XLC complete catalogue 2012/2013 English
Transcription
XLC complete catalogue 2012/2013 English
Collection trustworthy / innovative / high performance All XLC parts are also to be found in the main catalogue E. Wiener Bike Parts, in the corresponding ware groups! collection 2012- 2013 The quick line to the professionals ... ... when dialling this number, the next free line will be yours! Team Export Benelux Bernd Lesch Patrick Dietmar Cindy Cramer Linda Blattner Sonja Bausewein Tel.: 0 97 21 / 65 01 - 139 Tel.: 0 97 21 / 65 01 - 163 Tel.: 0 97 21 / 65 01 - 173 Tel.: 0 97 21 / 65 01 - 163 Tel.: 0 97 21 / 65 01 - 129 Tel.: 0 97 21 / 65 01 - Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 [email protected] [email protected] [email protected] [email protected] [email protected] [email protected] Team PL Team CZ Team Asia Team Denmark Marcin Burzyk Iva Lamberska Qi Fang Mads Egebjerg Søren Petersen Tel.: 0 97 21 / 65 01 - 130 Tel.: 0 97 21 / 65 01 - 128 Tel.: 0 97 21 / 65 01 - 164 Mobil: 20 23 77 01 Hotline: 70 23 77 01 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: 0 97 21 / 65 01 - 179 Fax: - Fax: - [email protected] [email protected] [email protected] [email protected] [email protected] Online Shop http://b2b.winora-group.com Louise Kellner Our strength lies in … (take a look at our online catalogue) Delivery within 48 hours Acces to more than 12000 articles 16000 articles to choose from Categories specially for novelties Availability up to 90% Special offers A great Branche on the market Real time availability indication A competent performance Individual functions 24 hours shopping in our online shop and a direct connection to our warehouse Managing of your goods in our system 3ULFHUHTXHVWVRQOLQHSRVVLEOH Shipment tracking Office hours Generate your own labels Monday until thursday 8h00 – 12h00 Monday until thursday 12h45 – 17h00 Friday 8h00 – 15h45 Tyres / Inner tubes ......................................... Clothing / Helmets ............................................. Lighting ...................................................................... Brakes ....................................................................... XLC and more as from Page 212 onwards Forks / Headsets .............................................. Luggage Racks ................................................... Bells / Stays Protection ................................... Chains ........................................................................ Gearshift Accessories ................................. Wheels ....................................................................... Handlebars, Stems and Grips ................... Bags ............................................................................ Pedals ......................................................................... Pumps ......................................................................... Saddles / Seat Posts .................................... Locks ........................................................................... Mudguards ............................................................. Kick stands ............................................................ Bike Computers.................................................... Bottom brackets ................................................ Mirrors, Bottles and Bottle Holders .. Tools ............................................................................ Hometrainers.......................................................... E. Wiener Original trustworthy | innovative | high perfomance XLC is a young international brand with a high technical standard. We offer bike components and accessories for every use. www.xlc-parts.com XLC sets the curse for an interactive future. Since 2010 XLC has been staging a completely new, independent internet appearance under www.xlc-parts.com. In the internet site, XLC does not only pay attention to clearness, but also to accuracy: detailed specifications and high definition photographs provide the user with up to date product information. With a three megapixel definition, no detail remains hidden in the zoom mode. XLC offers adequate parts for every bike and every use. Our components are perfectly adapted to the respective use, offering outstanding design and best quality. The XLC products benefit from our 100 years’ experience in bike construction. They must pass the hardest tests in everyday use before they are at last allowed to make bikers’ hearts beat faster. In the domain “XLC PARTS IN ACTION”, you can visualise the components in 3D animated graphics. XLC parts and accessories stand for functionality, fashion, comfort and technology … The family managed enterprise E. Wiener Bike Parts spans a bridge between its traditional values and forward-looking logistics/IT. The circle is completed by our innovative ware logistics, a semi-automatic storage system and a fully automatic forwarding system. E. Wiener Bike Parts supplies exclusively the specialised trade with over 13.000 different parts stored and commissioned in Schweinfurt. From here we supply Germany, Austria, France, Italy, Spain and all other bordering countries. The exclusive components brand XLC, with its unbeatable shop-in-shop system, gains importance increasingly. The wholesale trade E. Wiener Bike Parts and its exclusive brand XLC belong to the Winora Group, which includes the following brands: XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The Concept for success The Concept for Success Establish yourself Together with the Winora Group for the future. You want to present your Products in an attractive way? You need a competent & reliable Partner for your bike parts distribution? You want optimal Margins and high availability? You are aiming for a consistent appearance for your Products? Your planning, delivery and construction should be taken over by professionals? We offer you the best possible XLC Products presentation! Consistent and High Quality package! The XLC exhibition Panel will be provided according to the placement! Planning, construction and equipping will be taken over by us! Our XLC Back-office and our XLC account-managers will give you individual consultation! Page 4 www.xlc-parts.com Technical changes reserved. XLC SHOP CONZEPT x-cellent bike components 250 The T h e Concept C o n c e p t for f o r success success THE T HE EX EXHIBITION XHIBITION PAN PANEL E EL Standard Pa Panel nel Height 2 Pillars Heig ght 220 cm, Stand included 1 lower shelff panel 1 Back pane el smooth, 100 x 100 x 30 cm 4 Back Pane Panels els / perforated 100 x 40 1 Panel XLC 100 x 20 cm included. 50 collapsible e double hooks 30 cm shields in ncluded. *The Standar Standard rd Panel does not contain Lightn Lightning ning and Posterss Additional-Panel Ad Additional-P Panel and accessories: complete gondolas, On demand and to favourable conditions, we e additionally ionally offer you yo a comple ete shopfitting containing gondol as, various can directly trays ys for sho sshoes, oes, frames for textiles les and variou us presenters, which ch ca n be dire ectly integrated into the Panel. Shopping-experience S Shopp ping-e experie ence e for your costum costumer! co mer! Technical changes reserved. www.xlc-parts.com Page 5 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The Concept for success THE BASIC IDEA Before After A Non-Optimal Presentation! A blind arrangement of various products. An optimal display of the products by consistent package and attractive Presentation. THE XLC-CONCEPT FOR SUCCESS Vertical presentation of the products Shopping experience through subject areas on the self-service wall More impulse buying trough the Mix of consumables and articles of daily use Page 6 www.xlc-parts.com Technical changes reserved. XLC SHOP CONZEPT x-cellent bike components 250 The Concept for success THE CONSISTENT LABELLING All products and price information at a glance Individual Text changes are possible. THE SHOPPING MODULE Dynamically extendable XLC shop- concept Lightning Technical changes reserved. www.xlc-parts.com Page 7 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The T h e Concept C o n c e p t ffor o r success success SHOPPING-EXPERIENCE S HOPP PING-EXPERIENCE TH THANKS ANKS TO OE EXHIBITION XHIBITION -P -PANELS PANELS Page 8 www.xlc-parts.com Technical changes reserved. XLC SHOP CONZEPT x-cellent bike components 250 The Concept for success THE EFFECT Awakening Emotions by professional appearance Technical changes reserved. www.xlc-parts.com Page 9 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The Concept for success GROUP OVERVIEW Quality products for all Areas (city, trekking, mountain bike, road bike and kid’s bike) The Basic Line for active cyclists, who put emphasis on design, comfort, and durability. MATERIALS AND TECHNOLOGY: In this category we offer a very wide range of products for all needs around cycling. Thanks to the specific Product selection, you can find the well priced components of high quality. Top Design and best Quality, that is XLC COMP. the Sporty components will render your Bike a special touch. MATERIALS AND TECHNOLOGY: You can see by the lasered Logo on XLC COMP that even here we set a very high standard. With the use of the double-butted 6061 aluminium we do reach the best features in this Segment. XLC PRO sounds like a component Line that should be at the top of the Range. Good enough for the professionals? Yes, that’s right. XLC PRO meets all demands; because of the favourable prizes it leaves you financial scope for more dreams to come true. MATERIAL & TECHNIK: We use the same production technologies and materials on XLC Pro components as on XLC Pro LC. By using a bit more input we achieve a wider rang of application for the XLC Pro Parts. The complex multicoloured Thermotransfer Decor underlines the high quality of this Line. Your aspiration is high Tech for the road or for the use of cross country and marathon? XLC Pro SL will be the right components for your race bike! MATERIALS AND TECHNOLOGY: The components of the XLC PRO SL Line are custom made out of high-quality 7075 or 2014 T6 Aluminium alloys. Through the selective cold forging processing (3D forged / cold forged) we achieve increased stability by minimum weigh for the XLC Pro SL components. Page 10 www.xlc-parts.com Technical changes reserved. x-cellent bike components XLC SHOP CONZEPT 250 The Concept for success XLC-PACKAGE “Professional Header parts Presentation at the highest level.” (Quote: Radmarkt 07/07) Try-and-Buy package. The customer is allowed to give a first try and buy. Technical changes reserved. www.xlc-parts.com Page 11 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The T h e Concept C o n c e p t ffor o r success success Selected BrandBrand-Name Name e Products in addition to “XLC and More …” card d These are the products, whic which h are blister packed on own-bra own-brand and XLC cards. This will give you the opportunity to also offer popu popular ular brands, which the customer can pin point on the XLC wall, easily. e Thiss segment iss constantly con be being eing revised and adjusted. You have the opportunity to display displa ay your articles on a well-strucwell-structured wall. Thus you u can avoid d imbalanced presentation and packaging several kinds of pack ckaging on n the wall. Page 12 www.xlc-parts.com Technical changes reserved. x-cellent bike components XLC SHOP CONZEPT 250 The Concept for success THE PROCESS We take over: The planning The construction The Maintenance Technical changes reserved. www.xlc-parts.com Page 13 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The Concept for success ADVANTAGES OF THE XLC-CONCEPT High distributor margins Storage optimisation Time savings for your service Staff - Less consulting expenses - Simple maintenance and re-order The Wall Panel of XLC will be provided after agreed equipping More impulse Buying Professional appearance of your store Individual support - Data pool for your management system - Online shop link etc. - Support by our account manager Attractive marketing support - Homepage www.xlc-parts.com - Facebook - Sponsoring - Test in Trade Magazine - T-shirt, promotion items - OEM Supplier for Haibike, Winora, Staiger and Sinus Page 14 www.xlc-parts.com Technical changes reserved. x-cellent bike components XLC SHOP CONZEPT 250 The Concept for success GALLERY Technical changes reserved. www.xlc-parts.com Page 15 XLC SHOPNEWS ware group XLC SHOPNEWS ware group 250 XLC SHOP CONZEPT x-cellent bike components The Concept for success XLC WEBSITE www.xlc-parts.com XLC is a young, international Brand on a high technical level. We offer Bike components and accessories for all kinds of application. XLC sets the course for an interactive future. Since 2010 XLC presents its products on the website www. XLC-parts.com. with a completely new and independent internet presence. XLC does not only focus on clarity but also on the Detail. The detailed specifications and high resolution pictures provide the user an up-to-date information about the products. With a resolution of three megapixels every detail of the parts will be perfect illustrated in zoom function. XLC provides the suitable parts for every bike and every application. Our Bike components are perfectly matched to the respective fields of application with excellent Design and best quality. The XLC products benefit of our Know-how from 100 years bike manufacture. They must go through the toughest tests in everyday use, before they can inspire the cyclist. In the section “XLC Parts in Action” you can even visualize the components in a 3D Animation. XLC parts and Accessories represent the function, fashion, comfort and technology. TRADITION AND LATEST LOGISTICS UNITED – E. Wiener Bike Parts The family operated company E.Wiener Bike Pars bridges from traditional merits to trendsetting logistics/IT. With our innovative goods-logistics, a semi automatic warehouse-system and a fully automatic forwarding station it closes the circle. E.Wiener Bike Parts exlusively sells to retailers with more then 13000 diferend parts, which are stored and ordered in Schweinfurt. From here we supply al through Germany, Austria, France, Italy, Spain and all the adjacent countries. The Exclusive Component Branch XLC and its unbeatable shop-in-shop system are gaining importance. The E. Wiener Bike Parts Wholesale and its exclusive Branch XLC are counted to the WinoraGroup which included the following branches: Page 16 www.xlc-parts.com Technical changes reserved. XLC SHOP CONZEPT x-cellent bike components 250 The Concept for success Easy, quick and up-to-date THE ONLINESHOP http://b2b.bike-parts.de Easy article selection by the product review, or with the quickdatarecord. The availability of the products is shown by the green to red traffic light function. With only a few clicks you can create your own labels, with your own notations, article numbers and EAN-Codes. To a surcharge we will label your goods for you. After collecting the goods in your virtual basket, with just one touch of the button, the order will go to our warehouse. If a product should not be available, you can keep track of the goods by using a backorder list. The goods will be sent after as soon as possible. Technical changes reserved. www.xlc-parts.com Page 17 XLC SHOPNEWS ware group ware group 250 TABLE OF CONTENTS A C Additional brake lever . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 Adjustable quill stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122 A-Head handlebar stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .123 A-Head headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .99 A-Head Plugs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .97 A-Head Spacer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98 A-Head stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .123 A-Head stem elevation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .127 Allen key . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .201 Alu Bar Ends . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .128 Alu luggage rack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .103 Alu stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122 Apron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .206 Arm warmers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 Articulated hook wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .199 Assembly rack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .208 Assembly paste . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .208 Assembly wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 B Bag holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .143 Bar Ends . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .128 Bar Grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Bar tape . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .136 Battery lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Battery lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Battery lighting set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 Battery rear light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69 Bells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106 Bermuda shorts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .42 Bike brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 Bike chain fastening . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108 Bike chains . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108 Bike computer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .188 Bike glasses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 Bike gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 Bike helmets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28 Bike lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Bike mirror . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .193 Bike rack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .183 Bike tyres . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23 Biker socks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Biking jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 Biking shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 Biking tights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 BMX pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156 Boxer shorts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .44 Brake accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Brake accessories . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Brake cables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 Brake disc adjuster . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .202 Brake discs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .87 Brake duct cutter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .202 Brake duct holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Brake duct kits . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95 Brake lever . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .77 Brake levers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .77 Brake outer cover . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .81 Brake pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Brake pipe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Brake piston adjusting tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .202 Brake shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 Page 18 x-cellent bike components Cable Donuts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111 Cable lock . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .178 Cable pincers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .202 Cantilever brake shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 Cantilever brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 Cantilever-Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 Cargo Box . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140 Cartridge bake shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83 Cassette remover . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 Cell phone bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .143 Chain cleaning disc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .191 Chain fastener . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108 Chain guide pulley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110 Chain lock . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .180 Chain ring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .192 Chain ring screws . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .192 Chain rivet remover . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .203 Chain stays protector . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107 Chain tensioner . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110 Chains . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108 Chainset kickstand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .183 Children's brake lever . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 Children's jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 Children's saddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Children's tights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39 Chuck . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .202 City bracket . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 City saddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Cleaning set fo water bottles . . . . . . . . . . . . . . . . . . . . . . . . . . . . .197 Cleaning set for chain gear shifting . . . . . . . . . . . . . . . . . . . . . . . .204 Clip for outer sheaths . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Clothing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Combination locks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .178 Cone adjusting key . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .200 Cork grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .130 Crank dismantling tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 Cup holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .194 Cycle booties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 Cycle trainer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .209 D Damper pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .162 Disc Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .86 Disc brake adapter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88 Disc Brake Pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 Disc brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .86 Disc for Brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .87 Display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .186 Display for sunglasses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .50 Double bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .144 Double kickstands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .185 Driving tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 E Ergo Bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .117 www.xlc-parts.com Technical changes reserved. ware group TABLE OF CONTENTS x-cellent bike components 250 F Luggage rack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .103 Fashion Grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .132 Luggage rack bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .145 Flat Bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .117 Luggage rack box . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140 Foam Grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Foot pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .161 M Fork . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .97 Magnetic key . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Fork stem cutter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Magnetic rail . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .206 Frame bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .142 Measuring tape . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .206 Frame locks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .180 Messenger bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .143 Frame pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .162 Mini beamer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .73 Free ride pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156 Mini bells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106 Front Bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Mini pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160 Front light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Mirror . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .193 Front lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 MTB handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .117 Front wheel brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 MTB saddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .166 MTB shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 Mudguards . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .181 G Gear rim dismantling tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .199 Multi tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .200 Gear shift inner cables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .112 Multitool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .207 Gear shift outer sheaths . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .112 Gear shifting cable adjuster . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111 Gear shifting kit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .112 Gear shifting set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .112 Gel grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Gel pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .136 Gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52 Grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 N H Pedal straps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .156 Pedal wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .200 Pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .150 Plastics wheel protector . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .181 Plates for system pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .158 Plug-in mudguards . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .181 Pocket ratchet wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .204 Polo shirts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40 Polyvalent handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 Polyvalent handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 Protectiong gum for outer sheaths . . . . . . . . . . . . . . . . . . . . . . . . . .80 PU hammer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .206 Pulley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110 Pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160 Pumps, spare parts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160 Handlebar bags . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Handlebar grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Handlebar horns . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .128 Handlebar stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122 Handlebar tape . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .136 Handlebars . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 Headset . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98 Helmets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .28 Home trainer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .209 Horn Bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 I/J Inner bearing tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 Jackets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .35 Jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 K Neoprene grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .130 O Organic disc brake pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .89 Overshoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 Overshoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .57 P Q Quick Release . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .136 R Knapsack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Race bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .120 Knee warmers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 Race bike brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 Race bike brake lever . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .79 L Race bike handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .120 Lateral kickstand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .183 Race bike saddel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .169 Leather grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .130 Race bike shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63 LED Front Beamer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Rear derailleur pulley . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110 LED lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Rear light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69 LED rear light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69 Rear wheel brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 Leg warmers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .56 Retro bells . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106 Lifestyle shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .60 Ringo grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .130 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Riser bar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .118 Road brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .76 Lighting set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72 Road shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 Lights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .66 Rock ring . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .191 Lock with spiralled cable . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .178 Locks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .178 Long-fingered gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .54 Low-rider bags . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Technical changes reserved. www.xlc-parts.com Page 19 ware group 250 TABLE OF CONTENTS S Saddle bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .141 Saddles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Saw guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Screws for water bottel holder . . . . . . . . . . . . . . . . . . . . . . . . . . . .197 Seat post . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .173 Seat post . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .173 Seat post clamp collar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .171 Seatpost luggage rack . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .103 Service kit for hydraulic disc brakes . . . . . . . . . . . . . . . . . . . . . . . . .87 Shoe display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .59 Shopping basket . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .149 Short sleeved jersey . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 Shorts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .38 Single bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Single bags . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .139 Sintered disc brake pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .93 Socks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .64 Spacer set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98 Spacers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .98 Spare bkake pad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .84 Spokes gauge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Spokes wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Spring fastening . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108 Sunglasses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 Sunglasses . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .46 Suspenion seat post . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .175 Suspension fork pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .162 System pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .153 x-cellent bike components U U-brakes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 U-lock . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .180 Under-helmet cap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .31 Unicycle display . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .185 Universal wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .200 V V-Brake . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .75 V-Brake shoes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .82 W Wall holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .186 Water bottle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .193 Water bottle holder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .193 Wheel bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140 Wheels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .113 Wind blocker . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .45 Winter gloves . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .55 Wooden grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .133 X XLC and more as from . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .212 Y Y wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .201 Youth saddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Z ST Stabilising wheels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .186 Stem . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .122 Stem bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .142 T Tank-Tops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .34 Telescopic pumps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .160 Telescopic seat post . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .176 Terminal plugs for brake inner cables . . . . . . . . . . . . . . . . . . . . . . .80 Terminal plugs for brake outer sheaths . . . . . . . . . . . . . . . . . . . . . .80 Terminal plugs for rear derailleur outer sheaths . . . . . . . . . . . . . .111 Tights . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37 Tool case . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .206 Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 Torque wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .203 Torx wrench . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .201 Transport bag for unicycle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140 Travel Stand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .185 Treadle dismantling tool . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .198 Trekking handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 Trekking handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .116 Trekking saddle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .165 Tri Bar handlebar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .121 Tri Bar superstructure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .121 Triple bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .145 Trunk bag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .144 T-shirts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .32 Tube Tops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .80 Tubes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .25 Two components grips . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .129 Tyre iron . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .205 Tyres . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .23 Imprint: Idea & conception: Design & realisation Cover design: Editor: Printing: Page 20 www.xlc-parts.com Winora-Group, Schweinfurt Hilde Pampel, Gunther Riess Judith Diemer Matthias Gräf, Holger Hümpfer Cindy Cramer, Stefanie Wiederer Aumüller Druck, Regensburg Technical changes reserved. ware group CLAIMS/WARRANTY/LIABILITY x-cellent bike components 250 Dear customer, On the occasion of the publication of the new XLC catalogue we herewith inform you in detail about our return, defects liability and warranty regulations. You are kindly requested to observe the following procedural method: 1. Reconsignments are organised by E. Wiener Bike Parts. We assign our carriers or parcel service to pick up the consignment at your place. Additional costs arising by the use of other means or routes of dispatch or modes of dispatch like express will not be accepted. Freight collect consignments will not be accepted either. 2. Reconsignments/returns will only be processed if accompanied by the necessary documents (delivery slip, invoice). Furthermore, the recon signment form printed in the catalogue, filled in with the detailed defect description for each article, has to be enclosed. In case of missing information or if extensive investigation is necessary we reserve the right of deducting a service charge of 20% of the ware value. 