas, adult attachment and early trauma in individuals with depression. 17th International and 48th National Conference of the Indian Academy of Applied Psychology, Karnataka University, Dharwad, 22-24 May 2013. 2. Abhishekh HA, Acharya U, Thirthalli J, Phutane V, Muralidharan K, Gangadhar BN. Ictal EEG non-linear and high order spectral analysis methods in electroconvulsive therapy and its clinical utility. Annual Conference of Association of Physiologists and Pharmacologists 27-30 November 2013. (Harish Gupta Best Paper Award) 3. Ahalya Raguram. (i) Parent stress management. Training of Trainers Program on Parenting Skills Development, Christ College, Bangalore, 29 January 2014 (ii) Emotional intelligence for effective classroom management. UGC Sponsored National Workshop organized by Home Science Association of India – Karnataka Branch and Smt .VHD. Central Insititute of Home Science, Hosur, 26 July 2013 (Keynote Address) (iii) Inner world of dysfunctional families. Workshop on Psychiatry Update -2013, KMC, Manipal, 16-17 November 2013 (iv) Psychotherapeutic interventions. Orientation to Clinical Psychology, NIMHANS, 3-4 December 2013. 4. Ahmed A, Reddy NK, Tahira M.Efficacy of psychosocial interventions among caregivers of malignant brain tumor patients. 32nd ANC of ISPSW, Karnataka State Women’s University, Bijapur. (Dr. M. Chandrasekar Rao Memorial Award for Best Paper on Research) 5. Aier A, Veena S, Suman LN. Perceived burden and treatment expectations of family members of individuals with intellectual disability. 40th National Annual Conference of the Indian Association of Clinical Psychologists, SRM University, Kattankulathur, Tamil Nadu, 28 February - 2 March 2014. 6. Ajay KN. (i) Electrophysiological indices of cognition. DST sponsored Workshop, current physiological techniques – from basic to applied aspects; emerging trends in neurophysiology: from cell to systems. NIMHANS, Bangalore, 26 November 2013 (ii) Neural correlates of consciousness and sleep. Workshop, Research Challenges in EEG Signal Analysis and Application, Organized by Ambedkar Institute of Technology. NIMHANS, Bangalore, 26 June 2013 (iii) Principles and applications of ERP recordings. National Conference, Electrophysiology & Neurology Trends in Electro Diagnosis & Research. DY Patil University, Kolhapur, 31 January 2014 (iv) Rajayoga Research at NIMHANS. 7th Spirituality in Researchers Conference. Brahma Kumaris, Gyan Sarovar, Rajasthan, 1 September 2013. 7. Amaresha AC, Reddy NK, Ahmed A, Ross D, Setty VK, Arthur JA (August, 2011). Strain and coping among 127. Yadav R, Adwani SG, Chandra SR, Kumar KJ, Pal PK. Cognition in Early Parkinson’s disease and the effect of laterality of motor symptoms. 20th World Congress on Parkinson’s disease and Related Disorders, Geneva, Switzerland, 8-11 December 2013. B. PRESENTATIONS IN NATIONAL CONFERENCES 1. Abhinay. (i) Contrast enhanced MR Angiography. Philips Gyro Cup. Jayanagar, Bangalore, 14 November 2013 (ii) Types of MR Angiography in Brain. 17th National Conference of Society of Indian Radiographers. Mahabaleshwar, Pune, 6-8 December 2013. 248 / National Institute of Mental Health and Neuro Sciences Annual Report 2013 (iii) Dead men do tell tales. Brain cutting session, MERT 2013, 12 October 2013 (iv) Neuropathology of fungal infections of nervous system. IAMM 2013, NIMHANS, Bangalore, 12 October 2013 (v) Brain anatomy – The inside story. 4th National Workshop, Neuropsychology- Emerging Hope: EEG Neurofeedback Training (EH:NFT-2013) NIMHANS, Bangalore, 1820 November 2013 (vi) Clinicopathologic conference, Bangalore Neurological Society, 7 December 2013 (vii) The fevered brain- whodunit? CME, Acute Febrile Illnesses, 62nd APCON 2013, Aurangabad. 12-15 December 2013 (viii) Slide seminar, KCIAPM, Bowring Institute, Bangalore, 26 January 2014 (ix) Clinicopathologic Conference, KNACON 2014, Shivamoga, 15-16 February 2014 (ix) Clinicopathologic Conference and conduct Quiz program, TROPICON 2014, Chennai, 8-9 March 2014. caregivers of persons with brain tumor. UGC Sponsored Social Work Conference Arignar Anna Arts College, Karaikal, Pondicherry. 8. 9. 10. Andrade C. (i) Future therapies for Alzheimer’s disease. World Federation of Neurology, 3rd Teaching Course in Cognitive Neurology, Bangalore, 5-7 April 2013 (ii) Art of psychiatry: Indian Association of Private Psychiatry, Puri, 31 August - 1 September 2013 (iii) Limitations of psychotherapy. Annual Conference of the Indian Psychiatric Society. (Maharashtra), Shirdi, 28-29 September 2013 (iv) Bipolar disorder: A critical examination of recent research for take-home messages. Annual Conference of the Indian Psychiatric Society (Central Zone), Lucknow, 19-20 October 2013 (v) CME: Psychopharmacology in the medically ill. Mid-term CME, Indian Psychiatric Society. (Haryana), New Delhi, 06 October 2013 (vi) Drug interactions in geriatric psychopharmacology. CME. Indian Psychiatric Society (Haryana), Delhi (vii) The future of Alzheimer’s disease psychopharmacology. CME. Indian Psychiatric Society (Haryana), Delhi (viii) Mechanism of action of ECT: Recent research. Symposium, ECT, NIMHANS, Bangalore, 7 December 2013 (ix) Professional hazards in Psychiatry. Mid-term CME, Indian Psychiatric Society (Andhra Pradesh), Warrangal, 9 February 2014. (Keynote address) (x) Workshop: Drug interactions and psychotropic medications. Neuropsychiatry CME, 2014, SDM College of Medical Sciences and Hospital, Dharwad, 23 February 2014 (xi) How to review a manuscript. 2nd Joint Conference of NIMHANS and Royal College of Psychiatrists, UK, Bangalore, 7-8 March 2014 (xii) CBT augmentation of pharmacotherapy with special reference to OCD. Workshop, Mid-Term CME of the Indian Psychiatric Society. Tamil Nadu, Pondicherry, 16 March 2014. Anisha Mary Abraham, Sudhir PM, Bantwal G. Health care providers’ perspectives on barriers to self-care in type 2 Diabetes Mellitus in India. 40th National Annual Conference of the Indian Association of Clinical Psychologists, Chennai, Tamil Nadu. 28 February-1 March 2014. Anita Mahadevan. CNS infections: Sleeping with the enemy and Reviving a dying science: Autopsy in current day practice of pathology (Brain cutting session). Neuropathology CME, KMC Manipal, 20 July 2013 (ii) Pathology of drug resistant epilepsy. Colloquium on Drug Resistant Epilepsy, NIMHANS, Bangalore, 16-18 August 2013-14 11. Annie P John. Effectiveness of an educational module on knowledge about, attitude towards an experience with anti depression drugs in anti depression naïve depressed patient. National Conference of Indian Society of Psychiatric Nurses Conference, St. John’s College of Nursing, Bangalore, 8-10 February 2014. 12. Anshu K, Laxmi TR. Animal acoustic startle system: assessing startle response and prepulse inhibition in rats. APPICON 2013: Pre-conference workshop, sponsored by DST on Current Physiological Techniques from Basics to Applied Aspects: Emerging trends in Neurophysiology from Cell to System, NIMHANS, Bangalore, 26 November 2013. 13. Anu Mary Varghese, Aparna Sharma, Poojashree Mishra, Vijayalakshmi K, Harsha HC, Sathyaprabha TN, Srinivas Bharath, Nalini A, Phalguni Anand Alladi, Raju TR. Chitotriosidase – a putative biomarker for sporadic amyotrophic lateral sclerosis. APPICON 2013, Bangalore, 28-30 November 2013 (R. Srinivasan Prize for the Best Paper) 14. Anupam Gupta. (i) (a) Botulinum Toxin A in spasticity, (b) Neuropsychological assessment and cognitive retraining. IAPMR National Mid-Term CME, Mumbai, 2022 September. 2013 (ii)Neurogenic Bladder.MERT CME Program. NIMHANS, Bengaluru, 19 October 2013 (iii) Neurogenic bowel dysfunction & management. CME Joint Program by Bangalore Neurological Society & Bangalore Urological Society, NIMHANS, Bengaluru, 19 January 2014 (iv) (a) Epidemiology, barriers to admission & discharge for patients with SCI: ISCoR group experience National Institute of Mental Health and Neuro Sciences / 249 Annual Report 2013-14 (b) Cognitive Rehabilitation. 2nd National Indian federation of Neurological Rehabilitation Conference. Mumbai, Maharashtra, 27 February 2014 (v) Prevalence of fatigue in patients with Multiple sclerosis and its effect in quality of life. 62nd Annual National Conference, NSICON, Mumbai, 12-15 December 2013. 15. Aravind Raj E. Health status of Tibetan women in India. 32nd Annual ISPSW, Karnataka State Women’s University, Bijapur, 20-22 January 2014. 16. Arivazhagan A, Bhaskara Rao M, Sanjib Sinha, Chandramouli BA, Satishchandra P. Clinical spectrum of etiologies and nuances in epilepsy surgery in children An institutional experience. Annual Conference of Indian Society for Stereotactic & Functional Neurosurgery, Stereocon 2013, New Delhi, 14-15 September 2013. 