3. Procedural method regarding products: a. We only accept products we have sold. b. We cannot assume liability/conversion for products purchased longer than 1 year ago. In such cases it is necessary to consult the supplier, who knows which course of action is to be taken. c. All returned products have to be free of dirt d. The packing materials the articles have been sold in have to be returned too, protected against transport damage by an adequate cardboard wrapping. e. Handling of tagged, not packaged or dismantled ware under reserve. f. The returned articles (factory-new ware) have to be resaleable. g. In case of missing accessories, e.g. baskets or bike computers without fastening devices we shall deduct the value of the missing parts from the total value. 5. Wrongly ordered items: Wrong orders (clerical errors, mistaken articles, double orders etc.) are subject to a flat restocking fee of 20%. 6. Special orders from the supplier: Please understand the fact that the items which have been obtained by special order (articles which do not appear in the catalogue) can not be exchanged or taken back, as these parts were ordered according to your wishes. Items wrongly delivered by the supplier are excluded. 7. We shall not refund personnel costs, unless our upstream supplier agrees to it or it is a matter or widespread failure. In case of widespread failure, the arising labour costs are flat-rated. 8. The general, completive business conditions for liability are as follows: The customer commits himself: a. to inform the supplier of missing parts or defects immediately, or else within 3 days of receiving the item at the latest. b. to check the completeness of the consigned ware upon delivery, especially as to the amount and number of packages and search for potential defects. c. to counter-sign the vendor’s copy of the package label. d. to note visible damages and missing parts on the delivery slip. e. to return the damaged or wrongly delivered ware within the original wrapping in case of complaint. f. to journalise transport damages and have them countersigned by the carrier. g. to inform the supplier of damages, which could not be detected within the lapse of time indicated under a), immediately after detection. All complaints have to be filed in writing, either by mail, by fax or by e-mail. Enclosed conclusive photographs hasten the handling. Changements in the invoices, self-refunds or debit notes are not allowed! In case of notice of defects, the customer has to send the faulty item immediately to E. Wiener Bike Parts or to a service centre indicated by the latter, in its original wrapping, with all accessories and accompanied by an exact description of the damage and a copy of the invoice which was enclosed with the consignment, indicating the number of the delivery slip and the item number. As long as the customer does not fulfil these obligations he cannot demand rectification, exchange or price reduction. In case the customer sends items in without fulfilling the aforementioned obligations, he will be notified in writing and the consignment returned to him with costs. If the wrapping of returned factory-new ware is pasted up or written upon we shall deduct a re-storage fee of 20% of the value. Technical changes reserved. www.xlc-parts.com Page 21 TYERES MATERIAL & TECHNOLOGY TYRES TUBES Technical terms intelligibly illustrated! TYRES TPI TPI indicates the number of threads per inch in the tyre carcass. The higher the value is, the lower the rolling resistance Collapsible Collapsible Collapsible tyres are equipped with several Kevlar threads, instead of wire. Thus, the tyre can be folded to a compact pack size. Because of this configuration, collapsible tyres are moreover lighter than comparable wired-on tyres. . with Puncture Protection Tyres with integrated puncture protection have got a special layer between tread and carcass, which protects effectively the tube against punctures, thus actively preventing flat tyres. with Reflecting Stripes The legislative authorities of several countries (among which Germany) prescribe baffles on the wheels. Both the well-known spokes baffles and continuous reflecting stripes, vulcanised on both tyre flanks, are hereby allowed. These reflecting stripes are made of microscopic glass spheres, which throw the light back to its source, thus making these reflecting stripes visible from a distance of 150 m, a much farther reach than that of normal spokes baffles. The reflexion angle is wider too. According to the German Road Traffic Act (StVZO), if a bike tyre is equipped with these reflection stripes, it can dispense with spokes baffles. Semi slick Semi-slick tyres are moulded tyres, which can be used in the open country, as well as on roads, thanks to a central tread groove. TUBES Blitz Valve The Blitz valve is the widest spread valve in Germany and The Netherlands. Their characteristic is that they are tucked in a piece of metal tube, being secured with a lock nut. Therefore, these valves can be exchanged quickly and without tools, but they can be as easily stolen or sabotaged. The lock nut must be loosened to release the air. Schrader Valve The Schrader valve is often to be found in mountain bikes. Besides, it is also used for cars, which is why it is also called in German „car valve“(Autoventil). When a pump head or a manometer are attached, a pin is pressed down within the valve, opening it and allowing the air to enter or the air pressure within the tyre to be measured. Hand pumps for Schrader valves need therefore a non-return valve in the pump head. An advantage of the Schrader valve is the possibility of inflating it at petrol stations without needing adapters. Presta Valve The Presta valve (also called French valve or race valve) qualifies for high pressure and is used for MTBs, race bikes or touring bikes. To inflate the tyre, the small knurled nut placed on the thread pin has to be loosened. As this valve, as opposed to the Schrader valve, is not kept closed by a spring but by the excess of pressure within the tyre, it hasn’t to be opened mechanically in order to be pumped up, but opens up by itself at the slightest difference of pressure. Page 22 www.xlc-parts.com Technical changes reserved. ware group TYRES x-cellent bike components WPE article designation TYRES article number 250 XLC ATB TYRES 'HANNIBAL II' BT-S01/F01 • especially for marathon contests on dry road conditions 250 73 61000 250 73 61200 250 73 61400 91595 91995 93295 26x2,10 BT-S01 26x2,10 BT-S01 26x2,10 BT-F01 56-559 56-559 56-559 black 22TPI black 60TPI black 60TPI foldable XLC ATB TYRES 'ACHILLES' BT-S02 • silent ATB-tyre with semi-slick tyre profile 250 73 63000 250 73 63200 91295 91395 24x1,95 26x1,95 53-507 53-559 black 60 TPI black 60 TPI XLC MTB TYRES 'ATTILA' BT-S03 • aggressive cross-country tyre for unpredictable territories 250 73 62000 91695 26x2,10 BT-S03 54-559 black 60 TPI XLC MTB TYRES 'BEN HUR' BT-S04 • very fast cross-country tyre with a lowly roll resistance 250 73 63400 91695 Technical changes reserved. 26x2,10 54-559 black 60 TPI www.xlc-parts.com Page 23 ware group 250 WPE TYRES article number TYRES x-cellent bike components article designation XLC MTB TYRE 'SPARTAKUS' BT-S05 • the ideal freerider for rough terrain 250 73 63600 250 73 63800 91795 91895 26x2,25 26x2,40 62-559 66-559 black 60 TPI black 60 TPI XLC CITY-/TOURING TYRE 'GREYHOUND' BT-S06 • with protection layer against flats 250 73 65000 250 73 65200 250 73 65400 250 73 65600 9995 9995 9995 9995 26x1,75 28x1 3/8 700x38C 28x1,75 47-559 37-622 40-622 47-622 black 22 TPI black 22 TPI black 22 TPI black 22 TPI XLC CITY-/TOURING TYRE 'MALAMUT' BT-S07 • with reflective stripes • 3 mm protection layer against flats • perfect for wet and dry road conditions 250 73 66000 250 73 66200 250 73 66400 250 73 66600 Page 24 91795 91795 91795 91795 26x1.75 28x 1 3/8 700x38C 28x1.75 47-559 37-622 40-622 47-622 black 22 TPI black 22 TPI black 22 TPI black 22 TPI www.xlc-parts.com Technical changes reserved. ware group TUBES x-cellent bike components WPE article designation TYRES article number 250 XLC INNER TUBES 250 81 20000 250 81 20200 9550 9550 12 1/2 x 2 1/4 12 1/2 x 2 1/4 47/62-203 47/62-203 DV 32 mm AV 35 mm VT-D12 VT-A12 250 81 40000 9550 14 x 1 3/8 37/44-288/305 DV 32 mm VT-D14 250 81 60000 250 81 60200 9550 9550 16 x1.75/2.125 16 x1.75/2.125 47/62-305 47/62-305 DV 32 mm AV 35 mm VT-D16 VT-A16 250 81 80000 250 81 80200 9550 9550 18 x1.75/2.125 18 x1.75/2.125 37/50-355/400 37/50-355/400 DV 32 mm AV 35 mm VT-D18 VT-A18 250 82 00000 250 82 00200 250 82 00400 9550 9550 9550 20 x1.5/2.5 20 x1.5/2.5 20 x1.5/2.5 40/62-406 40/62-406 40/62-406 DV 32 mm AV 35 mm SV 32 mm VT-D20 VT-A20 VT-S20 250 82 40000 250 82 40200 9550 9550 24 x1.5/2.5 24 x1.5/2.5 40/62-507 40/62-507 DV 40 mm AV 35 mm VT-D24 VT-A20 250 82 60000 250 82 61200 250 82 61400 250 82 62000 250 82 62200 250 82 62400 9550 9550 9550 9550 9550 9550 26 x1 1/4-1.75 26 x1.0/1.5 26 x1.0/1.5 26 x1.5/2.5 26 x1.5/2.5 26 x1.5/2.5 32/40-584/590 25/40-559 25/40-559 40/62-559 40/62-559 40/62-559 DV 40 mm AV 35 mm SV 32 mm DV 40 mm AV 35 mm SV 32 mm VT-D26 VT-A26 VT-S26 VT-D26 VT-A26 VT-S26 250 82 80000 250 82 80200 250 82 80400 250 82 80500 9550 9550 9550 9550 28 x 1 1/8 x 1.75 28 x 1 1/8 x 1.75 28 x 1 1/8 x 1.75 28 x 1 1/8 x 1.75 28/40-622/635 28/40-622/635 28/40-622/635 28/40-622/635 DV 40 mm AV 35 mm SV 32 mm SV 48 mm VT-D28 VT-A28 VT-S28 VT-S28 250 82 81400 250 82 81500 250 82 81600 9550 9550 9550 700x18/25C 700x18/25C 700x18/25C 18/25-622/630 18/25-622/630 18/25-622/630 SV 32 mm SV 48 mm SV 60 mm VT-S28 VT-S28 VT-S28 Technical changes reserved. www.xlc-parts.com Page 25 MATERIAL & TECHNOLOGY CLOTHING HELMETS CLOTHING SUNGLASSES GLOVES SHOES SOCKS Technical terms intelligibly illustrated! HELMETS Coolmax Inmold Construction Inmold is a manufacturing process consisting in joining the inside and outside shells of the helmet under high pressure. The result is an extremely robust leightweight construction. LED Safety Flashlight The LED safety light is integrated in the adjusting system of your helmet. You have the choice between the flashlight and the permanent modes. The LED safety flashlight is no substitute for the lighting installation prescribed for your bike, but it is a sensible completion thereof, for more safety in road traffic. Twin Lock Adjusting System Das Twin-Lock Verstellsystem passt den Helmring auf die individuelle Kopfform an. Das Verstellsystem sitzt im Hinterkopfbereich und wird mit zwei Händen justiert. Coolmax® by ADVANSA is a highly efficient fabric, which aids ist wearer in his/her athletic activities. Based on the patented DuPont fibre technology, Coolmax® transports moisture away from the body to the fabric surface, where it dries quikklier than on any other fabric. Tests confirm that clothing made of Coolmax® dries almost completely within 20-30 minutes. In comparison, the humidity of cotton after the same lapse of time was still of 50 %. Perspiring weakens. Better evaporation means that less energy is needed to cool down the body, thus improving efficiency and endurance. And because Coolmax® is more breathable, nothing else is more comfortable. Coolmax® is used for shirts, socks, jogging trousers, underwear, sports-bras and even workwear. Not to mention the contents of the wardrobes of some of the world’s best athletes. Cool comfort in each situation. Cooling comfort for extreme performances. Extreme athletes know what the demands upon a functional fabric are and thus accept only the best. They appreciate therefore the physiological advantages offered by Coolmax® extreme. As has been proved, the fabric reduces the body temperature, maintains the heart rate low and balances the water household. It has, moreover, outstanding moisture managing properties. Quick Turn Adjusting System The Twin-Lock Adjusting System adjusts the helmet circumference to the individual form of the head. The adjusting system is at the rear and has to be operated with both hands. Meryl MERYL is a functional, matt finished fibre, very light (140 g only), breathable, elastic, shape-retaining, resistant, easy to clean and quickly drying. Furthermore, MERYL has very good compression properties. CLOTHING Active Based on the patented DuPont fibre technology, ACTIVE fibres transport moisture away from the body to the surface of the fabric, where it dries quicklier than on many other fabrics. Tests confirm that clothing made of ACTIVE dries almost completely within 20-30 minutes. In comparison, the humidity of cotton after the same lapse of time was still of 50 %. Active consists of 100% polyester with Coolmax finishing. It is the classic honeycomb fibre and weighs 135 g. This fabric is highly breathable and transports easily sweat to the outside. The configuration of the fibres arrests the development of bacteria, though this property diminishes in time, after much laundering. The fabric is very soft and slightly shiny. with Zipper Pocket Some of the XLC textiles have got an extra zipper pocket. In this pocket you can carry about your valuables, i.e. wallet/purse, watch, jewels, mobile even when riding a bike. Polyamide 100% polyester. Consolidated but airy and light polyester fibre, breathable, stainproof, shape-retaining and colour-fast. Together with the complementary inner netting an attractive solution for an elegant and high-quality aspect. Raglan Cut Breathable Breathable textiles allow the transport of sweat from the inside to the outside, thus protecting the body against disagreeable moisture. At the same time they avoid efficiently the penetration of wind and water from the outside, thereby providing more comfort when cycling. The raglan sleeve or raglan cut designates sleeves that are sewn to the collar, thus avoiding a seam on the shoulder. This cut is particularly advantageous in sports. Lacking seams on the shoulders, the pressure of knapsack straps is less disagreeable, for instance, which is important, especially in case of heavy loads. Reflecting Stripes, Reflecting Zipper Bi-Elastic Bi-Elasticity is the property of textiles and other materials to stretch in two different senses without loosing their basic form. It is also called the plastic memory of materials. Many of our XLC textiles are equipped with reflecting appliqués. These reflecting stripes and reflecting zippers increase safety in road traffic. Antibacterial Super Roubaix Antibacterial textiles arrest the development of bacteria and microorganisms, thus avoiding body odour. SUPER ROUBAIX®- this strongly rebounding, extremely resistant fibre, is extremely soft and comfortable, easy to clean and adaptable. This slightly lined fabric, roughened inside, establishes an ideal climate between outside temperature and body warmth. Lycra Power Special Lycra fabric, 80% polyamide + 20% spandex (Lycra), highly elastic and of stable form, weight 210g/m2, supporting function, highly breathable and efficiency-aiding by quick evaporation of sweat. The optimal use of spandex improves movement precision, increases endurance and discharges the muscles. Perfect fit, due to the extremely high elasticity of the material. We use only Lycra fabrics of M.I.T.I. as from 210 g, onwards, as these fabrics improve the ability for compression, thus guaranteeing better blood circulation. Lycra Power fabrics maintain their stability and colour-fastness for years. Page 26 Tactel Fabrics made of Tactel fibres could be mistaken for cotton at first touch and this fact makes them agreeable to many. DuPont obtains this yarn out of an unlimited numer of micro-fine polyamide filaments (endless fibres) of variable texture, which can be used for different purposes. 80% polyester, 20% spandex (Lycra), 190g/m2 – special Tactel fabric, light, highly elastic and shape-retaining, performance-supporting by quick evaporation of sweat. www.xlc-parts.com Technical changes reserved. ware group MATERIAL & TECHNOLOGY x-cellent bike components 250 SUNGLASSES XLC lenses with 100% protection against UV rays are adequate for road traffic, according to the European Norm 1836. XLC lenses are available in different shades. Yellow and orange lenses help avoiding accidents on cloudy days because of their particular good contrast sight. Grey or browne lenses render the environment colours most naturally. Besides, the intensity of the colouring has no influence whatsoever upon the protection against UV rays. Lifestyle Shoes Thanks to the adaption system integrated deep into the sole and to the slip-proof structure of the sole, XLC Lifestyle shoes suit system pedals, as well as traditional ATB/MTB pedals with cage. The slightly flexible sole also qualifies for longer walks. Look System Compatible With special adapter plates, the XLC Road shoes also suit Look system pedals. Photochromic Lenses Everybody knows probably the following situation: in strong sunshine, or when the season changes and diffuse light affects the sight, the eyes tire more, because of the squinting. The photochromic lenses of some of the XLC sunglasses adjust automatically to the light intensity. Intelligent plastics lenses, guaranteeing defined, dazzle-free and reflexion-free sight. MTB Shoes Special shoes for MTB/ATB/Freeride use, with removable studs for additional grip. The pedal adaption is integrated into the sole and thanks to the generous profile this shoe also qualifies for walking. Ratchet Fastening Soft-Flex Frame The Soft-Flex frames of our XLC sports glasses are made of elastic, shatter-proof material, which adjusts optimally to the form of the head. The ratchet fastening provides a simple but well-fitting and firm compression of the third fastening strap, thus guaranteeing firm foot support at all times. Adjustments can also be made during the ride and moreover ratchet fastenings can be changed. Sports Glasses for Spectacles Wearers These sports glasses have got a special insert for dioptric lenses. This insert can be removed, to be implemented by the optician with lenses having your dioptres. Exchangeable Lenses The use of special exchangeable lenses is recommended for rides through woods, where there are many light-shadow effects or in twilight. They are enclosed with the respective XLC glasses. There are different shades: yellow and orange lenses help avoiding accidents on cloudy days because of their particular good contrast sight. Grey or brown lenses render the environment colours most naturally and are therefore recommended in normal or bright light. Road Shoes The XLC Road shoes have got an extremely rigid outer sole. The respective pedal system is attached directly to the sole. Microfibre Leather Microfibre leather is a tough synthetic fabric made of chemical fibres, which stands out by its high comfort and breathability. Furthermore, microfibre leather is waterproof and dirt-repellent. It doesn’t only produce a pleasant foot climate, it is also easily and quickly cleaned. Coolmax Rubberised Nose Pads XLC sports glasses are equipped with rubberised nose pads. These nose pads are pleasantly soft, thus reducing pressure. Moreover, the anti-slip material of the pads forestalls slipping when sweating, thus guaranteeing high comfort. GLOVES Terry Cloth Thumb Terry cloth is particularly absorbent and pleasant to touch. The slings, which increase the volume and can thus absorb a relatively high amount of moisture are characteristic for the fabric. In XLC gloves, terry cloth is used for the thumb area. Coolmax® by ADVANSA is a highly efficient fabric, which aids ist wearer in his/her athletic activities. Based on the patented DuPont fibre technology, Coolmax® transports moisture away from the body to the fabric surface, where it dries quikklier than on any other fabric. Tests confirm that clothing made of Coolmax® dries almost completely within 20-30 minutes. In comparison, the humidity of cotton after the same lapse of time was still of 50 %. Perspiring weakens. Better evaporation means that less energy is needed to cool down the body, thus improving efficiency and endurance. And because Coolmax® is more breathable, nothing else is more comfortable. Coolmax® is used for shirts, socks, jogging trousers, underwear, sports-bras and even workwear. Not to mention the contents of the wardrobes of some of the world’s best athletes. Cool comfort in each situation. Cooling comfort for extreme performances. Extreme athletes know what the demands upon a functional fabric are and thus accept only the best. They appreciate therefore the physiological advantages offered by Coolmax® extreme. As has been proved, the fabric reduces the body temperature, maintains the heart rate low and balances the water household. It has, moreover, outstanding moisture managing properties. Lycra 80% polyamide + 20% spandex (Lycra), 190g/m2 – a special mix of highly elastic and shape-retaining materials, with supporting function, shape-retaining and breathable, encourages performance by quick sweat evaporation. Microfibre Leather Microfibre leather is a tough synthetic fabric made of chemical fibres, which stands out by its high comfort and breathability. Furthermore, microfibre leather is waterproof and dirt-repellent. Compatible with the SPD System With special adaption plates, XLC shoes are also suited for adaption to Shimano SPD and SPD-R system pedals. Your XLC retailer will be pleased to help you with choosing the most appropriate XLC shoes for you. TPU Studs The removable TPU studs offer additional grip and a safe tread especially on extremely spongy ground. Protectors Protectors of PVC or carbon protect the sensitive parts of your hand, e.g. the knukkles. washable XLC gloves bearing this icon are washable at temperatures up to 30° C. SHOES / SOCKS Carbon Sole The extra rigid carbon sole weighs very little and provides an optimal transfer of the tread energy onto the pedal. EVA Inner Sole The EVA inner sole is an ergonomic, extra light insole, which provides high comfort thanks to the anatomic padding. EVA is a high-quality foam. Dry and warm thanks to closed cells, elastic, tear-proof and slip-proof. The expansion is done without foaming agent and is thus CFC-free. Technical changes reserved. www.xlc-parts.com Page 27 CLOTHING 100% protection against UV rays ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation HELMETS XLC PRO BICYCLE HELMET 'BROMO' BH-C11 • 24 air vents • visor • Weight: approx. 250 g • 'Quick Turn'-adjustment system • in mold shell design 250 01 74500 250 01 74600 98995 98995 Size S/M (52-57 cm) matt black Size L/XL (57-62 cm) matt black 250 01 74700 250 01 74800 98995 98995 Size S/M (52-57 cm) matt white Size L/XL (57-62 cm) matt white XLC COMP BICYCLE HELMET 'FUEGO' BH-C10 • 17 air vents • visor • Weight: approx. 260 g • 'Quick Turn'-adjustment system • in mold shell design 250 01 74000 250 01 74010 95995 95995 Size S/M (54-60 cm) white/gray Size S/M (54-60 cm) black/white 250 01 74100 250 01 74110 95995 95995 Size L/XL (58-62 cm) white/gray Size L/XL (58-62 cm) black/white XLC COMP BICYCLE HELMET 'YELLOWSTONE' BH-C09 • 12 air vents • visor • Weight: approx. 275 - 290 g • 'Quick Turn'-adjustment system • mesh against insects • in mold-shell 250 01 73500 250 01 73510 250 01 73520 94995 94995 94995 Size S (49-54 cm) white/black/blue Size S (49-54 cm) gray/white/green Size S (49-54 cm) green/white/blue 250 01 73600 250 01 73610 250 01 73620 94995 94995 94995 uni (54-60 cm) white/black/blue uni (54-60 cm) gray/white/green uni (54-60 cm) green/white/blue 250 01 73700 94995 Size XXL (59-65 cm) white/black/blue Page 28 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation HELMETS XLC COMP BICYCLE HELMET 'MT. KENIA' BH-C08 • 18 air vents • visor • Weight: approx. 260 g • mesh against insects • 'Quick Turn'-adjustable system • in mold-shell 250 01 73000 93995 unisize (52-60 cm) gray/red 250 01 73010 93995 unisize (52-60 cm) silver/white XLC MTB/ATB BIKE HELMETS 'VULCANO' BH-C05 • 17 ventilation ducts • twist lock adjustment system • insect net • helmet with a shield • Available only while stock lasts! 250 01 61100 91995 54-60 cm, black/white 250 01 61200 91995 54-60 cm, carbonlook/red XLC FREERIDE FULL FACE HELMETS 'PINATUBO' • one-piece • 13 ventilation slits • helmet visor • Weight: approx. 900 g • CE EN 1078 250 01 71800 97995 57-58 cm white 250 01 71900 97995 59-60 cm white Technical changes reserved. www.xlc-parts.com Page 29 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation HELMETS XLC FREERIDE 'FULL FACE' HELMETS 'ARENAL II' • two-piece • 11 ventilation slits • helmet visor • Weigth: approx. 630 gr. • CE EN 1078 250 01 71500 94995 54-58 cm matt black 250 01 71600 94995 58-62 cm matt black XLC COMP KID'S-/YOUTH'S HELMETS 'MAUI' BH-C07 • 9 air vents • integrated visor • Weight: approx. 255 g • mesh against insects • 'Hyper Control System' 250 01 72500 250 01 72510 92995 92995 Size S (47-52 cm) flower decor Size S (47-52 cm) Eightball 250 01 72600 250 01 72610 92995 92995 Size M (52-57 cm) flower decore Size M (52-57 cm) Eightball XLC COMP CHILDREN'S HELMETS • 8 ventilation slits • Quick-Turn adjusting system • bug screen net • with LED-flashing/permanent light • CE EN 1078 250 01 70000 91995 52-57 cm, Boy 250 01 70100 91995 52-57 cm, Girl Page 30 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation HELMETS XLC KIDS HELMETS BH-C01 • 6 ventilation ducts • 'Quick Turn'-adjustment system • insect net • Available only while stock lasts! 250 01 60000 91495 50-56 cm, 'Cat' pink 250 01 60300 91495 50-56 cm, 'Stars' blue 250 01 60400 91495 50-56 cm, 'Stars' red XLC BABY/KIDS HELMETS BH-C02 • 6 ventilation ducts • 'Quick Turn'-adjustment system • insect net • delivery only as long as stocks in the storage 250 01 60600 91395 49-52 cm, flower 250 01 60700 91395 49-52 cm, flame XLC HELMET CAP BH-X01 • helmet cap, windproof and breathable • washable at 30° 250 01 59800 91595 Size S/M 54-57 cm 250 01 59900 91595 Size L/XL 57-61 cm black Technical changes reserved. black www.xlc-parts.com Page 31 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation JERSEY & TROUSERS XLC MAN’ T-SHIRT JE-C04 • trendy gents’ shirt made of pure cotton • always well dressed, thanks to different colours and prints - this is the trend for the next season 251 01 40500 251 01 40600 251 01 40700 251 01 40800 251 01 40900 91995 91995 91995 91995 91995 Size S Size M Size L Size XL Size XXL Man green bmx Man green bmx Man green bmx Man green bmx Man green bmx blue city 251 01 41000 251 01 41100 251 01 41200 251 01 41300 251 01 41400 91995 91995 91995 91995 91995 Size S Size M Size L Size XL Size XXL Man dark gray Man dark gray Man dark gray Man dark gray Man dark gray 251 01 43000 251 01 43100 251 01 43200 251 01 43300 251 01 43400 91995 91995 91995 91995 91995 Size S Size M Size L Size XL Size XXL Man blue city Man blue city Man blue city Man blue city Man blue city 251 01 43500 251 01 43600 251 01 43700 251 01 43800 251 01 43900 91995 91995 91995 91995 91995 Size S Size M Size L Size XL Size XXL Man cinder retro bikes Man cinder retro bikes Man cinder retro bikes Man cinder retro bikes Man cinder retro bikes 251 01 44500 251 01 44600 251 01 44700 251 01 44800 251 01 44900 91995 91995 91995 91995 91995 Size S Size M Size L Size XL Size XXL Man white wood Man white wood Man white wood Man white wood Man white wood vert bmx green bmx dark gray white wood Page 32 cinder bike rétro www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC LADIES’ T-SHIRT JE-C07 • trendy ladies’ t-shirt made of pure cotton • always well dressed, thanks to different colours and prints, this is the trend for the next season. 251 01 45000 251 01 45100 251 01 45200 251 01 45300 251 01 45400 91995 91995 91995 91995 91995 Size XS Size S Size M Size L Size XL Lady dark gray retro Lady dark gray retro Lady dark gray retro Lady dark gray retro Lady dark gray retro 251 01 47000 251 01 47100 251 01 47200 251 01 47300 251 01 47400 91995 91995 91995 91995 91995 Size XS Size S Size M Size L Size XL Lady red angel Lady red angel Lady red angel Lady red angel Lady red angel 251 01 48000 251 01 48100 251 01 48200 251 01 48300 251 01 48400 91995 91995 91995 91995 91995 Size XS Size S Size M Size L Size XL Lady deep blue beach Lady deep blue beach Lady deep blue beach Lady deep blue beach Lady deep blue beach 251 01 48500 251 01 48600 251 01 48700 251 01 48800 251 01 48900 91995 91995 91995 91995 91995 Size XS Size S Size M Size L Size XL Lady blue dandelion Lady blue dandelion Lady blue dandelion Lady blue dandelion Lady blue dandelion dark gray retro vert bmx red angel 251 01 49500 251 01 49600 251 01 49700 251 01 49800 251 01 49900 91995 91995 91995 91995 91995 Size XS Size S Size M Size L Size XL Lady white retro bike Lady white retro bike Lady white retro bike Lady white retro bike Lady white retro bike deep blue beach blue dandelion Technical changes reserved. www.xlc-parts.com white retro bike Page 33 ware group 250 JERSEY & TROUSERS article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC GENTS’ LONGSLEEVE SHIRT JE-C05 • trendy gents’ longsleeve shirt made of pure cotton • always well dressed, thanks to different colours and prints in summer and the transitional season. 251 01 41500 251 01 41600 251 01 41700 251 01 41800 251 01 41900 92495 92495 92495 92495 92495 Size S Size M Size L Size XL Size XXL Man black Man black Man black Man black Man black 251 01 44000 251 01 44100 251 01 44200 251 01 44300 251 01 44400 92495 92495 92495 92495 92495 Size S Size M Size L Size XL Size XXL Man dark gray XLC Icons Man dark gray XLC Icons Man dark gray XLC Icons Man dark gray XLC Icons Man dark gray XLC Icons XLC LADIES’ TANK TOP JE-C08 • trendy tank top for ladies • spandex jersey tank top of feminine cut made of 94% cotton and 6% spandex 251 01 47500 251 01 47600 251 01 47700 251 01 47800 251 01 47900 91695 91695 91695 91695 91695 Size XS Size S Size M Size L Size XL Lady black Lady black Lady black Lady black Lady black XLC GENTS’ JE-C09/LADIES’ JE-C10 OUTDOOR SHIRT • this extremely functional shirt made of pure polyester is odour-inhibiting and breathable • the stretch fabric allows a high mobility in all activities • special forearms and back mesh inserts ensure ventilation 251 01 59500 251 01 59600 251 01 59700 251 01 59800 251 01 59900 92495 92495 92495 92495 92495 MAN JE-C09 Size S Man black Size M Man black Size L Man black Size XL Man black Size XXL Man black 251 01 60500 251 01 60600 251 01 60700 251 01 60800 251 01 60900 92495 92495 92495 92495 92495 LADY JE-C10 Size XS Lady black Size S Lady black Size M Lady black Size L Lady black Size XL Lady black Page 34 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC FLATFLEECE HYBRID JACKET FT-A09 • softshell inserts on the sides and breast • appropriate for every occasion • two front pockets, drawstring hemline • 100% polyester 251 01 57000 251 01 57100 251 01 57200 251 01 57300 251 01 57400 96995 96995 96995 96995 96995 Size S Size M Size L Size XL Size XXL Man dark gray/red Man dark gray/red Man dark gray/red Man dark gray/red Man dark gray/red XLC FLATFLEECE HYBRID JACKET FT-A10 • softshell inserts on the sides and breast • appropriate for every occasion • two front pockets, drawstring hemline • 100% polyester 251 01 58000 251 01 58100 251 01 58200 251 01 58300 251 01 58400 96995 96995 96995 96995 96995 Size XS Size S Size M Size L Size XL Lady purple/white Lady purple/white Lady purple/white Lady purple/white Lady purple/white XLC LADIES’ SOFTSHELL JACKET FT-A02 • sportive ladies’ softshell jacket - a perfect mixture of breathability and weather protection • quick drying thanks to ventilating enzymes lining • windproof and waterproof • optimal liberty of movement thanks to the very elastic material • attached hood, preformed raglan sleeves with cuffs • 6000mm membrane, 2 front pockets and concealed zipper, hem draw cord • Material 100% polyester, 6000mm/n²/3000g/24h 251 01 52000 251 01 52100 251 01 52200 251 01 52300 251 01 52400 98995 98995 98995 98995 98995 Technical changes reserved. Size XS Size S Size M Size L Size XL Lady purple/white/black Lady purple/white/black Lady purple/white/black Lady purple/white/black Lady purple/white/black www.xlc-parts.com Page 35 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation JERSEY & TROUSERS XLC GENTS’ SOFTSHELL JACKET FT-A01 • sportive gents’ softshell jacket, a perfect mixture of breathability and weather protection • quick drying thanks to ventilating enzymes lining • windproof and waterproof • optimal liberty of movement thanks to the very elastic material • attached hood, preformed raglan sleeves with cuffs • 6000mm membrane, 2 front pockets and concealed zipper, hem draw cord • Material 100% polyester, 6000mm/n²/3000g/24h 251 01 50500 251 01 50600 251 01 50700 251 01 50800 251 01 50900 98995 98995 98995 98995 98995 Size S Size M Size L Size XL Size XXL Man gray/blue Man gray/blue Man gray/blue Man gray/blue Man gray/blue 251 01 51000 251 01 51100 251 01 51200 251 01 51300 251 01 51400 98995 98995 98995 98995 98995 Size S Size M Size L Size XL Size XXL Man green/white/gray Man green/white/gray Man green/white/gray Man green/white/gray Man green/white/gray XLC GENTS’ SOFTSHELL JACKET FT-A03 • sportive gents’ softshell jacket, a perfect mixture of breathability and weather protection • quick drying thanks to ventilating enzymes lining • windproof and waterproof • optimal liberty of movement thanks to the very elastic material • preformed raglan sleeves with lycra cuffs • 6000mm membrane, 2 front pockets and concealed zipper, hem draw cord • Material 100% polyester, 6000mm/n²/3000g/24h 251 01 53500 251 01 53600 251 01 53700 251 01 53800 251 01 53900 96995 96995 96995 96995 96995 Size S Size M Size L Size XL Size XXL Man black/blue Man black/blue Man black/blue Man black/blue Man black/blue XLC SOFTSHELL JACKET LADY FT-A04 • sportive ladies’ softshell jacket, a perfect mixture of breathability and weather protection • quick drying, thanks to enzyme ventilating lining • windproof and waterproof • optimal mobility thanks to the very elastic material • preformed raglan sleeves with elastic Lycra cuffs • 6000mm membrane, 2 front pockets and concealed zipper, hem draw cord • Material: 100% polyester, 6000mm/n²/3000g/24h 251 01 54000 251 01 54100 251 01 54200 251 01 54300 251 01 54400 Page 36 96995 96995 96995 96995 96995 Size XS Size S Size M Size L Size XL Lady white/wild green Lady white/wild green Lady white/wild green Lady white/wild green Lady white/wild green www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC GENTS’ RAIN JACKET FT-A05 + GENTS’ RAIN PANTS FT-A07 • optimal protection in bad weather • this XLC line is characterized by the waterproof and windproof quality • our aquatex membrane also ensures the breathability • jacket with 2 front pockets and a hood • pants with 2 front pockets, zipper and adjustable velcro at leg end • Material 100% rip stop polyester, sealed tape seam, 5000mm/n²/2000gr/24h 251 01 55000 251 01 55100 251 01 55200 251 01 55300 251 01 55400 95995 95995 95995 95995 95995 rain jacket Size S rain jacket Size M rain jacket Size L rain jacket Size XL rain jacket Size XXL Man black/blue Man black/blue Man black/blue Man black/blue Man black/blue 251 01 55500 251 01 55600 251 01 55700 251 01 55800 251 01 55900 94495 94495 94495 94495 94495 rain pants Size S rain pants Size M rain pants Size L rain pants Size XL rain pants Size XXL Man black Man black Man black Man black Man black XLC LADIES’ RAIN JACKET FT-A06 + LADIES’ RAIN PANTS FT-A08 • optimal protection in bad weather • this XLC line is characterized by the waterproof and windproof quality • our aquatex membrane also ensures the breathability • jacket with 2 front pockets and a hood • pants with 2 front pockets, zipper and adjustable velcro at leg end • Material 100% rip stop polyester, sealed tape seam, 5000mm/n²/2000gr/24h 251 01 56000 251 01 56100 251 01 56200 251 01 56300 251 01 56400 95995 95995 95995 95995 95995 rain jacket Size XS rain jacket Size S rain jacket Size M rain jacket Size L rain jacket Size XL Lady black/purple Lady black/purple Lady black/purple Lady black/purple Lady black/purple 251 01 56500 251 01 56600 251 01 56700 251 01 56800 251 01 56900 94495 94495 94495 94495 94495 rain pants Size XS rain pants Size S rain pants Size M rain pants Size L rain pants Size XL Lady black Lady black Lady black Lady black Lady black Technical changes reserved. www.xlc-parts.com Page 37 ware group 250 JERSEY & TROUSERS article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC PRO SHORT SLEEVE JERSEY JE-S03/JE-S05 • zip pocket, reflective zipper • stand-up collar with concealed zipper • rubberised hem 251 01 07000 251 01 07100 251 01 07200 251 01 07300 251 01 07400 94495 94495 94495 94495 94495 Size S Size M Size L Size XL Size XXL black black black black black JE-S03 JE-S03 JE-S03 JE-S03 JE-S03 251 01 07005 251 01 07105 251 01 07205 251 01 07305 251 01 07405 94495 94495 94495 94495 94495 Size S Size M Size L Size XL Size XXL black/red