17. Arivazhagan A, Sanjib Sinha, Malla Bhaskara Rao, P Satishchandra. Disconnection surgeries for drug resistant epilepsy – indications, learning curve and outcome. 18. 19. 20. Arivazhagan A, Santosh V, Thennarasu K, Pandey P, Anandh B, Hegde AS, Chandramouli BA. Long term survival in GBM patients following RT and temozolomide – results from the largest prospective cohort treated with standard uniform adjuvant therapy from India. 62nd Annual Conference of Neurological Society of India. Mumbai, 12-15 December 2013. Arivazhagan A. (i) Temporal lobe epilespy - problem solving approach. Case discussion in Colloquium on Drug Resistant Epilepsy. NIMHANS, 6-18 August 2013(ii) Posterior third ventricular tumors - Case discussion. 24th Annual Conference of Indian Society for Pediatric Neurosurgery, Neuropedicon 2013, Udaipur, Rajasthan. 24-26 October 2013 Arthur Julian Anthony Joseph (i) Group interventions for substance use disorders. Medical Officers Training Programme on Substance Use Disorders. NIMHANS (CAM) Bangalore, 29 July 2013 (ii) Stress management. Workshop, Personality Development and Stress Management. Karnataka State Police Training Institute, 12 September 2013 (iii) Brief interventions for substance use disorders. Two months training programme on addiction counselling for NRHM social workers from Himachal Pradesh, NIMHANS (CAM), Bangalore, 26 November 2013. 21. Arun H Shastry, Balaram Thota, Srividya MR, Shwetha Durgad, Kota Shravani, Kandavel Thennarasu, Paritosh Pandey, Hegde AS, Chandramouli BA, Arivazhagan A, Vani Santosh. Immuno histochemical analysis of novel molecular markers in astrocytoma - value in aiding diagnosis and prognosis. 62nd Annual Conference of Neurological Society of India, Mumbai, 11-14 December 2013 (Herbert Krauss award for the Best Paper in Neurooncology) 22. Arun K (i) Technical session. Tobacco Cessation. Karnataka state level consultation on ban on Tobacco Advertising Promotion and Sponsorship. 5 July 2013 (ii) Alcohol-the socio political Neuroscience. Community Medicine CMEAnnapoorna Institute of Medical Sciences, Salem, 24 January 2014 (ii) Anxiety disorder and drug use. Training on Management of Co-morbid Conditions among Injecting Drug Users under National AIDS Control Programme organized by Regional Technical Training Centre, South Zone, NIMHANS. Bangalore, 19 March 2014. 23. Arun Vangili. Psychodynamic diagnostic assessment in child psychiatry. DYPSCAP 2014, Mumbai, Maharashtra, 1-3 March 2014. 24. Arvinda HR (i) Cerebral Angiogram; Anterior Circulation. KNACON 2013. Narayana Hrudayalaya, Bangalore, 16 June 2013 (ii) Neurointerventions basics, 30th State Conference of IRIA, Hubli, 29-30 March 2014. 25. Ashmeet Nagpal, Ahalya Raguram. Indian adolescents perceptions of separation- individuation and parental relationships–a qualitative study. 40th National Annual Conference of IACP, Chennai, 28 February-2 March 2014. 26. Ashmeet Nagpal. (i) Zooming in on ‘the solo note’: preliminary findings on systemic individual marital therapy. 40th National Annual Conference of Indian Association of Clinical Psychology, Chennai, 28 February-2 March 2014 (ii) Family formulation, hypothesization and techniques of family intervention. Workshop on Psychiatry Update–2013, KMC, Manipal, 16-17 November 2013. 27. Ashok M, Indira Devi B, Shukla D, Subbakrishna, Neeraj U, Jamuna Rajeswaran. Quantitative evidence of brain volume changes during early weeks of mild head injury and its cognitive consequences: A longitudinal study. 31st Annual National Neurotrauma Symposium, Nashville, USA, 4-7 August 2013. 250 / National Institute of Mental Health and Neuro Sciences Annual Report 28. Ashok S. Kori, Swarupa U, Nirmala BP. Challenges experienced in rehabilitating long stay women with disability in day care center at NIMHANS. 32nd Annual ISPSW, Karnataka State Women’s University, Bijapur, 20-22 January 2014. 29. Ashwath Narayan Rao J. Advanced applications of 3 T MRI. National Conference of Society of Indian Radiographers, Mahabaleshwar, Pune, 6-8 December 2013. 30. Ashwin YB, Reeta Mani, Madhusudana SN. Human rabies cases despite pos-exposure treatment: An audit. 15th National Conference of the Association for Prevention and Control of Rabies in India.Pune, 6-7 July 2013. 31. Athulaya Jayakumar, Mallika, Jamuna Rajeswaran B. Neurofeedback training in cerebral hypoxia: a case study report. 4th Continuing Education in NeuropsychologyNeuropsychological Rehabilitation RehabilitationEmerging Hope: EEG NFT. NIMHANS, Bangalore, 18-20 November 2013. 32. Basavarajappa C, Suresh Kumar K, Kumar CN, Ravishankar V, Vanamoorthy U, Waghmare A, Sivakumar T, Mehta U, Thirthalli J. Comparison of IDEAS and WHODAS 12-item scale cutoffs in persons with psychiatric disorders referred to psychiatric rehabilitation services of NIMHANS. National Conference, Research and Services on Psychiatric Rehabilitation: Focus on Recovery, NIMHANS, Bangalore, 8-9 March 2014. 33. Bhadrinarayan V. (i) How to safeguard from Hospital infection? PG Excel – 2013, Bangalore, 11 August 2013 (ii) Basic principles of ventilation and respiratory care in the ICU. Navodaya Medical College, Raichur, 24 August 2013 (iii) Post resuscitation care beyond CPR. Annual Karnataka State Conference, Bangalore, 13- 15 September 2013 (iv) Pediatric traumatic brain injury. 61st Annual Conference of the Indian Society of Anaesthesiologists, Guwahati, 26-29 December 2013. 34. Bhaskar MV, Arun K Gupta, Bharath RD, Pramod K Pal. Assessment of brain plasticity induced by rtms in patient with writer cramp using resting state connectivity by simultaneous EEG-fMRI. 16th Annual Conference of ISNR 2013, Bangalore, 26-29 September 2013. (Best Poster Award) 35. Bhola P (i) Recovery-oriented services at NIMHANS: Assessment, home-based rehabilitation and volunteer 2013-14 participation. Annual National Conference of the World Association of Psychiatric Rehabilitation, Calicut, Kerala, 20-21 July 2013 (ii) Innovations in psychiatric rehabilitation services: service delivery and advanced training in psychiatric rehabilitation at NIMHANS. National Conference on Research and Services in Psychiatric Rehabilitation with Focus on Recovery, NIMHANS, Bangalore, 8-9 March 2014.(iii) Psychosocial rehabilitation. Psychological Care for Addictive Behaviours Programme for trainees from Shimla. December, 2013 (iv) Integrating self-reflection into Practice, How Psychotherapists Develop, Therapist Self-care. One-day workshop titled Tuning in: Being a reflective psychotherapist. NIMHANS Centre for Wellbeing, Bangalore, 4 April 2013 (v) Rehabilitation psychology: Beyond symptom amelioration. Presentation at Orientation to Clinical Psychology: Emerging areas. A twoday orientation program organized by the Department of Clinical Psychology, NIMHANS, Bangalore. 3-4 December 2013 (vi) Health Psychology: The mind-body relationship. Presentation at Orientation to Clinical Psychology: Emerging areas. A two-day orientation program organized by the Department of Clinical Psychology, NIMHANS, Bangalore, 3-4 December 2013 (vii) Therapist strengths and limitations, Integrating self-reflection into practice. Workshop titled Mirror, Mirror on the Wall: Becoming a self-reflective practitioner. NIMRCPSYCH 2014: 2nd Joint Conference of NIMHANS and RCPSYCH UK: Training and learning for the 21st century trainee in Psychiatry, NIMHANS, Bangalore, 7-8 March 2014. 36. Bhola P, Mathur S. Session on Suicidal behaviours: assessment and preventive interventions. Making a Difference: A workshop on Youth Mental Health for College Counselors. Department of Clinical Psychology, 11-12 July 2013. 