black/red black/red black/red black/red JE-S03 JE-S03 JE-S03 JE-S03 JE-S03 251 01 11000 251 01 11100 251 01 11200 251 01 11300 251 01 11400 94495 94495 94495 94495 94495 Size S Size M Size L Size XL Size XXL white/gold/black white/gold/black white/gold/black white/gold/black white/gold/black JE-S05 JE-S05 JE-S05 JE-S05 JE-S05 XLC PRO TROUSERS WITH STRAPS SHORT TR-S05/TR-S06 • bucco cushion pressed • mesh straps • outline cut • flat seams anthracite • leg cuff with rubber stopper 251 01 08000 251 01 08100 251 01 08200 251 01 08300 251 01 08400 95995 95995 95995 95995 95995 Size S Size M Size L Size XL Size XXL black black black black black TR-S05 TR-S05 TR-S05 TR-S05 TR-S05 251 01 08005 251 01 08105 251 01 08205 251 01 08305 251 01 08405 95995 95995 95995 95995 95995 Size S Size M Size L Size XL Size XXL black/red black/red black/red black/red black/red TR-S05 TR-S05 TR-S05 TR-S05 TR-S05 251 01 11600 251 01 11700 251 01 11800 251 01 11900 251 01 12000 95995 95995 95995 95995 95995 Size S Size M Size L Size XL Size XXL white/gold/black white/gold/black white/gold/black white/gold/black white/gold/black Page 38 TR-S06 TR-S06 TR-S06 TR-S06 TR-S06 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC PRO LONG SLEEVED JERSEY JE-L01 • pocket with zip fastener, reflective zip, • band collar with zip cover • rubberised hemline 251 01 07500 251 01 07600 251 01 07700 251 01 07800 251 01 07900 96495 96495 96495 96495 96495 Size S Size M Size L Size XL Size XXL black black black black black XLC PRO TROUSERS WITH STRAPS LONG TR-L01 • bucco cushion pressed • mesh inlets • outline cut • flat seams grey 251 01 08500 251 01 08600 251 01 08700 251 01 08800 251 01 08900 98450 98450 98450 98450 98450 Size S Size M Size L Size XL Size XXL black black black black black XLC KIDS JERSEY JE-S02 • reflective zip fastener, affixing for zip fastener 251 01 01500 251 01 01600 251 01 01700 91995 91995 91995 Size 128 red Size 140 red Size 152 red XLC KIDS RACING TROUSERS SHORT TR-S03 • pressed padding 170 gr. • silicone belt worked in to improve a firm fit • 6 panel cuts 251 01 03100 251 01 03200 251 01 03300 251 01 03400 92295 92295 92295 92295 Technical changes reserved. Size 128 Size 140 Size 152 Size 164 black black black black www.xlc-parts.com Page 39 ware group 250 JERSEY & TROUSERS article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC COMP SHORT SLEEVE JERSEY JE-S01 • raglan style, contrast piping • three-part pockets on the back • reflective zip fastener, affixing for zip fastener 251 01 00000 251 01 00100 251 01 00200 251 01 00300 251 01 00400 92495 92495 92495 92495 92495 Size S Size M Size L Size XL Size XXL white white white white white 251 01 01000 251 01 01100 251 01 01200 251 01 01300 251 01 01400 92495 92495 92495 92495 92495 Size S Size M Size L Size XL Size XXL royalblue royalblue royalblue royalblue royalblue XLC COMP BIKEPOLO SHIRT JE-C01 • pocket with concealed zipper • easy fit, high wearing comfort thanks to improved breathability • Fabric: CoolTech, 100% polyester, breathable, UV-protection, quick drying • plaid pattern 251 01 20000 251 01 20100 251 01 20200 251 01 20300 251 01 20400 251 01 20500 251 01 20600 95900 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL Size XXL white/black/blue white/black/blue white/black/blue white/black/blue white/black/blue white/black/blue white/black/blue 251 01 21000 251 01 21100 251 01 21200 251 01 21300 251 01 21400 251 01 21500 251 01 21600 95900 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL Size XXL white/anthracite/gray white/anthracite/gray white/anthracite/gray white/anthracite/gray white/anthracite/gray white/anthracite/gray white/anthracite/gray Page 40 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC COMP BIKEPOLO SHIRT JE-C02 • pocket with concealed zipper • easy fit, high wearing comfort thanks to improved breathability • Fabric: COOLMAX, 100% polyester, breathable, UV-protection, quick drying 251 01 22000 251 01 22100 251 01 22200 251 01 22300 251 01 22400 251 01 22500 251 01 22500 251 01 22600 95900 95900 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL Size XL Size XXL black/anthracite black/anthracite black/anthracite black/anthracite black/anthracite black/anthracite black/anthracite black/anthracite 251 01 23000 251 01 23100 251 01 23200 251 01 23300 251 01 23400 251 01 23500 251 01 23600 95900 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL Size XXL black/white black/white black/white black/white black/white black/white black/white 251 01 24000 251 01 24100 251 01 24200 251 01 24300 251 01 24400 251 01 24500 251 01 24600 95900 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL Size XXL wine red/anthracite wine red/anthracite wine red/anthracite wine red/anthracite wine red/anthracite wine red/anthracite wine red/anthracite XLC COMP LIFESTYLE SHIRT JE-C03 • pocket with concealed zipper • easy fit, high wearing comfort thanks to improved breathability • mesh inserts on the sleeves and at the sides • Fabric: CoolTech, 100% polyester, breathable, UV-protection, quick drying 251 01 25000 251 01 25100 251 01 25200 251 01 25300 251 01 25400 251 01 25500 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL blue/light blue blue/light blue blue/light blue blue/light blue blue/light blue blue/light blue 251 01 26000 251 01 26100 251 01 26200 251 01 26300 251 01 26400 251 01 26500 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL white/brown white/brown white/brown white/brown white/brown white/brown 251 01 27000 251 01 27100 251 01 27200 251 01 27300 251 01 27400 251 01 27500 95900 95900 95900 95900 95900 95900 Size XXS Size XS Size S Size M Size L Size XL anthracite/brown anthracite/brown anthracite/brown anthracite/brown anthracite/brown anthracite/brown Technical changes reserved. www.xlc-parts.com Page 41 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation JERSEY & TROUSERS XLC GENTS’ BERMUDA TR-S07 • upper material: 100% polyamide • massive offroad execution • rip stop in the iner thigh area • bi-elastic rip stop in the kidney area • 1 fitted side pocket with zipper • 2 front pockets • removable, antibacterial lining in micro-fiber bag 251 01 32000 251 01 32100 251 01 32200 251 01 32300 95995 95995 95995 95995 Size S Size M Size L Size XL black black black black XLC LADIES’ BERMUDA TR-S08 • upper material: 100% polyamide • massive offroad execution • rip stop in the inner thigh area • bi-elastic rip stop in the kidney area • 1 side pocket with zipper • 2 front pockets • elastic belt plus velcro-belt for size adjustment • velcro zipper • removable, antibacterial lining in micro-fiber bag 251 01 32500 251 01 32600 251 01 32700 251 01 32800 95995 95995 95995 95995 Size 36 Size 38 Size 40 Size 42 black black black black XLC COMP TROUSERS WITH STRAPS SHORT TR-S02 • bi-elastic cushion pressed • 200 g Lycra • silicone belt worked in to improve the firm fit 251 01 02500 251 01 02600 251 01 02700 251 01 02900 251 01 03000 Page 42 93495 93495 93495 93495 93495 Size S Size M Size L Size XL Size XXL black black black black black www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC COMP 3/4 TROUSERS WITH STRAPS TR-M01 • bi-elastic cushion pressed • 200 gr. Lycra • flat seams • silicone belt worked in to improve the firm fit 251 01 03500 251 01 03600 251 01 03700 251 01 03800 251 01 03900 94495 94495 94495 94495 94495 Size S Size M Size L Size XL Size XXL black black black black black XLC COMP RACING TROUSERS SHORT TR-S01 • bi-elastic cushion pressed • 200 gr. Lycra • cord, silicone belt worked in to improve the firm fit 251 01 02000 251 01 02100 251 01 02200 251 01 02300 251 01 02400 92995 92995 92995 92995 92995 Size S Size M Size L Size XL Size XXL black black black black black XLC COMP WOMEN'S SHORTS SHORT TR-S04 • bi-elastic women cushion pressed • 200 gr. Lycra • flat seams • silicone belt worked in to improve the firm fit, cord 251 01 04000 251 01 04100 251 01 04200 251 01 04300 251 01 04400 92995 92995 92995 92995 92995 Technical changes reserved. Size 36 Size 38 Size 40 Size 42 Size 44 black black black black black www.xlc-parts.com Page 43 ware group 250 JERSEY & TROUSERS article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC COMP 3/4 WOMEN'S SHORTS TR-M02 • bi-elastic women cushion pressed • 200 g Lycra • flat seams • silicone belt worked in to improve the firm fit, cord 251 01 04500 251 01 04600 251 01 04700 251 01 04800 251 01 04900 93995 93995 93995 93995 93995 Size 36 Size 38 Size 40 Size 42 Size 42 black black black black black XLC GENTS’ BOXER SHORT TR-S09 • Material: 60% polyamide, 30% polyester, 10% spandex • erognomic biker fit, front cut lower than the back • seamless welded, antibacterial silicon pad • high wearing comfort thanks to seamless execution • elastic belt 251 01 34000 251 01 34100 251 01 34200 92995 92995 92995 Size S/M Size L/XL Size XXL XLC LADIES’ BOXER SHORT TR-S10 • Material: 60% polyamide, 30% polyester, 10% spandex • ergonomic biker fit, front cut lower than the back • seamless welded, antibacterial silicon pad • high wearing comfort through seamless execution • elastic belt 251 01 34500 251 01 34600 251 01 34800 Page 44 92995 92995 92995 Size 36/38 Size 40/42 Size 44/46 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation JERSEY & TROUSERS XLC WIND BLOCKER JA-W01 • ultra light (120 g) • front reflective print, rear reflective stripes • ventilation openings with zipper under the arms • back pocket • ventilation openings at the back • practical stowage in a hand-sized bag • elastic arm cuffs • Material: 100% polyamide 251 01 30000 251 01 30100 251 01 30200 251 01 30300 251 01 30400 251 01 30500 93995 93995 93995 93995 93995 93995 Size XS Size S Size M Size L Size XL Size XXL white white white white white white XLC RAIN AND WIND BLOCKER JA-W02 • ultra light (140 g) • front reflective print, rear reflective stripes • back pocket • practical stowage in a hand-sized bag • elastic arm cuffs • 3000 mm water depth • Material: 100% polyamide 251 01 31000 251 01 31100 251 01 31200 251 01 31300 251 01 31400 251 01 31500 93995 93995 93995 93995 93995 93995 Technical changes reserved. Size XS Size S Size M Size L Size XL Size XXL white white white white white white www.xlc-parts.com Page 45 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation SUNGLASSES XLC SUNGLASSES CAYMAN SG-F03 • soft-flex frame • extreme light • 'Rubber touch' • rubberised nose pads • microfibre bag included • 100% protection against UV rays 250 01 57000 91895 frame: dark red, glasses: orange 250 01 57100 91895 frame: matt black, glasses: mirrored XLC SUNGLASSES JAMAICA SG-C07 • soft-flex-frame • extreme light • 2 removable glasses, clear and yellow • rubberised nose pads • inclusive microfibre bag • 100% UV protection 250 01 56800 91895 frame: white, glasses: silver mirror 250 01 56900 91895 frame: transparent, glasses: dark mirror XLC SUNGLASSES LA GOMERA SG-C04 • transparent glasses • soft-flex frame • two pairs of spare glasses, yellow and orange • microfibre bag included • 100% protection against UV rays 250 01 55500 91995 frame: black-polish 250 01 55600 91995 frame: gray-polish Page 46 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation SUNGLASSES XLC SUNGLASSES MALEDIEVEN SG-C05 • smoky glasses • soft-flex frame • rubberised nose pads • two pairs of exchange glasses, transparent and orange • microfibre sachet included • 100% protection against UV rays 250 01 56000 91995 frame: white 250 01 56100 91995 frame: black matt XLC SUNGLASSES REUNION SG-F05 • optimal for freeride/DH • soft flex frame • rubberised nose pads • red mirrored glasses • removable sides • elastic band for extremely firm fit • dust sealing • inclusive microfibre bag • 100% protection against UV rays 250 01 54000 92795 frame: transparent XLC SUNGLASSES BAHAMAS SG-F01 • removable 'Optical Frame'; especially for spectacle wearers • correction glasses can be integrated into these glasses! (fitting dimension: max. 2 mm +/-0,1 mm) • soft flex frame • rubberised nose pads • smoke-coloured glasses • two replaceable glasses in clear and yellow • stabile Transportbox •100% protection against UV rays 250 01 50000 91995 frame: matt black, for spectacle wearers 250 01 50100 91995 frame: matt silver, for spectacle wearers Technical changes reserved. www.xlc-parts.com Page 47 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation SUNGLASSES XLC SUNGLASSES SANSIBAR SG-F04 'Optic Frame'; special for spectacle wearers • with handy folding function • soft-flex-frame • rubberised nose pads • smoky glasses • two pairs of spare glasses, colourless and yellow • microfibre sachet included • 100% protection against UV-rays 250 01 50200 92495 frame: matt silver, for wearer of glasses XLC SUNGLASSES GALAPAGOS SG-C06 • soft-flex-frame • extreme light • 2 removable glasses, mirrored and yellow • rubberised nose pads • inclusive microfibre bag • 100% UV protection 250 01 56500 91995 frame: black-polish, glasses: orange mirror 250 01 56600 91995 frame: silver, glasses: orange mirror XLC SUNGLASSES GALAPAGOS II SG-F02 • with self-shading glasses (adapt to the prevalent lightning conditions) • glasses: yellow - gray • soft-flex-frame • extreme light • rubberised nose pads • inclusive hardcover box •100% UV protection 250 01 56550 94995 frame: black, photochromic glasses 250 01 56650 94995 frame: silver, photochromic glasses Page 48 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation SUNGLASSES XLC SUNGLASSES SEYCHELLEN SG-C01 • smoke-coloured glasses • soft flex frame • rubberised nose pads • two replaceable glasses in clear and yellow • inclusive microfibre bag • 100% UV protection 250 01 50600 91695 frame: matt black 250 01 50700 91695 frame: silver XLC SUNGLASSES TAHITI SG-C02 • mirrored glasses • soft-flex frame • rubberised nose pads • two replaceable glasses in clear and yellow • inclusive microfibre bag • 100% UV protection 250 01 50900 91695 frame: blue 250 01 51000 91695 frame: red 250 01 51100 91695 frame: silver XLC SUNGLASSES FOR KIDS MAUI SG-K01 • soft-flex frame • inclusive microfibre bag • 100% UV protection 250 01 53000 9995 Technical changes reserved. frame: blue, mirrored glasses www.xlc-parts.com Page 49 ware group 250 SUNGLASSES article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC SUNGLASSES FOR CHILDREN MAUI SG-K02 • soft-flex frame • microfibre sachet included • 100% protection against UV-rays 250 01 53100 9995 frame: orange, toned glasses XLC SUNGLASSES FOR CHILDREN MAUI SG-K03 • soft-flex-frame • microfibre sachet included • 100% protection against UV-rays 250 01 53200 9995 frame: white/pink, glasses: pink XLC SUNGLASSES FOR CHILDREN MAUI SG-K04 • soft-flex-frame • microfibre sachet included • 100% protection against UV-rays 250 01 53300 9995 frame: pink/black, toned glasses XLC STAND FOR GLASSES FOR A SHOP • Material: wood • (unpopulated) 250 01 59500 Page 50 request for 12 glasses with mirror www.xlc-parts.com Technical changes reserved. SUNGLASSES DESIGN AWARD of the FEDERAL REPUBLIC OF GERMANY THE HEET RX THE CARBON ALL-MOUNTAIN More travel – more fun! Coming at you with 155 mm travel at a record breaking weight of 1980 g. Massive PressFit BB, tapered headtube and Syntace X12 axle system for the rear wheel make the frame super stiff. The Heet RX presents itself as an All-MountainFully at the highest level. It has been worth because at the same time the “HEET” was nominated for the DESIGN AWARD of the FEDERAL REPUBLIC OF GERMANY 2012. The HEET – a real weapon on the trail, a feast for the eyes. What more could one want? haibike.de/heet Stay hungry haibike.de ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC MECHANIC GLOVES CG-L05 GLOVES Perfect bike mechanic gloves for mounting- and precision work, optimal flair and yet extremely durable. • palm material: goatskin, very soft and flexible, very good feeling, very good flexibility • upper hand material: spandex (92% polyester, 8 % spandex), very flexible, allows unreastrained mobility of the hand • velcro at the wrist, firm cuffs 250 01 45000 250 01 45100 250 01 45200 250 01 45300 250 01 45400 250 01 45500 91495 91495 91495 91495 91495 91495 Size XS Size S Size M Size L Size XL Size XXL black/white black/white black/white black/white black/white black/white XLC BIKE GLOVES BG-SF01 'SATURN' CG-S01 • Upper hand: sprintnit, terry cloth thumb to wipe off sweat special hook and loop fastener, which does not draw threads • Inside hand: serino, light cushioning stitched down inside hand 250 01 20000 250 01 20100 250 01 20200 250 01 20300 250 01 20400 250 01 20500 9695 9695 9695 9695 9695 9695 Size XS Size S Size M Size L Size XL Size XXL black black black black black black XLC CHILDREN'S GLOVES 'SPUTNIK' CG-S02 • velcro fastening with rubber label • washable • Upper part: Lycra • Palm: slightly padded and with partition seams • Caution! The colour and pattern may vary! 250 01 31000 250 01 31100 250 01 31200 Page 52 9595 9595 9595 Size 4 Size 5 Size 6 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC BIKE GLOVES 'APOLLO' CG-S03 250 01 37500 250 01 37600 250 01 37700 250 01 37800 9995 9995 9995 9995 Size S Size M Size L Size XL GLOVES • hook and loop fastener with rubber label • washable • Upper hand: Lycra • Inside hand: 'anti-slip' polygrip naps, polyurethane pads • Thumbs: terry cloth fabric, ideal to wipe off sweat gray/black gray/black gray/black gray/black XLC BIKE GLOVES 'ATLANTIS' CG-S04 • hook and loop fastener with rubber label • washable • Upper hand: Lycra • Inside hand: microfibre leather, strengthened, synthetic suede, foam cushioning • Thumbs: terry cloth fabric, ideal to wipe off sweat 250 01 39500 250 01 39600 250 01 39700 250 01 39800 91695 91695 91695 91695 Size S Size M Size L Size XL blue/gray/black blue/gray/black blue/gray/black blue/gray/black XLC BIKE GLOVES 'COLUMBIA' CG-S05 • stretch closure, extra light and breathable, washable • Upper hand: breathable net, microfibre fabric • Inside hand: microfibre leather, 3 mm slight neoprene cushion, breathable net • Thumbs: terry cloth fabric, ideal to wipe off sweat 250 01 40000 250 01 40100 250 01 40200 250 01 40300 91695 91695 91695 91695 Technical changes reserved. Size S Size M Size L Size XL black/gray black/gray black/gray black/gray www.xlc-parts.com Page 53 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC BIKE GLOVES 'SOJUS' CG-S06 GLOVES • hook and loop fastener with rubber label, knuckle protectors, washable, laces to help taking off gloves • Upper hand: breathable net, knuckle protectors • Inside hand: Amara microfibre leather with gel cushioning, silicone-anti-slip-grips, laces to help taking off gloves, strengthened, synthetic suede • Thumbs: terry cloth fabric, ideal to wipe off sweat 250 01 41000 250 01 41100 250 01 41200 250 01 41300 91995 91995 91995 91995 Size S Size M Size L Size XL black/red black/red black/red black/red XLC BIKE GLOVES CG-S07 • elastic upper hand material made of micronet for perfect fit and excellent ventilation • quick-pull system for easy removal • terry thumb, ideal to wipe off sweat • palm made of sturdy clarino • gel padding anatomically shaped to protect palm when falling • power net for good palm ventilation • washable at 30° 250 01 44000 250 01 44100 250 01 44200 250 01 44300 250 01 44400 250 01 44500 92495 92495 92495 92495 92495 92495 Size XS Size S Size M Size L Size XL Size XXL black/white black/white black/white black/white black/white black/white XLC LONG FINGER GLOVES 'ORION' CG-L01 • gel cushioning, knuckle protectors, hook and loop fastener with rubber label, washable • Inside hand: Amara-microfibre leather with gel cushioning, strengthened, synthetic suede, anti-slip silicone grips at the fingers • Upper hand: breathable nylon net, PVC knuckle protectors, flexible knuckle strap • Thumbs: terry cloth fabric, ideal to wipe off sweat 250 01 33000 250 01 33100 250 01 33200 250 01 33300 Page 54 92995 92995 92995 92995 Size S Size M Size L Size XL blue/gray/black blue/gray/black blue/gray/black blue/gray/black www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC LONG FINGER GLOVES MERCURY PRO TEAM EDITION CG-L04 250 01 33500 250 01 33600 250 01 33700 250 01 33800 92995 92995 92995 92995 Size S Size M Size L Size XL white/black/blue white/black/blue white/black/blue white/black/blue 250 01 33503 250 01 33603 250 01 33703 250 01 33803 92995 92995 92995 92995 Size S Size M Size L Size XL white/black white/black white/black white/black GLOVES ultra light competition gloves (46 g for Size L) • velcro closure with rubber label • washable • Palm: perforated microfibre leather, with damping neoprene padding, additional grip thanks to silicone print on the middle and forefinger • Upper part: Lycra • Thumb: terry cloth, ideal to wipe off sweat XLC LONG FINGER GLOVES CG-L06 • elastic, air permeable upper hand fabric, for perfect ventilation • neoprene knuckle protection • reinforced thumb area • palm made of soft, robust clarino with silicone print for perfect grip • airvent ventilation system • donning help • washable at 30° 250 01 35000 250 01 35100 250 01 35200 250 01 35300 250 01 35400 250 01 35500 92995 92995 92995 92995 92995 92995 Size XS Size S Size M Size L Size XL Size XXL white/black white/black white/black white/black white/black white/black XLC WINTER GLOVES WINDPROTECT CG-L07 • upper hand fabric windproof and breathable • wristlet • reinforced thumb area • donning help • rubbertec grip securing • anatomically stitched palm of soft, robust vitech • washable at 30° 250 01 46000 250 01 46100 250 01 46200 250 01 46300 250 01 46400 250 01 46500 93295 93295 93295 93295 93295 93295 Technical changes reserved. Size XS Size S Size M Size L Size XL Size XXL black black black black black black www.xlc-parts.com Page 55 ware group 250 GAITERS, ARM-/ LEGWARMERS article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC WINTER GLOVES WATERPROOF CG-L08 • waterproof, windproof and breathable upper hand material • terry thumb, ideal to wipe off sweat • rubbertec grip security, neoprene gauntlet, reinforced thumb area • anatomically stitched palm made of soft, durable vitech • donning help, washable at 30° 250 01 47000 250 01 47100 250 01 47200 250 01 47300 250 01 47400 250 01 47500 93995 93995 93995 93995 93995 93995 Size XS Size S Size M Size L Size XL Size XXL black black black black black black XLC ARM WARMERS AW-S01 • roughened inside • silicone stop gum at the top • flat lateral seams • Material: superrubaix, 80% polyamide + 20% spandex 250 00 11000 250 00 11100 250 00 11200 92795 92795 92795 Size M Size L Size XL XLC LEG WARMERS LW-S01 • roughened inside • silicone stop gum at the top • flat lateral seams • Material: superrubaix, 80% polyamide + 20% spandex 250 00 11500 250 00 11600 250 00 11700 93495 93495 93495 Size M Size L Size XL XLC KNEE WARMERS KW-S01 • roughened inside • silicone stop gum at the top • flat lateral seams • Material: superrubaix, 80% polyamide + 20% spandex 250 00 12000 250 00 12100 250 00 12200 Page 56 92795 92795 92795 Size M Size L Size XL www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC CYCLEBOOTIES BO-A01 251 00 00000 251 00 00100 251 00 00200 251 00 00300 251 00 00400 251 00 00500 92795 92795 92795 92795 92795 92795 GAITERS • for autumn, spring and winter weather • 2 mm neoprene fabric protects against cold, rain and dirt • Lycra edging • YKK-zipper • toe area rubberised and reinforced • velcro closure on the sole • reflective velcro closure at the rear • silicone print Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 XLC CYCLEBOOTIES BO-A02 • for autumn, spring and rainy weather • PU card web for special protection against wetness • neoprene heels reinforcement • waterproof seams • reflective edgings and seams for additional safety • YKK-zipper plus velcro closure • embossed, profiled rubber sole with press cut opening for cleats • silicone print 251 00 01000 251 00 01100 251 00 01200 251 00 01300 251 00 01400 251 00 01500 93695 93695 93695 93695 93695 93695 Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 XLC CYCLEBOOTIES BO-A03 • for autumn, spring and winter weather • 2 mm neoprene fabric protects against cold, rain and dirt • reflective edging • waterproof, rubberised, lateral zipper • silicone print 251 00 02000 251 00 02100 251 00 02200 251 00 02300 251 00 02400 251 00 02500 92295 92295 92295 92295 92295 92295 Technical changes reserved. Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 www.xlc-parts.com Page 57 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC CYCLEBOOTIES BO-A04 GAITERS • for autumn and winter weather • 2 mm neoprene fabric, plus card web laminated for optimum protection against cold, rain and dirt • waterproof, reinforced seams • YKK-zipper plus velcro closure • toe area rubberised and reinforced • reflective strip for more safety • profiled rubber sole with press cut opening for cleats 251 00 03000 251 00 03100 251 00 03200 251 00 03300 251 00 03400 251 00 03500 93995 93995 93995 93995 93995 93995 Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 XLC CYCLEBOOTIES BO-A05 • for spring, summer and autumn weather • for rainy weather • oxford polyester, extremely tearproof, resistant to weather and waterproof • waterproof seams • massive, continued velcro closure • elastic, flexible fit • reinforced toe area 251 00 04000 251 00 04100 251 00 04200 251 00 04300 251 00 04400 251 00 04500 92495 92495 92495 92495 92495 92495 Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 XLC CYCLEBOOTIES BO-A07 • for winter weather • 4 mm neoprene fabric protect against extreme cold, rain and dirt • waterproof, reinforced seams • reflective strips for additional safety • YKK zipper plus velcro closure • toe area rubberised and reinforced • card web in the toe area • slip on/off aid • silicone print 251 00 06000 251 00 06100 251 00 06200 251 00 06300 251 00 06400 251 00 06500 Page 58 93995 93995 93995 93995 93995 93995 Size 37/38 Size 39/40 Size 41/42 Size 43/44 Size 45/46 Size 47/48 www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC PRO SL MTB SHOES DIRTY CB-M01 250 01 15000 250 01 15100 250 01 15200 250 01 15300 250 01 15400 250 01 15500 250 01 15600 250 01 15700 915995 915995 915995 915995 915995 915995 915995 915995 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 250 01 99000 9995 buckle closure for Pro SL MTB Shoes (piece) 250 01 99200 9595 studs for MTB Shoes (set) 250 01 99100 9995 buckle closure for MTB Pro & Road Pro SL (piece) SHOES • Upper material: extra light microfibre leather and breathable net • heels strengthened • two carbon fibre hook and loop fasteners, one forged quick buckle closure • carbon fibre sole with PU studs; inclusive ventilation • perforated EVA innersole, very good wearing comfort, extra light • TPU studs • Weight: 808g (Size 42) • appropriate for SPD system black/silver black/silver black/silver black/silver black/silver black/silver black/silver black/silver XLC PRO MTB SHOES 'OFFROAD II' CB-M02 • Upper: extra light microfibre-leather and breathable net part • heels strengthened, with reflector • two hook and loop fasteners, one forged quick buckle closure • slip-resistant fibreglass-nylon sole inclusive ventilation • perforated EVA innersole, very good wearing comfort, extra light • TPU studs • Weight: 800g (Size 42) • suitable for SPD system 250 01 06002 250 01 06102 250 01 06202 250 01 06302 250 01 06402 250 01 06502 250 01 06602 250 01 06702 250 01 06802 250 01 06902 250 01 07002 250 01 07202 911495 911495 911495 911495 911495 911495 911495 911495 911495 911495 911495 911495 Technical changes reserved. Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 white/black white/black white/black white/black white/black white/black white/black white/black white/black white/black white/black white/black www.xlc-parts.com Page 59 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC COMP MTB-SHOES CROSSCOUNTRY CB-M05 SHOES • Upper material: extra light, PU-coated leather • breathable nylon mesh • reinforced heels, with reflector • three velcro straps • slideproof fibreglass-nylon sole, with footsure profile • TPU-studs • perforated EVA insole, very good wearing comfort, extra light • Weight: 716 g (Size 42) • compatible with the SPD system 250 00 92000 250 00 92100 250 00 92200 250 00 92300 250 00 92400 250 00 92500 250 00 92600 250 00 92700 250 00 92800 250 00 92900 250 00 93000 250 00 93100 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 Size 37 black Size 38 black Size 39 black Size 40 black Size 41 black Size 42 black Size 43 black Size 44 black Size 45 black Size 46 black Size 47 black Size 48 black XLC LIFESTYLE-SHOES 'PASSION II' CB-L02 • Upper: velours leather, inserted nylon net parts, strengthened nylon heel • hook and loop fastener • Middle sole: fibreglass strengthened nylon, also ideal for longer cursorial passages • slip-resistant and -proof rubber outsole • perfect air circulation • EVA innersole, very good wearing comfort, extra light, washable • Weight: 820g (Size 42) • suitable for SPD system 250 01 14400 250 01 14405 250 01 14500 250 01 14505 250 01 14600 250 01 14605 250 01 14700 250 01 14705 250 01 14800 250 01 14805 250 01 14900 250 01 14905 Page 60 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 black/green black/green black/green black/green black/green black/green black/green black/green black/green black/green black/green black/green www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC LIFESTYLE-SHOES 'FASHION' CB-L03 250 01 16000 250 01 16100 250 01 16200 250 01 16300 250 01 16400 250 01 16500 250 01 16600 250 01 16700 250 01 16800 250 01 16900 250 01 17000 250 01 17100 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 SHOES • Upper material: suede, nylon mesh inserts, reinforced nylon heel • shoelace fastening, one velcro strip • Middle sole: fiberglass reinforced nylon, also ideal for longer walks • rubber antiskid and non-slip outside sole • EVA inside sole, very good wearing comfort, extremely light, washable • Weight: 986g (Size 42) • compatible with the SPD system black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue black/gray/blue XLC LIFESTYLE-SHOES 'URBAN II' CB-L04 • Upper material: robust and breathable suede • shoelace fastening, one velcro strip • nylon net insert • Middle sole: fiberglass reinforced nylon, also ideal for longer walks • rubber antiskid and non-slip outside sole • EVA inner sole, very good wearing comfort, extremely light, washable • Weight: 900g (Size 42) • compatible with the SPD system 250 01 18000 250 01 18100 250 01 18200 250 01 18300 250 01 18400 250 01 18500 250 01 18600 250 01 18700 250 01 18800 250 01 18900 250 01 19000 250 01 19100 96495 96495 96495 96495 96495 96495 96495 96495 96495 96495 96495 96495 Technical changes reserved. Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange black/gray/orange www.xlc-parts.com Page 61 ware group 250 article number CLOTHING & ACCESSORIES WPE x-cellent bike components article designation XLC LIFESTYLE-SHOES 'CASUAL' CB-L05 SHOES • Upper: linen fabric, PU-coated leather • shoelace fastener • slip-resistant and -proof rubber outsole • lateral ventilation slits • EVA innersole, very good wearing comfort, extra light • Weight: 944g (Size 42) • suitable for SPD-System 250 00 90200 250 00 90300 250 00 90400 250 00 90500 250 00 90600 250 00 90700 250 00 90800 250 00 90900 250 00 91000 250 00 91100 250 00 91200 250 00 91300 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 95995 Size 37 black Size 38 black Size 39 black Size 40 black Size 41 black Size 42 black Size 43 black Size 44 black Size 45 black Size 46 black Size 47 black Size 48 black XLC LIFESTYLE-SHOES LADY LCB-L01 • Upper: extra light microfibre-leather and breathable net part • 3 hook and loop fasteners • nylon net • Middle sole: fibreglass strengthened nylon, also ideal for longer cursorial passages • slip-resistant and -proof rubber outsole • EVA innersole, very good wearing comfort, extra light • Weight: 760g (Size 42) • suitable for SPD system 250 01 09200 250 01 09300 250 01 09400 250 01 09500 250 01 09600 250 01 09700 250 01 09800 250 01 09900 Page 62 97995 97995 97995 97995 97995 97995 97995 97995 Size 35 Size 36 Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 white/silver/pink white/silver/pink white/silver/pink white/silver/pink white/silver/pink white/silver/pink white/silver/pink white/silver/pink www.xlc-parts.com Technical changes reserved. ware group CLOTHING & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC PRO ROAD SHOES 'STREET II' CB-R01 250 01 02001 250 01 02101 250 01 02201 250 01 02301 250 01 02401 250 01 02501 250 01 02601 250 01 02701 250 01 02801 250 01 02901 250 01 03001 250 01 03101 910995 910995 910995 910995 910995 910995 910995 910995 910995 910995 910995 910995 Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 SHOES • Upper: extra light microfibre-leather and breathable net part • heels strengthened, with reflector • two hook and loop fasteners • slip-resistant fibreglass-nylon-sole inclusive ventilation • perforated EVA innersole, very good wearing comfort, extra light • Weight: 760g (Size 42) • suitable for LOOK, SPD, SPD-R system black/gold black/gold black/gold black/gold black/gold black/gold black/gold black/gold black/gold black/gold black/gold black/gold XLC COMP MTB SHOES CB-R03 • Upper material: extra light, PU-coated leather • breathable nylon mesh • reinforced heels, with reflector • three velcro straps • slideproof fibreglass-nylon sole, with footsure profile • perforated EVA insole, very good wearing comfort, extra light • Weight: 716 g (Size 42) • compatible with the SPD system 250 00 94000 250 00 94100 250 00 94200 250 00 94300 250 00 94400 250 00 94500 250 00 94600 250 00 94700 250 00 94800 250 00 94900 250 00 95000 250 00 95100 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 96995 Technical changes reserved. Size 37 Size 38 Size 39 Size 40 Size 41 Size 42 Size 43 Size 44 Size 45 Size 46 Size 47 Size 48 white white white white white white white white white white white white www.xlc-parts.com Page 63 ware group 250 CLOTHING & ACCESSORIES article number WPE x-cellent bike components article designation SOCKS XLC SHOE-DISPLAY • 350 x 300 x 1400mm • delivery without shoes 340 00 10000 request silver-coloured metal XLC BIKER SOCKS CS-S01 • high wearing comfort • Material: robust cotton fibre 250 00 00100 250 00 00200 250 00 00300 250 00 00400 9595 9595 9595 9595 Size S 36-40 Size M 40-43 Size L 43-46 Size XL 46+ black black black black 250 00 00800 250 00 00900 250 00 01000 250 00 01100 9595 9595 9595 9595 Size S 36-40 Size M 40-43 Size L 43-46 Size XL 46+ white white white white XLC BIKER SOCKS CS-C01 • high wearing comfort • Material: coolmax, low weight, breathable • cool in summer, heat in winter 250 00 01300 250 00 01400 250 00 01500 250 00 01600 9895 9895 9895 9895 Size S 36-40 Size M 40-43 Size L 43-46 Size XL 46+ gray/black gray/black gray/black gray/black 250 00 01700 250 00 01800 250 00 01900 250 00 02000 9895 9895 9895 9895 Size S 36-40 Size M 40-43 Size L 43-46 Size L 46+ black/red black/red black/red black/red TABLE SIZE OF SHOES US 4 4.5 5 5.5 6 6.5 7 7.5 8 8.5 9 9.5 10 10.5 11 11.5 12 12.5 13 13.5 UK 3 3.5 4 4.5 5 5.5 6 6.5 7 7.5 8 8.5 9 9.5 10 10.5 11 11.5 12 12.5 Euro 36 Page 64 37 38 39 40 41 42 43 44 www.xlc-parts.com 45 46 47 48 Technical changes reserved. MATERIAL & TECHNOLOGY LIGHTING LIGHTING Technical terms intelligibly illustrated! BATTERY LIGHTING LED's LED lights consume definitely less electric current than traditional electric bulbs and are much more durable. For optimal lighting, the indicated number of ultra-bright LEDs is to be used in the light described here. Aluminium Casing Some of our high-quality battery headlights have got an elaborate aluminium casing, which confers them a very elegant and sportive aspect. At the same time, it protects against all noxious influences which are met by cyclists daily. Hi-Power LED This LED light consumes definitely less electric current than traditional electric bulbs and is much more durable. The modern Hi-Power LED produces a particularly bright cone of light. Personal Safety Light The battery lights designated as personal safety lights do not comply with the requirements of the German Road Traffic Act (StVZO) and are therefore only allowed in addition to your dynamo-operated lighting or for other leisure time activities. Please ask your retailer for the rules and regulations valid for other countries. Homologated According to the Prescriptions of the German Traffic Act (STVZO) Traffic Act (STVZO) All battery lights bearing this sign are homologated according to the prescriptions of the German Traffic Act (StVZO). Please ask your retailer for the rules and regulations valid for other countries. Technical changes reserved. www.xlc-parts.com Page 65 ware group 250 article number LIGHTING WPE x-cellent bike components article designation LIGHTING XLC PRO LED FRONT BEAMER 'PHOBOS' 1W CL-F07 high performance LED spot light • luminous period flashing mode: 60 hours • luminous period permanent mode: high 15 hours / low 30 hours • inclusive holder Ø 19 - 31.8 mm • inclusive 3 AAA batteries 250 02 16000 93395 250 02 14600 9295 personal safety lighting, non autorised by the German road act front light bracket for XLC Pro front light XLC PRO LED FRONT BEAMER 'PHOBOS' 3X CL-F08 high performance LED spot light • luminous period flashing mode: 145 hours • luminous period permanent mode: 80 hours • inclusive holder Ø 19 - 31,8 mm • inclusive 3 AAA batteries 250 02 16200 92195 250 02 14600 9295 personal safety lighting, non autorised by the German road act front light bracket for XLC Pro front light XLC PRO LED FRONT BEAMER 'PHOBOS' 5X CL-F09 high performance LED spot light • luminous period flashing mode: 90 hours • luminous period permanent mode: 50 hours • inclusive holder Ø 19 - 31,8 mm • inclusive 3 AAA batteries 250 02 16400 92395 250 02 14600 9295 personal safety lighting, non autorised by the German road act front light bracket for XLC Pro front light XLC PRO HIGH BEAMER 'PROTEUS' 1W CL-F10 • luminous period flashing mode: 60 hours • luminous period permanent mode: 15/30 hours • inclusive holder Ø 19 - 31,8 mm • inclusive 3 AAA batteries 250 02 16600 92495 250 02 14500 9195 Page 66 personal safety lighting, non autorised by the German road act XLC front light bracket for LED Beamer Thebe 4X www.xlc-parts.com Technical changes reserved. ware group LIGHTING x-cellent bike components article number WPE 250 article designation XLC LED FRONT ULTRA BEAMER 'DEIMOS' 1W CL-F04 250 02 10300 92495 250 02 14400 9195 LIGHTING high performance LED spot light • robust aluminium casing • 1 ultra bright white 1 W LED • luminous period, intermittent mode: 60 hours • luminous period continuous light mode: 30 hours • including QR fastening Ø 25,4 - 31,8 mm • including 3 AAA batteries personal safety lighting, non autorised by the German road act replacement bracket for High Beamer 1W XLC LED FRONT HIGH BEAMER 'DEIMOS' 3W CL-F02 high performance LED spot light • aluminium housing • 3W, white LED • Illumination length flashing mode: 60 hours • Illumination length permanent mode: 40 hours • Illumination length Highlight mode: 20 hours • inclusive fixation, diameter 25,4 - 31,8 mm • inclusive 3 AA batteries 250 02 10100 93995 250 02 14400 9195 personal safety lighting, non autorised by the German road act replacement bracket for High Beamer 3W XLC LED FRONT HIGH BEAMER 'EUROPA' 1W CL-F06 high performance LED spot light • 1 ultra-bright, white 1 W LED luminary • Illumination length flashing mode: 60 hours • Illumination length permanent mode: 30 hours • inclusive fixation, diameter 25,4 - 31,8 mm • inclusive 3 AAA batteries 250 02 10700 91995 250 02 14000 9195 personal safety lighting, non autorised by the German road act replacement bracket for Front Beamer 3X / 1 W XLC PRO COMP BEAMER 'CUPID 1W' CL-F12 • 1 High-Power LED • 15 Lux • high power mode / power saving mode • burn time: 8 / 16 hours • inclusive mount Ø 19 - 31,8 mm • inclusive 4 x LR 06 (AA) batteries 250 02 17200 92795 250 02 14700 9250 Technical changes reserved. with German Road Traffic Act authorisation front light bracket for XLC Comp Cupid www.xlc-parts.com Page 67 ware group 250 article number LIGHTING WPE x-cellent bike components article designation LIGHTING XLC LED FRONT BEAMER 'ARIEL' CL-F13 • 1 ultra-bright, 1 W Power LED • 2 light modes (power mode/energy-saving mode) • luminous intensity: 20 Lux/11 Lux • with battery indicator • inclusive holder Ø 19 - 31,8 mm • inclusive 3 AAA batteries 250 02 17100 91995 250 02 14800 9250 with the German road act XLC front light bracket for XLC Comp front light Ariel/Galatea XLC COMP LED FRONT BEAMER 'GALATEA' 5X CL-F11 • 5 japanese LED's • 2 light modes (flashing,permanent) • luminous period flashing mode: 90 hours • luminous period permanent mode: 50 hours • inclusive holder Ø 19 - 31,8 mm • inclusive 3 AAA batteries 250 02 17000 91895 250 02 14800 9250 personal safety lighting, non autorised by the German road act XLC front light bracket for XLC Comp front light Galatea XLC LED FRONT HIGH BEAMER TRITON 5X CL-F01 • heavy duty LED reflector • 5 ultra-bright, white LEDs • luminous period flashing mode: 60 hours • luminous period permanent mode: 30 hours • inclusive holder Ø 25,4 - 31,8 mm • inclusive 4 AAA batteries 250 02 10000 91295 250 02 14000 9195 personal safety lighting, non autorised by the German road act replacement fastening for High Beamer 3X/5X XLC LED FRONT HIGH BEAMER TRITON 3X CL-F03 • heavy duty LED reflector • 3 ultra-bright, white LEDs • luminous period flashing mode: 50 hours • luminous period permanent mode: 25 hours • inclusive holder Ø 25,4 - 31,8 mm • inclusive 2 AAA batteries 250 02 10200 9995 personal safety lighting, non autorised by the German road act 250 02 14000 9195 replacement fastening for High Beamer 3X/5X Page 68 www.xlc-parts.com Technical changes reserved. ware group LIGHTING x-cellent bike components article number WPE 250 article designation XLC LED ULTRA BEAMER 'TRITON 1W' CL-F05 250 02 10400 91995 250 02 14100 9195 LIGHTING • high performance LED spot light • 1 ultra bright, white 1 W LED • illuminating duration blinking mode: 40 hours • illuminating duration continuous light mode: 20 hours • inclusive holder Ø 25.4 - 31.8 mm • inclusive 4 AAA batteries personal safety lighting, non autorised by the German road act replacement bracket for High Beamer 1X XLC LED REAR PANORAMA BEAMER 'CAPRO' 7X CL-R01 • LED rear light with 7 ultra bright, red LEDs • illuminating duration blinking mode: 60 hours • illuminating duration continuous light mode: 30 hours • inclusive holder for seat post and rear frame stays • inclusive 2 AAA batteries 250 02 10600 9795 personal safety lighting, non autorised by the German road act 250 02 14300 250 02 14200 9195 9195 replacement bracket for Panorama Beamer Rear replacement bracket for Panorama Beamer Front (model 2009) XLC COMP LED REAR BEAMER 'OBERON 5X' CL-R09 • 5 LEDs • burn time: approx. 70 hours • inclusive mount Ø 25 - 31,8 mm • inclusive 2 x LR 03 (AAA) batteries 250 02 18000 9795 with German Road Traffic Act authorisation 250 02 14900 9195 replacement bracket for XLC Comp taillight Oberon/Prospero/Biance XLC COMP LED REAR BEAMER 'PROSPERO 3X' CL-R10 • 3 LEDs • burn time: approx. 50 hours/120 hours • inclusive mount Ø 25 - 32 mm • inclusive 1 x CR 2032 batteries 250 02 18100 9795 personal safety lighting, non autorised by the German road act 250 02 14900 9195 replacement bracket for XLC Comp taillight Oberon/Prospero/Biance Technical changes reserved. www.xlc-parts.com Page 69 ware group 250 article number LIGHTING WPE x-cellent bike components article designation LIGHTING XLC COMP LED REAR BEAMER 'BIANCA' CL-R11 • 2 0,5 W LEDs • Illumination length: 40 hours • luminous intensity: 1 Lux • with battery indicator • inclusive holder Ø 25 - 32 mm • inclusive 2 AAA batteries 250 02 18200 91995 250 02 14900 9195 with the German road act replacement fastening for XLC Comp taillight Oberon/Prospero/Biance XLC LED CARRIER BEAMER 'LARISSA' 3X CL-R05 LED taillight • 3 ultra-bright, red LEDs • illumination length: 100 hours • 80 mm hole spacing • inclusive 2 AA batteries 250 02 11100 9995 personal safety lighting, non autorised by the German road act XLC LED REAR ULTRA BEAMER THEBE ULTRA 0,5W CL-R07 LED taillight • 4 modes • 1 ultra-bright, red 0,5 W LED • 2 ultra-bright LEDs for flashing mode • Illumination length permanent mode: 50 hours • Illumination length flashing mode: 100 hours • inclusive fixation for seat post and chainstays • inclusive 2 AAA batteries 250 02 11300 9995 personal safety lighting, non autorised by the German road act 250 02 14300 9195 taillight bracket for Ultra Beamer 0,5 W XLC LED REAR BEAMER THEBE 4X CL-R08 LED taillight with 4 modes and 4 LEDs • Illumination length permanent mode: 50 hours • Illumination length flashing mode: 100 hours • inclusive fixation for seat post and chainstays • inclusive 2 velcro for flexible assembly (helmet fixation, backpack etc)) • inclusive 2 batteries CR2032 250 02 11400 9995 personal safety lighting, non autorised by the German road act 250 02 14500 9195 taillight bracket for LED Beamer 4 X Page 70 www.xlc-parts.com Technical changes reserved. ware group LIGHTING x-cellent bike components article number WPE 250 article designation XLC LED REAR BEAMER THEBE 5X CL-R02 250 02 10800 9795 LED Beamer 5X, personal safety lighting, non autorised by the German road act 250 02 14300 9195 replacement bracket for LED Beamer 5X LIGHTING LED rear light with 5 ultra bright, red LEDs • illuminating duration blinking mode: 70 hours • illuminating duration continuous light mode: 35 hours • inclusive holder for seat post and rear frame stays • inclusive 2 AAA batteries XLC LED REAR BEAMER THEBE 9X CL-R03 LED rear light with 9 ultra bright, red LEDs • illuminating duration blinking mode: 50 hours • illuminating duration continuous light mode: 25 hours • inclusive bracket for seat post and rear end strut • inclusive 2 AAA batteries 250 02 10900 9895 LED Beamer 9X, personal safety lighting, non autorised by the German road act 250 02 14300 9195 replacement bracket for LED Beamer 9X XLC LED CARRIER BEAMER GANY MED 3X CL-R04 • LED rear light for luggage rack, bolt distance 80 mm • 3 ultra bright, red LEDs • illuminating duration: 100 hours • inclusive 2 AAA batteries 250 02 11000 9595 personal safety lighting, non autorised by the German road act XLC LED REAR ULTRA BEAMER CAPRO ULTRA X CL-R06 • LED rear light • 1 ultra bright, red 0.5 W LED • 2 ultra bright LEDs for blinking mode • illuminating duration: 100 hours • inclusive holder for seat post and rear frame stays • inclusive 2 AAA batteries 250 02 11200 9995 personal safety lighting, non autorised by the German road act 250 02 14300 9195 replacement bracket for Panorama Beamer Rear Technical changes reserved. www.xlc-parts.com Page 71 ware group 250 article number LIGHTING WPE x-cellent bike components article designation XLC COMP LED LIGHTING SET 'CUPID/OBERON' CL-S07 LIGHTING composed of: • XLC Comp front light '1 W' and XLC rear light '5 X' 250 02 18500 93500 with the German road act XLC LED LIGHTING SET TRITON + THEBE 5X CL-S03 composed of: • LED front floodlight High Beamer 5X (250 02 100) • LED rear light LED Beamer 5X (250 02 108) 250 02 12000 91695 personal safety lighting set, non autorised by the German road act XLC LED LIGHTING SET TRITON + THEBE 0,5W CL-S04 composed of: • LED-front spotlight High Beamer 1X with 1 ultra bright 0,5 W LED & LED rear light LED Beamer 3X with 2 LEDs and 1 ultra bright 0,5 W LED. 250 02 12100 92495 personal safety lighting set, non autorised by the German road act XLC LIGHTING SET 10 LUX CL-S01 • 10 LUX front beamer • rear light with 5 LEDs • incl. batteries 250 02 00000 91495 250 02 00500 250 02 00600 9195 9195 Page 72 black, incl. batteries replacement bracket for head lamp XLC replacement bracket for rear light XLC www.xlc-parts.com Technical changes reserved. ware group LIGHTING x-cellent bike components article number WPE 250 article designation XLC LED MINI BEAMER SET SAO CL-S05 250 02 12400 9595 LIGHTING • ultra bright red and white LEDs • illuminating duration blinking mode: 100 hours • illuminating duration continuous light mode: 50 hours • inclusive 4 X batteries CR2016 personal safety lighting, non autorised by the German road act XLC LED-MINI BEAMER SET 'BUGGY' CL-S02 • universal safetylights • extreme bright red and white LEDs • duration gleam mode: 160 hours • light duration mode: 80 hours • universal assembly options for the handle bar-, saddle-, chainstray, etc • inclusive 4 X batteries CR2032 250 02 00100 9995 personal safety lighting, non autorised by the German road act XLC LED MINI BEAMER SET 'RACEBAR' CL-S06 • red LED beamer for assembly in the handlebar • signal light on the both outermost sides of the bike • incl. 4 batteries LR44 • flashing and permanent light • Attention: for safeguarding, the handlebar tape also has to be installed at the assembly (handlebar inner clamping) 250 02 12800 91995 Technical changes reserved. personal safety lighting, non autorised by the German road act www.xlc-parts.com Page 73 MATERIAL & TECHNOLOGY BRAKES BRAKES & ACCESSORIES Technical terms intelligibly illustrated! IS 2000 BRAKES AND ACCESSORIES IS 2000 is a disc brake adaption system placed laterally (in parallel to the axle), on the fork or frame. 2-fingers lever 2-fingers lever are levers built for 2-fingers use. They are generally meant for very sportive MTB-use. Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. 3,5-fingers lever 3.5-fingers levers are levers built for 3 or 4 fingers use. 3-fingers lever 3-fingers levers levers are levers built for 3 fingers use. Mechanic Disc Brakes Disc brakes are brakes which operate by means of a brake disc fastened on the hub and of brake blocks within the calliper. Mechanic disc brakes are operated by means of a Bowden cable, just as in the traditional brake systems. Slightly higher force has to be applied for the braking than in case of the hydraulic system. Mechanic brakes are lower priced though and can be changed with simple means. 4-fingers lever 4-fingers levers levers are levers built for 4 fingers use. Cantilever Brake The name Cantilever brake designates a bike rim brake, installed on a special adapter set on the bike frame or fork and operated by means of a centrally conducted cable. Some of our brake levers are particularly well suited for Cantilever brakes. with Colour Indicator The colour indicator on the brake pads indicates when these have to be changed without fail. When the first colour on the brake pad is rubbed off, the brake pad has to be changed immediately. Cartridge Brake Shoes Cartridge brake shoes are two-parts brake shoes the brake pads of which can be changed when worn out. Their advantage over normal brake shoes is that only the worn out brake pads have to be changed and thus the brake shoes haven’t got to be adjusted each time when such a change is made. Only the tension of the brake cable would have to be possibly reduced, in case the old pad had already become too thin. Organic Brake Pads Because of their material consistence, organic brake pads are particularly well suited to all weather conditions and are characterised by the balanced relation between their durability and braking performance. Postmount Adapter CNC milled Postmount is disc brake adapter system, fastened on the fork or frame. CNC is a precise, computerised milling process (Computerised Numerical Controll) allowing the manufacturing of complex and intricate items out of one block. Road Brake for Thumb Switcher Some of our brake levers are particularly suited for assembly together with thumb switchers. Road brakes are rim brakes fastened on the triple tree or chainstay and operated by means of a lateral cable. Some of our brake levers are particularly suited to be assembled together with Road brakes. U-Brake for Twist Grip Switchers Some of our XLC brake levers are particularly suited for assembly together with twist grip switchers. Special brake for BMX use. Some of our brake levers are particularly suited to be assembled together with U-Brakes. Sintered Brake Pads V-Brake Sintered brake pads achieve optimal braking performances even at high temperatures and are thus suited for sportive cyclists, who demand a high braking performance. V-Brakes are rim brakes fastened on a special adapter plinth on the frame or fork and operated by means of a lateral cable. Some of our brake levers are particularly suited to be assembled together with V-Brakes. Hydraulic Disc Brake Disc brakes are brakes which operate by means of a brake disc fastened on the hub and of brake blocks within the calliper. Hydraulic disc brakes use brake fluid or mineral oil as brake medium and achieve excellent braking values. Page 74 www.xlc-parts.com Technical changes reserved.. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC MINI V-BRAKE BR-V04 250 03 01000 9995 BRAKES • Material: aluminium forged • with fixing material, without levers and brake lines • incl. cable duct • Weight: 150 gr. • 85 mm leg length • adjusting range, brake shoes: 20,5 mm - 36,5 mm • 70 mm cartridge brake shoes aluminium black XLC COMP MINI V-BRAKE BR-V06 • Material: aluminium cold forged • with fastening material, without levers and cables • incl. cable guide • Weight: 180 g • 85 mm leg length 250 03 01100 92395 black for FW or RW XLC V-BRAKE BR-V03 • Material: forged aluminium • with fastening material, without levers and brake cables • incl. cable duct • 110 mm leg length • brake shoes: 70 mm, adjusting range: 19 mm - 39 mm • Weight: 190 g 250 03 00500 250 03 00700 91195 91195 aluminium black aluminium silver XLC V-BRAKE BR-V01 • Material: aluminium forged • with fixing material, without levers and brake lines • incl. cable duct • Weight: 161 g • 70 mm brake shoes • for FW or RW 250 03 00000 91995 aluminium black XLC PRO SL V-BRAKE BR-V05 • Material: aluminium, CNC-made • with cartridge brake pads 72 mm • with fixing material, without levers and brake lines • Weight: just 198g (incl. bolt) • for FW or RW 250 03 01800 96995 Technical changes reserved. aluminium black www.xlc-parts.com Page 75 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC COMP V-BRAKE BR-V02 BRAKES • Material: aluminium forged • with fixing material, without levers and brake lines • incl. cable duct • Weight: 161 g • cartridge brake shoes 72 mm • for FW or RW 250 03 00100 92995 aluminium black 250 03 00103 92995 aluminium white XLC COMP ROAD-BRAKE BR-R01 • Material: aluminium forged • adjustment range: 39 - 49 mm • Weight: 161 g • with fixing material without levers and brake lines • cartridge brake shoes 55 mm 250 03 02000 93295 FW, black 250 03 02200 93295 RW, black 250 03 02003 93495 FW, white 250 03 02203 93495 RW white XLC CANTILEVER-BRAKE BR-C01 • Material: aluminium forged • with fastening material, without lever and brake cables • brake shoes 70 mm • for FW or RW 250 03 01500 91395 aluminium black XLC CANTILEVER-BRAKE CROSS BR-C03 • Material: forged aluminium • 21 - 35 mm • with cartridge brake pads of 72 mm • adjustable spring tension • with fastening material, without lever and cable • Weight: 121 g • for FW or RW 250 03 01700 Page 76 92395 aluminium black www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC COMP CANTILEVER-BRAKE BR-C02 • Material: aluminium cold forged • with fastenings material, without lever and cables • Weight: approx. 175 g 91795 aluminium black for FW or RW BRAKES 250 03 01600 XLC BMX U-BRAKE BR-U01 • forged aluminium • brake pads for aluminium rims 55 mm • with fastening material, without lever and traction • adjustment range: 68-91 mm 250 03 06500 9995 FW black 68-91 mm 250 03 06600 9995 RW black 68-91 mm XLC BRAKE LEVER FOR MINI V-BRAKE BL-V03 • Material: aluminium • 2 fingers • Weight: 81 g • for U-Brake and Cantilever/Mini V-Brake 250 03 55500 91495 aluminium black, U-Brake and Cantilever-/Mini V-Brake XLC BRAKE LEVER BL-V01 • Material: aluminium • 2 fingers • Weight: 180 g 250 03 55000 91395 aluminium black, V-Brake 250 03 55003 91595 aluminium white/black, Rapidfire XLC PRO SL BRAKE LEVER SET FOR V-BRAKE BL-V10 • CNC-shaped brake lever • Weight: just 64 g 250 03 56400 96995 Technical changes reserved. aluminium black www.xlc-parts.com Page 77 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC BRAKE LEVER BL-D01 BRAKES • Material: aluminium • 2,5 fingers • can be used on the right, as well as on the left side • for BR-D01 250 03 54900 93295 black 250 03 54903 93295 white XLC BRAKE LEVER SET BL-V02 • for V-Brake • Material: aluminium • 3 fingers • Weight: 196 g • for grip shifter 250 03 55200 91395 aluminium black XLC BRAKE LEVER SET BL-V04 • for V-Brake • Material: aluminium • 3,5 fingers • appropriate for grip shifter and thumb shifter 250 03 55700 91395 black, V-Brake XLC BRAKE LEVER SET BL-C01 • Material: aluminium • 3,5 fingers • appropriate for grip shifter and thumb shifter 250 03 55800 91395 black, cantilever brake XLC BRAKE LEVER SET BL-V05 • V-Brake • Material: aluminium • 4 fingers • rubberised for better grip • appropriate for grip shifter and thumb shifter 250 03 55900 Page 78 91395 aluminium black www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC COMP BRAKE LEVER BL-V12 • Material: aluminium, cold forged • 2 fingers, lever, CNC-manufactured • Weight: approx. 103 g • for mechanic disc brake and V-Brake 91295 black/silver for Rapidfire BRAKES 250 03 55600 XLC ACCESSORY BRAKE LEVER CROSS BL-R02 • Material: aluminium • for drop handlebars 250 03 56600 250 03 56700 91695 91695 Ø 26,0 mm black/silver Ø 31,8 mm black/silver XLC BRAKE LEVER SET ROAD ROAD BL-R01 • Material: aluminium • Weight: 260 g • ergonomic design • for drop handlebars 250 03 57000 91995 brake-lever-set road XLC BRAKE LEVER SET KID BL-V11 • Material: aluminium / nylon composite body • Weight: 176 g • 4-fingers-design • appropriate for twist grip • ergonomic design • for children's bikes 250 03 57200 9995 Technical changes reserved. black/silver www.xlc-parts.com Page 79 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC TUBE TOPS FRAME PROTECTION RUBBER BR-X06 • protective rubber for outer cables 9595 black (set of 4) 250 03 60100 9695 white/transparent (set of 4) BRAKES 250 03 60000 XLC OUTER CABLE CLIP BR-X30 250 03 60200 91295 bag with 200 pieces XLC OUTER SHELL CLIP BR-X08 • aluminium, adhesive 250 03 60400 94995 bottle with 200 pieces XLC END CAPS FOR BRAKE OUTER CABLES BR-X10 • Material: brazen • disposal per bottle with 200 pieces 250 03 60500 91495 bottle with 200 pieces, internal-Ø 5,1 mm XLC END CAP FOR BRAKE OUTER SHELLS BR-X10 • Material: aluminium 250 03 60506 250 03 60507 93995 93995 gold internal Ø 5,0 mm, bottle with 50 pieces red internal Ø 5,0 mm, bottle with 50 pieces 250 03 60516 250 03 60517 9895 9895 gold internal Ø 5,0 mm, card with 10 pieces red internal Ø 5,0 mm, card with 10 pieces XLC END CAPS FOR INNER CABLES BR-X09 • Material: aluminium • disposal per bottle with 500 pieces 250 03 60600 Page 80 91495 bottle with 500 pieces, internal-Ø 1,5 - 1,8 mm www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC OUTER SHELL CLIP BR-X11 • plastic, with cable clip 9895 incl. cable clip (set of 3) BRAKES 250 03 60700 XLC BRAKE TUBE MOUNT BR-X12 • high quality steel, two-piece • for all frame guidance • adjustable • for all customary hydraulic disc brake systems 250 03 60800 91195 adjustable (set of 2) XLC BRAKE INNER CABLES RACE BR-X16/17 • workshop dispenser, with 100 pieces, minimum order = 1 • Ø 1,5 x 1700 mm • Nirosta • Sram/Shimano • low frictional resistance, more effective braking 250 03 61900 250 03 62000 914995 914995 with pear nipple for Race, dispenser with 100 piece with cross nipple for MTB, dispenser with 100 piece BR-X16 BR-X17 XLC BRAKE INNER LINES RACE BR-X15/18 • Ø 1,5 x 1700 mm Nirosta • PTFE-coated, lesser maintenance, optimally sealed • extremely low fictional resistance, effective brake efficiency 250 03 61800 9595 with pear nipple for Race, individually packed on XLC card BR-X15 250 03 62100 9595 with cross nipple for MTB, individually packed on XLC card BR-X18 XLC S-HOOK BR-X13 • plastic, twistable • for derailleur-/brake cables 250 03 60900 9795 (set of 4) XLC BRAKE CABLE SHEATH BR-X19 • Ø 5 mm, robust outer cable, steel inner spiral • polymeric inner cable for low frictional resistance 250 03 62300 92995 dispenser with 50 meter, black 250 03 62303 94995 dispenser with 50 meter, white Technical changes reserved. www.xlc-parts.com Page 81 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC BRAKEPIPE BR-X14 • Nirosta • flexible 9199 BRAKES 250 03 61000 flexible cable duct silver XLC BRAKE CABLE KIT BR-X20 • outer cable: Ø 5 x 2500 mm, inner cable: 1350/2350 mm Niro • maintenance-free, self-greasing, waterproof • incl. 6 cable end ferrules, 3 donuts, 2 inner cable end caps 250 03 62500 91995 brake cable kit with accessories XLC CANTILEVER BRAKE SHOES BS-C01 • Length: 53 mm • Colour: black 203 96 00000 see price list 25 pairs workshop box XLC CANTILEVER BRAKE SHOES BS-C03 • Length: 70 mm • Colour: black 250 03 81400 9895 set of 4 XLC CANTILEVER BRAKE SHOES BS-C02 • Length: 55 mm • Colour: black 250 03 81200 9695 set of 4 250 03 83100 9495 set of 2, 70 mm, black 250 03 83000 203 96 00200 9895 see price list set of 4, 70 mm, black, 25 pairs workshop box 250 03 83200 9995 XLC V-BRAKE BRAKE SHOES BS-V01 Page 82 set of 4, 70 mm, black/red 2 coloured, for immediate recognition of the wear limit www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC V-BRAKE BRAKE SHOES BS-V09 • Length: 70 mm • 3 coloured • asymmetric design 9995 set of 4 BRAKES 250 03 83300 XLC CARTRIGE V-BRAKE BRAKE SHOES BS-V02 • set of 4 • Length: 72 mm • Colour: silver/black 250 03 83500 203 96 00400 91395 see price list set of 4 25 pairs workshop box XLC V-BRAKE BRAKE SHOES BS-V04 • 2 coloured, for immediate recognition of the wearout limit • Length: 72 mm • Colour: black/red • the 'Bow Design', shortens the braking distance, optimally adjustable 250 03 83400 91495 set of 4 XLC CARTRIDGE V-BRAKE BRAKE SHOES BS-V10 • outstanding all-weather features • carbon look • Colour: 3 coloured • Length: 72 mm 250 03 84500 91895 set of 4 XLC V-BRAKE CARTRIDGE BRAKE SHOES BS-V06 • excellent 'All-weather'-performance • 'Trible Combound Mix', soft natural rubber and hard, abrasion-proof, heat-resistant synthetic rubber for optimal brake performance • Colour: green/gray/black, Colour cardridge: white, Length: 72 mm 250 03 85100 91995 set of 4 XLC V-BRAKE CARTRIDGE BRAKE SHOES BS-V03 • Length: 72 mm • Colour: black/red 250 03 84800 91595 Technical changes reserved. set of 4 www.xlc-parts.com Page 83 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC V-BRAKE CARTRIDGE V-BRAKE BRAKE SHOES BS-V05 • with elastomer inserts for a better control and an ABS function • flexible barb, for rim cleaning from mud and water, optimizes the contact and shortens the braking distance. Length: 78 mm / Colour: black/red 91695 BRAKES 250 03 85000 set of 4 XLC V-BRAKE SPARE BRAKE BLOCKS BS-X05 • excellent all-weather characteristics. Thanks to elastomere, the contact between tire and rim is optimised (ABS function) • flexible tip cleans the rim of mud and water • very short braking distance; Length: 78 mm / Colour: black/red 250 03 86900 91095 set of 4 XLC V-BRAKE SPARE BRAKE BLOCKS BS-X07 • Length: 72 mm 250 03 83700 9595 set of 4, black 250 03 84700 9895 set of 4, 3-coloured XLC V-BRAKE RESERVE BRAKE RUBBER BS-X02 • outstanding all-weather features • slim design • Length: 72 mm • Colour: black/red 250 03 86800 9995 set of 4 XLC ROAD BRAKE SHOES BS-R01 • Length: 50 mm • Colour: black 250 03 85800 9695 set of 4 XLC ROAD BRAKE SHOES BS-R02 • cartridge type • set of 4 • Length: 55 mm, Colour: black/silver 250 03 86000 Page 84 91995 set of 4 www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC ROAD CARTRIDGE BRAKE SHOES BS-R06 • set of 4 • Length: 55 mm • extra light • Colour: red/black 92395 set of 4 BRAKES 250 03 86100 XLC ROAD CARTRIDGE BRAKE SHOES BS-R05 • excellent all-weather characteristics • 'Trible Combound Mix', soft natural rubber and hard, abrasion-proof, heat-resistant synthetic rubber for optimal brake performance • Length: 55 mm • Colour cardridge: white / Colour: green/gray/black 250 03 86300 92195 set of 4 XLC ROAD CARTRIDGE BRAKE SHOES BS-R04 • excellent all-weather characteristics, short braking distance • with elastomer inserts for a better control and an ABS function. • flexible barb, for rim cleaning from mud and water • Length: 55 mm / Colour: black/red 250 03 86200 92195 set of 4 XLC ROAD SPARE BRAKE BLOCKS BS-X04 • excellent all-weather characteristics • with elastomer inserts for a better contact between tire and rim is optimised • (ABS function), short braking distance • flexible barb, for rim cleaning from mud and water • Length: 55 mm / Colour: black/red 250 03 86400 91095 set of 4 XLC BRAKE SHOES FOR MAGURA BS-X06 • Length: 55 mm • Colour: black 250 03 87000 91995 set of 4 BRAKE SHOES FOR MAGURA • for HS 11 / 12 / 22 / 24 / 33 / 66 /, • hydro stop / hydro stop mountain 203 96 00500 9399 Technical changes reserved. 25 pairs workshop box www.xlc-parts.com Page 85 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC ROAD RESERVE BRAKE RUBBER BS-X01 BRAKES • cartridge type • Length: 55 mm 250 03 86500 9795 set of 4, black 250 03 86700 9895 set of 4, 3-coloured 250 03 86600 91395 set of 4, for carbon wheels A XLC V-BRAKE CARTRIDGE BRAKE SHOES BS-V08 • set of 4 • Length: 72 mm 250 03 85200 91995 set of 4, black/gold (Map A) 250 03 85300 91995 set of 4, white/gold (Map B) 250 03 85400 91995 set of 4, black/red (Map C) 250 03 85500 91995 set of 4, pink/blue (Map D) 250 03 85600 91995 set of 4, black/titan (Map E) B C D E XLC PRO DISC BRAKE BR-D01 • hydraulic 2-flasks disc brakes with reservoir bottle • aluminium lever with the feature to adjust the range of the grip, on the right and left applicable • automatic brake lining wear compensation • cable can be cut • affixing according to international standard IS 2000 • brake medium: brake fluid mineral oil 250 03 20500 250 03 20600 98995 98995 FW, black, Ø 180 mm disc RW, black, Ø 160 mm disc 250 03 20501 250 03 20601 99995 99995 FW, white, Ø 180 mm disc RW, white, Ø 160 mm disc XLC BRAKE LEVER BL-D01 • disc brake • Material: aluminium • 2,5 fingers • can be used on the right, as well as on the left side 250 03 54900 93295 black 250 03 54903 93295 white Page 86 www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation 250 03 21000 250 03 21100 250 03 21500 91495 91695 91795 Ø 160 mm Ø 180 mm Ø 203 mm BR-X01 BR-X01 BR-X01 250 03 21004 250 03 21104 250 03 21504 91595 91795 91895 Ø 160 mm silver/red Ø 180 mm silver/red Ø 203 mm silver/red BR-X02 BR-X02 BR-X02 BRAKES XLC BRAKE DISC BR-X01/02 XLC BRAKE DISC BR-X50 • Material: brake acting surface: Niro AISI 420; Spider: aluminium 7075 • two-parts construction for less deformation of the disc under high temperatures • less heat transfer to the hub protects the bearings • Weight: Ø 160 mm 106 g, Ø 180 mm 157 g 250 03 21600 250 03 21603 93195 93195 Ø 160 mm Ø 160 mm black/red white/red 250 03 21700 250 03 21703 93995 93995 Ø 180 mm Ø 180 mm black/red white/red XLC SERVICE KIT FOR DISC BRAKE BR-X03/04 250 03 21200 9995 service kit with brake fluid, cartridge seal, etc. BR-X03 250 03 21300 9295 mineral oil/brake fluid, alternative bottle, 50 ccm BR-X04 XLC BRAKE LINE BR-X05 250 03 21400 91295 1600 mm, kevlar XLC DISC BRAKE BR-D02 • mechanical disc brake • Ø 160 mm brake disc • toolless adjustment of the brake pad distance • post mount compatible • inclusive adapter for IS 2000 250 03 22000 250 03 22100 94750 94750 Technical changes reserved. Ø 160 mm disc for FW Ø 160 mm disc for RW www.xlc-parts.com Page 87 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation XLC DISC BRAKE ADAPTER BR-X.. BRAKES • for post mount-brakes • CNC-crafted • Colour: black/silver • lightweight construction 250 03 71000 9995 IS-fork FW Ø160 mm RW Ø140 mm BR-X21 250 03 71100 9995 IS RW Ø160 mm BR-X22 250 03 71200 9995 IS-fork FW Ø180 mm BR-X23 250 03 71300 9995 IS RW Ø180 mm BR-X24 250 03 71400 91295 IS-fork FW Ø203 mm BR-X25 250 03 71500 91295 IS-RW Ø203 mm BR-X26 250 03 71600 91295 PM-fork FW Ø180 mm BR-X27 for PM-fork FW Ø 203 mm BR-X56 NEW! 250 03 71650 91295 BR-X25 BR-X26 BR-X21 BR-X22 BR-X23 BR-X24 BR-X27 BR-X56 XLC DISC BRAKE ADAPTER BR-X.. • for IS-Brake • CNC-crafted • Colour: black/silver • lightweight construction 250 03 71700 91395 IS-fork FW Ø 180 mm, RW Ø160 mm BR-X28 250 03 71800 91395 IS-fork FW Ø 203 mm, RW Ø180 mm BR-X29 BR-X28 Page 88 www.xlc-parts.com BR-X29 Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation BRAKES XLC BRAKE PADS (TESTED ACCORDING TO EN STANDARDS) • per set (1 set = 2 pads) • orange: organic brake pads for all weather conditions, provide a good balance between braking power and durability BP-O04 250 03 92000 91495 for Promax, Hayes BP-O01 250 03 92200 91495 for Promax DSK 400, 601, Xnine BP-O15 250 03 92300 91495 for Avid Code, Code 5 BP-O03 250 03 92400 91495 for RST mechanical BP-O16 250 03 92500 91495 for Formula Oro 250 03 92600 91495 for Tektro Io 250 03 92800 91495 for Magura Louise to 2001; Clara to 2000 250 03 93900 91495 for Shimano Saint BP-O02 BP-O13 BP-O20 Technical changes reserved. www.xlc-parts.com Page 89 ware group 250 article number BRAKES & ACCESSORIES WPE article designation 250 03 94700 91495 for HAYES Stroker Trial 250 03 94800 91495 for Hayes Stroke Ace 250 03 94900 91495 for Tektro Novela Iox x-cellent bike components BRAKES BP-O19 BP-O22 BP-O23 BP-O21 250 03 95000 91495 for Avid Elixir + XX 250 03 92900 91495 for Magura Louise '07, BAT, Carbon '08 250 03 93000 91495 for Magura Marta / Marta SL 250 03 93200 91495 for Magura Gustav M 250 03 93400 91495 for Magura Louise from 2002 and Clara from 2001 XLC Mod. 2 to 2009 BP-O14 BP-O05 BP-O06 BP-O09 Page 90 www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation 91495 for Magura Julie 250 03 93700 91495 Avid Jucy 3/5, Alimate 250 03 94500 91495 AVID BB5, XLC BR-D02 BRAKES BP-O08 250 03 93600 BP-O24 BP-O17 BP-O07 250 03 93800 91495 for Shimano BR-M 575 / 515 / 525 / 495 / 486 / 485 / 475 / 465 / 445 / 416 Tektro Auriga Comp/Pro, Draco, XLC Mod. 3 from 2009 BP-O10 250 03 94000 91495 for Shimano Deore XT (BR-M 755). Grimeca Sys 8 and Sram 250 03 94200 91495 for Shimano Deore (BR-M 555) and Nexave (BR-C 92) 250 03 94400 91495 for Shimano XTR (BR-M 965/966), Deore XT (BR-M 765) and Saint 250 03 94600 91495 for Hayes Stroker Ryde BP-O12 BP-O11 BP-O18 Technical changes reserved. www.xlc-parts.com Page 91 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation BP-O26 91495 BRAKES 250 03 95200 for Hayes Prime BP-O27 250 03 95300 91495 for Hayes Stroker Ryde 2011 BP-O28 250 03 95400 91495 for Hope X2 BP-O29 250 03 95500 91495 for Hope Moto V2 BP-O30 250 03 95600 91995 for Hope M4 BP-O25 250 03 95100 91495 for Shimano XTR 2011 BP-O31 250 03 95700 Page 92 91495 for Formula Mega ONE, R, RX www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC PRO DISC BRAKE PADS SINTERED BRAKES • per set (1 set = 2 pads) • gold: sintered coating that maintains good braking performance also at a high temperature range. Especially for sporty drivers who demand high braking power. BP-S15 250 03 92305 91995 Avid Code, Code 5 250 03 92505 91995 Formula Oro 250 03 92605 91995 Tektro hydraulic & mechanical 250 03 93605 91995 Magura Julie 250 03 93705 91995 Avid Jucy 3/5, Alimate BP-S16 BP-S02 BP-S08 BP-S24 BP-S07 250 03 93805 91995 Technical changes reserved. for Shimano BR-M 575 / 515 / 525 / 495 / 486 / 485 / 475 / 465 / 445 / 416 Tektro Auriga Comp/Pro, Draco, XLC Mod. 3 from 2009, Shim. mech. BR-M515 www.xlc-parts.com Page 93 ware group 250 article number BRAKES & ACCESSORIES WPE x-cellent bike components article designation BP-S10 91995 BRAKES 250 03 94005 Shim. Deore XT (BR-M755), Grimeca Sys 8, Sram BP-S12 250 03 94205 91995 Shim. Deore (BR-M555), Nexave (BR-C92) 250 03 94405 91995 Shim. XTR (BR-M965/966), Deore XT (BR-M765), Saint 250 03 93405 91995 Magura Louise from 2002 / Clara from 2001 XLC Mod. 2 to 2009 BP-S11 BP-S09 BP-S25 250 03 95105 91995 for Shimano XTR 2011 BP-S31 250 03 95705 Page 94 91995 for Formula Mega ONE, R, RX www.xlc-parts.com Technical changes reserved. ware group BRAKES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC HYDRAULIC HOSE KIT • Ø 2,5 x 5,0 mm • max. 12000 psi • Material: kevlar/nylon • compression: 2,0 ml (1500 psi), 3,5 ml (3000 psi) 250 03 75000 250 03 75006 250 03 75008 96500 96500 96500 • suitable for Avid Elixir R, Elixir CR, Elixir 4/5, Elixir CR Magnesium X0, X9, X7 3000 mm, titanium 3000 mm, gold 3000 mm, green 96500 96500 96500 • suitable for Avid XX, Juicy Seven, 3000 mm, titanium 3000 mm, gold 3000 mm, green BRAKES BR-X48 BR-X49 250 03 75100 250 03 75106 250 03 75108 accessories according to type of brake BR-X57 250 03 75200 250 03 75206 250 03 75208 95500 95500 95500 • suitable for Shimano XTR 2007-2010, Deore XT 2008-2010 Hone 2005-2008, SLX 2010, Deore LX 2007-2008, Deore 2002-2010, Alfine 2007-2009 3000 mm, titanium 3000 mm, gold 3000 mm, green BR-X51 250 03 75300 250 03 75306 250 03 75308 96500 96500 96500 • suitable for Magura Clara 2002 Gustav M 2000 - 2010, Marta 2002 - 2010 Marta SL 2003-2010, Marta Gold 2007, Louise 2000 - 2010, Louise FR 2002 - 2006, Louise BAT 2008 - 2010, Louise Carbon 2008 - 2010 3000 mm, titanium 3000 mm, gold 3000 mm, green BR-X52 250 03 75400 250 03 75406 250 03 75408 96500 96500 96500 • suitable for Formula Oro 3000 mm, titanium 3000 mm, gold 3000 mm, green accessories according to type of brake BR-X53 250 03 75500 250 03 75506 250 03 75508 96500 96500 96500 • suitable for Formula R1, THE ONE, MEGA, RX, THE ONE FR 3000 mm, titanium 3000 mm, gold 3000 mm, green BR-X54 250 03 75600 250 03 75606 250 03 75608 96500 96500 96500 • suitable for Hayes Stroker Trail, Stroker Carbon, Stroker Ace, Stroker Gram 3000 mm, titanium 3000 mm, gold 3000 mm, green BR-X55 250 03 75700 250 03 75706 250 03 75708 95500 95500 95500 • suitable for XLC Pro, Tektro Auriga Comp 3000 mm, titanium 3000 mm, gold 3000 mm, green accessories according to type of brake Technical changes reserved. www.xlc-parts.com Page 95 MATERIAL & TECHNOLOGY HEADSET HEADSETS & ACCESSORIES LUGGAGE RACKS BELLS CHAINSTAY PROTECTION Technical terms intelligibly illustrated! HEADSETS & ACCESSORIES BELLS 1 1/8 inches extra light 1 1/8 inches headsets are compatible with 1 1/8 inches steering tubes (outer Ø of the tube: 28,6 mm) Light accessories play an ever-increasing part in bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. 