37. Bindu M Kutty. (i) Mind training and brain plasticity during the scientific program, ‘Mind Science organised during the Youth Interfaith Pilgrimage program of the Foundation for the Universal Responsibility of his Holiness The Dalai Lama NIMHANS, 8 August 2013 (ii) Polysomnography : A window to assess the brain Functions’. CME, Current Trends in Neurophysiology. Little Flower Hospital and Research center, Angamali, Kerala, 28-29 September 2013 (iii) Polysomnography: a window to assess the neurobiology of sleep. National Workshop on ‘Biomedical Systems’ organized by PES Institute of Technology, Bangalore, 25 October 2013 (iv) Environmental enrichment: A window to understand the National Institute of Mental Health and Neuro Sciences / 251 Annual Report 2013-14 phenomenon of cognitive reserve in the brain-during the Emerging Hope: EEG Neurofeedback Training Workshop. NIMHANS, 18-20 November 2013 (v) Understanding consciousness from illness to wellness. DST sponsored Workshop, Current Physiological Techniques – From Basic to Applied Aspects; Emerging Trends in Neurophysiology: From Cell to Systems. NIMHANS, Bangalore, 26 November 2013 (vi) Anatomy and physiology of sleep’ during the 8th National Sleep Medicine Course. Balaji Medical College, Chennai, 14-15 December 2013 (vii) Neural plasticity and the concept of cognitive reserve: experimental evidences and newer concepts. Bangalore Cognition Workshop under the Learning and Memory Module. IISc, Bangalore,19-21 December 2013 (viii) Mind Training, brain plasticity and the concept of cognitive reserve. Workshop, Neurophysiology & Electrophysiology Axxonet Solutions, Bangalore,9-12 January 2014 (ix) Sleep – a dynamic state – a revisit & homeostatic and circadian regulation of sleep. One day CME, Basics of Sleep and Sleep Disorders, Raja Rajeswari Medical College, Bangalore, 9 March 2014. 38. 39. Bindu PS, Sonam K, Govindaraju C, Taly AB, Gayathri N, Srinivas Bharath MM, Arvinda HR, Nagappa M, Sinha S, Khan NA, Govindaraj P, Vandana N, Thangaraj K. Pediatric mitochondrial disorders: study from a tertiary care neurological institute.Mitochondria in Health and Disease, Bangalore, 18 -20 December 2013. Bindu PS. (i) Mitochondrial disorders. Overview. Hands on workshop in Neurochemistry and Electronmicroscopy. NIMHANS, Bangalore, 18 July 2013 (ii) Clinical clues to the diagnosis of neurometabolic disorders & leukoencephalopathies. 16th Annual Conference of Indian Society of Neuroradiology, Bangalore, 27 September 2013 (iii) Mitochondrial disorders, a diagnostic conundrum. Child Neurocon. 5th Annual Conference of Association of Child Neurology, Hyderabad, 9 February 2014. 40. Bingi Rajeshwari. A comparative study to assess the knowledge and attitude of school personnel about Tobacco control policies in schools and training materials available for implementing tobacco prevention and control interventions among government and private school. National Conference of Indian Society of Psychiatric Nurses Conference, St. John’s College of Nursing, Arekere, Bangalore, 8-10 February 2014. 41. Birudu Raju. The unmet psychosocial needs of family care givers of persons with brain tumors- a qualitative study. Emerging Health Issues Across Life Stages, University of Mysore, Mysore. 6-7 March 2014. 42. Chaitanya G, Sinha S, Satishchandra P. Ripples and waves: patterns of high frequency oscillations (HFOs) in absence epilepsy.Colloquium in drug resistant epilepsy. Bangalore, 16-18 August 2013. 43. Chandra PS, Girish, Padma, Desai G. Suicide Reporting for Journalists (Prajavani). Prajavani Office. Bangalore, 8 February 2014. 44. Chandra SR. (i) Can TMS be used as a biomarker to differentiate between early Alzheimers disease from ftd.Indo-German Workshop on Neurobionics 2013 in Clinical Neurology. JIPMER Puducherry. 15 -17 February 2013 (ii) Metabolic encephalopathy–Diagnosis and management. 62nd Annual conference of neurological Society of India, Chennai, 12 December 2013 (iii) Neuroradiology Conference-16th Annual Conference of Indian Society of Neuroradiology – Indian Society of Health & Neuro Sciences, NIMHANS, Bangalore, 2629 September 2013 (iv) Chaired session on Metals and Brain. Chennai Neuroupdate, Chennai, 24-26 January 2014(v) Chaired session on recent advances. 62nd Annual Conference of Neurological Society of India. Mumbai,12 December 2013. 45. Chandrajit Prasad. A case of Rabies–Neuroimaging Findings. 16th Annual Conference of Indian Society of Neuroradiology. Bangalore, 26-29 September 2013. 46. Chetan GK, Sibin MK, Dhanajayan Bhat, Lavanya CH, Jeru manoj, Geethasree N. Role of P16 deletion and BMI1 copy number variationin Glioma. 39th Indian society of Human Genetics Annual Conference, Ahmedabad 22-25 January 2014. 47. Christopher R. (i) Tandem mass spectrometry for diagnosis of neurometabolic disorders. 2nd Hands-on workshop on Neurochemistry and Electron microscopy, NIMHANS, Bangalore 19 July 2013 (ii) Investigation of lysosomal storage disorders, Programme of awareness of Lysosomal Storage Disorders and PID, Indira Gandhi Institute of Child Health, Bangalore, 9 November 2013 (iii) Inborn errors of metabolism: recent advances in diagnosis and screening, CME, Inborn Errors of Metabolism, Raja Rajeshwari Medical College and Hospital, Bangalore, 12 December 2013 (iv) Laboratory diagnosis and prenatal screening of IEM, CME, Inborn Errors of Metabolism, 252 / National Institute of Mental Health and Neuro Sciences Annual Report Satishchandra P. Predictors of spontaneous seizure remission in patients of medically refractory epilepsy due to mesial temporal sclerosis : A preliminary study. Colloquium in Drug Resistant Epilepsy, Bangalore, 16 -18 August 2013. Sri Manakula Vinayaga Medical College and Hospital, Puducherry, 21 February 2014. 48. Dania Jose, Sri Mahavir Agarwal, Janardhanan C. Narayanaswamy, Sunil Kalmady, Ganesan Venkatasubramanian, Janardhan Reddy YC. The Neurohemodynamic substrates of response inhibition in medication naïve OCD: an fMRI study using go/nogo task. 43rd Annual Meeting of Society for neuroscience. Sandiego, USA, November 2013. 49. Deepa S, Bindu PS, Gayathri N. Presence of inflammation is not always inflammatory disease – MYOCON-2014. Chennai, January 2014. 50. Desai A. Diagnosing Dengue: the role of the laboratory, Brain Storming Conference on Dengue Scenario in India, Madurai, 25-26 July 2013. 51. Desai G. (i) Use of psychotropic medication in pregnancy and breastfeeding on interface between Obstetrics and psychiatry conducted BSOG. BMC auditorium, Bangalore, 26 May 2013 (ii) Psychotropics during pregnancy and lactation. (a) 2nd Annual State Level Conference, Psychiatry Society of Goa, Panaji, 02 June 2013 (b) KANCIPS, Psychiatry Society of Karnataka, Hassan, 4 August 2013. 52. Dhananjaya I Bhat. Use of amniotic membrane as a wrap for nerve anastamosis. XV WFNS, Seoul, 8-13 September 2013. 53. Dhaval P Shukla (i) Outcome after diffuse cerebral injury. Annual Conference of Neurotrauma Society of India, Guwahati, 2013 (ii) Post-traumatic cephalalgia. AIIMS Annual Neurotrauma Conference, New Delhi, 2013 (iii) Mild traumatic brain injury sequelae. AIIMS Annual Neurotrauma Conference, New Delhi, 2013 (iv) Early bladder management in spinal cord injury. Bangalore Neurology Society, Neurourology CME, Bangalore, 2014 (v) Common neurosurgical problems in children. Annual Conference of Karnataka Neuroscience Academy, Shimoga, Bangalore, 2014 (vi) Paroxysmal sympathetic hyperactivity in a child with moyamoya disease. Annual conference of Indian Society of Pediatric Neurosurgery, Udaipur, 2013 (vii) Neuroepithelial tumors of cerebellopontine angle in children. Annual conference of Indian Society of Pediatric Neurosurgery, Udaipur, 2013. 54. Dhiman V, Sinha S, Arivazhagan A, Mahadevan A, Bharath RD, Saini J, Jamuna R, Rao MB, Shankar SK, 2013-14 55. Diksy Jose, Sailaxmi Gandhi, Geetha Desai. Recovery from schizophrenia: a qualitative analysis of patient perspectives. National Conference on Research and Service in Psychosocial Rehabilitation, NIMHANS, 8-9 March 2014. 56. Divya Sadana, Jamuna Rajeswaran. (i) Neuropsychological rehabilitation in schizophrenia: case series.(ii) Neuropsychological Rehabilitation in a case of cerebral hypoxia due to partial hanging. 4th Continuing Education in Neuropsychology-Neuropsychological RehabilitationEmerging Hope: EEG NFT, NIMHANS, Bangalore, 18-20 November 2013. 57. Dwarakanath Srinivas (i) Lesioning in multi etiological tremor. 2nd update on Functional Neurosurgery and Radiosurgery. Medanta the Medicity, Gurgaon, April 2013(ii) (a) Pediatric severe head injuries – dilemmas and decisions (b) Post traumatic hydrocephalus AIIMS Annual update on Neurotrauma. 31 August-1 September 2014 (iii) Management strategies in arterio-venous malformations. Annual meeting of Neuro-radiology society of India, Bangalore, 28-29 September 2013 (iv) Surgical management of Tremor. 3rd Annual Conference of the Neurological Surgeon’s Society of India, NSSI 2014. Rishikesh, 28 February- 2 March 2014 (v)(a) Surgical management of cavernous sinus hemangiomas (b) Craniosynostosis: Surgical management strategies, Thalamotomy in multietiological tremor: outcomes. 15th WFNS, Seoul 8-13 September 2013 (vi) Surgical management of brainstem cavernomas. NEUROVASCON 2013, Hyderabad, 21-22 September 2013 (vii) Surgical management of multi compartmental trigeminal schwannomas. Skull Base 2013. Chandigarh, 4-6 October 2013 (viii) Endoscopic management of thoracic spine – NIMHANS experience. 