1 inch 1 inch headsets are compatible with 1 inch steering tubes (outer Ø of the tube: 25,4 mm) A-Head Set In case of the A-Head-Set systems, the stem is fastened to the steering tube from outside. The steering tube does no longer need a thread, this giving the fork manufacturers the possibility of producing steering tubes with thinner walls and to use other materials, e.g. carbon. Hence, the A-Head Set system offers a weight advantage and facilitates assembly. CHAINSTAY PROTECTION Neoprene Neoprene is a material made of synthetic rubber. It is very robust and extremely resistant against atmospheric exposure and embrittlement. With these properties, the XLC chainstay protection protects the paint and the frame material of your bike effectively against damages in the long run. Cartridge Bearing Cartridge bearings are the type of bearings most frequently used in bikes. The manufacturers set thereby all necessary ball bearings in a so-called cartridge, adjust and grout them, so that they are protected against dust and dirt and they must not be adjusted in the assembling process. They are thus absolutely maintenance-free. integrated In case of integrated headset systems, the bearing shells are integrated in the frame beforehand and the shells are not grouted. A lower weight and a lower height are the result. semi-integrated In semi-integrated headsets, the bearings shells are still grouted into the head tube of the bike frame, but the bearing direction is already within the head tube, which results in a lower weight and a lower height. LUGGAGE RACKS Aluminium-Luggage racks The aluminium used fort he construction minimises the own weight of the luggage rack and renders it resistant against corrosion. Moreover, aluminium luggage racks are stiffer than those of pliant steel wire, which are easily deformed. with Spring Flap The spring flap is a special flap which serves to fix luggage quickly and easily to the luggage rack, by means of a spring. Lowrider-Luggage Rack The term Lowrider designates luggage racks fastened to the front wheel fork. The luggage is placed left and right of the front wheel. Thus, the centre of gravity lies very low and the manoeuvrability remains good even under full load. You can consult your XLC retailer as to the compatibility of the respective XLC Lowrider luggage rack with your bike. with Pump Hook It is often difficult to find an appropriate place for a pump on one’s bike. Yet, as it is extremely important to carry an efficient pump, especially on tours on which one carries luggage, some of the XLC luggage racks are serially equipped with so-called pump hooks. Pump hooks are pin-like adaptions on the luggage rack, where special clamp pumps can be installed without any tools. The pump is thus always at hand. Page 96 www.xlc-parts.com Technical changes reserved. ware group FORK, HEADSETS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC PRO SL CARBON RACING BIKE FORK CF-R01 • 700 C, carbon tube 300 mm, with allen drill, without lugs • for short racing brakes (49 mm) • Cone: 30 mm (integrated) • Weight: approx. 383 g • approach 40 mm • fitting dimension: 375 mm 919995 1.1/8" A-Head SL 330 mm cone 30 mm (integrated) HEADSET 250 05 28215 XLC A-HEAD PLUGS AP-S01 • with claw fastener 250 05 20000 250 05 20200 9395 9395 1", aluminium, silver 1", aluminium, black 250 05 20400 250 05 20600 9395 9395 1.1/8", aluminium, silver 1.1/8", aluminium, black 250 05 20606 250 05 20607 250 05 20608 250 05 20609 9595 9595 9595 9595 1.1/8", aluminium, gold 1.1/8", aluminium, red 1.1/8", aluminium, green 1.1/8", aluminium, blue XLC A-HEAD PLUG AP-A01 • for carbon fork • aluminium cap 250 05 29000 250 05 29100 250 05 29200 9995 9995 9995 carbon stem Ø 22-23 mm, 50 mm carbon stem Ø 23-24 mm, 50 mm carbon stem Ø 24-25 mm, 50 mm image shows carbon cap ! XLC A-HEAD PLUG AP-C01/AP-C02 • for carbon fork • carbon cap • approx. 40 g (25 mm) 250 05 30000 250 05 30100 250 05 30200 91395 91395 91395 carbon stem Ø 22-23 mm carbon stem Ø 23-24 mm carbon stem Ø 24-25 mm 250 05 30050 250 05 30150 250 05 30250 91795 91795 91795 carbon stem Ø 22-23 mm, 50 mm NEW! carbon stem Ø 23-24 mm, 50 mm NEW! carbon stem Ø 24-25 mm, 50 mm NEW! Technical changes reserved. www.xlc-parts.com Page 97 ware group 250 article number HEADSETS & ACCESSORIES WPE x-cellent bike components article designation XLC A-HEAD SPACER AS-A01 9595 HEADSET 250 05 30500 1.1/8”, conical form, height 18 mm, black XLC A-HEAD SPACER-SET AS-A02 • Ø 1" (25,4 mm) alternatively Ø 1 1/8" (28,6 mm) • consisting of: 3 x 5 mm, 1 x 10 mm, 1 x 15 mm 250 05 31000 9595 Ø 1" (25,4 mm) 3 x 5, 1 x 10, 1 x 15 mm, matt black 250 05 31500 9595 Ø 1 1/8" (28,6 mm) 3 x 5, 1 x 10, 1 x 15, matt black 250 05 31501 9595 Ø 1 1/8" (28,6 mm) 3 x 5, 1 x 10, 1 x 15, wet-black XLC A-HEAD SPACER-SET AS-A02 • Ø 1 1/8" (28,6 mm) • consisting of: 3 x 5 mm, 1 x 10 mm, 1 x 15 mm 250 05 31506 250 05 31507 250 05 31508 9795 9795 9795 3 x 5, 1 x 10, 1 x 15, gold 3 x 5, 1 x 10, 1 x 15, red 3 x 5, 1 x 10, 1 x 15, green 250 05 31509 9795 3 x 5, 1 x 10, 1 x 15, blue XLC A-HEAD SPACER-SET AS-C01 • Ø 1 1/8" (28,6 mm) • consisting of: 3 x 5 mm, 1 x 10 mm, 1 x 15 mm 250 05 31600 91295 3 x 5, 1 x 10, 1 x 15, carbon XLC HEADSET HS-S01 • Material: steel • double sealed • Height: 24 + 9,5 = 33,5 mm • 8-part, 160 g 250 05 00000 250 05 00100 250 05 00200 Page 98 9795 9795 9795 1", cone Ø 22,2/34,0/26,4 mm, chromed 1", cone Ø 22,2/30,0/26,4 mm, chromed 1", cone Ø 22,2/34,0/27,0 mm, chromed www.xlc-parts.com Technical changes reserved. ware group HEADSETS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC HEADSET HS-S02 • Material: steel • Measures: Ø 25.4/34.0/30.0 mm, sealed • Height: 23,5 + 10,5 = 34 mm • consists of 9 part, 160 g 9995 9995 1 1/8", cone 30,0 mm, chromed 1 1/8", cone 30,0 mm, black HEADSET 250 05 00500 250 05 00700 XLC COMP HEADSET HS-S03 • Material: aluminium, 6-parts, 110 g • Measures: Ø 22,2/30,2/26,4 (22,2/30,0/27,0) mm, • semi-cartridge, waterproof, Height: 25,8 + 11,7 = 37,5 mm 250 05 01000 250 05 01200 250 05 01400 250 05 01600 92995 92995 92995 92995 1", cone 26,4 mm, black 1", cone 26,4 mm, silver 1", cone 27,0 mm, black 1", cone 27,0 mm, silver XLC COMP A-HEAD HEADSET ROAD HS-A01 • Material: aluminium • Measures: Ø 25,4/30,2/26,4 mm, semi-cartridge • Height: 26,7 + 14,5 = 41,2 mm • 7-part, 102 gr. 250 05 02500 250 05 02600 92995 92995 1" cone Ø 26,4, black 1" cone Ø 26,4, silver COMP A-HEAD HEADSET MTB/FREERIDE HS-A02 • bottom cone Heavy Duty CroMO 4 mm • Material: steel/CroMo • Measures: Ø 28,6/34,0/30,0 mm • Height: 17 + 13,5 = 30,5 mm • 10-part, 200 g 250 05 03000 92995 1 1/8" cone Ø 30,0 black XLC A-HEAD HEADSET MTB HS-A04 • Material: steel • Measures: Ø 28,6/34,0/30,0 mm • Height: 12 + 11 = 23 mm • 5-part, 139 g 250 05 04000 91395 Technical changes reserved. 1 1/8" cone Ø 30,0 black www.xlc-parts.com Page 99 ware group 250 article number HEADSETS & ACCESSORIES WPE x-cellent bike components article designation XLC A-HEAD HEADSET MTB HS-A03 • Material: aluminium • Measures: Ø 28,6/34/30 mm • Height: 15,2 + 12,4 = 27,6 mm • 9-part, 101 g 92795 92795 HEADSET 250 05 04400 250 05 04500 1 1/8" cone Ø 30,0 black 1 1/8" cone Ø 30,0 silver XLC A-HEAD HEADSET MTB/ROAD HS-A05 • Material: aluminium • Measures: Ø 28,6/34/30 mm, semi-cartridge, waterproof • Height: 27,7 + 11,5 = 39,2 mm • 6-part, 90 g 250 05 04600 92895 1 1/8" cone Ø 30,0 black XLC A-HEAD HEADSET HS-A06 • Material: steel • Measure: Ø 25,4/30,2/26,4 mm, semi-cartridge • Height: 11,45 + 11,05 = 22,5 mm • 6-part, 101 g 250 05 04800 250 05 04900 91995 91995 1" cone Ø 26,4 black 1" cone Ø 26,4 silver XLC A-HEAD HEADSET HS-A07 • Material: steel • Measure: Ø 25,4/30,0/27,0 mm, semi-cartridge • Height: 11,45 + 11,05 = 22,5 mm • 6-part, 101 g 250 05 05000 250 05 05100 91995 91995 1" cone Ø 27,0 black 1" cone Ø 27,0 silver XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-A09 • cartridge, sealed • Material: CroMo • Measure: Ø 38,1/49,7/39,8 mm • Height: 17 + 14,1 = 31,1 mm • 7-part, 335 g 250 05 08700 Page 100 95995 1,5" cone Ø 39,8 black www.xlc-parts.com Technical changes reserved. ware group HEADSETS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-A10 • cartridge, sealed • Material: CroMo • Measures: Ø 28,6/49,7/30,0 mm • Height: 17 + 14,1 = 31,1 mm • 7-part, 335 g 95995 1,5" cone Ø 30,0 for 1 1/8" fork HEADSET 250 05 08800 XLC COMP A-HEAD HEADSET HS-A08 • Material: aluminium • Measures: Ø 28,6/34,0/30,0 mm, semi-cartridge • Height: 15,4 + 11,8 = 27,2 mm • 8-part, 112 g 250 05 05300 250 05 05400 93295 93295 1 1/8" cone Ø 30,0 black 1 1/8" cone Ø 30,0 silver XLC HEADSET SEMI-INTEGRATED HS-I04 • Material: steel • Measures: Ø 25,4/44/30,0 mm, semi-cartridge, sealed • Height: 15,2 + 3,0 = 18,2 mm • 9-part, 153 g 250 05 02000 250 05 02200 9995 9995 1 1/8", cone Ø 30,0 black 1 1/8", cone Ø 30,0 silver XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I09 Freeride, Jumping • Material: CroMo bearing shells, aluminium casing semi-integrated • Measures: Ø 28,6/44/30 mm • Height: 10,1 + 5,5 = 15,6 mm • 10-parts, 130 g 250 05 02300 93295 1 1/8", cone, 30 mm black XLC A-HEAD HEADSET SEMI-INTEGRATED HS-I03 • Material: aluminium • Measures: Ø 28,6/44,0/30,0 mm, semi-cartridge • Height: 5,5 + 3 = 8,5 mm • 5-part, 117 g 250 05 05700 91395 Technical changes reserved. 1 1/8" cone, 30 mm black www.xlc-parts.com Page 101 ware group 250 article number HEADSETS & ACCESSORIES WPE x-cellent bike components article designation XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I08 tapered (1 1/8 - 1,5") • cartridge, sealed, 5-part, 95 g • material: aluminium • Measure: Ø 28,6/44-55/39,8 mm (plus fork cone 30,0 mm) • Height: 7,3 + 3,0=10,3 mm 94995 HEADSET 250 05 08500 1 1/8 - 1,5 " tapered, semi-integrated XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I10 tapered (1 1/8 - 1,5") • sealed bearings, 9-part, 226 g • CroMo bearing shells, aluminium casing • Measure: Ø 28,6/44-49,7/39,8 mm (plus fork cone 30,0 mm) • Height: 10,1 + 14,1= 24,2 mm 250 05 08600 95995 1 1/8 - 1,5 " tapered, semi-integrated XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I02 • Material: aluminium • Measure: Ø 28,6/44,0/30,0 mm, cartridge • Height: 7,3 + 2 = 9,3 mm • 8-part, 80 g 250 05 05800 250 05 05900 92995 92995 1 1/8" cone Ø 30 mm black 1 1/8" cone Ø 30 mm silver XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I07 tapered (1 1/8 - 1,4") • cartridge, sealed • Material: aluminium • Measure: Ø 28,6/41,4-50,6/33,0 mm • Height: 18,2 + 3,5=21,7 mm • 7-part, 113 g 250 05 08000 93995 1 1/8 - 1 1/4, tapered, semi-integrated, black XLC COMP A-HEAD HEADSET INTEGRATED HS-I01 • Material: aluminium • Measure: Ø 28,6/41/30 mm, cartridge, sealed • Height: 11,05 + 0,65 = 11,7 mm • 5-part, 50 gr. 250 05 06500 Page 102 92995 1 1/8" cone Ø 30 mm black www.xlc-parts.com Technical changes reserved. ware group LUGGAGE RACKS x-cellent bike components article number WPE 250 article designation XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I05 tapered (1 1/8 - 1,5") • cartridge, sealed, 5-part, 75 g • Material: aluminium • 45/45° • Measures: Ø 28,6/41,8-52/39,8 mm (plus fork cone 30,0 mm) • Height: 8,8 + 0,7 = 9,5 mm 94995 1 1/8 - 1,5", integrated, black LUGGAGE RACKS 250 05 07000 XLC COMP A-HEAD HEADSET SEMI-INTEGRATED HS-I06 tapered (1 1/8 - 1,5") • cartridge, sealed • Material: aluminium • Measures: Ø 28,6/41,8-46,9/33,0 mm, 45/45° • Height: 7,8 + 0,8 = 8,6 mm • 5-part, 74 g 250 05 07500 94500 1 1/8 - 1 1/4, integrated, black XLC ALU RW-LUGGAGE RACK RP-R01 • including fastening for soldered eyelets • precision welded • spring damper, hook for the tyre pump, tail lamp holder • maximum load: 25 kg 250 06 00000 92995 26 - 28" black matt 250 06 00200 92995 26 - 28" silver matt XLC ALU LUGGAGE RACK RP-R09 • Weight: approx. 800 g • for seat post fastening with Quickrelease • 2 lateral bags with mesh outer pockets • removeable interior compartment • interior mesh pocket • expo-system - volume expandable from 3 to 5 liter 250 06 02800 95995 incl. removable bag, carrier handle and reflective tapes XLC ALU SEAT POST LUGGAGE RACK RP-R07 • with spring clamp • adequate for Ø 25,4 - Ø 31,8 mm • with quick release • with lateral mount for optimal bag fastening • maximum load: 10 kg 250 06 00600 92395 Technical changes reserved. black www.xlc-parts.com Page 103 ware group 250 article number LUGGAGE RACKS WPE x-cellent bike components article designation XLC ALU SEAT POST LUGGAGE RACK RP-R06 • precision welding • fixation gum • appropriate for Ø 25,4 - Ø 32,0 • quick release • with quick release system • maximum load: 10 kg • 13 mm aluminium tube • charge surface 32 x 18 cm 92995 LUGGAGE RACKS 250 06 00500 black matt XLC ALU CARRIER RP-R03 • precision welded • clamping belt • fixation gum • tail lamp holder • hook for the tyre pump 240 mm • maximum load: 25 kg • Weight: 670 g • 13 mm aluminium tube 250 06 00700 92695 206 62 40200 9295 28" black matt tension belt, black, 600 mm XLC ALU CARRIER RP-R02 • precision welded • 4kt profile, adjustable stays • quick adjusting sytem • with spring damper and hook for the tyre pump • maximum load: 25 kg 250 06 02000 92595 26 - 28" matt black 250 06 02200 92595 26 - 28" silver XLC ALU LUGGAGE CARRIER RP-R04 • precision welded • 3 stays • with spring flap, adjustable from 26 - 28“ • maximum load 25 kg 250 06 02300 91995 26 - 28”, black 250 06 02400 91995 26 - 28”, silver Page 104 www.xlc-parts.com Technical changes reserved. ware group LUGGAGE RACKS x-cellent bike components article number WPE 250 article designation XLC ALU LUGGAGE RACK RP-R05 250 06 02500 92995 26”, black 250 06 02600 92995 28”, black LUGGAGE RACKS • including fastening for soldered eyelets • Material 6061-T6 • Ø 14 - 16 mm • with spring flap • with pump hook • maximum loading: 25 kg • including fixing parts for chainstays XLC ALU LUGGAGE RACK RP-R08 • rear light fastener • with spring clamp • maximum load: 25 kg • incl. fastening parts for soldered eyelets 250 06 01500 92795 24 - 28", black XLC ALU LOWRIDER LUGGAGE RACK LR-F02 • precision welded • incl. fixing material • maximum load: 10 kg 250 06 01200 92395 black matt XLC ALU LOWRIDER LUGGAGE RACK LR-F01 • with suspension fork • precision welded • incl. fixing material • maximum load: 10 kg • max. 40 mm 250 06 01300 92395 Technical changes reserved. black matt www.xlc-parts.com Page 105 ware group 250 article number BELLS WPE x-cellent bike components article designation XLC MINI BELL DD-M01 • extra loud, clear sound 250 07 00000 9495 silver 250 07 00200 9495 black BELLS XLC MINI BELL 'MESSING' (BRASS) DD-M02 250 07 01000 9695 brass coloured XLC MINI BELL 'RETRO' DD-M03/DD-M04 250 07 01500 91395 250 07 01600 9795 brass DD-M03 aluminium DD-M04 XLC MINI BELL DD-M09 • Material: aluminium • available in three different colours • suited for diameter from Ø 22,2 mm to Ø 31,8 mm 250 07 03000 9495 black Ø 22,2 - 31,8 mm 250 07 03003 9495 white Ø 22,2 - 31,8 mm 250 07 03100 9495 silver Ø 22,2 - 31,8 mm XLC MINI BELL OVERSIZE DD-M05 250 07 02000 Page 106 9595 compatible for handlebar diameter to Ø 31,8 mm www.xlc-parts.com Technical changes reserved. ware group BELLS, CHAINSTAY PROJECTION 250 x-cellent bike components article number WPE article designation XLC BELL FOR RACE BIKES DD-M08 • Material: aluminium • appropriate for handlebar Ø from 25.4 to 31.8 mm • extra light, only 20 g 250 07 02200 9495 black 250 07 02500 250 07 02600 250 07 02700 250 07 02800 9295 9295 9295 9295 BELLS CHAINSTAY PROTECTION XLC MINI BELL DD-M06 black silver red blue XLC NEOPRENE CHAIN STAY PROTECTOR CP-N01 • with hook and loop fastener 250 08 00000 9595 black XLC NEOPRENE CHAIN STAY PROTECTOR CP-N02 • with hook and loop fastener 250 08 00200 250 08 00300 9950 9950 carbon silver carbon black XLC NEOPRENE CHAIN STAY PROTECTOR CP-C01 • for frames and chain stay, 8 different adhesive pads 250 08 00500 91095 Technical changes reserved. carbon black www.xlc-parts.com Page 107 ware group 250 article number BICYLE CHAIN WPE x-cellent bike components article designation XLC BICYCLE CHAIN CC-H01 • 1/2 x 1/8, 112 links • bolt length 9,2 mm • Weight: 410 g • inclusive spring pin 250 10 00000 9995 1/2 x 1/8 112 links BICYCLE CHAIN XLC BICYCLE CHAIN CC-C01 Chemically nickel plated outer plate for high quality corrosion protection and brilliant optics. • 1/2 x 3/32, 114 links • for 6/7/8-fold shifts • bolt length 7.2 mm, Weight: 319 g • inclusive quick release 250 10 00400 91695 1/2 x 3/32, 114 links, 6-7-8-speed XLC BICYCLE CHAIN CC-C02 Chemically nickel plated outer plate for high quality corrosion protection and brilliant optics. • 1/2 x 11/128, 114 links • for 9-fold shifts • bolt length 6,6 mm, Weight: 298 g • inclusive quick release 250 10 00600 92495 1/2 x 11/128, 114 links, 9-fold XLC BICYCLE CHAIN CC-C03 Chemically nickel plated outer plate for high quality corrosion protection and brilliant optics. • 1/2 x 11/128, 114 links • for 10-fold shifts • bolt length 5,9 mm, Weight: 285 g • inclusive quick release 250 10 00800 93295 1/2 x 11/128, 114 links, 10-fold XLC SPRING FASTENER CC-X01 250 10 02100 9135 for gear hub chains 1/2" x 11/8" XLC-LINK CHAIN SEALING CC-X.. 250 10 02500 9395 for chains 6/7/8-fold CC-X05 250 10 02600 9395 for chains 9-fold CC-X06 250 10 02700 9795 for chains 10-fold CC-X07 Page 108 www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY GEAR CHANGING ACCESSORIES WHEELS Technical terms intelligibly illustrated! GEAR CHANGING ACCESSORIES Aluminium 6061 GEAR CHANGING ACCESSORIES The aluminium alloys of the 6000 series contain mainly the metals magnesium and silicium. The tensile strength lies between about 200 and 350 N/mm. Among the advantages of this quite pliant aluminium there are very good processing and resistance to corrosion. The aluminium alloy 6061 has got many uses, among others shop equipment, aviation, astronautics and naturally construction of bike frames and components. CNC CNC is a precise, computerised milling process (Computerised Numerical Controll) allowing the manufacturing of complex and intricate items out of one block. The dimensional tolerances are reduced to a minimum. Single Speed The term Single-Speed designates a bike without gear changing. If there is no free wheel it is called “rigid gear” or „fixed gear“, colloquially also frequently called „Fixie“. WHEELS Cartridge Bearings Cartridge bearings are the type of bearings most frequently used in bikes. The manufacturers set thereby all necessary ball bearings in a so-called cartridge, adjust and grout them, so that they are protected against dust and dirt and they must not be adjusted in the assembling process. They are thus absolutely maintenance-free. CNC CNC is a precise, computerised milling process (Computerised Numerical Controll) allowing the manufacturing of complex and intricate items out of one block. The dimensional tolerances are reduced to a minimum. Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. Flat Spokes The profiles of flat spokes generate less air turbulences, thus reducing air resistance and better aerodynamics. For this reason flat spokes are mainly used in cycling competitions. Wear Indicator The rims of some of our XLC wheel sets have got a groove in the braking surface, which serves as wear indicator. When this groove in the lateral surface can no longer be seen, the braking flank of the rim is so worn that the necessary material thikkness for a safe use of the rim is no longer given. In this case, the rim has to be changed immediately. The rim wear can be staved off by always using special brake pads for aluminium rims. Old brake pads or those, which have been stored for too long and have therefore hardened also can damage the rim. Technical changes reserved. www.xlc-parts.com Page 109 ware group 250 article number GEAR CHANGING ACCESSORIES WPE x-cellent bike components article designation XLC CHAIN GUIDE ROLLER CR-A02 • adequate for most chain stays • Material: aluminium 6061-T6 250 11 05000 91995 rear fastening XLC CHAIN TENSIONER CR-A03 • for single-speed hubs, not suited to back pedalling hubs • fastening at the derailleur hanger • Material: aluminium 6061-T6 CNC • C/C68 mm, 16 - 20 sprockets 91995 GEAR CHANGING ACCESSORIES 250 11 06000 fastening at the derailleur hanger XLC CHAIN TENSIONER CR-A04 • for single-speed hubs, not suited to back pedalling hubs • fastening at the derailleur hanger • Material: aluminium 6061-T6 CNC • C/C68 mm, 16 - 20 sprockets 250 11 06100 92495 fastening at the derailleur hanger XLC CHAIN TENSIONER CR-A05 • Material: aluminium 6061-T6 CNC • also for two-wheel chain leaves 250 11 06200 91995 fastening at the derailleur hanger XLC CHAIN TENSIONER CR-A06 • Material: aluminium 6061-T6 CNC • 12 - 13 sprockets • C/C34 mm • fastening at the derailleur hanger 250 11 06300 92995 fastening at the derailleur hanger XLC GEAR SHIFT PULLEY PU-A01 • Shimano compatible • obturated • per pair 250 11 06500 Page 110 91295 silver www.xlc-parts.com Technical changes reserved. ware group GEAR CHANGING ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC REAR DERAILLEUR PULLY 'COLOURED EDITION' PU-A02 • Material: aluminium 7075 • compatible with Shimano 8/9/10-fold, Campa 9/10-fold • sealed • per pair 250 11 06706 250 11 06707 250 11 06708 250 11 06709 92995 92995 92995 92995 gold red green blue XLC END CAPS FOR SHIFT PROTECTIVE COVERS SH-X08 • disposal per bottle with 100 piece 9995 disposal per bottle with 100 piece (quantity ordered = 1 VE) GEAR CHANGING ACCESSORIES 250 11 00000 XLC END CAPS FOR SHIFT OUTER SHELLS SH-X07 • Material: aluminium • bottle with 50 pieces 250 11 00006 250 11 00007 93995 93995 gold, inner-Ø 4,0 mm bottle with 50 piece red, inner-Ø 4,0 mm bottle with 50 piece XLC CABLE DONUTS SH-X9 • for openly run shift and brake cables • disposal per bottle with 200 piece 250 11 00200 92895 disposal per bottle with 200 piece (quantity ordered = 1 VE) XLC DERAILLEUR CABLE ADJUSTER 'MINI-INLINE' SH-X10 • incl. 2 x Ø 4 mm end cap • aluminium 'rubbercoated' • for the fastening of gear cable shells • enables an exacts adjustment of gear cables Attention: not suitable for brake systems 250 11 52300 250 11 52303 91195 91195 Technical changes reserved. black (set of 2) white (set of 2) www.xlc-parts.com Page 111 ware group 250 article number GEAR CHANGING ACCESSORIES WPE x-cellent bike components article designation XLC SHIFT INNER CABLES SH-X01 • workshop dispenser with 100 pieces • order quantity = 1 • Ø 1,1 x 2000 mm Nirosta • low frictional resistance, precise shift mechanism 250 11 500 00 912995 dispenser with 100 pieces (minimum order quantity=1PU) XLC SHIFT INNER CABLES SH-X02 • Ø 1,1 x 2000 mm, Nirosta • teflon-coated, lower maintenance • optimally sealed, extremely low friction resistance • accurate switching performance GEAR CHANGING ACCESSORIES 250 11 50100 9595 inner cable box, nirosta, individually packed XLC SHIFT PROTECTIVE COVER SH-X03 • Ø 4 mm double-walled, robust protective cover • linear lead of a cable • low frictional resistance 250 11 50300 97995 dispenser with 50 meter, black (order quantity=1PU) 250 11 50303 98995 dispenser with 50 meter, white (order quantity=1PU) XLC DERAILLEUR CABLE ADJUSTER 'INLINE' SH-X06 • incl. 2 x Ø 4 mm end caps • aluminium • gear outer shell fastening • enables an exact,chain linked adjustment of cables Attention: Not suitable for Brake systems 250 11 52200 91295 black (set of 2) 250 11 52203 91495 white (set of 2) NEW! XLC DERAILLEUR CABLE KIT SH-X04 • outer shell: Ø 4 x 1800 mm • inner cable: 1500/2000 mm Niro • maintenance-free, self-lubricating, waterproof • incl. 9 stop sleeves, 6 donuts, 2 end caps, 1 dirt trap 250 11 50500 91995 incl. accessories XLC DERAILLEUR CABLE ADJUSTER SH-X05 • for M 5er thread • aluminium 'rubbercoated' • for cable stopper mount • enable the chain linked cable adjustment 250 11 52000 250 11 52003 Page 112 9695 9695 black (set of 2) white (set of 2) www.xlc-parts.com Technical changes reserved. ware group WHEELS x-cellent bike components article number WPE 250 article designation XLC PRO SL RACING WHEEL SET WS-R01 • Hubs: CNC-made hub shell with medium flange made of ERGAL 7075 hub body metallic orange • high-precision industry bearing (front wheel 2-fold; rear wheel 4-fold) with long-term grease lubrication for durable protection and sliding capability • the adjustment of the hub bearing can take place on the assembled wheel • Rims: light alloy with strengthening sleeve and brake indicator. • rear wheel rim asymmetric tread; Height: 25 mm; wired tire; Inox spokes: knife spokes • front wheel radial 18 X spokes; rear wheel radial and right crossed 16+8 • Weight: FW = about 800 gr; RW = about 1030 gr; quick release = about 105 gr. • without weight limit • Compatibility: CA 9-10-11 fold; SH 9-10 fold - free wheel: ERGAL 7075 250 14 02500 934900 black matt XLC PRO RACING WHEEL SET WS-R02 250 14 02700 923900 WHEELS • Hubs: forged aluminium, CNC-shaped; high-precision industry bearing (front wheel 2-fold; rear wheel 4-fold) with long-term grease lubrication for durable protection and sliding capability. • the adjustment of the hub bearing can take place with the assembled wheel. • Rims: aluminium with brake indicators; Height: 25 mm; wired tire • Inox spokes: progressive knife spoke is only processed in that way by Miche. • radial, front wheel 24 X spokes; rear wheel 28 X spokes. • Weight: FW = about 880 g; RW = about 1085 g; quick release = about 105 g • without weight limit • compatibility: CA 9-10-11 fold; SH 9-10 fold - free wheel: ERGAL 7075 black matt XLC COMP RACING WHEEL SET WS-R03 • Hubs: forged aluminium, CNC-shaped, hub colour: silver • high-precision industry bearing • (FW 2-fold; RW 4-fold) with long-term grease lubrication for durable protection and sliding capability. • the adjustment of the hub bearing can take place with the assembled wheel. • Rims: aluminium with brake indicators; Height: 23 mm; wired tire • Inox spokes: progressive knife spoke is only processed in that way by Miche radial, front wheel 24 X spokes; rear wheel 28 X spokes • Weight: FW = about 945 g; RW = about 1175 g; quick release = about 100 g • without weight limit • compatibility: CA 9-10-11 fold; SH 9-10 fold - free wheel: ERGAL 7075 250 14 02900 916900 Technical changes reserved. black matt www.xlc-parts.com Page 113 ware group 250 article number WHEELS WPE x-cellent bike components article designation XLC PRO SL MTB WHEEL SET WS-M01 • Hubs: CNC-shaped hub shell made of ERGAL 7075 with 6-hole fixation for discs. • high-precision industry bearing (front wheel 2-fold; rear wheel 4-fold) with long-term grease lubrication for durable protection and sliding capability The adjustment of the hub bearing can take place with the assembled wheel. • Rims: made of extremely continual aluminium with low tread and drop-shaped cross section, with strengthening sleeves • Height: 18 mm; wired tire; Inox spokes: progressive knife spokes; radial/crossed front wheel 24 X spokes; rear wheel 24 X spokes • Weight: FW approx. 810 g; RW = approx. 1020 g; quick release = approx. 105 g • without weight limit • Compatibility: SH 8-9 fold - free wheel: ERGAL 7075 934900 black matt WHEELS 250 14 03100 XLC PRO MTB SET OF WHEELS WS-M02 • Hubs: body of forged, CNC crafted aluminium ERGA 7075 with 6-holes-fastening for discs • FW-hub for 15 mm full-floating axle and QR device • high precision industrial bearings (FW-2-fold; RW-4-fold) with long-lasting lubrication for long-term protection and gliding ability • The adjustment of the hub bearings can be done on the already assembled wheel. • 26" rims: made of extremely resistant aluminium, with low profile and drop-shaped cross section, with reinforcement bushes • Height: 23 mm; wire wheels; Inox spokes: flat spokes; FW 24 X spokes; RW 24 X spokes • Weigh: (26") FW = about 975 g; RW = about 1165 g; QR device = about 105 g • without weight restriction • Compatibility: Shimano 8/9-fold, free wheel of ERGAL 7075, fitting dimensions: 100/135 mm 250 14 03300 927900 26" black 250 14 03400 928900 29" black Page 114 www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY HANDLEBARS STEMS & ACCESSORIES Technical terms intelligibly illustrated! HANDLEBARS, STEMS & ACCESSORIES Toolless Adjusting 25,4 mm The XLC handlebar bearing this icon has got a clamping area of Ø 25.4 mm. This dimension must be taken into consideration at any cost when purchasing a handlebar stem. In stems bearing this icon the inclination of the adjustable quill stem can be adapted individually to the desired riding position without needing a tool. Adjustable quill stems allow to adjust the handlebar height and thus dapt it to the seat height. It can be adjusted to every rider and to different riding styles (athletic, relaxed). 31,8 mm Aluminium 2014 Aluminium 2014 contains a high amount of copper and thanks to its high tensile strength and temperature range it is also used in aviation and astronautics. Aluminium 7075 Aluminium 7075 contains a high amount of zinc and thanks to its maximal tensile strength and temperature range it is also used in aviation and astronautics. Adjustable Angle In stems bearing this icon the inclination of the adjustable quill stem can be adapted individually to the desired riding position without needing a tool. Adjustable quill stems allow to adjust the handlebar height and thus dapt it to the seat height. They can be adjusted to every rider and to different riding styles (athletic, relaxed). Integrated Mini Tool Compact multi-functional tools are integrated in these bar ends. They can be taken out by simply unscrewing the bar ends. This allows to carry out important repairs also en route. Aluminium Aluminium bike components are characterised by high tensile strength and low weight. In alloys with magnesium, silicium and other metals, aluminium reaches a resistance little inferior to that of steel. 2-Components Material Two materials with different properties are used for these grips, in order to obtain optimum performance and top comfort. 3-Components Material Three materials with different properties are used for these grips, in order to obtain optimum performance and top comfort. Reach and Drop In case of race handlebars the term 'reach' designates the grip width and the term 'drop' the grip depth. Genuine Wood XLC grips bearing this icon are made of genuine wood. Thanks to their ergonomic form, they fit surprisingly well into the hand and impart a feeling of high quality. Double Butted Double Butted is a manufacturing process destined to conify aluminium tubes, in order to reduce the weight still maintaining the same rigidity values. The outer circumference of conified tubes remains the same, whereas inside the tube ends are thicker, which makes these parts, where the strongest forces act, more durable and stable. This system saves weight in the middle of the tube, which is thinner, because the acting forces are lesser. Genuine Leather The outer material of the XLC grips bearing this icon is genuine leather. Thanks to their ergonomic form and to the strapping padding, they fit surprisingly well into the hand and impart a feeling of very high quality. Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. Gel Padding The gel padding is a comfortable padding version for bike grips. It absorbs vibrations and shocks, thus relieving the hands, the arms and the shoulders. The inertly reacting gel padding absorbs shocks, thus avoiding transmission to the rider. By natural anatomic adaption, the rider’s weight is reparted equally to all pressure points, thanks to the flexibility of the gel. 3D forged 3D forging is a forging technique which guarantees particularly high material resistance. This technique allows to produce high quality pieces and to reduce dimensional tolerances to a minimum. A-Head Set In case of the A-Head-Set systems, the stem is fastened to the steering tube from outside. The steering tube does no longer need a thread, this giving the fork manufacturers the possibility of producing steering tubes with thinner walls and to use other materials, e.g. carbon. Hence, the A-Head Set system offers a weight advantage and facilitates assembly. Technical changes reserved. Screw Locking Modern handlebar grips with screw locking offer many advantages. They are quikkly and easily assembled, by simple plugging on the handlebar ends. Afterwards, only the clamp screws have to be tightened. Correctly screwed clamp locks are optimally protected against twisting. Furthermore, the grips can be removed at any time and be used elsewhere. Please inquire at any rate at the handlebar manufacturer’s if your handlebar is laid out for screw locking. www.xlc-parts.com Page 115 HANDLEBARS, BAR ENDS, STEMS The XLC handlebar bearing this icon has got a clamping area of Ø 31.8mm. This dimension must be taken into consideration at any cost when purchasing a handlebar stem. HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC CITY/TREKKING BAR HB-C01 • Material: aluminium 6061 PG • Bend: 59° • Width: 610 mm • Weight: 271 g 250 15 00000 91095 Ø 25,4 mm, black matt 250 15 00002 91095 Ø 25,4 mm, silver matt XLC CITY/TREKKING BAR HB-C02 • Material: aluminium 6061 • Bend: 27° • Width: 600 mm 250 15 00200 91095 Ø 25,4 mm, black matt 250 15 00202 91095 Ø 25,4 mm, silver matt XLC CITY/TREKKING BAR HB-C03 • Material: aluminium 6061 PG • Bend: 40° • Weight: 273 gr. • Width: 600 mm 250 15 00800 91095 Ø 25,4 mm, black matt 250 15 00802 91095 Ø 25,4 mm, silver matt XLC TREKKING MULTIFUNCTIONAL BAR HB-C05 • Material: aluminium 6061 PG • Bend: 27° • Weight: 505 gr. • Width: 585 mm 250 15 00400 91595 Ø 25,4 mm, black matt 250 15 00402 91595 Ø 25,4 mm, silver matt XLC TREKKING BAR 'HORNBAR' HB-C04 • Material: aluminium 6061 • Width: 620 mm • Weight: 380 gr. 250 15 01000 Page 116 91595 Ø 25,4 mm, black matt www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC COMP ERGO BAR HB-C08 • Material: aluminium, butted • Weight: about 198 g • Curve: 27° • Width: 600 mm 250 15 13000 91995 Ø 25,4 mm, black 250 15 13100 91995 Ø 31,8 mm, black XLC COMP ERGO RISER BAR HB-C09 250 15 13200 91295 Ø 25,4 mm, black 250 15 13300 91295 Ø 31,8 mm, black HANDLEBARS, BAR ENDS, STEMS • Material: aluminium, butted • Height: 30 mm, Width: 600 mm • Weight: approx. 198 g • Curve: 15° XLC COMP ERGO BAR HB-C10 • Material: aluminium 6061 / 7050 butted • Rise: 5° • Sweep: 30° • Weight: approx. 279 g • Width: 630 mm 250 15 13500 92595 Ø 31,8 mm, black XLC COMP FLAT BAR HB-M13 • Material: aluminium, double butted • Bending: 6° • Weight: approx. 260 g (Ø 25,4 x 600 mm) • Width: 600 mm 250 15 10300 91795 Ø 25,4 mm, black 250 15 10400 92195 Ø 31,8 mm, black XLC PRO FLAT BAR HB-M14 • Material: aluminium 6061, double butted • Bending: 9° • Weight: approx. 232 g (Ø 25,4 x 580 mm) 250 15 14300 250 15 14400 250 15 14402 91995 92395 92395 Technical changes reserved. Ø 25,4 mm, 600 mm black matt Ø 31,8 mm, 600 mm black matt Ø 31,8 mm, 600 mm high polished www.xlc-parts.com Page 117 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC PRO RIDE FLAT BAR HB-M17 • Material: aluminium 7050, double butted • Bend: 9° • Weight: approx. 330 g (Ø 31,8 x 780 mm) 250 15 03600 250 15 03603 94495 94495 Ø 31,8 mm, black Ø 31,8 mm, white XLC PRO SL FLAT BAR HB-M15 • Material: aluminium 7050, double butted • Bend: 9° • Weight: approx. 224 g (Ø 31,8 x 600 mm) • Width: 600 mm 250 15 15300 250 15 15303 93495 93495 Ø 31,8 mm, black Ø 31,8 mm, white XLC RISER BAR HB-M04 • Material: aluminium 6061 PG • Bend: 9°/ 6° • Weight: 325 gr. / 322 gr. • Width: 630 mm • Height: 30 mm / 50 mm 250 15 01200 250 15 01202 91395 91395 30 mm, Ø 25,4 mm, black matt 30 mm, Ø 25,4 mm, silver matt 250 15 01600 250 15 01602 91395 91395 50 mm, Ø 25,4 mm, black matt 50 mm, Ø 25,4 mm, silver matt 250 15 01400 250 15 01800 91495 91495 30 mm, Ø 31,8 mm, black matt 50 mm, Ø 31,8 mm, black matt XLC COMP RISER BAR HB-M10 • Material: aluminium, double butted • Bend: 8° • Weight: approx. 324 g (Ø 25,4 x 640 mm) • Width: 640 mm 250 15 02100 250 15 02300 250 15 02500 92295 92995 92995 18 mm Height, Ø 25,4 mm black 25 mm Height, Ø 31,8 mm black 50 mm Height, Ø 31,8 mm black XLC PRO RISER BAR HB-M11 • Material: aluminium 6061, double butted • Bend: 9° ( Ø 25,4 mm 8°) • Height: 15 mm (Ø 25,4 mm 25 mm) • Weight: approx. 255 g (Ø 31,8 x 620 mm) 250 15 02700 92695 660 mm Width, Ø 25,4 mm, matt black 250 15 02900 250 15 02902 92895 92895 680 mm Width, Ø 31,8 mm, matt black 680 mm Width, Ø 31,8 mm, high polished Page 118 www.xlc-parts.com Technical changes reserved. HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC PRO SL RISER BAR HB-M12 • Material: aluminium 7050, double butted • Bend: 9° • Height: 15 mm • Weight: approx. 325 g (Ø 31,8 x 680 mm) 250 15 03100 250 15 03103 93995 93995 Ø 31,8 mm, black Ø 31,8 mm, white XLC PRO RIDE RISER BAR HB-M16 • Material: aluminium 7050, triple butted • Bend: 9° • Height: 25 mm • Weight: approx. 