6th World Congress of Neuroendoscopy, Mumbai, 8-11 December 2013. 58. Elias JK, Michael RJ, Mehrotra S. Mind Matters! Faculty Development Program for college teachers from Kerala state, Institute of Social and Economic Change, 13 February 2014. 59. Fasli Sidheek, Jamuna Rajeswaran, Rajakumari K. Neurofeedback training in ADHD- A qualitative National Institute of Mental Health and Neuro Sciences / 253 Annual Report 2013-14 report. 4th Continuing Education in NeuropsychologyNeuropsychological Rehabilitation RehabilitationEmerging Hope: EEG NFT, NIMHANS, Bangalore, 18-20 November 2013. 60. 61. 62. 63. 64. Gandhi S, Chinnaya HP, Rathanmma, Thirthalli J, Bhola P, Nirmala BP, Sivakumar T, Chaturvedi SK. Individual training and placement in psychiatric rehabilitation setting- a case study report. National Conference on Research and Service in Psychosocial Rehabilitation, NIMHANS, 8-9 March 2014. Gayathri N (i) Histotechniques – Its role in diagnosis, Bangalore, October 2013 (ii) Congenital muscular dystrophies. MYOCON, Chennai, January 2014 (iii) Mitochondrial disorders - Pathology of skeletal muscle tissue. 38th Mahabaleshwar series, Mahabaleshwar, January 2014. Gayatri Hegde, Jamuna Rajeswaran, John Vijaysagar. (i) Effect of EEG neurofeedback training in children with mild mental retardation. 48th National and 17th International Conference of – The Indian Academy of Applied Psychology. Karnatak University, Dharwad, 22-24 May 2013 (b) 4th Continuing Education in NeuropsychologyNeuropsychological Rehabilitation-Emerging Hope: EEG NFT, NIMHANS, Bangalore, 18-20 November 2013. Girimaji SC (i) Introduction to child psychotherapy. CME Program on Psychotherapy, KMC, Manipal November 2013 (ii) Introduction and overview on violence and sexual abuse of persons with disabilities. Seminar on Early Intervention & Issues of Violence & Sexual Harassment of Persons with Disabilities. Bangalore, November 2013 (iii) Recent trends in classification in child and adolescent psychiatry. IPS (KC) CME on Recent Advances in Classification, Bangalore, February 2014 (iv) Approach to intellectual disability, scholastic backwardness and oppositional defiant disorder. CME on Child Psychiatric Disorders, Jaipur, March 2014. Girish Baburao Kulkarni. Heart and Stroke 2013 Conference –AIIMS. New Delhi, 8-10 November 2013 (ii) Profile of patients with cerebral venous sinus thrombosis with cerebellar involvement. National Conference of Indian Stroke Association ISACON 2014. Trivendrum, 14-16 March 2014 (iii) Ischemic stroke clinician’s perspective. Indian Society of Neuroradiology, Bangalore, 26-29 October 2013. 65. Gopal Krishna KN. Dexmeditomedine as an anaesthetic adjuvant in patients undergoing trans-sphenoidal resection of pituitary tumor. 61st Annual Conference of the Indian Society of Anaesthesiologists, Guwahati, 2629 December 2013. 66. Gope R. RNAi and cancer research. DBT Sponsored Workshop. RNAi technology and its application. Maharani’s Science College for women, Bangalore, 10 February 2014. 67. Gorky Medhi, Subhendu Parida, Vinay Hegde, Jitender Saini, Hima Pendharkar. Cortical malformation with aberrant course of corticospinal tract in a case of infantile hemiplegia. 16th Annual Conference of Indian society of Neuroradiology. Bangalore, 26-29 September 2013. 68. Govindaraju C, Sonam K, Bindu PS, Gayathri N, Govindaraju P, Khan NA, Vandana N, Arvinda HR,Thangaraj K, Taly AB. Genotypic observations in patients with mitochondrial disorders: a study on 320 patients from south India. 21st Annual conference of Indian Academy of Neurology. Indore, 24-27 October 2013. 69. Govindaraju C, Sonam K, Bindu PS, Gayathri N, Govindaraju P, Khan NA, Vandana N, Arvinda HR,Thangaraj K, Taly AB. Imaging observations in patients with mitochondrial cytopathy from south indian tertiary care centre. 3rd Annual Conference of Society for Mitochondrial Research and Medicine. Bangalore, 19-20 December 2013. 70. Gupta AK. (i) Role of interventional radiology in management of dural arteriovenous malformation. Annual Neurological Society of India Conference. Mumbai, 12-15 December 2013 (ii) Cerebral AVM - NBCA embolization-technique & results. Microneurosurgery and Neuroendovascular Workshop. Sri Sathya Sai Institute of Higher Medical Sciences, Bangalore, 16-17 February 2014 (iii) Cerebral AVM - NBCA EmbolizationTechnique & Results. Stroke and Advanced neurovascular intervention. Kolkata Institute of Neurosciences. Kolkata, 1-2 March 2014 (iv) CME, Emergency and Trauma radiology, Department of Radio diagnosis & Imaging, Chandigarh. 4-5 May 2013. 71. Gupta HK, Sharma MK, Ramana GV. Exploration of psychological distress among caregivers in Ayurvedic treatment setting. 66th ANCIPS, Pune, 16-19 January 2014. 254 / National Institute of Mental Health and Neuro Sciences Annual Report 72. Hargun Ahluwalia, Jamuna Rajeswaran, John P John. Neurofeedback training in chronic Schizophrenia : a case study. 4th Continuing Education in NeuropsychologyNeuropsychological Rehabilitation RehabilitationEmerging Hope: EEG NFT, NIMHANS, Bangalore, 18-20 November 2013. 73. Hegde S. Music cognition: An overview. Seminar organized for Jagadish Bose National Science talent search students (Undergraduate students in Basic Sciences, Engineering, and Medicine). NIMHANS, Bangalore, 13 June 2013 (ii) Music and cognition: Neural basis of music perception and cognition. Mind Science. Seminar organized by Department of Neurophysiology, NIMHANS in association with the Youth Interfaith pilgrimage program of the Foundation for universal responsibility of His Holiness the Dalai Lama, NIMHANS, Banglaore, 8 August 2013 (iii) Neuromusicology: its contribution to evidenced based music therapy practice-Nadamanthana Music Therapy Workshop, Organized by Meera Center for Music Therapy Education and Research. Jain College, Bangalore, 15 September 2013. 74. Herbert HS, Manjula M. (i) Keeping the motivation up: Maintaining good peer relationships. Workshop on Meeting the challenge: A workshop on handling academics effectively. Christ Pre-University Residential College, Bangalore, 11-12 June 2013 (ii) Managing healthy relationships with peers and parents. Workshop, Making a difference: Youth Mental Health for College Counselors, NIMHANS, Bangalore, 11- 12 July 2013 (iii) Resilience based intervention in college youth: an efficacy study. 40th National Annual Conference of Indian Association of Clinical Psychologist, SRM University, Chennai, Tamil Nadu, 28 February - 2 March 2014. 75. 76. Hima Pendharkar, Gupta AK, Shubhendu, Anantram G (i) Neurovascular manifestations of Neurofibromatosis type 1. 16th Annual Conference of Indian Society of Neuroradiology. Bangalore, 26-29 September 2013 (ii) Complication in neurointerventions. 10th Monsoon Meet Goa, 29 August-2 September 2013 (iii) Management of carotico cavernous fistula. 67th Annual Conference of Indian Radiological & Imaging Association. Agra, 2326 January 2014 (iv) What’s new in stroke imaging? Symposium, Advanced MRI Application in Neuro, MSK & Body Imaging. Gurgaon, 21-23 February 2014. Hirisave U (i) Parental pressure and child development. Workshop, VHT Institute, Bangalore, 18 April 2013 2013-14 (ii) Emotional development in children. Rashtrotana Pratisthana, Bangalore 24 May 2013 (iii) Child development theories relevant for intervention. Training of Trainers Programme, Child Protection Personnel of Karnataka, Bangalore, July- August 2013 (iv) Emotional problems of children. Workshop, Karnataka Branch of IPS, Hassan, 9 August 2013 (v) Promotive intervention for young children. Workshop organized by NIMHANS and ICSSR, NIMHANS, 21 September 2013 (vi) Sex education for parents of children and adolescents with mental retardation, Organized by Seva in Action and NIMHANS, NIMHANS, 23 November 2013 (vii) Psychological Testing. Parikrama, programme organized for teachers, 2 December 2013 (viii) Psychotherapy with Children. Seminar organized by Department of Clinical Psychology for post graduates in Psychology, 3 December 2013 (ix) Interactive session on child psychology with DMPH Psychologists, 6-18 December 2013 (x) Benefits of hobbies for Children. Hobby Master (NGO) Sarla Birla Academy, Bangalore, 12 January 2014 (xi) Sentence completion test for children for trainee counsellors. Prasanna Counseling Centre, Bangalore, 25 January 2014 (xii) Testing of intellectual functions. Regional workshop organized by Karnataka Government for Officers from the Department of Disability, 7 Februrary 2014 (xiii) Child Psychotherapy. CME, Department of Child Psychiatry, DY Patil medical college and Hospital, Mumbai, 28 February 2014. 77. Hurmath Fathima K, Nandakumar DN. Role of IL-1beta on proliferation and activity of gelatinase subfamily of MMPs in U87MG glioma cells. 33rd Annual Convention of Indian Association for Cancer Research, Kollam, Kerala, 13-15 February 2014. 78. Indupriya B, Jamuna Rajeswaran, Nupur Pruthi. Creativity and cognitive functions in traumatic brain injury. 40th National Annual Conference of Indian Association of Clinical Psychologist. SRM Medical College, Hospital and Research Institute, Kattankulathur, Chennai. 28 January-2 February 2014 (Best Paper Award) 79. Jagath Lal G. Cranio-orbital meningiomas: Management and Outcome. 15th Annual Conference of Skull base society of India. Postgraduate Institute of Medical Education and Research, (PGIMER), Chandigarh, 5 October 2013. 80. Janardhan Reddy YC. (i) Childhood OCD. IPS, Karnataka Chapter PG CME, KS Hegde Medical Academy, NITTE University, Mangalore, February 2014 National Institute of Mental Health and Neuro Sciences / 255 Annual Report 2013-14 (ii) Cognitive-behavior therapy of obsessions. Art of Psychiatry, Indian Association of Private Psychiatry. Puri, Orissa, 2013 (iii) Clinical course and outcome in OCD. Workshop, CBT: Applications in Emotional Disorders. NIMHANS, Bangalore, 2013 (iv) Classification of OCD & related disorders: DSM 5 & ICD 11. CME, organized by the IPS, Karnataka chapter and NIMHANS, February 2014 (v) Treatment of Bipolar depression. Symposium, World Bipolar day. Organized by the Asha Hospital, Hyderabad. March 2014. 81. Janardhana N. CBR and mental illness. ROSES Conference, 8-9 March 2014 82. Janardhanan CN. Deficient hippocampal activation during learned irrelevance in high risk subjects of schizophrenia: an fMRI study. Annual National Conference of the Indian Psychiatric Society, January 2014. (Young Psychiatrist Award) 83. 84. 85. 86. Jayanthi KN. Legal guidelines for nurses. One day Seminar Dr. RN Moorthy Continuing Nursing Education, Legal and Ethical issues in nursing. NIMHANS, Bangalore, November 2013. Jayaram M. Age related changes on hearing and perception of speech. National Conference,Ageing and its Effects on Hearing, Speech, Language and Communication. Institute of Speech and Hearing, Bangalore, 19-21 September 2013 (ii) Plagiaism in scientific writing. 46th Annual Conference of the ISHA. Kochi, 5-7 February 2014. Jitender Saini (i) Cross sectional anatomy of neck. CME, Neck Imaging. Davangere, 20 April 2013 (ii) Imaging of demyelinating disorders. CME, Advanced Imaging Techniques. NIMHANS, Bangalore, 12 May 2013 (iii) Imaging in Parkinson’s disease. Parkinson’s disease Education Programme for Neurology, Neurophysiology Students. Bangalore, 5-7 March 2014. John Vijay Sagar K. (i) Psychiatric emergencies in children and adolescents. Pedicriticon -2013 (State Conference of IAP Intensive Care Chapter of Karnataka and 3rd North Karnataka CME of IAP), May 2013 (ii) Psychosocial issues in adolescence. Bangalore Obstetics and Gynaecology Society CME, September 2013 (iii) Mental health disorders in adolescents in life skills educators’ Workshop on Empowering Adolescents – Promotion of Psychosocial Competence using Life Skills Education, NIMHANS, 27 September 2013, 14 March 2014. (iv) School refusal. Indian Academy of Pediatrics-Tumkur Chapter CME, November 2013(v) Specific learning disorders. Seminar on learning disability (Steps to strides) organized by Times Foundation at Gems Business School, Bangalore, 14 December 2013 (vi) Evaluation and Management of ADHD. Psychiatry PG CME, KSHEMA, Mangalore, February 2014. 87. Joshi PG. (i) Signaling networks in the brain: Role of neuron-glia crosstalk. Recent Perspectives in Biophysics. PGIMER Chandigarh, 11 May 2013 (ii) New insights into brain signaling: Neuron-glia crosstalk. ICMR Workshop for Advancement of Physiological Sciences in India, Bangalore, 21-22 September 2013. 88. Jothimani G. (i) (a) Assessment of prevalence, knowledge, attitude, behavior and interpersonal factors related to the use of tobacco among adolescents (b) Knowledge and attitude on tobacco use among adolescence. National Conference of Indian Society of Psychiatric Nurses, St. John’s College of Nursing, Bangalore, 8-10 February 2014. 89. Jyothi EK, Anjana Shenoy, Ravikumar R. A clinical isolate of blandm-1 positive pseudomonas putidain a tertiary care hospital.MICROCON 2013, Hyderabad, 20-24 November 2013. 90. Kailash S, Chethan B, Suresh VC, Umamaheshwari V, Vinutha R, Waghmare A, Kumar CN, Sivakumar T. Comparison of disability assessed on different versions of 12 items WHODAS 2.0 in psychiatric patients. National Conference on Research and Service in Psychosocial Rehabilitation, NIMHANS, 8-9 March 2014. 91. Kamal Kishore. (i) Application of generalized estimating equations technique for handling longitudinal data with MCAR and MAR pattern. 12th Biennial Conference of International Biometric Society- Indian Region. National Institute for Research in Tuberculosis, Chetput, Chennai, 27-28 December 2013 (ii) Comparing linear mixed model and generalized estimating equations techniques for longitudinal data. 31st Annual Conference of Indian Society for Medical Statistics, Christian Medical College, Vellore, 24-26 October 2013. 92. Kavitha P, Sekar K. (i) Evolution of devadasi system from family and societal perspective. 32nd Annual ISPSW, Karnataka State Women’s University, Bijapur, 20-22 January 2014. 256 / National Institute of Mental Health and Neuro Sciences Annual Report 93. 94. 95. 96. Kori A, Ahmed A, Muralidhar D, Reddy D, Hamza A. Spectrum of psycho-social interventions in psychiatric social work setting- review of case records at NIMHANS. 32nd National Annual Conference of the Indian Society of Professional Social Work, Bijapur, 20-22 January 2014. (Mr. Ashok Kori, was awarded the Gold Medal) Kumar CN. Community based rehabilitation: the NIMHANS experience. Research and Services on Psychiatric Rehabilitation: Focus on Recovery, NIMHANS, March 2014. Kumar D. (i) Psychological perspective/understanding of children and adolescents in conflict with law; Application of Psychology in forensic set-ups. Refresher Program, Odissa Judicial Academy, Cuttack, 26 December 2013 (ii) Shaking the unshakeable: Metacognitive therapy for delusions. Annual National Conference of the Indian Psychiatric Society, Pune, 16-19 January 2014 (iii) Psychotherapies for psychotic experiences: contributions of translational psychological research. National Annual Conference of the Indian Association of Clinical Psychologists, Chennai, 28 February- 2 March 2014 (iv) Cognitive aspects of psychiatric rehabilitation. ROSES Conference, Psychiatric Rehabilitation services, NIMHANS, Bangalore, 8-9 March 2014 (v) How to motivate an interviewee during interview process: Strategies that can be helpful in enhancing information gathering. Development of a Curriculum to Train Investigative Officers in Scientific Interviewing Methods, NIMHANS, Bangalore, 23 December 2014. Kumar KJ (i) Psycho-somatic and memory management. Half a day workshop for Professional Certificate Programme on tea tasting and Marketing. Indian Institute of Plantation Management. Govt of India, Bangalore, 18 June 2013 (ii) Neuropsychology: the brain behaviour relationship. Orientation to Clinical Psychology Programme for Masters’s level students (Psychology) of various Universities, NIMHANS Bangalore, 3-4 November 2013 (iii) Emerging trends in neuropsychological rehabilitation. One day workshop, National Seminar on Neuropsychological Rehabilitation, Ethiraj College for Women, Chennai, 18 December 2013 (iv) (a) Preconference workshop, Neuropsychological Rehabilitation in Head Injury 27 February 2013 (b) Cognitive retraining in Schizophrenia. 40th National Conference of Indian Association of Clinical Psychologist, Kattankulathur, Chennai, 27 February-1 March 2014 (v) Cognitive aspects of psychiatric rehabilitation. National 2013-14 Conference on Research and Services in Psychiatric Rehabilitation: Focus on Recovery. NIMHANS, 8-9 March 2014. 97. Kumar N, Mohan V, Sinha S, Anand A, Satishchandra P. Role of ABCB1 and ABCC2 genes in drug resistant partial epilepsy: A study from south India. IANCON 2013. Indore, 24-27 October 2013. 98. Kumar R, Kumar KJ, Benegal V (i) Underlying hypothesis of decision making process on iowa gambling task. International Integrated Clinical Neuroscience Forum, New Delhi, 14-15 September 2013 (ii) Impulsivity might be a predisposing vulnerability for high risk alcoholism. International Conference on Cognition, Emotion and Action. IIT Gandhinagar, Gujrat, 6-8 December 2013 (iii) Alcoholism: an understanding from neuropsychology perspective. 