372 g (Ø 31,8 x 780 mm) 93995 93995 93995 93995 93995 93995 HANDLEBARS, BAR ENDS, STEMS 250 15 03500 250 15 03503 250 15 03506 250 15 03507 250 15 03508 250 15 03509 Ø 31,8 mm, black Ø 31,8 mm, white Ø 31,8 mm, gold Ø 31,8 mm, red Ø 31,8 mm, green Ø 31,8 mm, blue XLC CARBON SL RISER-BAR HB-K03 Caution: not appropriate for installation of bar ends • Material: full carbon • Sweep: 9° • Bend: 6° • Rise: 30 mm • Weight: 209 g 250 15 14900 98500 Ø 31,8 mm 700 mm black XLC CARBON SL TOPFLAT BAR HB-K04 Caution: not appropriate for installation of bar ends • Material: full carbon • Sweep: 9°, Bend: 6° • Rise: 10 mm • Weight: 193 g 250 15 14950 98500 Ø 31,8 mm 700 mm black XLC CARBON SL RACE BAR BO ERGO HB-K05 + BO COMPACT HB-K06 • Material: full carbon • Reach/drop: 80/130 mm 250 15 00500 250 15 00501 99900 99900 BO Ergo HB-K05 BO Ergo HB-K05 250 15 00505 250 15 00506 250 15 00507 99900 99900 99900 BO Compact HB-K06 Ø 31,8 mm 400 mm 204 g BO Compact HB-K06 Ø 31,8 mm 420 mm 209 g BO Compact HB-K06 Ø 31,8 mm 440 mm 213 g Page 120 Ø 31,8 mm 420 mm 209 g Ø 31,8 mm 440 mm 213 g www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC COMP RACE BAR HB-R03 • Material: aluminium 6061 P.G. • Weight: approx. 460g (420 mm) • Reach/drop: 84/131 mm 250 15 00530 250 15 00531 250 15 00532 91995 91995 91995 Ø 31,8 mm, 400 mm, black Ø 31,8 mm, 420 mm, black Ø 31,8 mm, 440 mm, black XLC PRO RACE BAR HB-R02 • Material: aluminium 6061, double butted • Weight: approx. 310 g (420 mm) • Reach/drop: 84/131 mm 250 15 00520 250 15 00521 250 15 00522 93595 93595 93595 Ø 31,8 mm, 400 mm, black Ø 31,8 mm, 420 mm, black Ø 31,8 mm, 440 mm, black PRO SL RACE BAR HB-R01 250 15 00510 250 15 00511 250 15 00512 95995 95995 95995 HANDLEBARS, BAR ENDS, STEMS • Material: aluminium 7050, double butted • Weight: approx. 283 g (420 mm) • Reach/drop: 84/131 mm Ø 31,8 mm, 400 mm, black Ø 31,8 mm, 420 mm, black Ø 31,8 mm, 440 mm, black XLC TRIBAR HANDLEBAR EXTENSION HB-T01 • aluminium 250 15 20000 93995 black matt, 25,4-26 mm 250 15 20100 91295 spare armrest for Tri-Bar race handlebar 25,4-26,0 mm HB-X01 XLC PRO TRI-BAR ATTACHMENT FOR RACE HANDLEBAR HB-T03 • Material: aluminium 6061-T6 • Ø 31,8 mm, with perforation for cable • Weight: approx. 475 g 250 15 20800 94995 Ø 31,8 mm XLC PRO BASE-BAR HB-T02 • Material: aluminium 6061-T6 • Ø 31,8 mm, 60 mm • Reach: 165 mm 250 15 20500 250 15 20600 250 15 20700 92995 92995 92995 Technical changes reserved. Ø 31,8 mm, 400 mm, black Ø 31,8 mm, 420 mm, black Ø 31,8 mm, 440 mm, black www.xlc-parts.com Page 121 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC ALU STEM, ADJUSTABLE ANGLE ST-T01 • Material: forged aluminium • Weight: about 456 gr. (Ø 25,4 x 180 mm) • adjustable angle 90° to 155° • Handlebar acceptance: Ø 25,4 mm • Shaft length: 180mm 250 15 28000 250 15 28001 91695 91695 1" 100 mm black 1" 100 mm silver 250 15 28100 250 15 28101 91695 91695 1 1/8 100 mm black 1 1/8 100 mm silver XLC STEM ADJUSTABLE IN ANGLE ST-T02 • Material: aluminium 2D • Weight: approx. 320 gr. • adjustable in angle 0° to 60° • diameter of the handlebar mounting: Ø 25,4 mm / shaft: 180 mm 250 15 24000 250 15 24200 250 15 24400 92295 92295 92295 1" black matt, 80 mm 1" black matt, 100 mm 1" black matt, 120 mm 250 15 24002 250 15 24202 250 15 24402 92295 92295 92295 1" silver, 80 mm 1" silver, 100 mm 1" silver, 120 mm 250 15 24600 250 15 24800 250 15 25000 92295 92295 92295 1 1/8" black matt, 80 mm 1 1/8" black matt, 100 mm 1 1/8" black matt, 120 mm 250 15 24602 250 15 24802 250 15 25002 92295 92295 92295 1 1/8" silver, 80 mm 1 1/8" silver, 100 mm 1 1/8" silver, 120 mm XLC COMP STEM ST-T12 • Material: aluminium, forged • angle adjustable 0° to +80° • diameter of the handlebar mounting: Ø 25,4 mm, shaft lenght: 230 mm • Weight: approx. 540 g (at 110x180 mm) 250 15 28500 92395 1" black, 110 mm, adjustable 250 15 28600 92395 1 1/8 " black, 110 mm adjustable XLC COMP STEM ST-T10 • Material: aluminum • angle adjustable from -10° to +90° • toolfree stem adjustment • Length: 180 mm • Weight: approx. 650 g (at 110 mm) 250 15 26700 Page 122 93995 1 1/8", Ø 25,4 mm, 110 mm, black www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC A-HEAD COMP STEM ST-T11 • Material: aluminium • angle adjustable from -10° to +90° • toolfree stem adjustment • Length: 82 mm (40 mm mounting length) • Weight: approx. 531 g (by 110 mm) 250 15 26800 93995 1 1/8", Ø 25,4 mm, 110 mm, black XLC COMP A-HEAD STEM ANGLE ADJUSTABLE ST-T13 • Material: aluminium 3D-forged • Angle: 0° - 90° • Weight: approx. 268 g (110mm) 250 15 51500 250 15 51600 92795 92795 1 1/8", Ø 25,4 mm, 90 mm, black, adjustable 1 1/8", Ø 25,4 mm, 110 mm, black, adjustable 250 15 51700 250 15 51800 92795 92795 1 1/8", Ø 31,8 mm, 90 mm, black, adjustable 1 1/8", Ø 31,8 mm, 110 mm, black, adjustable 215 80 27100 9195 HANDLEBARS, BAR ENDS, STEMS XLC headset stem plugs for ST-T13 black XLC A-HEAD STEM ADJUSTABLE IN ANGLE ST-M02 • Material: aluminium • adjustable in angle from -40° bis +40° • diameter of the handlebar`s hole: Ø 25,4 mm 250 15 50000 250 15 50002 92195 92195 1 1/8", black matt, 108 mm 1 1/8", silver matt, 108 mm 250 15 50200 250 15 50202 92195 92195 1 1/8", black matt, 128 mm 1 1/8", silver matt, 128 mm XLC A-HEAD STEM ADJUSTABLE IN ANGLE ST-T14 • Material: aluminium, 2D-forged • Angle: 0° - 60° • Weight: approx. 252 g (Ø 25,4 x 90 mm) 250 15 52200 250 15 52300 91995 91995 1 1/8", Ø 25,4 mm, 90 mm, black, adjustable 1 1/8", Ø 25,4 mm, 110 mm, black, adjustable 250 15 52400 250 15 52500 91995 91995 1 1/8", Ø 31,8 mm, 95 mm, black, adjustable 1 1/8", Ø 31,8 mm, 110 mm, black, adjustable XLC COMP A-HEAD STEM ANGLE ADJUSTABLE ST-T15 • Material: aluminium, 3D forged • twofold angle adjustable from 0° to 90°/ -80° to +80° • handlebar acceptance: Ø 31,8 mm • Weight: 272 gr. 250 15 56100 93495 Technical changes reserved. 1 1/8",100 mm, adjustable www.xlc-parts.com Page 123 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC PRO A-HEAD STEM ANGLE ADJUSTABLE ST-T16 • Material: aluminium 6061T6, 3D-forged • Angle: -30° to +50° • Weight: approx. 215 g (Ø25,4 x 110mm) 250 15 51200 93495 1 1/8", ØØ 25,4 mm, 110 mm, black, adjustable 250 15 51300 93495 1 1/8", ØØ 31,8 mm, 110 mm, black, adjustable XLC COMP A-HEAD STEM ST-M15 • Material: aluminium 6061, 3D forged • Weight: approx. 155 g (at Ø31,8 x 110 mm) 250 15 35900 91595 1 1/8", Ø 25.4 mm, 60 mm, 35°, black 250 15 36050 250 15 36150 91595 91595 1 1/8", Ø 25.4 mm, 90 mm, 6°, black 1 1/8", Ø 25.4 mm, 90 mm, 35°, black 250 15 36250 250 15 36350 91595 91595 1 1/8", Ø 25.4 mm, 110 mm, 6°, black 1 1/8", Ø 25.4 mm, 110 mm, 35°, black 250 15 36800 91595 1 1/8", Ø 31,8 mm, 60 mm, 35°, black 250 15 36450 250 15 36550 91595 91595 1 1/8", Ø 31,8 mm, 90 mm, 6°, black 1 1/8", Ø 31,8 mm, 90 mm, 35°, black 250 15 36650 250 15 36750 91595 91595 1 1/8", Ø 31,8 mm, 110 mm, 6°, black 1 1/8", Ø 31,8 mm, 110 mm, 35°, black XLC PRO SL ALU A-HEAD STEM ST-M16 • Material: aluminium 7050-T6, 3D-forged, clamp plate aluminum 2014 • Angle: +/- 7° • Weight: approx. 95 g (at stem length: 90mm) • Handlebar acceptance: Ø 31,8 mm 250 15 38500 250 15 38503 94295 94295 1 1/8", Ø 31,8 mm, 80 mm, black 1 1/8", Ø 31,8 mm, 80 mm, white 250 15 38600 250 15 38603 94295 94295 1 1/8", Ø 31,8 mm, 90 mm, black 1 1/8", Ø 31,8 mm, 90 mm, white 250 15 38700 250 15 38703 94295 94295 1 1/8", Ø 31,8 mm,100 mm, black 1 1/8", Ø 31,8 mm,100 mm, white 250 15 38800 250 15 38803 94295 94295 1 1/8", Ø 31,8 mm,110 mm, black 1 1/8", Ø 31,8 mm,110 mm, white 250 15 38900 250 15 38903 94295 94295 1 1/8", Ø 31,8 mm,120 mm, black 1 1/8", Ø 31,8 mm,120 mm, white Page 124 ROAD R Y ONL E C A www.xlc-parts.com ! Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC PRO A-HEAD ROAD/MTB STEM ST-M17 • Material: aluminium 6061-T6, 3D-forged • Angle: 8° / 35° • Weight: approx. 135 g (Ø 25,4 mm x 100mm) • Handlebar acceptance: Ø 25,4/31,8 mm 250 15 41000 250 15 41200 250 15 41300 250 15 41500 250 15 41600 92995 92995 92995 92995 92995 1 1/8", Ø 25,4 mm, 90 mm, matt black 1 1/8", Ø 25,4 mm, 100 mm, matt black 1 1/8", Ø 25,4 mm, 110 mm, matt black 1 1/8", Ø 25,4 mm, 120 mm, matt black 1 1/8", Ø 25,4 mm, 130 mm, matt black 250 15 41700 250 15 41702 250 15 41800 92995 92995 92995 1 1/8", Ø 31,8 mm, 90 mm, matt black 1 1/8", Ø 31,8 mm, 90 mm, high polished 1 1/8", Ø 31,8 mm, 90 mm, 35°, matt black 250 15 41900 250 15 42000 250 15 42002 92995 92995 92995 1 1/8", Ø 31,8 mm, 100 mm, matt black 1 1/8", Ø 31,8 mm, 110 mm, matt black 1 1/8", Ø 31,8 mm, 110 mm, high polished 250 15 42100 92995 1 1/8", Ø 31,8 mm, 105 mm, 35°, matt black 250 15 42200 250 15 42300 92995 92995 1 1/8", Ø 31,8 mm, 120 mm, matt black 1 1/8", Ø 31,8 mm, 130 mm, matt black HANDLEBARS, BAR ENDS, STEMS XLC PRO SL A-HEAD ROAD/MTB STEM ST-M18 • Material: aluminium 7075, 3D-forged • Angle: 8° • Weight: approx. 130 g (at stem length 110mm) • Handlebar acceptance: Ø 31,8 mm 250 15 60500 250 15 60503 93995 93995 1 1/8", Ø 31,8 mm, 90 mm, black 1 1/8", Ø 31,8 mm, 90 mm, white 250 15 60600 250 15 60603 93995 93995 1 1/8", Ø 31,8 mm, 100 mm, black 1 1/8", Ø 31,8 mm, 100 mm, white 250 15 60700 250 15 60703 93995 93995 1 1/8", Ø 31,8 mm, 110 mm, black 1 1/8", Ø 31,8 mm, 110 mm, white 250 15 60800 250 15 60803 93995 93995 1 1/8", Ø 31,8 mm, 120 mm, black 1 1/8", Ø 31,8 mm, 120 mm, white 250 15 60900 250 15 60903 93995 93995 1 1/8", Ø 31,8 mm, 130 mm, black 1 1/8", Ø 31,8 mm, 130 mm, white XLC PRO SL A-HEAD MTB STEM ST-M19 • Material: aluminium 6061-T6, 3D-forged • Angle: 8° • Weight: approx. 135 g (at stem length 110mm) • Handlebar acceptance: Ø 31,8 mm 250 15 61000 250 15 61003 93995 93995 1 1/8", Ø 31,8 mm, 90 mm, black 1 1/8", Ø 31,8 mm, 90 mm, white 250 15 61100 250 15 61103 93995 93995 1 1/8", Ø 31,8 mm, 100 mm, black 1 1/8", Ø 31,8 mm, 100 mm, white 250 15 61200 250 15 61203 93995 93995 1 1/8", Ø 31,8 mm, 110 mm, black 1 1/8", Ø 31,8 mm, 110 mm, white Technical changes reserved. www.xlc-parts.com Page 125 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC COMP A-HEAD STEM FREERIDE ST-F01 • Material: aluminium 6061 • Angle: 25° • Weight: approx. 195gr. 250 15 30900 91895 1.1/8", black matt, 60 mm, handlebar clamping: Ø 31,8 mm XLC CARBON SL A-HEAD STEM ST-K03 • Material: stem, frame: aluminium 7075 3D forged, carbon wrapped • Material clamping: 7075 cold forged, carbon wrapped • Angle: 8° • Weight: 130 g (110 mm) 250 15 27000 250 15 27001 250 15 27002 250 15 27003 97900 97900 97900 97900 Ø 31,8 mm, 90 mm, black Ø 31,8 mm, 100 mm, black Ø 31,8 mm, 110 mm, black Ø 31,8 mm, 120 mm, black XLC PRO RIDE A-HEAD STEM ST-F02 • Material: forged aluminium 6061T6, CNC-formed • Handlebar acceptance: Ø 31,8 mm • Angle: 15° • Weight: 250 g 250 15 30700 250 15 30703 93595 93795 1 1/8", Ø 31,8 mm, 40 mm, black/white 1 1/8", Ø 31,8 mm, 40 mm, white/black XLC PRO RIDE STEM CLAMPING CAP ST-X01 • appropriate for XLC Pro Ride stem ST-F02 • Material: forged aluminium 6061T6, • CNC-formed • Handlebar acceptance: Ø 31,8 mm • appropriate for ST-F02 250 15 30756 250 15 30757 250 15 30758 250 15 30759 Page 126 9995 9995 9995 9995 gold red green blue www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC A-HEAD STEM ENHANCEMENT 'UP 99' ST-L01 • Material: aluminium 6061, cold-forged • Weight: 174 gr. • Height: 99 mm • adjusting options: 48 mm • 8 mm (1 spacer) 250 15 68000 250 15 68100 92595 92595 1 1/8", black 1 1/8", silver XLC A-HEAD STEM ENHANCEMENT 'UP 117' ST-L01 • Material: aluminium 6061, cold-forged • Weight: 214 gr. • Height: 117 mm • adjusting options: 67 mm • 8 mm (1 spacer), 5 mm (4 spacer) 92595 92595 1 1/8", black 1 1/8", silver HANDLEBARS, BAR ENDS, STEMS 250 15 68200 250 15 68300 XLC A-HEAD ADAPTER 'EASY UP&DOWN' ST-L02 • Material: aluminium, forged • toolless height adjustment with quick release skewer • minimum shaft length: 150 mm • suitable for steel shafts • Weight: 377 gr. • Height: 110-180 mm • Lifting height: 70 mm 250 15 68500 94295 1 1/8", black XLC A-HEAD CONVERTER ST-L03 • allows the use of an Ahead stem in combination with a 1 1/8" thread steerer tube • Material: aluminium 250 15 68800 91595 Technical changes reserved. for 1 1/8" head tube, 1 1/8" clamping www.xlc-parts.com Page 127 ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC ALU BAR-ENDS BE-A01 • Material: aluminium 6061-T6 • Length: 140 mm • Weight: 127 gr. 250 15 70000 250 15 70002 91495 91495 140 mm, black matt 140 mm, silver matt XLC COMP BAR-ENDS 'BO' BE-A10 • Material: aluminium forged • ergonomic shape 250 15 71200 91995 110 mm, black XLC COMP COMP BAR-ENDS BE-A11 HANDLEBARS, BAR ENDS, STEMS innovative combination off minitool and bar-ends • Material: aluminium 6061-T6 3D forged • Length: 110 mm, Weight: 284g Tools: • 4/5/6/8 mm allen wrench • T25 Torx • spoke spanner • screwdriver cross/slot • 8/9/10 mm jaw wrench • chain pin remover • tyre iron 250 15 71400 92995 110 mm, black, incl. tools XLC COMP ALU BAR-ENDS BE-A12 • Material: aluminium 6061-T6 3D forged • Weight: 98 g (80 mm) • Length: 90 mm • with an ergonomic thumb support 250 15 73200 250 15 73202 91795 91895 90 mm, black matt 90 mm, high polished XLC PRO BAR-ENDS BE-A13 • Material: aluminium 6061-T6, 3D-forged • Weight: approx. 75 g. • ergonomic grip 250 15 73700 Page 128 92595 80 mm, black www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC PRO SL BAR-ENDS BE-A15 • Material: aluminium 7075, 3D forged • Surface: CNC-finish • Weight: black approx. 58g / white approx. 64g • Length: 85 mm 250 15 73900 250 15 73903 92995 92995 black white XLC COMP ALU BAR-ENDS BE-A08 • Material: aluminium/craton • Length: 125 mm • Weight: 142 gr. 91495 ergonomic shape, black HANDLEBARS, BAR ENDS, STEMS 250 15 71600 XLC PRO BAR-ENDS BE-A14 • Material: aluminium • Weight: 122 g • ergonomic design for the right and left hand 250 15 73803 92295 83 mm, white XLC BAR GRIPS ERGONOMIC GR-G03 • 2 material components • shock absorbing • gel grip surface • ergonomic shapeing 250 15 86600 9795 black/gray, 125 mm XLC BAR GRIPS ERGONOMIC GR-G06 • 3 material components • shock absorbing • ergonomic shapeing 250 15 85000 9795 Technical changes reserved. black/gray, 130 mm www.xlc-parts.com Page 129 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC BAR GRIPS 'ERGONOMIC' GR-S07 • 2 components material • shock absorbing • ergonomic form • with screws, for easy assembling and stable fit 250 15 85100 91295 140 mm, black/gray 250 15 85103 91395 140mm, white/black XLC BAR GRIPS 'ERGONOMIC' GR-G04 • 2 material components • shock absorbing • gel grip surface • ergonomic shaping 250 15 87000 250 15 87200 9795 9795 135 mm, black/gray 135/92 mm, black/gray XLC BAR GRIPS 'ERGONOMIC' GR-S04 • 2 material components • shock absorbing • ergonomic shaping • thread locking for easy mounting and tight screws 250 15 85200 250 15 85300 9895 9895 135 mm, black/gray 135/92mm, black/gray XLC BAR GRIPS 'CORK' GR-G11 • Material: PVC • leather look 250 15 88800 250 15 88900 9995 9995 135mm, brown leather look 135/92mm, brown leather look XLC GRIPS 'RETRO I' GR-S13 • Material: real wood • ergonomic design • with 2 screw locking device for an easy assembly and tight fit • Weight: 119 gr. (without sealing end) 250 15 89500 Page 130 92595 130 mm, real leather, dark brown www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC GRIPS 'RETRO II' GR-S14 • Material: real wood • ergonomic design • extra wide contact face • with 2 screw locking device for an easy assembly and tight fit 250 15 89600 93495 138 mm, real wood, dark brown 250 15 89700 93495 138/95 mm, real wood, dark brown, XLC BAR GRIPS 'CORK' GR-G12 • Material: cork 9595 125 mm, black HANDLEBARS, BAR ENDS, STEMS 250 15 88600 XLC BAR GRIPS GR-S19 • 2 components material • neoprene surface 250 15 80000 9995 129 mm, black XLC GRIPS GR-S20 • neoprene • gel padding • ergonomic design • with screw locking device for an easy assembly and tight fit • Weight: 98 g 250 15 80200 250 15 80203 91095 91095 135 mm, black 135 mm, white XLC BAR GRIPS SOFT GR-G13 • Material: foam rubber 250 15 88700 9395 Technical changes reserved. 130 mm, black www.xlc-parts.com Page 131 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC BAR GRIPS DUAL COLOUR GR-G07 • two-component material, gel cushioning, craton surface • Weight: 85 g. • 125 mm 250 15 83500 250 15 8350 250 15 83502 250 15 83503 250 15 83504 9595 9595 9595 9595 9595 black/blue black/pink black/green black/white black/red XLC GRIPS 'VISTA' GR-S06 • 2 component material • gel cushioning • transparent surface • with 2 screw locking devices for an easy assembly and extra certain hold • Weight: 89 g • 125 mm 250 15 83600 250 15 83603 91495 91495 black/transparent white/transparent XLC GRIPS RINGO GR-S05 • 3 material components • Material at the outside: craton • thread locking for easy mounting and tight screws • 130 mm 250 15 85400 250 15 85500 91495 91495 black/gray gray/anthracite XLC SET OF SECURING SCREWS GR-X01 FOR XLC-GRIPS 'RINGO' GR-S05 • set of 2 250 15 85401 250 15 85402 250 15 85403 250 15 85404 250 15 85405 9495 9495 9495 9495 9495 red green silver white brown XLC BAR GRIPS FASHION GR-S09 • shock absorbing • screws for easy assembly and firm fit • Weight: 115 g • 130 mm 250 15 84200 250 15 84300 250 15 84400 Page 132 91595 91595 91695 titan/brown, red/pink plaid pattern www.xlc-parts.com Technical changes reserved. ware group HANDLEBARS, STEMS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC BAR ENDS 'TAPE' GR-S08 • plastic bar end covered with gel bar tape in cork look • shock absorbing • screw locking device for an easy assembly and tight fit • 130 mm 250 15 84000 91595 white XLC BAR GRIPS 'WOODY' GR-S11 • Material: EVA • shock absorbing • with 2 securing screws, for easy assembling and safe fit • 130 mm 91495 wooden look, brown HANDLEBARS, BAR ENDS, STEMS 250 15 88500 XLC BAR GRIPS 'COMFORT BO2' GR-S17 • 2 components material, absorb impacts, grip surface of gel • 'Body Optimized', ergonomic shape 250 15 86900 250 15 86903 250 15 86906 9895 9895 9895 135 mm, black/gray 135 mm, white/gray 135 mm, red/gray 250 15 86950 250 15 86953 250 15 86956 9895 9895 9895 135/92 mm, black/gray 135/92 mm, white/gray 135/92 mm, red/gray XLC BAR GRIPS 'WOODY II' GR-S12 • Material: real wood • ergonomic design • with a screw locking device for an easy assembly and tight fit • inclusive metal plug • Weight: 179 g • 130 mm 250 15 89000 250 15 89100 93995 93995 real wood, light brown, real wood, dark brown XLC BAR GRIPS 'SECURE' GR-S10 • craton-bar end with extra long aluminium protection • ergonomic design • screw locking device for an easy assembly and tight fit • 130 mm 250 15 84500 92195 Technical changes reserved. white/black www.xlc-parts.com Page 133 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC BAR GRIPS SPORTIV GR-S01 • 2 material components • Material at the outside: craton • thread locking for easy mounting and tight screws 250 15 85600 9895 black, 130 mm XLC BAR GRIPS SPORTIV GR-S03 • 2 material components • Material at the outside: craton • thread locking for easy mounting and tight screws • 130 mm 250 15 85800 9895 black/gray XLC BAR GRIPS SPORTIV GR-S02 • 2 material components • Material at the outside: craton • thread locking for easy mounting and tight screws • 130 mm 250 15 86000 9995 black/gray XLC BAR GRIPS SPORTIV BO2 GR-S18 • 2 material components • absorb impacts • grip surface gel • 'Body Optimized', ergonomic shape 250 15 85700 250 15 85703 250 15 85706 9595 9595 9595 black/gray white/gray red/gray XLC GRIPS SPORT BO2 GR-S23 • 2 material components, absorb impacts, grip surface gel • 'Body Optimized', ergonomic shape • thread locking for easy mounting and tight screws 250 15 85750 250 15 85753 250 15 85756 Page 134 91595 91595 91595 black/gray white/gray red/gray www.xlc-parts.com Technical changes reserved. ware group x-cellent bike components article number WPE HANDLEBARS, STEMS & ACCESSORIES 250 article designation XLC BAR GRIPS 'SPORTIV' GR-G05 • 2 material components • shock absorbing • gel grip surface • 130 mm 250 15 87400 9795 black/gray XLC BAR GRIPS 'SPORTIV' GR-G01 • 2 material components • shock absorbing • gel grip surface • 130 mm 9695 black/gray HANDLEBARS, BAR ENDS, STEMS 250 15 86200 XLC BAR GRIPS 'HITCH' GR-G16 • 2 components material • ergonomic design • with craton gel padding • with integrated bar ends for different riding positions • securing screws for easy assembling and safe fit 250 15 88100 91995 black/gray, with integrated bar ends XLC GRIPS ERGONOMIC GR-S22 • 3 components material • shock absorbing gel pad • generous craton contact area • ergonomic design • securing screws for easy assembling and safe fit • 130 mm 250 15 83800 91595 Technical changes reserved. black/gray www.xlc-parts.com Page 135 HANDLEBARS, BAR ENDS, STEMS ware group 250 article number HANDLEBARS, STEMS & ACCESSORIES WPE x-cellent bike components article designation XLC FOAM-GRIP GR-F01 • Material: foam rubber • Measures: 400 mm x Ø 19-22 mm • for multifunctional handlebars 250 15 89900 9395 for multifunctional handlebars 400 mm XLC BAR TAPE CORK STYLE GR-T01 • gel cork-style • non adhesive, tension-style mounting 250 15 90000 250 15 90100 250 15 90200 250 15 90300 250 15 90400 9995 9995 9995 9995 9995 black white red blue yellow XLC BAR TAPE TWO COMPONENTS GR-T04 • 2 components structure (PU/microfiber) • with perforated surface 250 15 91200 250 15 91300 91395 91395 white/black white/red XLC BAR TAPE GEL PADS GR-T05 • gel cushioning for drop bar tape • consisting of 2 drop bar insets for below and 2 at top 250 15 91000 9895 transparent XLC PRO SL ROAD QUICK RELEASE-SET QR-L04 for road bikes, wheels • ultra light, titan axle, carbon lever • Weight: 42,5 g 250 16 02000 Page 136 94995 black www.xlc-parts.com Technical changes reserved. ware group QUICK RELEASE x-cellent bike components article number WPE 250 article designation XLC PRO QUICK RELEASE SET QR-L06 • for MTB wheels • titan axle, carbon lever • ultra light: weight only 46 g 250 16 02100 94995 for MTB wheels black XLC PRO QUICK RELEASE SET QR-L03 • aluminium/steel • in pairs • with quick release fastening 250 16 01570 91695 red XLC PRO QR-SET 'COLOUR EDITION' QR-L05 • consisting of FW-QR, RW-QR, saddle-QR 91695 91695 91695 91695 gold red green blue SCHNELLSPANNER 250 16 02106 250 16 02107 250 16 02108 250 16 02109 XLC PRO FW QUICK RELEASE QR-L01 • CroMo axle • new type of security system • no subsequent adjustment necessary • one-hand assembly 250 16 01560 91295 black XLC QUICK RELEASE SET QR-L02 • aluminium/steel • FW and RW • with quick release fastening 250 16 01550 91195 black, 110 g (pair) 250 16 01553 91195 alu/CroMo black/red FW/RW (pair) XLC ALLEN QUICK-RELEASE SET QR-A01 • front wheel + rear wheel + saddle quick release • for 5 mm allen screw 250 16 01520 9795 Technical changes reserved. black www.xlc-parts.com Page 137 MATERIAL & TECHNOLOGY BAGS PEDALS Technical terms intelligibly illustrated! PEDALES BAGS 450D Look System The number 450 D designates the size of the nylon threads used for weaving this material: that means for this material a thread size of 450 and reinforcing threads every 4 mm. XLC system pedals bearing this icon have got a Look adapter and are compatible with most of the bike race shoes available on the market. System pedals encourage the round tread and optimise the transfer of energy. 650D The number 650 D designates the size of the nylon threads used for weaving this material: that means for this material a thread size of 650 and reinforcing threads every 6.5 mm. Map Compartment BAGS The map compartment is a practical feature in handlebar bags. It is on top of the handlebar bag and its transparent protection foil allows map navigation even en route. Moreover, the foil also protects the map well against KlickFix-Holder The KlickFix holder is a handlebar adaption, compatible with bags equipped with a KlickFix basic plate. After installation of the KlickFix holder, the bag can be installed or removed any time without tools. Cartridge Bearings Cartridge bearings are the type of bearings most frequently used in bikes. The manufacturers set thereby all necessary ball bearings in a so-called cartridge, adjust and grout them, so that they are protected against dust and dirt and they must not be adjusted in the assembling process. They are thus absolutely maintenance-free. Quick Release With the XLC quick release system, the pedal can be removed from the crank by means of a simple but safe release device, without having to use tools. In order to achieve it, the pedal adapter enclosed in the scope of delivery is to be screwed into the standard thread of the crank, after which the pedal can be easily clicked into the pedal adapter and can be removed as easily. The pedals cannot get mixed up, as they fit right and left. This system allows removing quickly and easily the pedals in case a bike with mounted pedals takes too much space. It also avoids damaging the crank thread in the long run. MTS-holder The MTS holder is adequate for fitting suitable MTS handlebar bags to handlebars with a Ø of 25.4 mm. The integrated quick lock device allows installation or removal of the handlebar bag without tools. (Caution: only suited if the handlebar bag has got the MTS basic plate). SPD System The system pedal bearing this icon contains an SPD adapter and is compatible with most of the bike shoes available on the market. System pedals encourage the round tread and optimise the transfer of energy. Rain Cover A rain cover, included in the scope of delivery, protects against rain and dust. Reflecting Stripes Reflecting stripes reflect the light in provenience from other traffic participants or from street/road lighting, thus providing more safety in road traffic, especially in twilight or darkness. Reflecting fabric often contains myriads of microscopic, metallised glass spheres, applied with a special polymeric layer onto the basic fabric. They are able to withstand even rough laundering and drying. Unilateral System Unilateral system pedals have got an adapter system on only one side and can be used only with adequate bike shoes. Some hybrid pedals are equipped with an adapter system on one side and on the other with a traditional pedal cage. These can be used with special bike shoes, as well as with traditional sports shoes. Bilateral System Bilateral pedal systems are equipped with adapter systems on both sides and therefore can be used only with adequate bike shoes. Rixen & Kaul Fastening Rail The Rixen & Kaul KlickFix fastening rail is a practical bag fastening for rear wheel luggage racks and Lowrider. Removable adapting bushings allow fitting to luggage racks of several diametres. Tarpaulin Tarpaulin is an extremely robust fabric, therefore used as truck cover for instance. Tarpaulin provides 100% protection against water and it is extremely weather-proof. Tarpaulin bags often have a wrap fastening, providing absolute watertightness. Page 138 www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC 'GLOBETROTTER' BAR BAG BA-W01 • Material: tarpaulin, 100% waterproof, Wickelverschluss • incl. MTS quick-release system • interior stentering frame for optimal form, also when empty • removable map compartment • waterproof, removable briefcase • cushioned shoulder straps • reflective stripes consist of 3M Scotchlite TM • Measures: 26 x 24 x 18 cm, approx. 1030g 250 17 30000 250 17 30200 93995 93995 black/silver black/red 250 17 50600 91495 replacement fastening for XLC handlebar bags ‘Waterproof’ XLC 'GLOBETROTTER' LOWRIDER BAG SET BA-W02 • Material: tarpaulin, 100% waterproof • incl. fastening rixen & kaul • adapter parts for different carrier diameter • horizontal adjustable fixing clip for additional stability • net compartment inside, cushioned carrying handle • twist closure • reflective stripes consist of 3M Scotchlite TM • Measures: 29 x 11 x 31 cm, approx. 1500g 97995 97995 black/silver black/red BAGS 250 17 35000 250 17 35200 XLC 'GLOBETROTTER' BAG SET BA-W03 • Material: tarpaulin, 100 % waterproof, twist closure • incl. fastening rixen & kaul • adapter parts for different carrier diameter • horizontal adjustable fixing clip for additional stability • net compartment inside, cushioned carrying handle • reflective stripes consist of 3M Scotchlite TM • Measures: 30 x 17,5 x 38 cm, approx. 2100g 250 17 36000 250 17 36200 98995 98995 217 98 21500 9300 black/silver black/red The adjustable clamp hook prevents sideways motions of the pannier. XLC 'GLOBETROTTER' OUTDOOR RUCKSACK BA-W04 • Material: tarpaulin, 100 % waterproof • twist closure • reflective stripes consist of 3M Scotchlite TM • cushioned back part with air ducts for optimal wearing comfort • extra wide shoulder straps with additional, removable mobile phone pockete • lugs on the sides for additional mounting possibility • chest strap, cushioned carrying handle • Measures: 36 x 22 x 51 cm, approx. 850g 250 17 37000 250 17 37200 92995 92995 Technical changes reserved. black/silver black/red www.xlc-parts.com Page 139 ware group 250 article number BAGS & ACCESSORIES WPE x-cellent bike components article designation XLC CARGO BOX BA-B02 • lockable • cargo capacity 10 kg • Measures: 40 x 25 x 17 cm • capacity: around 12 litres (e.g. for a helmet) • Weight: around 1600 gr (including accessories) 250 17 80200 93295 217 98 13700 9200 black hook fastener for Rackboxlid, 2-part delivery without content XLC CARGO BOX 'DE LUXE' BA-B01 • lockable, removable at the push of a button • with ergonomic carrier handle • cargo capacity 10 kg • including removable adapter plate • Measures: 40 x 25 x 17 cm • Capacity: around 12 litres (e.g. for one helmet) • Weight: around 1727 gr (including accessories) 250 17 80000 94495 217 98 13700 9200 gray hook fastener for Rackboxlid, 2-part XLC WHEEL BAG BA-S02 BAGS • Material: 450D • cushioned, for 2 wheels • Ø 740 mm • with side protection at the height of the axle • also possible for 29” 250 17 60000 93495 black delivery without content XLC TRANSPORT BAG FOR COLLAPSIBLE BIKES BA-S36 • suited for many current collapsible bikes • foldable to a knapsack, with handlebar holder • Measures: 24 x 20 x 12 (folding size) alternatively 80 x 45 x 35 cm 250 17 79500 95995 black XLC OUTDOOR BACKPACK 'GLOBETROTTER' BA-S03 • Material: 450D • bag and opening for drinking vessel (not included in delivery contents), attached front pocket with zip fastener, 2 net outside pockets, reflective stripes • small front pocket with zip fastener, removable holder for helmet etc., ergonomic formed back part, zip fastener pocket with integrated rain hood, large main compartment, • small net compartment for glasses, mini tools, wallet etc. • net part on the back for optimal air supply • perforated shoulder straps, waistbelt, compression belts on the side parts 250 17 60300 Page 140 92995 anthracite/natogreen www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SADDLE BAG 'QUICK' BA-S04 • Material: 450D • quick-release mounting • vario, additional compartment, reflective stripes 250 17 61000 250 17 61100 250 17 61200 9850 9950 9995 anthracite/silver, Size S 13x11x7 cm anthracite/silver, Size M 18x13x19 cm anthracite/silver, Size L 21x16x10 cm XLC SADDLE BAG 'STRAP' BA-S05 • Material: 450D • mounting with hook and loop tape • vario, additional compartment • reflective stripes • size: ca 22x10x10 cm 250 17 61300 9850 anthracite/silver, with hook-and-loop fastener XLC SADDLE BAG 'GLOBETROTTER' BA-W05 250 17 38000 91895 black tarpaulin, Size S 250 17 38100 91995 black tarpaulin, Size M BAGS • Material: 1000D tarpaulin, 100% waterproof • quick-release mounting • reflective stripes XLC BAR BAG 'STRAP' BA-S07 • Material: 450D • Measures: 10 x 10 x 17 cm • incl. map compartment • mounting with hook and loop tape • reflective stripes • size: ca 19x14x12 cm 250 17 61600 9995 anthracite/silver XLC BAR BAG MTS BA-S06 • incl. MTS handlebar mounting • Material: 450D • large attached front pocket with zip fastener • removable map compartment • left side pocket for drinking bottle • right side pocket for mobile phone • inclusive interior stentering frame • rubberised zip fastener • size: ca 28x15x23 cm 250 17 61500 91795 anthracite/silver 250 17 50600 91495 replacement fastening for handlebar bags 'Waterproof' black BA-X02 Technical changes reserved. www.xlc-parts.com Page 141 ware group 250 article number BAGS & ACCESSORIES WPE x-cellent bike components article designation XLC HANDLEBAR BAG STRAP BA-S08 • Material: 450 • incl. map compartment • velcro fastening • reflective stripes 250 17 61650 91795 anthracite/silver XLC FRAME BAG ‘GLOBETROTTER’ BA-S01 • Material: 450D • reflective surfaces consist of 3M Scotchlite TM • 1 net outside compartment • rubberised zip fastener lugs • Material: polyester 600D • Measures: 24 x 18 x 18 cm, approx. 110 g 250 17 40800 9920 anthracite/silver XLC STEM BAG BA-S31 BAGS • without fastening • main compartment padded • velcro fastening • reflecting logo • Material: denier nylon • Measures: 140 x 100 x 50 mm 250 17 25000 91495 black XLC STEM BAG BA-S28 • without fastening • padded, zipped main compartment • padded, zipped lateral outer pocket • reflecting logo • Material: denier nylon • Measures: 140 x 100 x 20 mm 250 17 25100 91795 black XLC CELLPHONE BAG BA-S29 • without fastening • main compartment padded, with velcro fastening • side pocket with zipper • upper compartment with velcro fastening and window for mobile phone, MP3, etc. • incl. shoulder strap, reflectant logo • Material: denier nylon • Measure: 160 x 90 x 85 mm 250 17 25200 Page 142 92995 black www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC MESSENGER BAG BA-S30 • without fastening • padded main compartment • incl. padded 3 points shoulder strap • organizer • reflective logo • Material: denier nylon 250 17 25300 96995 black 480 x 285 x 85 XLC QUICK RELEASE 250 17 50500 9795 250 17 50600 91495 QR holder for XLC saddle bags (from year of construction 2005) (Map A) replacement fastening for XLC handlebar bags 'Waterproof' (Map B) A B XLC ALU LUGGAGE RACK RP-R09 • Weight: approx. 800g • for seat post fastening with quickrelease • with removeable bag • 2 lateral bags with mesh outer pockets • removeable interior compartment, interior mesh pocket • expo-system - capacity expandable from 3 to 5 liter 95995 incl. pocket, carrier handle and reflective tapes BAGS 250 06 02800 XLC STEM BAG 'CELLPHONE BAG' BA-S32 • without fastening • with window • reflective logo • Material: PU leather 250 17 25400 91195 black, 67 x 120 x 15 mm XLC STEM BAG 'CELLPHONE BAG' BA-S33 • without fastening • with window • reflective logo • Material: denier nylon 250 17 25500 91695 black, 92 x 132 x 15 mm BA-X09 BA-X10 XLC STEM FASTENING BA-X.. for the XLC bags 'Stembag & Cellphone bag' 250 17 50100 250 17 50200 250 17 50300 9395 9395 9395 for A-Head stem BA-X09 for A-Head stem BA-X10 for shaft stem 1 1/8" BA-X11 250 17 50400 9695 Ø 22 mm for XLC pocket, stem bag & cellphone bag and water bottles BA-X12 Technical changes reserved. www.xlc-parts.com BA-X11 BA-X12 Page 143 ware group 250 article number BAGS & ACCESSORIES WPE x-cellent bike components article designation XLC HANDLEBAR BAG 'TRAVELLER' BA-S11 • polyester fabric 650 D • plastic inner stretching frame • fastening plate for handlebar adapter KLICKfix • large map compartment • shoulder strap with slide stopper • Measures: about 24 x 15 x 17 cm, 5,5 litres 250 17 61700 92395 handlebar bag XLC ‘Traveller’, black/blue XLC SINGLE BAG 'TRAVELLER' BA-S12 • polyester 650 D • inner plastic tensor frame • cobra hooks for fastening on the luggage rack • handle • safety reflectors • per piece, can be used on the right or on the left side • Measures: about 34 x 30 x 18 cm, about 14 litres 250 17 62300 92795 XLC single bag 'Traveller', black/blue BAGS XLC DOUBLE BAG 'TRAVELLER' BA-S14 • polyester 650 D • plastics inner stretching frame • handle • safety reflector • Measures: about 48 x 32 x 29 cm, about 28 litres 250 17 62400 93395 double bag ‘Traveller’, black/blue XLC CASE BAG ‘TRAVELLER’ BA-S15 consisting of top compartment • polyester 650 D • stretching inner plastic frame • connexion by plastic snap fits • eyelets for extra luggage • handle • anti-slitting shoulder strap • protective cover • Measures: about 48 x 30 x 17 cm, about 25 litres and double bag • polyester 650 D • stretching inner plastic frame • handle • safety reflectors • Measures: about 48 x 32 x 29 cm, about 28 litres 250 17 62600 Page 144 95395 case bag ‘Traveller’, black/blue www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SADDLE BAG 'TRAVELLER' BA-S.. BA-S16 • with KLICKfix saddle adapter for unsprung saddles • fastening to the seat tube with velcro • In case of the Traveller 2.4 the volume doubles by opening the zipper. • with reflective stripes 250 17 62900 250 17 62700 250 17 62800 92395 92495 92595 black, 0,8 ltr, 170g black, 1,2 ltr, 180g black, 2,4 ltr, 190g BA-S27 BA-S16 BA-S26 BA-S26 BA-S27 XLC LUGGAGE RACK BAG 'TRAVELLER' BA-S35 • 600 D polyester • stowage space of the two side pockets expandable by 5 l each by opening the zipper • padded main compartment, stable of form • three mesh compartments • carrier handle with non-slip stoppers, protection cover • velcro straps for fastening on the luggage rack • Measures: 36 x 20 x 22 cm 250 17 63500 94495 black, 15 - 25 ltr, 750 g BAGS XLC LUGGAGE RACK BAG 'TRAVELLER' BA-S37 • expo-function - capacity can be expanded by approx. 