2nd International Conference, Recent Advances in Cognition and Health, BHU, Varanasi, 23-25 January 2014. 99. Lakshmanan Sethuraman, Deepak Jayarajan, Arun Kandasamy, Ngaitlang Mary Tariang, Prabhat Chand, Pratima Murthy, Vivek Benegal.Centre for Addiction Medicine. CAM after care services – 1year follow-up of in-patients with substance use disorders. National Conference – Psychiatric Rehabilitation Services and Research, 7-8 March 2014. 100. Lakshmi J, Paulomi M. Sudhir, Eesha Sharma, Shyam Sundar A, Janardhan Reddy YC. Mindfulness integrated cognitive behavior therapy with a patient with body dysmorphic disorder. 46th Annual Conference of Indian Psychiatric Society South Zone/ Kumarokam, 18-20 October 2013. 101. Lakshmi J, Sudhir PM, Sharma E. Shyam Sundar, Reddy YCJ. Mindfulness integrated CBT with a patient with body dysmorphic disorder. 46th Annual Conference of the Indian Psychiatric Society-South Zone branch, Kumarakom, Kottayam, Kerala, 19 October 2013. 102. Lalitha K. (i) Innovations towards nursing excellence Regional Workshop – Organised by M.Sc Nursing Students, Dayananda Sagar College of Nursing, Bangalore, 3 April 2013 (ii) Revelation of Nursing Informatics. Workshop organized by PG students, AECS Maaruti College of Nursing, Bangalore, 3 April 2013 (iii) Ward management techniques. Workshop, Strengthening the Role of Nursing Administrators, Sri Jayadeva Institute of Cardiovascular Sciences and Research, Bangalore, 4 National Institute of Mental Health and Neuro Sciences / 257 Annual Report 2013-14 May 2013 (iv) Interpersonal relationship for a teacher & student mentoring, two-Day Workshop,Institutional Integration and Enhancing Teaching Effectiveness, Kristu Jayanthi College, Bangalore, 4 June 2013 (v) Empowering nursing practice – Breaking complexities. National Conference, Avant Gardism – Cutting edges in Nurse Learning– Context Based Learning , Saveetha College of Nursing, Tamil Nadu, 14 June 2013. (vi) (a) Overview of Nursing Theories (b) Utilization of theories in practice in psychiatric nursing speciality. National Conference, Theoretical Foundations & its applications in Nursing. RVS College of Nursing, Coimbatore, 12 July 2013 (vii) (a) Perinatal psychiatric disorders (b) Ethical and legal issues in promoting the mental health rights of the vulnerable. National Nursing Conference. Theme: Nursing insight into the Mental Health of Vulnerable, Ganga Institute of Health Sciences, Coimbatore, 14 September 2013 (viii) Policies and programmes for Senior Citizens.National Conference–Dhanalakshmi Srinivasan College of Nursing.Tamil Nadu. 12 October 2013 (ix) Types of quantitative research and selection of research problem. Epidemiology of Chronic Diseases: Nursing Research Perspectives. 17th NRSI Annual National Conference–Theme: Manikaka Topawala Institute of Nursing, Gujarat, 25-27 October 2013 (x) (a) Analysis of quantitative research (b) Common ethical issues in nursing research (c) Concept of standardized tool, validity of measuring instruments, tools for data collection (d) Conducting qualitative nursing research (e) Determining the limitations of research study (f) Developing CFW for research (g) Ethics in Nursing research (h) Interpretation and dissemination of qualitative findings (i) Manuscript writing (j)Population and sampling (k) Preparing a research protocol (l) Sample size determination (m) Tool testing and Pilot study (n) Tools and data collection (o) Validity of measuring instrument (p)Vital Health Statistics. M.Sc Nursing students – LGB Regional Institute of Mental Health, Tezpur, Assam, 1-3 November 2013 (xi) Patients rights and application of basic ethical principles in nursing practice Ethical and Legal Guidelines for Nurses. Dr. Ramachandra N. Moorthy CME-One Day Seminar. College of Nursing, NIMHANS, Bangalore, 27 November 2013 (xii) Changing the outlook of quantitative research. National Level Workshop, Building on the Best: Accentuating your expertise in research and statistics. Organised by Continuing Education. Department of JSS College of Nursing. Mysore, 16 December 2013 (xiii) (a) Research Design as applied in Nursing Research (b) Research problem selection (c) Tool preparation (d) Standardisation of tools reliability and validity. Pre Ph.D Workshop. PD Hinduja College of Nursing, Mumbai, 24 January 2014 (xiv) Suicide and its Management. One Day Workshop, Psychiatric Emergencies and its management. Funded by Dr. RN Moorthy Foundation Funds, Dept. of Nursing, NIMHANS, Bangalore, 26 February 2014. 103. Lavanya CH, Chetan GK, Sibin MK, Manoj MJ, Bharath MM. Promoter methylation of PTEN gene in high grade gliomas. 39th Indian society of Human Genetics Annual Conference, Ahmedabad, 22-25 January 2014. 104. Lavanya TP, Manjula M. Emotion regulation and psychological problems among college students. National Annual Conference of Indian Association of Clinical Psychologists, SRM University, Chennai, Tamil Nadu, 28 February - 2 March 2014. 105. Laxmi T Rao. (i) Environmental manipulation in early and late in life on adult brain plasticity. 31st International Annual Conference of Indian Academy of Neurosciences. Emerging trends and challenges in Neuroscience. Allahabad, Uttar Pradesh, 25-27 October 2013 (ii) Research Methods Pre-conference appicon 2013.DST Sponsored Workshop, Emerging Trends in Neurophysiology: From Cell to Systems. NIMHANS, Bangalore, 26 November 2013 (iii) Stress and cognition: historical and functional analysis. 4th National Workshop, Emerging Hope: Neurofeedback Training. NIMHANS, Bangalore, 18-20 November 2013 (iv) Early life Stress and cognition: Historical and functional analysis. in: Brain and Cognition Workshop Bangalore 8-21 December 2013 (v) The emotional brain. Mind Science. 10th Youth Interfaith Piligrimage program 2013, Foundation for Universal responsibility of his Holiness the Dalai Lama, NIMHANS, Bangalore, 8 August 2013. 106. Leeshma K, Jamuna Rajeswaran, Nupur Pruthi. The effect of traumatic brain injury on cognitive and behavioural functions in adolescents. 40th National Annual Conference of Indian Association of Clinical Psychologist, SRM Medical College, Hospital and Research Institute, Kattankulathur, Chennai. 28 January-2 February 2014. 107. Madhavadas S, Kutty BM, Subramanian S. Development of non-transgenic animal model for Alzheimer disease. 59th Annual National Conference of Association of Physiologists and Pharmacologists of India. Bangalore, 28-30 November 2013. 258 / National Institute of Mental Health and Neuro Sciences Annual Report 108. Madhusudana SN, Manjunatha MV, Reeta Mani. Dual role of immune response in rabies encephalitis. Studies in mice and their implications in human disease. 15th National Conference of the Association for Prevention and Control of Rabies in India, 6-7 July 2013. 109. Mahati K, Bhagya V, Christofer T, Raju TR, Shankaranarayana Rao BS. Concomitant enriched environment and antidepressant treatment restores depression-induced aberrant neuronal plasticity and impaired spatial learning. 59th Annual Conference of the Association of Physiologists and Pharmacologists of India, Bangalore, 28 - 30 November 2013. 110. Malla Bhaskara Rao. (i) Selective amygdalohippocampectomy and anterior temporal lobectomy. 13th ISSFN meeting. New Delhi, 14-15 September 2013 (ii) How to develop epilepsy surgery programmes in India. 62nd Annual meeting of the NSI, Mumbai (iii) Epilepsy Surgery. Neurovision. Visakhapatnam, 31 August - 1 September 2013 (iv) Surgery for temporal lobe epilepsy. 3rd Annual Conference of the Karnataka Neurosciences Academy, 15-16 June 2013 (v) Surgery for epilepsy. CGHS Doctors Forum as chief guest, Bangalore. 111. Maltesh Kambali, Pradeep K Mishra, Preethi Hegde and Laxmi TR. Classical fear conditioning: a model for associative learning and memory. APPICON 2013: Preconference Workshop, Current Physiological Techniques from Basics to Applied Aspects: Emerging trends in Neurophysiology from Cell to System; NIMHANS, Bangalore, 26 November 2013. 112. Manjula M (i) Handling exam stress effectively. Workshop for Engineering students. Indian Institute of Technology, Hyderabad, 3 April 2013 (ii) Stresscauses, responses and coping; improving self esteem – helpful thinking. Workshop, Meeting the Challenge: A workshop on Handling Academics Effectively. Christ Pre-University Residential College, Bangalore, 1112 June 2013 (iii) Stress and common mental health problems in students; academic stress: assessment and management; heterosexual relationships in young people: issues and intervention. Making a difference: A workshop on Youth Mental Health for College Counselors, NIMHANS, Bangalore, 11-12 July 2013 (iv) Women mental health. Workshop- Health Education for Mental, Neurological and Substance Abuse Disorders for Lady Health Visitor Trainees. NIMHANS, Bangalore, 2013-14 22-26 July 2013 (v) Cognitive behavioural assessment; cognitive model of depression; behavioural strategies in CBT. Cognitive Behaviour Therapy: Principles and Applications, NIMHANS, Bangalore, 13-14 August 2013 (vi) Counseling: basic principles and skills. Training of Counselors under the National Programme for Prevention and Control of Cancer, Diabetes, Cardiovascular diseases and Stroke. NIMHANS, Bangalore, 20 August 2013 (vii) Essentials of interpersonal relationships; making and maintaining romantic relationships. Maintaining healthy relationships. A Workshop for Youth. Indian Institute of Science, Bangalore, 19 September 2013 (viii) Stress identification and management techniques. Stress management Training Program For Managers Toyota Motor Private Limited, Bidadi. NIMHANS, Bangalore, 5 October 2013 (ix) Essentials of interpersonal relationships and counseling in romantic relationships. Workshop, Maintaining Healthy Interpersonal Relationships for Youth. NIMHANS Centre for well being, Bangalore, 12 November 2013 (x) Cognitive behavioral assessment in OCD: identifying dysfunctional beliefs and assumptions; Cognitive behavioural models and assessment in social phobia. Workshop, CBT: Applications in Emotional Disorders. NIMHANS, Bangalore, 15-16 November 2013 (xi) Facing exams effectively. (a) Workshop for Post Graduate Students of Jain University. Bangalore, 6 April 2013 (b) NIMHANS Centre for Well Being, Bangalore, 1 March 2013, 7 December 2013 (xii) Emotions and its regulation. Workshop, Emotion Regulation for Healthy Living. NIMHANS Centre for Well Being, Bangalore, 21 December 2013 (xiii) Women mental health issues and challenges. UGC Sponsored two day National Seminar, Psychological Issues and Challenges Related to Women and Children. Mahrani’s Arts and Commerce College, Bangalore, 21-22 March 2014 (xiv) Basic skills of counseling. Training-cum-refresher Program for Family Counseling Centre Stakeholders. NIMHANS, Bangalore, 18 March 2014. 113. Manjula M, Seema P Nambiar. Stress management. Trainees from Shimla. NIMHANS, Bangalore, 27 December 2013. 114. Manjula V. Managing healthy relationships – making and maintaining healthy relationships, dealing with break ups. 40th National Annual Conference of Indian Association of Clinical Psychology, Chennai, 28 February-2 March 2014. 115. Manjula. Screening for the novel potential therapeutic modulators for the flip form of ionotropic glutamate National Institute of Mental Health and Neuro Sciences / 259 Annual Report 2013-14 receptors 2 (iGluA2). Recent Advances in Computational Drug Design, Bangalore, 16-17 September 2013. 116. Manjunatha MV, Nandita Hazra, Ashwin Belludi, Reeta Mani, Madhusudhana SN. Th1 and Th2 cell responses following intradermal administration of rabies vaccineA preliminary study. 15th National Conference of the Association for Prevention and Control of Rabies in India, Pune, 6-7 July 2013. 117. Manoj MJ, Chetan GK, Rao KVL, Venkatesh HN, Sibin MK, Lavanya CH. The role of direct DNA repair gene O6methylguanine-DNA methyltransferase (MGMT) in high grade malignant glioma. 39th Indian Society of Human Genetics Annual Conference, Ahmedabad, 22-25 January 2014. 118. Mariamma Philip. Structural equation modelling approach in handling missing data. 31st Annual Conference of Indian Society for Medical Statistics, Christian Medical College, Vellore, 24 -26 October 2013. 119. Masoom Abbas Kulkarni, Girish Baburao, Mustare Veerendrakumar. Subcutaneous unfractionated heparin followed by oral anticoagulation in deep cerebral venous sinus thrombosis (dcvt). National Conference of Indian Stroke Association-2014, Trivendrum, 14-16 March 2014. 120. Mathur S, Sharma MP, Bharath S. Effectiveness of mindfulness based cognitive therapy for late life depression. 40 th National Annual Conference of Indian Association of Clinical Psychologists, SRM University, Kattankulathur, Chennai, 28 February-2 March 2014. 121. Mathuranath PS. Epidemiology of dementia: current status in India. 21st Annual Conference of the Indian Academy of Neurology. Indore, 24-27 October 2013. 122. Maya Bhat. Demonstration of hemorrhage in the wall of pyogenic abscess using susceptibility weighted imaging. 16th Annual Conference of Indian Society of Neuroradiology, Bangalore, 26- 29 September 2013. 123. Meeka Khanna. Prevalence of fatigue in patients with Guillain Barre syndrome in neurological rehabilitation setting. 8th Annual Conference of Indraprastha Association of Rehabilitation Medicine - DELHI PMRCON 2014. New Delhi, 1-2 March 2014. 124. Meena KS. Quality of life of persons with mental illness staying in a psychiatric rehabilitation centre and home: a comparative study. National Conference, Research and services in Psychiatric Rehabilitation with focus on Recovery. NIMHANS, Bangalore, 8-9 March 2014. 125. Megha Rupa. (i) Child development. Training of Trainers on Child Protection organized by UNICEF in collaboration with CCCYC, Bangalore, 8-13 February 2014 (ii) Development of videos: An innovative approach to parent training. 40th National Annual Conference of Indian Association of Clinical Psychologists, Chennai, 28 February-2 March 2014 (Best Paper Award) 126. Mehrotra S (i) Counseling skills. Life Skills Educators Workshop on Empowering Adolescents training, NIMHANS, Bangalore, 26-28 September, 2013, 1315 March 2014 (ii) Mental health promotion. In Orientation to Clinical Psychology: Emerging areas Seminar, NIMHANS, Bangalore, 3-4 December 2013 (iii) Encouraging volunteerism? In Recovery Oriented Services for the mentally ill. National Conference on Research and Services in Psychiatric Rehabilitation, NIMHANS, Bangalore, 8-9 March 2014. 127. Mehrotra S, Tripathi R. Positive psychology: what? how? where? National Workshop, Research Survey and Exploration in Psychology (6th ICSSR Survey), NIMHANS, Bangalore, 21 September 2013. 128. Modi Mehul Navin Chandra. Value of indocyanine green dye videoangiography in intracranial aneurysm surgery – A perspective from a tertiary medical centre in a developing country. NEUROVASCON 2013, Cerebrovascular Society of India. Hyderabad, September 2013. (Best Paper Award) 129. Mohd Afsar, Jamuna Rajeswaran. Neuropsychological profile in juvenile onset Schizophrenia. 4th Continuing Education in Neuropsychology-Neuropsychological Rehabilitation-Emerging Hope: EEG NFT, NIMHANS, Bangalore, 18-20 November 2013. 130. Mohit mittal. Stunned myocardium following triple HHH therapy. ISNACC 2014, Jaipur, 31 January- 2 February 2014. 131. Nagarathna S. Central nervous system infection and its laboratory diagnosis. National Conference on Driving Stem Cell Research Towards Therapy a Vision of the Future. 20-21 March 2014. 260 / National Institute of Mental Health and Neuro Sciences Annual Report 132. Nandakumar DN, Hurmath FK, Palaniswamy R. IL-1β mediates migration and invasion of glioma cells in a p53independent manner. 33rd Annual Convention of Indian Association for Cancer Research. Kollam, Kerala, 13-15 February 2014. 133. Nandakumar DN, Palaniswamy R. Anti-oxidant status and activated NMDA receptors in glioma. 82nd Annual Meeting of Society of Biological Chemists, India. University of Hyderabad, 2-5 December 2013. 134. Nandakumar DN. Glutamate receptors and cytokines in progression of primary brain tumour. National symposium, Cancer Biology, Mysore, 29-30 November 2013. 135. Narasinga Rao KVL. Brain and Cognition. Short term training program. Department of Medical Electronics, BMS College of Engineering, Bangalore. 8 January 2013. 136. Narayana DH, Madhusudana SN, Sampath G, Tripathy RM, Sudarshan MK. Safety and immunogenicity study of a new purified chick embryo cell rabies vaccine vaxirab-n (pitman moore strain) manufactured in India. 15th National Conference of the Association for Prevention and Control of Rabies in India, Pune, 6-7 July 2013. 137. Nathan D, Narasimha VL, Ravishankar V, Kumar CN, Thirthalli J, Sivakumar PT, Bharath S, Mathew V, Gangadhar BN. Electroconvulsive therapy in the elderly-a: five year retrospective chart review. ECT Symposium, NIMHANS, Bangalore, December 2013. 138. Nayak C, Sinha S, Nagappa M, Thennarasu K, Taly AB. Relation of sleep related events & spontaneous arousals during sleep in Juvenile Myoclonic Epilepsy patients as compared to Normal Subjects. Colloquium in Drug Resistant Epilepsy. Bangalore, 16 -18 August 2013. 