5 l • Material: 600 D polyester • two large side pockets, inner mesh pocket, front pocket • padded, divisible main compartment, stable of form • carrier handle with non-slip stoppers, protection cover • additional fastening tapes for carrier • Measures: 36 x 20 x 22/28 cm 250 17 63600 94495 black, 15 - 25 ltr, 750 g XLC TRIPLE BAG 'TRAVELLER DELUXE' BA-S19 Consisting of double saddle bag and top-compartment (connection by plastic snap locks) incl. cover top-compartment bag: • carrying handle, carrying strap with slide stopper • plastic inner tenter frame, eyelets for additional carrier • rubber mount for additional luggage double saddle bag: • 2 fitted side pockets • plastic inner tenter frame, security reflector, carrying handle • fastening rail for carrier stay • adjustable elastic band mounting for carrier stays • Filling volume: approx. 56 ltr • Measures: (top-compartment) 48 x 30 x 17 cm, double saddle bag 48 x 32 x 29 cm 250 17 64400 99995 black, 56,0 ltr, 3330g 217 98 21500 9395 The adjustable clamp hook prevents sideways motions of the pannier. Technical changes reserved. www.xlc-parts.com Page 145 ware group 250 article number BAGS & ACCESSORIES WPE x-cellent bike components article designation XLC LUGGAGE RACK BAG 'TRAVELLER' BA-S38 Shorter version, thus suitable for many e-bike luggage rack systems; e. g. Winora Town:exp • polyester 600 D • expo-function - capacity can be expanded by approx 5 ltr. • two big side pockets, inner mesh compartment, front pocket • padded, divisible main compartment of stable form • carrier handle with non-slip stoppers • velcro straps for fastening to the luggage rack • protective cover • Measures: 30x 20 x 22 cm 250 17 63550 94495 black, about 13-23 ltr, 680 g XLC HANDLEBAR BAG 'TRAVELLER DE LUXE' BA-S17 • with mounting plate for KLICKfix, handlebar adapter • carrying strap • with folding, big map-case • fitted front pocket • 2 lateral net pockets • 1 inside net pocket • Measures: 24 x 15 x 17 cm 93995 BAGS 250 17 64000 black, 8,0 ltr, 740g XLC DOUBLE BAG 'TRAVELLER DELUXE' BA-S18 • with rixen & kaul rail and hook • 2 fitted side pockets • plastic inner tenter frame • security reflector, carrying handle • fastening rail for carrier stay • adjustable elastic band mounting for carrier stays • filling volume: approx. 31 ltrs • Measures: 48 x 32 x 29 cm 250 17 64200 94995 black, 31,0 ltr, 1980g 217 98 21500 9395 The adjustable clamp hook prevents sideways motions of the pannier. XLC RAIN PROTECTION CAP BA-X03 • made for our Traveller- and Traveller DeLuxe series • also suitable for the most popular forms of bags • made of coated nylon material • with transport bag • signal colours and additional reflectors on all rear bags 250 17 50700 250 17 50710 250 17 50720 250 17 50730 Page 146 91595 91250 91195 9895 for case bags for double bags for single bags for handlebar bags www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SINGLE PACK BAG 'ALLEGRO' BA-S22 • Material: polyester, waterproof • front pocket with zipper • reflective stripes • with covered luggage rack hooks • additional fastening tapes for luggage rack strut • removable padded shoulder belt included • incl. carrying handle • Measures: 35 x 32 x 15 cm, 17 ltr. 250 17 45903 93995 Berry white NEW! 250 17 45909 93995 Berry blue NEW! 250 17 45900 93995 Berry black XLC SINGLE PACK BAG 'SENORA' BA-S23 250 17 46109 94495 blue NEW! 250 17 46000 94495 sand/purple 250 17 46100 94495 gray BAGS • Material: polyester, waterproof • with covered luggage rack hooks • 2 additional outer pockets • net inside pocket • removable padded shoulder belt included • incl. carrier handle • Measures: 37 x 28 x 12 cm, 12 ltr. XLC SINGLE SADDLE BAG 'POSTINO OFFICE' BA-S24 • Material: polyester, waterproof • with covered luggage rack hooks • 3 additional exterior pockets (1 with zipper) • net inside pocket • incl. detachable shoulder strap with cushioning • incl. carrying handle • Measures: 39 x 31,5 x 13 cm, 16 ltr. 250 17 46200 95995 gray 250 17 46300 95995 blue Technical changes reserved. www.xlc-parts.com Page 147 ware group 250 article number BAGS & ACCESSORIES WPE x-cellent bike components article designation XLC SINGLE BAG BA-S34 • Material: polyester, waterproof • outside pocket • with luggage rack hooks • incl. carrier handle • Measures: 35 x 40 x 16 cm, 24 ltr. 93995 berry black 250 17 47003 93995 berry white 250 17 47009 93995 berry blue BAGS 250 17 47000 XLC DOUBLE BAG ‘FIORI’ BA-S20 • Material: polyester, waterproof • reflective strips • transparent closure • additional fastening straps for luggage rack • velcro fastening for luggage carrier strut • Measures: 37 x 33 x 12,5 cm, 32 ltr. 250 17 45203 93995 berry white NEW! 250 17 45209 93995 berry blue NEW! 250 17 45200 93995 berry black Page 148 www.xlc-parts.com Technical changes reserved. ware group BAGS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC DOUBLE SADDLE BAG 'ALLEGRO' BA-S21 250 17 45603 95995 Berry white NEW! 250 17 45609 95995 Berry blue NEW! 250 17 45600 95995 Berry black BAGS • Material: polyester, waterproof • reflective stripes • front pocket with zipper • additional fixation tapes for carrier • hook and loop fixation for carrier stay • Measures: 35 x 32 x 15 cm, 34 ltr. XLC SHOPPING BAG 'UMBRIE' BA-S25 • Material: polyester, waterproof, steel frame • integrated rain cover • inside pocket with zipper • exterior pocket with zipper • front exterior pocket • net inside pocket • incl. carrying handle • incl. stem mount • Measures: 35 x 27 x 25 cm, 14 ltr. 250 17 46703 93995 Berry white 250 17 46709 93995 Berry blue 250 17 46700 93995 Berry black 250 17 500 000 91095 spare holder for shopping basket Umbrie Technical changes reserved. www.xlc-parts.com Page 149 ware group 250 article number PEDALS & ACCESSORIES WPE x-cellent bike components article designation XLC CITY/COMFORT PEDAL PD-C01 • aluminium body • CroMo axle • ball bearing • Weight: 452 g • 103 x 70 mm 250 18 40000 91095 silver/black XLC COMFORT-PEDAL PD-C09 • polished aluminium body • plastic cage antislip bearing • CroMo axle, ball bearing, rubber pad • Weight: 335 g • 100 x 80 mm 250 18 40100 91395 silver/black XLC CITY/COMFORT PEDAL PD-C02 PEDALS • aluminium body • CroMo axle • ball bearing • Weight: 290 g • 97 x 70 mm 250 18 40200 91595 black/silver XLC CITY/COMFORT PEDAL PD-C07 • aluminium body craton coating/plastic cage • CroMo axle • ball bearing • Weight: 265 g • 101 x 80 mm 250 18 40300 91495 gray/silver/black XLC CITY/COMFORT PEDAL PD-C03 • aluminium body • boron axle • ball bearing • Weight: 420 g • 108 x 69 mm 250 18 40400 Page 150 91095 silver/black www.xlc-parts.com Technical changes reserved. ware group PEDALS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC COMFORT PEDAL PD-C04 • aluminium body • boron axle • ball bearing • Weight: 460 g • 95 x 76 mm 250 18 40600 91395 silver/black XLC COMFORT-PEDAL PD-C08 • low profile • polished low profile aluminium body • plastic cage with antislip bearing • CNC CroMo axle • sealed ball bearing of high quality • Weight: 260 g • 100 x 80 mm 250 18 41100 92595 silver/black XLC CITY/COMFORT PEDAL PD-C06 250 18 41200 92195 PEDALS • low profile • polished low profile aluminium body • CNC CroMo axle • sealed ball bearing of high quality • non-slip rubber layer • Weight: 290 g • 98 x 72 x 22 mm black/silver XLC CITY/COMFORT PEDAL PD-Q02 • • • • • • 250 18 41300 94995 low tread, quickrelease system polished aluminium body, CNC CroMo axle high-grade, sealed ball bearing non-slip rubber pad Weight: 310g 98 x 72 x 22 mm silver/black XLC ATB/MTB-PEDAL PD-M07 • Body: aluminium 6061 CNC, CroMo axle CNC • cartridge bearing, obturated • Weight: 210 g • 95 x 63 mm 250 18 12200 94495 Technical changes reserved. black/silver www.xlc-parts.com Page 151 ware group 250 article number PEDALS & ACCESSORIES WPE x-cellent bike components article designation XLC ATB/MTB-PEDAL PD-Q01 • aluminium body 6061 CNC, CroMo axle CNC • cartridge bearing, sealed • Weight: 200 gr • 72 x 62 mm • with Quickrelease system 250 18 12300 97995 black/silver XLC ATB/MTB-CARBON-PEDAL PD-M08 • carbon body, CNC CroMo axle • high quality, obturated ball bearing • Weight: 210 g • 94 x 73 mm 250 18 41400 93395 black XLC MTB-PEDAL PD-M01 PEDALS • body consisting of synthetic material /aluminium cage, boron axle • ball bearing • Weight: 300 g • 102 x 63 mm 250 18 10000 250 18 10002 9695 9695 black black/silver XLC MTB-PEDAL PD-M02 • 'one piece' aluminium body / aluminium cage CNC • boron axle • ball bearing • Weight: 374 g • 101 x 67 mm 250 18 11000 91395 black XLC MTB-PEDAL PD-M03 • aluminium body / steel cage • boron axle • ball bearing • Weight: 352 g • 104 x 67 mm 250 18 11500 Page 152 91395 silver/black www.xlc-parts.com Technical changes reserved. ware group PEDALS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC MTB PEDAL 'ULTRALIGHT' PD-M04 • aluminium body/aluminium cage • CroMo axle • ball bearing • Weight: 236 g • 99 x 70 mm 250 18 12000 91495 silver/black XLC MTB-PEDAL 'ULTRALIGHT III' PD-M13 • magnesium body, CroMo axle, CNC-crafted • high quality sealed cartridge bearing • integrated reflector for homogeneous look • maintenance-interface for practical upkeep of storage • Weight: 238 g, Measures: 102 x 68 mm 250 18 11700 93595 white XLC MTB-PEDAL 'ULTRALIGHT II' PD-M11 250 18 12100 92695 PEDALS • aluminium compound/aluminium retainer • cold forged • CroMo axle, CNC manufactured • high-quality cartrige bearing, sealed • Weight: approx. 272 g • with reflector • 98 x 62 mm black/silver XLC MTB-PEDAL PD-M05 • polished aluminium body/aluminium cage • boron axle • ball bearing • Weight: 390 g • 110 x 85 mm 250 18 11800 91595 silver/black XLC SYSTEM PEDAL PD-S01 ONESIDED • aluminium body/aluminium cage • CroMo axle • ball bearing • Weight: 465 g • 112 x 65 mm 250 18 20000 93495 Technical changes reserved. silver/black Shimano compatible www.xlc-parts.com Page 153 ware group 250 article number PEDALS & ACCESSORIES WPE x-cellent bike components article designation XLC SYSTEM-PEDAL PD-S10 ONESIDED • aluminium body / aluminium cage • CroMo axle • ball bearings, sealed • Weight: approx. 349 gr. • 93 x 66 x 30,1 mm 250 18 20100 93995 silver Shimano compatiblel XLC SYSTEM-PEDAL PD-S02 ONESIDED • aluminium body / aluminium cage • CroMo axle, CNC milled • sealed • Weight: 350 g • 108 x 65 mm 250 18 20200 93995 silver/black Shimano compatible XLC SYSTEM-PEDAL PD-S03 TWOSIDED PEDALS • aluminium body • CroMo axle, CNC milled • sealed • Weight: 365 g • 84 x 58 mm 250 18 20400 93295 black Shimano compatible XLC SYSTEM-PEDAL PD-S12 TWOSIDED • aluminium body • CroMo axle, CNC milled • cartridge bearing, sealed • Weight: 365 g • 82 x 66 mm 250 18 20500 93995 white Shimano compatible XLC SYSTEM-PEDAL PD-S04 TWOSIDED • aluminium body • CroMo CNC • sealed • Weight: 355 gr. • 84 x 58 x 29 mm 250 18 20600 Page 154 93995 black/silver Shimano compatible www.xlc-parts.com Technical changes reserved. ware group PEDALS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SYSTEM PEDAL ROAD PD-S05 ONESIDED • aluminium body • CroMo axle • ball bearing • Weight: 255 g • 77 x 52 mm 250 18 21000 93295 silver Shimano compatible XLC SYSTEM PEDAL ROAD PD-S11 ONESIDED • aluminium body, coated • CroMo axle, CNC • high-quality, sealed cartridge bearing • Weight: 360 g • 89 x 99 mm • onesided, adjustable binding (80 ~ 140kg-cm) 250 18 21300 97995 silver Shimano compatible XLC SYSTEM PEDAL ROAD PD-S07 ONESIDED 250 18 21400 93295 silver PEDALS • aluminium body • CroMo axle • ball bearing • Weight: 315 g • 81 x 76 mm Shimano compatible XLC PRO SYSTEM PEDAL ROAD ONESIDED PD-S13 • aluminium body, CNC-crafted CroMo axle • high quality sealed needle bearing • adjustable binding • incl. pedal plaque 6° • Weight: 326 g • 81 x 87 x 33 mm 250 18 21500 93995 onesided, black, look-keo-compatible XLC SYSTEM PEDAL ROAD PD-S08 ONESIDED • aluminium body • CNC CroMo axle, cartridge system • sealed bearings of high quality • Weight: 350 g • 85 x 91 mm 250 18 21600 95995 Technical changes reserved. silver look compatible www.xlc-parts.com Page 155 ware group 250 article number PEDALS & ACCESSORIES WPE x-cellent bike components article designation XLC SYSTEM-PEDAL ROAD PD-S09 UNILATERAL • 'One piece' HiPAC carbon body • CNC CroMo axle • with obturated cartridge bearing • adjustable thermoplastic fibre glass attachment (80-140kgf.cm) • 87,5 x 92 mm • only 280 g • incl. pedal plate group 250 18 21700 97995 black look compatible (fixed- & 9°-plates) XLC PEDAL ROAD PD-R01/R02 UNILATERAL • boron axle (aluminium-version with CroMo-CNC axle) • ball bearing • Weight: 392 g (aluminium-version 420 g) • 140 x 95 mm 250 18 21800 91495 synthetic material, black, hooks and straps included PD-R01 250 18 21900 92595 aluminium, silver, hooks and straps included PD-R02 XLC PEDAL STRAPS PD-X01 • per pair • nylon 9350 black 250 18 90300 9350 white NEW! PEDALS 250 18 90000 XLC BMX/FREESTYLE PEDAL PD-M10 • aluminium body • CroMo axle • ball bearing • Weight: 580 g • 110 x 110 mm 250 18 30000 91595 black XLC BMX/FREERIDE PLATFORM-PEDAL PD-M06 • aluminium body with thermoplastic tread • CNC CroMo axle • sealed ball bearing • Weight: 540 g • 113,5 x 100 mm 250 18 13000 Page 156 93995 black/silver www.xlc-parts.com Technical changes reserved. ware group PEDALS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC BMX/FREERIDE PLATFORM-PEDAL PD-M09 • ultraflat design, generous tread • aluminium body, CNC-processed • CNC CroMo axle with cartridge bearing, obturated • Weight: 396 g • 110 x 106 mm 250 18 13200 250 18 13300 95995 95995 black/silver red anodized/silver XLC BMX/FREERIDE PLATFORM-PEDAL PD-M12 • ultraflat design, generous tread • soft annealed, CNC-processed • aluminium body • exchangeable pins • CNC CroMo axle • cartridge bearing, sealed • Weight: 385 g • 99,5 x 96 mm 95995 black/silver 250 18 13406 95995 gold 250 18 13407 95995 red 250 18 13408 95995 green 250 18 13409 95995 blue PEDALS 250 18 13400 XLC PINSET PD-X08 • 20 pieces • M4 x 07 x 7,5 mm • gold anodized • suitable for PD-M09 250 18 13350 9695 for PD-M09 XLC PINSET PD-X09 • 52 pieces • M4 x 07 x 7,5 mm • suitable for PD-M12 250 18 13450 9995 Technical changes reserved. for PD-M12 www.xlc-parts.com Page 157 ware group 250 article number PEDALS & ACCESSORIES WPE x-cellent bike components article designation XLC PLATE SETS PD-X02 • possible for XLC system-pedal • SPD-compatible 250 18 90500 91595 per pair XLC PLATE SETS PD-X03/04 PEDALS • per pair • possible for XLC system-pedal (look-compatible) 250 18 90600 91895 possible for XLC look-pedal, 0°, black PD-X03 250 18 90700 91895 possible for XLC system-pedal (look-compatible), 9°, red PD-X04 XLC PLATE SETS PD-X05/06/07 • per pair • possible for XLC system-pedal (look keo compatible) 250 18 90800 91895 possible for XLC look pedal, 0°, black PD-X05 250 18 90900 91895 possible for XLC look pedal, 6°, red PD-X06 250 18 91000 91895 possible for XLC look pedal, 9°, gray PD-X07 Page 158 www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY PUMPS Technical terms intelligibly illustrated! PUMPS 2 Ways System Pumps equipped with a 2 ways system build pressure in both directions (when pressing and when pulling the pump piston), which speeds up pumping. Blitz Valve Their characteristic is that they are tucked in a piece of metal tube, being secured with a lock nut. Therefore, these valves can be exchanged quickly and without tools, but they can be as easily stolen or sabotaged. The lock nut must be loosened to release the air. High-Power Mode In pumps equipped with the High-Power mode, you have the choice between two pump modes: high volume or high pressure. This allows to pump up the tyre very quickly and to reach the desired pressure in the High-Power mode too. Manometer PUMPS The manometer is an air pressure measuring device for bike tubes, suspension forks or rear wheel suspension for instance. Some of the XLC pumps are serially equipped with a manometer. Polyvalent Valve Head Pumps with polyvalent valve heads are suited or all the three valve types (Presta + Blitz + Schrader) Schrader Valve The Schrader valve is often to be found in mountain bikes. Besides, it is also used for cars, which is why it is also called in German „car valve“(Autoventil). When a pump head or a manometer are attached, a pin is pressed down within the valve, opening it and allowing the air to enter or the air pressure within the tyre to be measured. Hand pumps for Schrader valves need therefore a non-return valve in the pump head. An advantage of the Schrader valve is the possibility of inflating it at petrol stations without needing adapters. Presta Valve The Presta valve (also called French valve or race valve) qualifies for high pressure and is used for MTBs, race bikes or touring bikes. To inflate the tyre, the small knurled nut placed on the thread pin has to be loosened. As this valve, as opposed to the Schrader valve, is not kept closed by a spring but by the excess of pressure within the tyre, it hasn’t to be opened mechanically in order to be pumped up, but opens up by itself at the slightest difference of pressure. Telescopic Pump Some frames do not allow the attachment of a powerful - and consequently large – pump. The alternative is a mini pump, but this hasn’t generally got the performance of a normal pump. A further alternative is a telescopic pump. Thanks to the telescopic function, the length of the pump and thus the volume too can be almost doubled. Technical changes reserved. www.xlc-parts.com Page 159 ware group 250 article number PUMPS & ACCESSORIES WPE x-cellent bike components article designation XLC MINI PUMP ‘RACE’ PU-R01 • super-slim tee-handled aluminium racing bike pump 250 19 10500 91495 for SV, with universal-attachment XLC MINI PUMP 'ALPHA' PU-D01 • plastic case • 'Dual-Head'-pump head and aluminium lever • selective are pumps with high pressure and high volume • 2-way-system, with manometer 250 19 22300 91895 7 bar, with dual head XLC MINI PUMP ‘GAMMA’ PU-D03 • aluminium-casing • 'Dual-Head'-pump head and aluminum lever • selective pumps with high pressure and high volume • 2-way-system 250 19 22400 91995 7 bar, with dual head PUMPS XLC MINI PUMP ‘BETA’ PU-D02 • aluminium-casing • 'Dual-Head'-pump head and aluminum lever • selective pumps with high pressure and high volume • 2-way-system, with manometer 250 19 22500 92495 7 bar, with dual head XLC MINI PUMP ‘ALPHA’ PU-M01 • aluminium-casing • 'Dual-Head'-pump head • comfortable T-grip with a locking funktion • incl. universal fastener and rubber band 250 19 22100 9995 6 bar, with dual head XLC TELESCOPE-MINI PUMP ‘ALPHA’ PU-T01 • plastic shell • 'Dual-Head' pump head • comfortable T-grip with a locking function • incl. universal fastening and rubber band 250 19 22000 Page 160 9795 6 bar, with dual head www.xlc-parts.com Technical changes reserved. ware group PUMPS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC TELESCOPE-MINI PUMP 'BETA' PU-T02 • aluminium-case • 'Dual-Head'-pump head • comfortable T-grip with a locking function • incl. universal fastening and rubber band 250 19 22200 91695 6 bar, with dual head XLC FLOOR PUMP 'GAMMA' PU-S03 • stable floor pump with a large pump volume • large, clear 3,5" gauge with psi- and bar-display • with 'Dual-Head'-pump head with a 800 ml hose • comfortable XLC handle • robust plastic pedestal • plastic case, steel shaft 250 19 55000 92295 8 bar, with dual head XLC FLOOR PUMP 'BETA' PU-S02 250 19 55200 93695 PUMPS • stable '2-way'-floor pump with a large pump volume • large, clear 3,5" gauge with psi- and bar-display • with 'Dual-Head'-pump head with a 750 ml hose • comfortable XLC handle • robust plastic pedestal • high quality aluminium-case, steel shaft 11 bar, with dual head XLC FLOOR PUMP 'ALPHA' PU-S01 • stable '2-way'-floor pump with a large pump volume • large, clear 3,5" gauge with psi- and bar-display • with 'Dual-Head'-pump head with a 650 ml hose • comfortable XLC- handle • robust plastic pedestal • high quality aluminium-case, steel shaft 250 19 55400 93995 Technical changes reserved. 11 bar, with dual head www.xlc-parts.com Page 161 ware group 250 article number PUMPS & ACCESSORIES WPE x-cellent bike components article designation XLC FRAME PUMP PU-F01 • 'Dual-Head'-pump head with an aluminium lever • pump head and handle made of kraton • comfortable T-handle with lock function • incl. velcro 250 19 59000 250 19 59100 250 19 59200 250 19 59300 91695 91695 91695 91695 black/silver black/silver black/silver black/silver Size S (345-395 mm) Size M (400-450 mm) Size L (455-505 mm) Size XL (510-560 mm) XLC SUSPENSION PUMP HIGHAIR PU-H01 • suspension fork pump up to 400 psi. • CNC milled aluminium components and outlet valve 250 19 56000 92995 with pressure gauge and tube XLC SUSPENSION PUMP HIGHAIR PRO PU-H02 • suspension fork pump up to 400 psi • aluminium components with synthetic material grip and outlet valve • safety valve prevents pressure loss 92995 PUMPS 250 19 56500 with pressure gauge and tube XLC ALU 2 IN 1 FUNCTIONAL PUMP PU-A04 • for inner tubes and suspension systems, pumps optionally with high volume or high pressure, with manometer, with pump tube for DV / SV • with release key for precise pressure setting 250 19 23400 92995 incl. pump tube SPARE TUBE FOR XLC FLOOR PUMPS 250 19 58600 9395 universal, adequate for the XLC floor pumps Alpha, Beta, Gamma PU-X02 250 19 58700 9995 spare tube with dual head pump head for floor pumps Alpha, Beta, Gamma PU-X03 Page 162 www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY SADDLES SEAT POSTS ACCESSORIES Technical terms intelligibly illustrated! SADDLES Arctec Reflective Rear The ArcTec saddle base construction optimises the flexing movements of the saddle. The support frame of the Arc-Tec saddle is attached to the saddle by means of a flexible plastics frame, so that a comfortable suspension effect is generated. A high-quality, wear-proof reflective material is integrated at the rear of the saddle crest of some of the XLC saddles. This material reflects traffic lights or street lights, thus enforcing road traffic safety, especially in twilight or darkness. These reflecting stripes are made of microscopic glass spheres, embedded into a polymeric layer and applied to the fabric. In the weight optimised saddle shell of the XLC D2 Base saddles there are integrated rubber inserts, which optimise the flexing properties of the saddle already in the shell, not only in the padding. The D2 Base inserts are placed exactly at the anatomically necessary pressure points of the saddle and provide, together with the padding, highest comfort. Elastomers Elastomers are flexible plastics elements, which change their form under pressure or pulling and return to the original form after the outer influence is removed. They are located in the rear part of the saddle, between saddle shell and support frame and absorb shocks and vibrations which would act upon the rider, thus increasing the riding comfort. Full Zonecut Full Zonecut is an ergonomic indentation in the centre of the saddle. This indentation reduces the pressure upon the perineum, thus avoiding excess pressure on nerves and blood vessels. A far higher riding comfort is thus reached, which is very pleasant, especially on longer tours. Carbon Base Frame Carbon is an epoxide resin, wherein are embedded several layers of carbon fibres. Because of its low weight and extremely high tensile strength, carbon is used for manufacturing high-quality bike components. But caution is also recommended, as carbon parts are sensitive to wrongly applied clamping forces. Please respect therefore exactly the service instructions and use always a torque wrench to tighten the screws! A torque wrench, when correctly set, limits the maximum clamping torque, thus protecting the parts against too high clamping forces. A special XLC assembly paste for carbon parts additionally discharges the components: the paste increases the friction between the parts, thus providing enough hold, even with a low clamping torque. Base Frame of CroMo Steel Saddles marked with this icon have got a base frame of high quality chromiummolybdenum steel. This improved steel has got a higher tensile strength and improved breaking strain properties. Moreover, due to the CroMo alloy used, the base frame is lighter than the ones of traditional steel. Gel Padding Gel padding is a comfortable padding version for bike saddles. It absorbs vibrations and shocks and relieves the spine. The inertia of the gel insert „swallows“ shocks, thus avoiding their transfer upon the rider. Thanks to the gel flexibility, the rider’s weight is distributed very equally upon the whole bottom area, by a natural anatomic adaption. Base Frame of Steel Saddles marked with this icon have got a sturdy steel base frame. The steel base frame is somewhat heavier, but its price is lower and it is extremely durable. An advantageous alternative for all bikes in which weight does not count so much. Base Frame of Titanium-Aluminium Alloy Ladies The properties of the XLC saddles were developed for the special anatomic demands of men and women. The distance between the women’s ischial bones is about 130 mm, between the men’s about 117 mm. Furthermore, the genital areas of men and women are completely different. For this reason, special ladies’ XLC saddles are broader and shorter than those for gentlemen. The positioning of pressure-relieving padding is also arranged to match the different anatomic demands. . Saddles marked with this icon have got a base frame of titanium-aluminium alloy and are characterised by high resistance to corrosion, great sturdiness and low weight. Titanium alloys are especially suited to be used where high resistance to corrosion, sturdiness and low weight are asked. Because of the complicated manufacturing process, titanium is ten times more expensive than traditional steel. Therefore it is only used for high class XLC saddles. Base Frame with Scale Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. The scale on the base frame shows the range within which the seat post can be attached to the frame. Furthermore, the scale helps to adjust your personal riding position. Side Protector The Side Protector system of XLC saddles avoids lateral damages of the saddle crest, which could happen otherwise by falling or leaning against walls. Rain Cover Gents A waterproof rain cover is enclosed within the scope of delivery of some of the XLC saddles. As a measure of protection against theft, the cover is attached to the saddle by a rubber band and it can be fastened under the saddle with a velcro tape. When parking the bike, one has just got to loosen the velcro tape and pull out the rain cover. Now the rain cover can be pulled towards the front, covering the saddle, without having to detach the rubber band from the saddle. A second, sewn-in rubber band, fastens safely the rain cover. The properties of the XLC saddles were developed for the special anatomic demands of men and women. The distance between the women’s ischial bones is about 130 mm, between the men’s about 117 mm. Furthermore, the genital areas of men and women are completely different. For this reason, special ladies’ XLC saddles are broader and shorter than those for gentlemen. The positioning of pressure-relieving padding is also arranged to match the different anatomic demands. Technical changes reserved. www.xlc-parts.com Page 163 SADDLES SEAT POSTS D2 Base ware group 250 MATERIAL & TECHNOLOGY x-cellent bike components SADDLES Riding Position Leisure Suspension When developing a new XLC saddle, the first consideration is the use and consequently the riding position, as the latter determines the form and padding of the new saddle. The saddle construction of the XLC Leisure saddles is particularly suited for a moderate riding position as in trekking bikes for instance, where the upper part of the body is slightly bent forwards, in a 60° angle. Suspension seat posts are the alternative to a suspension rear part of the frame, having moreover a decisive weight and price advantage. The XLC suspension seat posts function according to the telescopic principle, effectively absorbing shocks provoked by uneven ground. On long tours or on rough ground, saddle suspension reduces the strain on bottom and backbone, thus preventing exhaustion. Riding Position Sport When developing a new XLC saddle, the first consideration is the use and consequently the riding position, as the latter determines the form and padding of the new saddle. The saddle construction of the XLC Leisure saddles is particularly suited for an athletic riding position, where the upper part of the body is strongly bent forwards, in an about 15°angle. These saddles are mainly used or MTBs, cross and race bikes. Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. Riding Position Urban When developing a new XLC saddle, the first consideration is the use and consequently the riding position, as the latter determines the form and padding of the new saddle. The saddle construction of the XLC Urban saddles is particularly suited for a straight riding position, in which the upper part of the body is not bent. This riding position is a favourite for city and comfort-bikes. Offset The term Offset designates the shifting of the seat post towards the rear. An offset seat post is needed when the angle of the seat tube is too steep and thus the distance between stem and saddle necessary for a correct riding position cannot be reached with a seat post without offset system. Soft Foam Padding Telescopic Function The term Soft Foam designates a padding made of compressed foam material. The soft foam padding absorbs vibrations and shocks, remaining elastic and maintaining its form even under high strain. The telescopic funktion allows adjusting the seat post height durng the ride. . Unisex There are two areas of use for which XLC produces saddles suited for men and women alike. Firstly, very sportive saddles, as the requirements and wishes of men and women in this area are very much alike. There exists a great choice of special MTB and race saddles for ladies, but still many women choose gents’ MTB saddles. Secondly, there are the very comfortable saddles for city and comfort bikes. These unisex saddles are very large and their soft padding is suited for ladies and gentlemen alike. Vacuum Cover SADDLES SEAT POSTS The term Vacuum Cover designates a 100% waterproof saddle crest manufactured according to a special production process. The flexible upper is smooth and splash water flows easily off the microscopically fine structure, thus drying quickly. Z Zonecut Zonecut is an ergonomic indentation in the saddle padding. This indentation reduces the pressure upon the perineum, thus avoiding excess pressure on nerves and blood vessels. A far higher riding comfort is thus reached, which is very pleasant, especially on longer tours. SEAT POSTS Aluminium Aluminium bike components are characterised by high tensile strength and low weight. In alloys with magnesium, silicium and other metals, aluminium reaches a resistance little inferior to that of steel Aluminium 2014 Aluminium 2014 contains a high amount of copper and thanks to its high tensile strength and temperature range it is also used in aviation and astronautics. . Aluminium 7075 Aluminium 7075 contains a high amount of zinc and thanks to its maximal tensile strength and temperature range it is also used in aviation and astronautics. Page 164 www.xlc-parts.com Technical changes reserved. ware group SADDLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SADDLE FOR CHILDREN 'EVERYDAY' SA-E01 • Saddle cover: black • Frame: steel, with scale, black • arctec, zonecut • reflex logo 250 20 20000 91595 230x136 mm, black 250 20 20200 91595 255x136 mm, black Z XLC SADDLE FOR YOUNG 'EVERYDAY' SA-E02 • Saddle cover: black • Frame: steel, with scale, black • Protector: black • arctec, zonecut • reflex logo 250 20 20400 91995 Boy, 270x138 mm, black 250 20 20600 91995 Girl, 246x151 mm, black Z XLC TREKKING SADDLE 'EVERYDAY' SA-E03 250 20 20800 91995 Sir, 260x158 mm, black 250 20 21000 91995 Lady, 266x178 mm, black 250 20 20850 91995 Sir, 260x158 mm, brown 250 20 21050 91995 Lady, 266x178 mm, brown SADDLES SEAT POSTS • riding position: leisure • Saddle cover: black or brown • Frame: steel, with scale, black • arctec, zonecut, D2 • reflex logo Z XLC CITY SADDLE 'EVERYDAY' SA-E04 • riding position: urban • Saddle cover: black • Frame: steel, with scale, black • with elastomere • arctec, zonecut, D2 • reflex logo 250 20 21200 92595 unisex, 268x204 mm, black 250 20 21250 92595 unisex, 268x204 mm, brown Z Technical changes reserved. www.xlc-parts.com Page 165 ware group 250 article number SADDLES & ACCESSORIES WPE x-cellent bike components article designation XLC MTB SADDLE 'EVERYDAY' SA-E05 • riding position: sport • Saddle cover: black • Frame: steel, with scale, black • arctec, zonecut, D2 • reflex logo 250 20 21400 91995 Sir, 283x145 mm, black 250 20 21600 91995 Lady, 240x160 mm, black Z XLC RACING SADDLE 'EVERYDAY' SA-E06 • riding position: sport • Saddle cover: black • Frame: steel, with scale, black • arctec, zonecut, D2 • reflex logo 250 20 21800 91995 Sir, 295x136 mm, black 250 20 22000 91995 Lady, 274x135 mm, black Z SADDLES SEAT POSTS XLC TREKKING SADDLE 'TRAVELLER' SA-T01 • riding position: leisure • Saddle cover: black • waterproof • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • with elastomere • D2, zonefullcut • reflex logo 250 20 23000 92995 Sir, 267x168 mm, black, about 497 g 250 20 23200 92995 Lady, 246x169 mm, black, about 466 g XLC TREKKING SADDLE 'TRAVELLER' SA-T02 • riding position: leisure • Saddle cover: black • waterproof • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • with elastomere • D2, zonecut • reflex logo 250 20 23400 92995 Sir, 268x167 mm, black, about 513 g 250 20 23600 92995 Lady, 246x178 mm, black, about 492 g Z Page 166 www.xlc-parts.com Technical changes reserved. ware group SADDLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC CITY SADDLE 'TRAVELLER I' SA-T03 • riding position: urban • Saddle cover: black • waterproofed • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • with elastomere • D2, zonefullcut • reflex logo 250 20 23800 93295 Sir, 278x168 mm, black, approx. 852 g 250 20 24000 93295 Lady, 260x210 mm, black, approx. 728 g XLC CITY SADDLE 'TRAVELLER II' SA-T04 • riding position: urban • Saddle cover: black • waterproofed • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • with elastomere • D2, zonecut • reflex logo 250 20 24200 93295 Sir, 272x213 mm, black, approx. 870 g 250 20 24400 93295 Lady, 253x207 mm, black, approx. 714 g Z XLC CITY SADDLE 'TRAVELLER' SA-T05 250 20 24600 92995 Sir 278x168 mm, black, approx. 467 g 250 20 24800 92995 Lady 262x189 mm, black, approx. 495 g SADDLES SEAT POSTS • riding position: urban • Saddle cover: black • waterproofed • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • with elastomere • D2, zonecut • reflex logo Z XLC MTB SADDLE 'TRAVELLER' SA-T06 • riding position: sport • Saddle cover: black • waterproofed • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • D2, zonecut • reflex logo 250 20 25000 92995 unisex 275x148 mm, black, approx. 374 g Z Technical changes reserved. www.xlc-parts.com Page 167 ware group 250 article number SADDLES & ACCESSORIES WPE x-cellent bike components article designation XLC MTB SADDLE 'TRAVELLER' SA-T07 • riding position: sport • Saddle cover: black • waterproof • Frame: steel, with scale, satin • with gel vision panel and gel cushioning • D2, zonefullcut • reflex logo 250 20 25200 92995 unisex 264x133 mm, black, about 350 g XLC TREKKING SADDLE 'GLOBETROTTER' SA-G01 • riding position: leisure • Saddle cover: black • incl. rain cover • Frame: CroMo, bicoloured • with gel vision panel • ergonomic gel cushioning • D2, zonefullcut • reflex logo 250 20 26000 93995 Sir 278 x 168 mm, black, about 420 g 250 20 26200 93995 Lady 238 x 168 mm, black, about 420 g SADDLES SEAT POSTS XLC CITY SADDLE 'GLOBETROTTER' SA-G02 • riding position: urban • Saddle cover: black • incl. rain cover • Frame: CroMo, bicoloured, • with gel vision panel • ergonomic gel cushioning • D2, zonefullcut • elastomere, reflex logo 250 20 26400 93995 Sir 275x213 mm, black, about 690 g 250 20 26600 93995 Lady 245x225 mm, black, about 690 g XLC MTB SADDLE 'GLOBETROTTER' SA-G03 • riding position: sport • Saddle cover: black • incl. rain cover • Frame: CroMo, bicoloured • with gel vision panel • ergonomic gel cushioning • D2, zonefullcut • elastomere • reflex logo 250 20 26800 Page 168 93995 unisex 268x135 mm, black, about 330 g www.xlc-parts.com Technical changes reserved. ware group SADDLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC MTB SADDLE 'AMBITION' SA-A01 • riding position: sport • Saddle cover: perforated • Frame: aluminium/titanium • with scale, black/silver • arctec, zonefullcut • extra light saddle design 250 20 28000 93995 unisex 282x149 mm, black, approx. 