139. Nesin M, Raju TR, Laxmi TR. Rotarod: motor behavioral testing. APPICON 2013: Pre-conference Workshop, Current Physiological Techniques from Basics to Applied Aspects: Emerging trends in Neurophysiology from Cell to System. NIMHANS, Bangalore, 26 November 2013. 140. Nirmala BP (i) Recovery-oriented services at NIMHANS: Psychiatric social work services. Annual National Conference of the World Association of Psychiatric Rehabilitation, Calicut, Kerala, 20-21 July 2013 (ii) Recovery oriented mental health services for women 2013-14 innovation from social work perspective. 32nd Annual ISPSW, Karnataka State Women’s University, Bijapur, 20-22 January 2014 (iii) Family and Community Responsibility in Placement of Persons with Intellectual Disability. National Conference, Employment Leading to Independent Living of Persons with Intellectual Disability, NIMH Secunderabad, 25-27 February 2014 (iv) (a)Role of families in the rehabilitation of psychiatrically disabled: Medication adherence.(b) Team presentation on Recovery Oriented Services in Psychiatric Rehabilitation services ROSes Conference. 8-9 March 2014. 141. Nupur Pruthi (i) Making screw insertion in C2 vertebra safer: Clinical application of a novel CT based grading system. 3rd Annual Conference of Karnataka Neurosciences academy, Bangalore, 15-16 June 2013 (Best Paper Award) (ii) CV junction anomalies. 16th Annual Conference of Indian Society of Neuroradiology, Bangalore, 26-29 September 2013. 142. Padmanabhan B (i) BET family proteins as therapeutic targets in major diseases. 42nd National Seminar on Crystallography and International Workshop on Application of X-ray Diffraction for Drug Discovery, New Delhi, 21-23 November 2013 (ii) The Keap1-Nrf2 pathway: A potential therapeutic target in neurodegenerative diseases. 6th International Symposium on Recent Trends in Macromolecular Structure and Function, Chennai, 2224 January 2014 (iii) Identification of BRD2 inhibitors by structure-based drug design method. Colloquium on Drug Resistant Epilepsy, Bangalore, 16-18 August 2013. 143. Padmavathi N. A study to assess tobacco use among adult men. Indian Society of Psychiatric Nurses Conference. St. John’s College of Nursing, Bangalore, February 2014. 144. Padmavathy D, Ragesh G. A brief skill-based gatekeeper training program for suicide prevention. NIMRCPSYCON 2014. Second Joint Conference of the Department of Psychiatry, NIMHANS, India & The Royal College of Psychiatrists, UK, 7-8 March 2014. 145. Palaniswamy R, Hurmath Fathima K, Nandakumar DN. NMDA receptor mediated proliferation and activation of MMP-2 on glioma. 82nd Annual Meeting of Society of Biological Chemists, India, University of Hyderabad, 2-5 December 2013. 146. Paramita B, Revathi S. Psychosocial consequences among women survivors of Uttarakhand flood disaster. 32nd National Institute of Mental Health and Neuro Sciences / 261 Annual Report 2013-14 Parkinson’s disease. Parkinson’s disease Education Program, Understanding parkinson’s disease: from clinics to basics, NIMHANS, Bangalore, 5-7 March 2014. Annual National Conference of ISPSW 2014, Bijapur, 22 January 2014. 147. Paramita Bhowmick. Empowerment of women in disaster management. 32nd Annual National Conference of ISPSW 2014. Bijapur, Karnataka, 20-22 January 2014 (Best Paper Award) 148. Paritosh Pandey (i) Surgery for ischemic cerebrovascular diseases. Neurosurgery update, May 2013, Mumbai (ii) Surgery for AVMs- an underutilized treatment, Radiosurgery update. New Delhi, April 2013 (iii) Surgery for ischemic cerebrovascular lesions. Cochin Neurological Association, June 2013 (iv) Pediatric Moyamoya disease. Annual Conference of Indian Society of Pediatric Neurosurgery, Udaipur (v) Rational management of intracranial avms: surgery, radiosurgery and embolization. Annual Conference of Neuro Surgeons Society of India, Rishikesh, February 2014 (vi) (a) STA_MCA bypass (b) Carotid Endarterectomy (c) Surgery for Intracranial AVMs. Annual Cerebrovascular update, Bangalore, February, 2014 (vii) How I do it: Surgery for peritrigonal AVMs. Dandy Society Meeting, Mahabalipuram, January 2014 (viii) Surgery for moyamoya disease. Annual Conference of Indian Society of Cerebrovascular Surgery, Hyderabad (ix) (a) Future research in traumatic brain injuries: surgeon’s perspective (b) Geriatric head injuries. First Annual AIIMS Neurotrauma Conference, New Delhi. 149. Patil SA, Sharma N, Sinha S, Satishchandra P. Antiheat shock protein -65 (HSP-65) antibodies in epilepsy. Colloquium in Drug Resistant Epilepsy, Bangalore, 16-18 August 2013. 150. Paulomi MS, Singhal M, Sudhir PM, Manjula M. Understanding and managing emotions. Workshop, Making a Difference: A Workshop on Youth Mental Health for College Counsellors. Department of Clinical Psychology, NIMHANS, 11-12 July 2013. 151. Phalguni Anand Alladi. (i) Role of glia in amyotrophic Lateral Sclerosis pathogenesis: to care for or create chaos? 21st Indian Academy of Neurosciences meet. Allahabad. 25-27 October 2013 (ii) Does the brain Age? Indian acience Academies. Workshop, Sense and Sensibility, Mumbai, 20-21 December 2013 (iii) Interaction and advice to masters’ students of Neuroscience. INSA sponsored Lecture. Mumbai, 20-21 December 2013 (iv) Neuroanatomical parallels between aging and 152. Pooja Shree Mishra, Dinesh K Dhull, Anu Mary Varghese, Vijayalakshmi K, Sathyaprabha TN, Nalini A, Phalguni Anand Alladi, Raju TR. Astroglial and microglial responses in an experimental model of Sporadic Amyotrophic Lateral Sclerosis. 31st Annual Conference of Indian Academy of Neuroscience, October, 2013. 153. Prabha S Chandra (i) Prescribing dilemmas in pregnancy and lactation. West Zone Annual Conference-2013, Goa, 18-20 October 2013 (ii) Psychotropic Medications in Pregnancy & Lactation. Neuropsychopharmacology Update – 2014, 23 February 2014. 154. Prabhuraj AR. Specturm of Intracranial fungal masses – NIMHANS experience. Annual Conference of Neurological Society of India, Mumbai, 12-15 December 2013. 155. Pradeep Kumar Mishra, Bindu M Kutty, Laxmi TR. Early maternal separation stress during stress hyporesponsive period in rats affects both fear memory and fear extinction. International Symposium on Neurosciences and 31st Annual Conference of Indian Academy of Neurosciences and Local Chapter of IAN, Allahabad, 25-27 October 2013. 156. Pradeep Kumar Mishra, Bindu M Kutty, Laxmi TR. Early maternal separation during stress hyporesponsive period evokes age-dependent changes in retention and extinction of fear memory in male Wistar rats. 59th Annual Conference of Association of Physiologists and Pharmacologists of India. NIMHANS, Bangalore, 28-30 November 2013. 157. Pradeep Kumar Mishra, Preethi Hegde, Laxmi TR. Neural correlates of fear memory and fear extinction: Single and multi-unit recordings in freely moving rats. APPICON 2013: Pre-Conference Workshop, Current Physiological Techniques from Basics to Applied Aspects: Emerging trends in Neurophysiology from Cell to System, NIMHANS, Bangalore, 26 November 2013. 158. Pragyan Sharma. Subacute and Chronic subdural hematomas in young populations less than 40 years. 22nd Annual Conference of Neurotrauma Society of India, Guwahati, 23-25 August 2013. (Awarded Shri Suresh Kare Indoco Remedies, Best Poster 2nd Prize.) (NSI – Neurosurgery award). 262 / National Institute of Mental Health and Neuro Sciences Annual Report 159. Prakasha LM. (i)Advanced Infection Imaging. RITE 2013, Sree Ramachandra Medical College, Chennai, 1415 November 2013 (ii) T2* Perfusion in tumors. Annual CME Society of Indian Radiographers, Pondicherry, 2-3 October 2013. 160. Pramod Kumar Pal. Sleep disturbances in Huntington’s disease. 21st Annual Conference of Indian Academy of Neurology. Indore, Madhya Pradesh, 24-27 October 2013 (ii) Clinical case discussion on basal ganglia. SHINE 2013, Chennai, 27 April 2013 (iii) (a) Diagnosis of Parkinsonism: pearls & pitfalls, (b) DBS in Parkinson’s Disease: Past, Present and Future. Update on Parkinson’s Disease. Neuro-Club, Bhopal, 30 June 2013 (iv) Clinical approach to tremor. 3rd Annual Conference of the Karnataka Neurosciences Academy. NIMHANS. 16 June 2013 (v) Approach to Dystonia. Case Discussion on Dystonia. IAN Summer School of Neurology 2013. All India Institute of Medical Sciences, New Delhi, 1921 July, 2013 (vi)Parkinsonism plus syndromes. CME of 69th Annual Conference of Association of Physicians of India. Ludhiana, 20 February 2014 (vii) Psychogenic movement