260 g 250 20 28100 93995 unisex 282x149 mm, white, approx. 260 g XLC MTB SADDLE 'AMBITION' SA-A02 • riding position: sport • Saddle cover: perforated • Frame: aluminium/titanium • with scale, black/silver • arctec • extra light saddle design 250 20 28300 93995 Sir 278x130 mm, black, approx. 240 g 250 20 28700 93995 Lady 266x137 mm, black, approx. 240 g XLC MTB SADDLE 'AMBITION' V SA-A03 250 20 28800 93995 unisex 278x188 mm, black, approx. 285 g 250 20 28803 93995 unisex 278x138 mm, white, approx. 285 g SADDLES SEAT POSTS • riding position: sport • Saddle cover: microfiber • Frame: aluminium/titanium • with scale, black/silver • arctec • extra light saddle design XLC RACING SADDLE 'AMBITION' SA-A04 • riding position: sport • Saddle cover: perforated • Frame: aluminium/titanium • with scale, black/silver • arctec, zonefullcut • extra light saddle design 250 20 28900 93995 Sir 278x130 mm, black, approx. 240 g 250 20 29000 93995 Lady 266x137 mm, black, approx. 240 g Technical changes reserved. www.xlc-parts.com Page 169 ware group 250 article number SADDLES & ACCESSORIES WPE x-cellent bike components article designation XLC MTB/TRIATHLON SADDLE 'AMBITION' SA-A05 • riding position: sport • Saddle cover: microfiber • Frame: aluminium/titanium, with scale: black/silver • arctec • extra light saddle design 250 20 28500 93995 unisex, 278 x 178 mm, black, about 260 g XLC FREERIDE SADDLE 'AMBITION' SA-A06 • riding position: sport • Saddle cover: vinyl + gel cushioning • Frame: aluminium/titanium • with scale black/silver • arctec • extra-light saddle design 250 20 29200 93995 unisex 282 x 136 mm, black, about 315 g XLC RACING SADDLE 'SPRINTER' SA-S02 • riding position: sport • Frame: carbon • carbon shell • extra light saddle design, about 90g • maximum rider’s weight 90kg SADDLES SEAT POSTS 250 20 30200 916995 unisex 278 x 125mm, black, about 90g XLC SADDLE COVER MTB/ATB SC-G01 • with shock absorbing gel insertion (Lycra) 250 20 19600 9995 MTB/ATB, 254 - 280 x 178 - 203 mm Geltech, black 250 20 19800 91195 CRUISER, 244 - 269 x 254 - 279 mm Geltech, black XLC SADDLE COVER MTB/ATB SC-G02 • with shock absorbing ergonomic gel insertion (Lycra) 250 20 19700 9995 MTB/ATB, 254 - 280 x 178 - 203 mm Geltech Ergo, black 250 20 19900 91095 CRUISER, 244 - 269 x 254 - 279 mm Geltech Ergo, black Page 170 www.xlc-parts.com Technical changes reserved. ware group SADDLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC SEAT POST CLAMPING RING PC-L01 250 20 60000 250 20 60100 9695 9695 black black Ø 31,8 mm Ø 34,9 mm 250 20 60200 250 20 60300 9695 9695 silver silver Ø 31,8 mm Ø 34,9 mm XLC SEAT POST CLAMPING RING PC-L03 250 20 62000 250 20 62002 250 20 62003 9795 9795 9895 black silver white Ø 31,8 mm Ø 31,8 mm Ø 31,8 mm 250 20 62100 250 20 62102 250 20 62103 9795 9795 9895 black silver white Ø 34,9 mm Ø 34,9 mm Ø 34,9 mm 250 20 60500 250 20 60600 250 20 60700 9695 9695 9695 black black black Ø 28,6 mm Ø 31,8 mm Ø 34,9 mm 250 20 60800 250 20 60900 250 20 61000 9695 9695 9695 silver silver silver Ø 28,6 mm Ø 31,8 mm Ø 34,9 mm SADDLES SEAT POSTS XLC SEAT POST CLAMPING RING PC-B02 XLC SEAT POST CLAMPING RING PC-B01 250 20 61100 9695 black Ø 31,8 mm 250 20 61200 9695 black Ø 34,9 mm Technical changes reserved. www.xlc-parts.com Page 171 ware group 250 article number SADDLES & ACCESSORIES WPE x-cellent bike components article designation XLC SEAT POST CLAMP RING 'COLOUR EDITION' PC-L04 • incl. quick release • Material: aluminium • cold forged 250 20 64006 250 20 64008 250 20 64007 250 20 64009 9795 9795 9795 9795 Ø 31,8 mm gold Ø 31,8 mm green Ø 31,8 mm red Ø 31,8 mm blue 250 20 64106 250 20 64107 250 20 64108 250 20 64109 9795 9795 9795 9795 Ø 34,9 mm gold Ø 34,9 mm red Ø 34,9 mm green Ø 34,9 mm blue XLC SEAT POST CLAMP RINGS PC-B03 250 20 63000 91295 black, specially made for carbon Ø 31,8 mm 250 20 63100 91295 black, specially made for carbon Ø 34,8 mm XLC SEAT POST CLAMP RING 'COLOUR EDITION' PC-B05 SADDLES SEAT POSTS • Material: aluminium • cold forged 250 20 64306 250 20 64307 250 20 64308 250 20 64309 9495 9495 9495 9495 Ø 31,8 mm gold Ø 31,8 mm red Ø 31,8 mm green Ø 31,8 mm blue 250 20 64406 250 20 64407 250 20 64408 250 20 64409 9495 9495 9495 9495 Ø 34,9 mm gold Ø 34,9 mm red Ø 34,9 mm green Ø 34,9 mm blue XLC SEAT POST CLAMPING RING PC-B04 • CNC-made • Weight: 43 gr. (Ø 34.9mm) • use: DH/Freeride • double clamping for extra secure stability 250 20 63500 250 20 63503 9995 91095 black, for Ø 31,6 white, for Ø 31,6 250 20 63600 250 20 63603 9995 91095 black, for Ø 34,9 mm white, for Ø 34,9 mm Page 172 www.xlc-parts.com Technical changes reserved. ware group SEAT POSTS x-cellent bike components article number WPE 250 article designation XLC CARBON SL ROAD SEAT POST SP-K02 • Material: carbon • Length: 300/400 mm • Offset: 5/15 mm • Weight: 190 g (Ø 27,2/300 mm), 225 g (Ø 27,2/400 mm) 204 g (Ø 31,6/300 mm), 244 g (Ø 31,6/400 mm) 250 20 55000 250 20 55001 99900 99900 Ø 27,2 mm 300 mm Ø 27,2 mm 300 mm 5 mm Offset 15 mm Offset black black 250 20 55002 250 20 55003 99900 99900 Ø 27,2 mm 400 mm Ø 27,2 mm 400 mm 5 mm Offset 15 mm Offset black black XLC CARBON SL MTB SEAT POST SP-K03 250 20 55100 250 20 55101 99900 99900 Ø 31,6 mm 300 mm Offset 5 mm Ø 31,6 mm 300 mm Offset 15 mm black black 250 20 55102 250 20 55103 99900 99900 Ø 31,6 mm 400 mm Offset 5 mm Ø 31,6 mm 400 mm Offset 15 mm black black SADDLES SEAT POSTS • Material: carbon • Length: 300/400 mm • Offset: 5/15 mm • Weight: 190 g (Ø 27,2/300 mm), 225 g (Ø 27,2/400 mm) 204 g (Ø 31,6/300 mm), 244 g (Ø 31,6/400 mm) XLC COMP SEAT POST SP-R04 • Material: aluminium 2014, forged aluminium head • Length: 350 mm • Weight: 243 g (at Ø27,2 x 300 mm) • Offset: 20 mm • angle adjustable from -15° to +15° 250 20 40000 250 20 40100 92295 92295 Ø 25,4 mm, 350 mm, black Ø 27,2 mm, 350 mm, black 250 20 40200 250 20 40300 92295 92295 Ø 30,9 mm, 350 mm, black Ø 31,6 mm, 350 mm, black Technical changes reserved. www.xlc-parts.com Page 173 ware group 250 article number SEAT POSTS WPE x-cellent bike components article designation XLC SL SEAT POST SP-R03 • Material: aluminium 2014T6, 'one-piece-construction', 3D forged • Length: 350/400 mm • Weight: 230 g (with Ø27,2 x 350 mm) • Offset: 24 mm • indicated angle 62° - 91° 250 20 50500 250 20 50510 94295 94295 Ø 27,2 mm, 350 mm, black Ø 27,2 mm, 400 mm, black 250 20 50600 250 20 50602 94295 93995 Ø 31,6 mm, 350 mm, black Ø 31,6 mm, 350 mm, high polished 250 20 50610 250 20 50612 94295 93995 Ø 31,6 mm, 400 mm, black Ø 31,6 mm, 400 mm, high polished XLC PRO SL SEAT POST SP-R01 • Material: aluminium 7075 3D forged • Length: 350 mm • Weight: 240 g (with Ø27,2 x 350 mm) • Offset: 16 mm 94595 94795 Ø 27,2 mm, 350 mm, black Ø 27,2 mm, 400 mm, black 250 20 52400 250 20 52410 94595 94795 Ø 30,9 mm, 350 mm, black Ø 30,9 mm, 400 mm, black 250 20 52500 250 20 52510 94595 94795 Ø 31,6 mm, 350 mm, black Ø 31,6 mm, 400 mm, black SADDLES SEAT POSTS 250 20 52300 250 20 52310 XLC PRO SL SEAT POST SP-R02 • Material: aluminium 7075, 3D forged • Length: 350 /400 mm • Weight: 200 g (with Ø27,2 x 350 mm) 250 20 52700 250 20 52710 94295 94495 Ø 27,2 mm, 350 mm, black Ø 27,2 mm, 400 mm, black 250 20 52800 250 20 52810 94295 94495 Ø 30,9 mm, 350 mm, black Ø 30,9 mm, 400 mm, black 250 20 52900 250 20 52910 94295 94495 Ø 31,6 mm, 350 mm, black Ø 31,6 mm, 400 mm, black Page 174 www.xlc-parts.com Technical changes reserved. ware group SEAT POSTS x-cellent bike components article number WPE 250 article designation XLC SUSPENSION SEAT POST SP-S01 • Material (head): aluminium 6061, 2D forged • Material (body): aluminium 6061 • Length: 350 mm • Weight: 475 g • pitch of spring: 40 mm 250 20 70000 91995 aluminium, black matt, Ø 27,2 mm XLC COMP SPRING SEAT POST SP-S06 • Material: aluminium 6061-T6 • Length: 350 mm • Weight: 466 g (Ø 31,6 x 350 mm) • deflexion: 40 mm • preload adjustable 250 20 70900 92295 Ø 27,2 mm, 350 mm black XLC PRO SPRING SEAT POST SP-S05 250 20 71100 92995 SADDLES SEAT POSTS • Material: aluminium 6061 • Length: 350 mm • Weight: 409 g (Ø 31,6 x 300 mm) • deflexion: 40 mm • clamping 43 x 33 mm • adjustable seat angle (-5° to 18°) Ø 27,2 mm, 350 mm black XLC PRO SPRING SEAT POST SP-S04 • Material: aluminium 6061 forged • Length: 355 mm • Weight: 350 g • deflexion: 40 mm • clamping 43 x 27,5 mm • offset-adjusting bolt for the adjustable seat angle ( -5° to 18°) • adjustable side play 250 20 72100 95995 Technical changes reserved. Ø 27,2 mm, 300 mm black matt www.xlc-parts.com Page 175 ware group 250 article number SEAT POSTS WPE x-cellent bike components article designation XLC TELESCOPE-SEAT POST SP-T02 • Material: aluminium 6066 • Length: 400 mm, lowerable to 280 mm • Weight: 354 g 250 20 69000 93995 Ø 31,6 mm, black XLC TELESCOPE-SEAT POST SP-T03 • Material: aluminium 6061-T6 • Offset: 15 mm • operating mode: pneumatic • 'Low-Profile'-patented head - minor structure hight • Length: 400 mm • 95 mm (+/- 5 mm) hight adjustability • Weight: 640 g (Ø 30,9x400 mm) 250 20 69500 913995 Ø 30,9 mm, 400 mm, black 250 20 69600 913995 Ø 31,6 mm, 400 mm, black SADDLES SEAT POSTS XLC TELESCOPE-SEAT POST SP-T04 • Material: aluminium 6061-T6 • Offset: 15 mm • operation mode: pneumatic • 'Low-Profile'-patented head - low structure hight • Length: 400 mm • 95 mm (+/- 5 mm) hight adjustability • Weight: 640 g (Ø 30,9x400 mm) 250 20 69550 915995 Ø 30,9 mm, 400 mm black, remote-lever 250 20 69650 915995 Ø 31,6 mm, 400 mm, black, remote-lever XLC REMOTELOCK LEVER SP-X01 • cable and sheath included • spare spring included 250 20 69655 Page 176 92495 for XLC Pro Telescope-Seat Post SP-T04 www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY LOCKS KICKSTANDS Technical terms intelligibly illustrated! KICKSTANDS LOCKS Cylinder-Discs Lock Direct Assembly In a cylinder-discs lock, turning the key causes a series of discs to rotate. When using the right key, these discs are correctly positioned and the blocking pin allows the cylinder to turn and the lock opens. Some bike frames are serially equipped with a side kickstand adapter plate placed on the chainstay, which allows direct assembly of special side kickstands. There are two types of adapters and kickstands, the one with an 18 mm, the other with a 40 mm distance between the holes. Safety Level 1 XLC locks with the safety level 1 are suited especially for securing accessories like helmets or baskets in case of very low safety risk. They are intended only as an additional device to a lock with a higher safety level. Adjustable Length Because of their adjustable length, these kickstands can be used for bikes with wheel and frames of different sizes. It is no longer necessary to cut the kickstand to length. Safety Level 2 XLC locks with the safety level 2 are suited especially for securing bikes in case of very low safety risk. They are intended especially for securing the bike or accessories like helmets or baskets for a short period of time. They work optimally in combination with a lock having a higher safety level. Safety Level 3 XLC locks with the safety level 3 are suited especially for securing the bike or accessories like helmets or baskets for a short period of time in case of very low safety risk. Safety Level 4 XLC locks with the safety level 4 are suited for securing bikes in case of normal safety risk. Safety Level 5 LOCKS XLC locks with the safety level 5 are suited for securing bikes in case of normal and slightly heightened safety risk. Safety Level 6 XLC locks with the safety level 6 are suited for securing bikes in case of heightened safety risk. The bike can be attached to lamp posts, street signs, fences, etc. Safety Level 7 XLC locks with the safety level 7 are suited for securing bikes in case of high safety risk. The bike can be attached to lamp posts, street signs, fences, etc. The massive, robust construction scares off potential thieves and forestalls opening attempts with light tools. Safety Level 10 XLC locks with the safety level 10 are optimally suited for securing bikes in case of high safety risk. The bike can be attached to lamp posts, street signs, fences, etc. The massive, robust construction scares off potential thieves. These locks are hard to crack, even with heavy tools. Pin Cylinder Several cylinder pins forestall the opening of the lock. Only the right key brings the cylinder pins in the correct position, releases the blockage and allows the lock to be opened. Technical changes reserved. www.xlc-parts.com Page 177 ware group 250 article number LOCKS WPE x-cellent bike components article designation XLC SPIRALED CABLE LOCK 'AL CAPONE II' LO-L03 • with 3 keys • with universal holder • disc cylinder with protecting cap • softtouch body 250 23 10000 250 23 10200 250 23 11000 250 23 11200 91195 91195 91195 91195 Ø 10 x 1200 mm, security level 2 Ø 10 x 1800 mm, security level 2 Ø 12 x 1800 mm, security level 3 Ø 15 x 1500 mm, security level 4 XLC CABLE LOCK 'DON CORLEONE II' LO-C04 • with 3 keys • disc cylinder with protecting cap • softtouch body 250 23 10400 250 23 11400 91095 91095 Ø 12 x 600 mm, security level 3 Ø 18 x 800 mm, security level 5 XLC ARMOURED CABLE LOCK 'DILLINGER II' LO-C05 • with 3 keys • disc cylinder with protecting cap • softtouch body • velcro 92395 Ø 22 mm x 1000 mm, security level 7 LOCKS 250 23 12500 XLC CODE LOCK 'RONALD BIGGS II' LO-L04 • with universal holder • freely selectable code • softtouch body 250 23 13000 Page 178 91495 cable Ø 12 mm, length: 1800 mm, with holder www.xlc-parts.com Technical changes reserved. ware group LOCKS x-cellent bike components article number WPE 250 article designation XLC SPIRALED CABLE LOCK LO-L06 • inclusive holder • price per piece 250 23 20000 250 23 20100 9399 9499 Ø 8 x 1200 mm VE 12 Ø 8 x 1200 mm VE 12 XLC CABLE LOCK LO-C06 • inclusive holder • price per piece 250 23 20500 9399 Ø 8 x 600 mm VE 12 XLC CODE LOCK WITH SPIRALED CABLE LO-L07 • adjustable code • without holder • price per piece 9599 9699 Ø 6 x 1200 mm VE 12 Ø 8 x 1200 mm VE 12 LOCKS 250 23 21000 250 23 21100 XLC CABLE LOCK WITH CODE LO-C08 • adjustable code • without holder • price per piece 250 23 21500 9599 Technical changes reserved. Ø 8 x 600 mm VE 12 www.xlc-parts.com Page 179 ware group 250 article number LOCKS WPE x-cellent bike components article designation XLC U-LOCK 'SUNDANCE & CASSIDY' LO-S01 • U-lock • 4-edged tube, U-lock consists of alloyed steel • with 3 keys • with universal holder • disc cylinder with protecting cap • interlocked on both sides • 135 x 245 mm • security level 10 250 23 03500 92995 Ø 135x245 mm, universal holder, security level 10 XLC U-LOCK 'FANTOMAS' LO-F01 • with deductible key • fastening: pletscher disc 92795 LOCKS 250 23 06000 fastening on pletscher disc , deductible key XLC ARMOURED CHAIN LOCK 'DR MABUSE' LO-C03 • double, automatic square locking • printed textile inner tube • 9-disc cylinder • corrosion protection • Ø 10 x 1000 mm 250 23 05000 Page 180 95995 Ø 10 x 1000 mm www.xlc-parts.com Technical changes reserved. ware group MUDGARDS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC MUDGUARDS 'JUNIOR' MG-C04 • compatible with suspension forks, rigid forks and V-Brakes 250 25 01800 9895 black 16 - 20" XLC MUDGUARD FRONT WHEEL MG-C05 • semi-transparent • toolfree assembly • universally adjustable loop fastening for the down tube or bolt fastening • very soft, flexible Material • suitable for 1,5" - 2" tyres • Weight: approx. 75 g • Measures: 140 x 190 mm 250 25 01000 9795 20 - 29" XLC MUDGUARD REAR WHEEL MG-C06 • semi-transparent • toolless assembling • universal loop fastening with adjustable angle for the seat post up to Ø 32,5 mm • very soft, flexible material • adequate for tyres of 1.5" to 2" • Weight: approx. 150 g. • Measures: 550 x 190 x 85 mm 9995 26/28 MUDGARD 250 25 01100 XLC MUDGUARD SET MG-C03 • front wheel and rear wheel set • also appropriate for V-brake 250 25 02000 9495 20" black 250 25 02600 9595 24 - 26" black 250 25 02800 9650 28" black Technical changes reserved. www.xlc-parts.com Page 181 ware group 250 article number MUDGARDS & ACCESSORIES WPE x-cellent bike components article designation XLC MUDGUARDS MG-C06/MG-C07/MG-C08 • for City-, Road-, Trekkingbikes in 26 - 28” • Colour: black 250 25 03000 9695 MG-C06, VR-Dirtboard, toolless fastening to the down tube, Length: 390 mm, Weight: 81 g 250 25 03100 9995 MG-C07, HR-Mudguard, seat post mounting Ø 24 - Ø 36 mm, Length: 540 mm, Width 42 mm, Weight 180 g 250 25 03200 91495 MG-C08 Dirtboard/Mudguard Set, consisting of 1 part MG-C06 and MG-C07 XLC MUDGUARDS MG-C12/MG-C13/MG-C14 • for MTB-Bikes, Trekking-Bikes • with reflex sticker 250 25 03300 91095 250 25 03400 9995 250 25 03500 91795 MG-C12 for fork tube fastening Ø 16 - 28,5 mm, Quickrelease system, Length: 560 mm, Width: 85 mm, Weight: only 132 g, black, 24-26" MG-C13 for seat post Ø 24 - 36 mm, Quickrelease system, adjustable angles, Length: 510 mm, Width: 86 mm, Weight: only 173 g, black, 24-26" MG-C14 Mudguard Set, consisting of 1 part MG-C12 and MG-C13 KICKSTANDS STABILISERS XLC DIRT BOARD MG-C11 • mounting down tube frame • also appropriate for oversizes 250 25 05200 Page 182 9495 black www.xlc-parts.com Technical changes reserved. ware group KICKSTANDS / STABILISERS x-cellent bike components article number WPE 250 article designation XLC SIDE STAND KS-S01 • extra large rubber foot for safe stand 250 26 00000 9995 black/silver, adjustable 24 - 28" 250 26 09900 9250 Ersatzständerfuß for Model KS-S01, KS-R01, KS-C01 XLC CHAINSTAYS STAND KS-R01 • extra large rubber foot for safe stand • adjustable 24 - 28" 250 26 00200 91295 250 26 09900 9250 black spare kickstand foot for Model KS-S01, KS-R01, KS-C01 XLC CHAINSTAYS STAND KS-R02 • adjustable 24 - 28" 250 26 10000 91195 black 250 26 10100 91195 silver XLC CHAINSTAYS STAND KS-R03 • adequate for multigear hubs, singlespeed and derailleur with slot • adjustable: 26 - 28" 91395 black KICKSTANDS STABILISERS 250 26 10200 XLC CHAINSTAYS STAND KS-R04 • fastening on the chainstays • convenient for oversize, aluminium and fully frames • adjustable: 24 - 28" 250 26 10500 91595 Technical changes reserved. black www.xlc-parts.com Page 183 ware group 250 article number KICKSTANDS / STABILISERS WPE x-cellent bike components article designation XLC CHAINSTAY SUPPORTING STAND 'MULTI II' KS-R05 • fastening: chainstay • universal placement possibilities • fastening horizontally and vertically adjustable • adequate for oversized, aluminium and fully frames • adequate for disc brake acceptance • adjustable 24 - 28" 250 26 10600 91595 black XLC SIDE STAND KS-B01 • mounting on the bearing shell • fits SHIMANO Hollowtech II & TRUVATIV Giga Pipe (BB Cup 44mm) • particularly suitable for Road bike & MTB carbon frame • adjustable through 2 mounted angle discs • with stable and broad rubber foot • Weight: just 152 gr 250 26 11000 93795 black, 26 - 28" XLC CHAINSTAYS STAND 'MULTI I' KS-R06 • fastening: chainstays • suitable for disc brake slot • with adjustable mounting for different chain stay angles • adjustable 24 - 28" 250 26 10700 91195 black XLC KICK STAND KS-C01 KICKSTANDS STABILISERS • installation on the chain stay • including replacement pads for oval, angled or round chain stays • adjustable 24 - 28", extra big rubber foot for safer standing 250 26 00300 91295 250 26 09900 9250 black spare kickstand foot for model KS-S01, KS-R01, KS-C01 XLC REAR END KICKSTAND KS-C04 • to be mounted directly on the chainstay with adaption plate • space between the hole: 18 mm • extra large rubber foot for more stability 250 26 00400 Page 184 91595 black, 26 - 28" www.xlc-parts.com Technical changes reserved. ware group KICKSTANDS / STABILISERS x-cellent bike components article number WPE 250 article designation XLC REAR END KICKSTAND KS-C05 • to be assembled on the chainstay itself, with support plate • space between holes: 40 mm • extra large rubber foot for more stability 250 26 00600 91595 26 - 28" XLC BIPOD KICKSTAND KS-D02 • Material: aluminium • with folding mechanism, both stand legs fold towards the chain side, thus avoiding contact with the chain • very stable execution, also suitable for e-bikes 250 26 13100 93295 black, 24 - 28" XLC SIDE STAND 'TRAVEL STAND' KS-S01 • portable side stand for saddle rack assembly • foldable to pocket size • fits on every bike (folding bike, racing bike) • inclusive bag • Length: 94 cm, folding measure 14 cm • Weight: just 136 gr incl. bag (without bag: 91 gr) 92495 silver KICKSTANDS STABILISERS 250 26 12000 XLC UNICYCLE DISPLAY • adequate for 4 unicycles • adjustable clamps for seat posts • very solid construction • stable stand • Height: around 190 cm 250 26 05200 see price list Technical changes reserved. for 4 unicycle www.xlc-parts.com Page 185 ware group 250 article number KICKSTANDS / STABILISERS WPE x-cellent bike components article designation XLC DISPLAY STAND 'UNISTAGE' VS-F01 • adequate as a repair stand, storage rack or sales exhibitor • robust steel construction, two pieced • also fits extreme tyre breadth • wide stand feet 250 26 05400 92495 for one bike XLC A STAND VS-F02 • robust steel construction, extremely stable • paint-friendly, coated holding fixture for front or rear wheel • suitable for 26 - 28" bikes 250 26 06000 92495 for one bike XLC WALL HOLDER KS-W01 • to hang up at the front wheel 91095 KICKSTANDS STABILISERS 250 26 05000 XLC wall holder XLC STABILISERS TW-S01 • 12 - 20" • with solid steel rim • TÜV-certified 250 26 30000 Page 186 91595 stabilisers 12 - 20" www.xlc-parts.com Technical changes reserved. MATERIAL & TECHNOLOGY BIKE COMPUTERS BOTTOM BRACKET WATER BOTTLES WATER BOTTLE BRACKET TOOLS WORKSHOP NEEDS BIKE COMPUTERS 7 functions Cadence Meter Bike computers bearing this icon have got 7 functions. The functions can vary, so please read the product specification. Bike computers bearing this icon are equipped with a cadence mensuration function. In case of cycling, the cadence means the number of crank rotations per minute. The computer measures it by means of a sensor, fastened on the chainstay and triggered by a solenoid on the crank. 12 functions Bike computers bearing this icon have got 12 functions. The functions can vary, so please read the product specification. BOTTOM BRACKET Aluminium 6061 17 functions Bike computers bearing this icon have got 17 functions. The functions can vary, so please read the product specification. 28 functions Bike computers bearing this icon have got 28 functions. The functions can vary, so please read the product specification. Aluminium alloys of the 6000 series contain mainly the metals magnesium and silicium. The tensile strengths are between about 200 and 350 N/mm. Among the advantages of this rather soft aluminium are the very good plasticity and the resistance to corrosion. The aluminium alloy 6061 has many uses, i.a. for shop interior, aviation, astronautics and naturally for bike frames and components. CNC milled CNC is a precise, computerised milling process (Computerised Numerical Controll) allowing the manufacturing of complex and intricate items out of one block. The dimensional tolerances are reduced to a minimum. 33 functions Bike computers bearing this icon have got 33 functions. The functions can vary, so please read the product specification. WATER BOTTLES Carbon Carbon is an epoxide resin with several incorporated layers of carbon fibres. Because of its low weight and extremely high tensile strength it is used for high quality bike components. Dual Wheel Size Bike computers bearing this icon can be calibrated for two different wheel sizes. Thus, the computer can be fastened alternately on a MTB and a race bike without having to change the basic setting. Food Safe The intenal coating of the XLC water bottles is tasteless and food safe. Heart Function Altimetric Function Bike computers bearing this icon are equipped with a barometric altimetry function. Barometric altimetry is performed by means of the atmospheric pressure at the place of mensuration. It is less exact than other methods, but it reacts very quickly and it weighs little. Calories Bike computers bearing this icon indicate the caloric consumption. It is an average value calculated by the computer. In order to find out the exact value please consult a specialist. Lightweight Lightweight parts play and ever increasing part in the bike technology. Hence, following this trend, XLC parts and accessories marked with the XLC Lightweight Icon were made as weight-optimised as possible. In the process, special attention was given to functionality and safety not be affected by the lightness of the construction. A light bike has got many advantages. It can be accelerated quickly, stopped safelier and as a general rule better manoeuvred. Besides, low weight makes transport by bus and train easier. Aluminium Aluminium bike components are characterised by high tensile strength and low weight. In alloys with magnesium, silicium and other metals, aluminium reaches a resistance little inferior to that of steel. TOOLS/WORKSHOP NEEDS Multi Function Tool Time Bike computers bearing this icon are equipped with a digital time function. Semi-Professional Wireless Bike computers bearing this icon do not need any cable between the sensors on the fork, respectively on the pedal, and the computer on the handlebar. The data are transferred wireless, no bothersome cable installation. Technical changes reserved. Multi function tools are extremely polyvalent and thanks to their compact build ideal for carrying about. Tools bearing this icon are particularly durable and robust and thus ideal for the use in hobby workshops. www.xlc-parts.com Page 187 BIKE COMPUTERS Bike computers bearing this icon are equipped with a heart rate function. The heart rate is the number of heart beats per minute. The heart rate depends on stress, age and fitness. In a healthy person it lies between 50 and 100 beats per minute in state of rest. The scope of delivery comprises a chest strap, which transfers the data wireless to the computer on the handlebar. ware group 250 article number BIKE COMPUTERS & ACCESSORIES WPE x-cellent bike components article designation XLC BIKE COMPUTER BV-C07 with 'Heavy-Duty' sensor cable simple handling 7 functions: • time: 12h/24h mode • travel time • current speed • average speed • daily distance • odometer • compares current to average speed (arrow symbols) 250 27 05000 91495 XLC bike computer, black XLC BIKE COMPUTER BV-W12 wireless simple handling 12 functions: • time: 12h/24h mode • travel time • current speed • average speed • maximum speed • day's distance • odometer with bike 1 & 2 • odometer for bike 1 or 2 • compares current to average speed (arrow symbols) • 2 wheel diameters adjustable • calorie counter 92395 XLC bike computer, silver BIKE COMPUTERS 250 27 05200 Page 188 www.xlc-parts.com Technical changes reserved. ware group BIKE COMPUTERS & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC BIKE COMPUTER 'SEVENTEEN' BV-W17 wireless 2.4 GHz 17 functions: • time: 12h/24h mode • travel time • current speed • average speed • maximum speed • day's distance • odometer bike 1 and 2 • odometer bike 1 or 2 • compares current to average speed (arrow symbols) • calorie counter • background light • cadence • average cadence • maximum cadence • day's cadence • scan mode • 2 tyres mounting adjustable 250 27 05400 95995 XLC bike computer, black XLC BIKE COMPUTER 'TWENTYEIGHT' BV-W28 wireless 2.4 GHz 250 27 05600 95995 Technical changes reserved. BIKE COMPUTERS 28 functions: • different languages adjustable • time: 12h/24h mode • travel time • total travel time bike 1 and 2 • 2 bike sizes adjustable • total travel time bike 1 or 2 • chronograph • current speed • average speed • maximum speed • day's distance • odometer (up/down) • odometer bike 1 and 2 • odometer bike 1 or 2 • compares current to average speed (arrow symbols) • calorie counter • thermometer • background light • countdown timer (up/down) • heart rate • visual display of heart rates overrun/undershooting • average heart rate • maximum heart rate • shows maximum heart rate in percent • timepiece heart rate • timepiece heart rate-zone • timepiece heart rate overrun • timepiece heart rate undershooting XLC bike computer, anthracite www.xlc-parts.com Page 189 ware group 250 article number BIKE COMPUTERS & ACCESSORIES WPE x-cellent bike components article designation XLC BIKE COMPUTER BV-W33 wireless 2.4 GHz with altimetry function 33 functions: • different languages adjustable • time: 12h/24h mode • travel time • total travel time for bike 1 or 2 • 2 bike sizes adjustable • total travel time bike 1 & 2 • chronograph • current speed • average speed • maximum speed • day's distance • odometer (up/down) • odometer bike 1 and 2 • total distance bike 1 and 2 • compares current to average speed (arrow symbols) • calorie counter • thermometer • background light • countdown timer (up/down) • cadence • average cadence • maximum cadence • cadence bike 1 & 2 • cadence bike 1 or 2 • current altitude • maximum altitude • ascent of day's distance • gain of altitude bike 1 & bike 2 • total gain of altitude bike 1 & bike 2 • loss of altitude • current slope • maximum slope • average slope 97995 BIKE COMPUTERS 250 27 05800 XLC bike computer, white XLC REPLACEMENT FASTENING • incl. handlebar fastening, rubber pad, cable, sensor, magnet, cable tie 250 27 10000 250 27 10100 250 27 10200 250 27 10300 Page 190 9795 91595 93395 91595 for BV-C07, black for BV-W12, black for BV-W17/33, black for BV-W28, black www.xlc-parts.com Technical changes reserved. ware group BOTTOM BRACKET x-cellent bike components article number WPE 250 article designation XLC CHAIN GUIDE CR-A07 • adequate for chain rings with 32 - 38 sprockets • ISCG compatible, including adapter • ball bearing chain guide roller 250 28 15000 93995 bottom bracket fastening XLC CHAIN GUIDE CR-A08 • adequate for chain rings with 32 - 38 sprockets • ISCG compatible, including adapter • ball bearing chain guide roller 250 28 15100 93995 bottom bracket fastening XLC CHAIN GUIDE CR-A09 • adequate for chain rings with 32 - 44 sprockets • Material: aluminium 6061T6 • ball bearing chain guide roller 250 28 15300 91995 bottom bracket fastening XLC CHAIN GUARD RING 'BULLET PROOF' RR-K01 250 28 16000 93495 32 sprockets incl. bolt 250 28 16100 93495 38 sprockets incl. bolt 250 28 16200 93495 44 sprockets incl. bolt BOTTOM BRACKET • Material: polycarbonate • 13 mm thick • Ø 104 mm XLC CHAIN WHEEL DISC CG-K01 • suitable for a space between crank/chain ring of 6 - 16 mm 250 28 25000 9795 smoke-coloured, 42 - 44 sprockets 250 28 25100 9795 smoke-coloured, 46 - 48 sprockets Technical changes reserved. www.xlc-parts.com Page 191 ware group 250 article number BOTTOM BRACKET WPE x-cellent bike components article designation XLC CHAINGUARD CG-A01 especially made for freeride use, is to be mounted in replacement of the outer chain ring • aluminium, CNC-crafted • Weight: 107 g (38 sprockets) • hole circle diameter: 104 mm 250 28 17000 91995 black/silver, f. 38 sprockets 250 28 17100 250 28 17105 91995 91995 black/silver, f. 42 sprockets red/silver, f. 42 sprockets 250 28 17200 250 28 17205 91995 91995 black/silver, f. 44 sprockets red/silver, f. 44 sprockets XLC CHAIN RINGS CR-A01 • Material: aluminium 7075 CNC • for 4 hole chain wheel set 250 28 30000 93995 44 sprockets, LK 104 mm 250 28 30100 93995 32 sprockets, LK 104 mm 250 28 30200 91995 22 sprockets, LK 64 mm XLC CHAIN RING SCREWS CR-X01 BOTTOM BRACKET • actual colours • Material: aluminium 7075 • set of 5 250 28 40006 250 28 40007 250 28 40008 250 28 40009 Page 192 91995 91995 91995 91995 gold red green blue www.xlc-parts.com Technical changes reserved. ware group WATER BOTTLES & ACCESSORIES 250 x-cellent bike components article number WPE article designation XLC BICYCLE MIRROR MR-K01 • for the handlebar inner clamping Ø 19-22 mm • 3D adjustable • with short, straight post 70 mm 250 32 40000 9695 convex mirror glass, Ø 50 mm XLC BICYCLE MIRROR MR-K02 • for the handlebar inner clamping Ø 19-22 mm • 3D adjustable • with bendable post 80 mm 250 32 40100 9850 convex mirror glass, Ø 80 mm XLC WATER BOTTLES WB-K02 • 750 ml • wide opening for easy cleaning • incl. pull-out mouthpiece • incl. measuring scale in ml & oz 250 32 31000 250 32 31100 250 32 31200 9495 9495 9495 750ml, transparent/black/gray 750ml, transparent/blue/black 750ml, transparent/black/red XLC DRINKING BOTTLE CAGE BC-A01 • Material: aluminium, Ø 5 mm • Lateral cushions also reduce the noise of aluminium drinking bottles. 250 32 00000 9495 black matt 250 32 00200 9495 silver matt WATER BOTTLES XLC DRINKING BOTTLE CAGE BC-K05 • Material: plastic • Weight: about 28 g 250 32 06000 9795 black 250 32 06100 9795 white Technical changes reserved. www.xlc-parts.com Page 193 ware group 250 article number WATER BOTTLES & ACCESSORIES WPE x-cellent bike components article designation XLC WATER BOTTLE FASTENER BC-A09 • Material: aluminium 5052 • Weight: about 24 g 250 32 06500 9995 black 250 32 06600 9995 white XLC CUPHOLDER BC-A08 • suitable for almost all current saleable cups • Material: aluminium, bracket nirosta • with two holders (Ø 22,4 - 27 mm, Ø 28,6 - 31,8 mm) • Diameter: exterior Ø 78 mm, interior Ø 75 mm • Weight: about 80 g 250 32 05000 91195 black 250 32 05100 91195 red XLC DRINKING BOTTLE CAGE BC-A02 250 32 00500 250 32 00700 250 32 00703 250 32 00707 9495 9495 9595 9595 • Material: aluminium, Ø 6 mm • lateral cushions also reduce the noise of aluminium drinking bottles • Weight: about 69 g black matt silver matt white NEW! red NEW! XLC WATER BOTTLE FASTENER BC-A03 WATER BOTTLES • Material: aluminium, Ø 6 mm 250 32 01000 9495 black matt 250 32 01200 9495 silver matt XLC WATER BOTTLE FASTENER BC-A04 • Material: aluminium • Weight: 48 gr. 250 32 01500 9695 silver matt 250 32 01600 9695 black matt 250 32 01700 9895 carbon look Page 194 www.xlc-parts.com Technical changes reserved. ware group WATER BOTTLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC DRINKING BOTTLE CAGE 'SIDECAGE' BC-S01 • Material: aluminium • with opening on the side • Weight: 57 g 250 32 02000 9895 black XLC DRINKING BOTTLE CAGE BC-A06 • Material: aluminium • with flex-function • Weight: 43 g 250 32 00800 9795 black matt XLC DRINKING BOTTLE CAGE BC-K02 • Material: nylon 250 32 00900 9695 white/decor XLC DRINKING BOTTLE HOLDER 'KURSIV' BC-K04 • Material: plastic • Differently arranged mounting holes allow a flexible, laterally displaced fitting to the bike frame. Especially for ladies' bikes respectively frames with constricted access possibilities to the drinking bottle. 250 32 02900 9795 plastic, black WATER BOTTLES XLC DRINKING BOTTLE HOLDER 'GAN BEI' BC-K01 • Material: plastic • Weight: 35 g • ideal for aluminium bottles 250 32 01900 9495 Technical changes reserved. black www.xlc-parts.com Page 195 ware group 250 article number WATER BOTTLES & ACCESSORIES WPE x-cellent bike components article designation XLC WATER BOTTLE FASTENER CARBON BY ELITE BC-C01 • Material: carbon Ø 74 mm • Weight: 33 g 250 32 02200 94995 black XLC WATER BOTTLE FASTENER CARBON BC-C02 • Material: carbon • monocoque construction • Weight: 27g 250 32 02500 92995 black XLC WATER BOTTLE FASTENER CARBON BC-C03 • Material: carbon • monocoque construction • Weight: 30 g 250 32 02600 93795 black XLC WATER BOTTLE FASTENER ALU SIDECAGE DELUXE BC-S02 WATER BOTTLES • with lateral opening • Material: aluminium • Weight: 35 g 250 32 10000 9695 black 250 32 10001 9695 white XLC WATER BOTTLE FASTENER ALU GERMAN ‘KING KONG’ BC-A07 • Material: aluminium • adjustable, appropriate for most PET water bottles 250 32 02100 Page 196 9995 black/silver www.xlc-parts.com Technical changes reserved. ware group WATER BOTTLES & ACCESSORIES x-cellent bike components article number WPE 250 article designation XLC DRINKING BOTTLE HOLDER 'HODALAH' BC-A05 • Material: aluminium • Weight: 53 g 250 32 04000 9995 black/white 250 32 04100 9995 white/black 250 32 04200 9995 silver/black 250 32 04300 9995 red/black 250 32 04400 9995 blue/black XLC REPLACEMENT SCREWS 'COLOURED EDITION' BC-X02 • Material: aluminium 7075 • M5 x 17 mm • for water bottle holders • set of 2 250 32 15006 250 32 15007 250 32 15008 250 32 15009 9495 9495 9495 9495 gold red green blue XLC ADAPTER SET FOR DRINKING BOTTLE CAGE BC-X03 • mounting at the saddle body • ideal for mounting 2 adapters at one saddle 250 32 03000 250 32 03200 9595 9595 Length 68 mm Length 45 mm WATER BOTTLES XLC CLEANING SET FOR HYDRATION PACK BC-X01 • incl. 2 brushes • frame for drying 250 32 10500 91195 Technical changes reserved. XLC cleaning kit for backpack drinking tank www.xlc-parts.com Page 197 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC INNER BEARING/CRANK MOUNTING WRENCH TO-S01 • semi-professional usage 250 36 00000 91495 for Shim. Hollowtech II & Truvativ GXP XLC CRANK MOUNTING WRENCH TO-S02 • semi-professional usage 250 36 00200 91295 for square & Octalink & ISIS XLC CARTRIDGE INNER BEARING DISMANTLING TOOL TO-S03 • semi-professional usage 250 36 00400 91395 for SHIMANO cartridge inner bearing XLC INNER BEARING TOOL TO-S04 250 36 00600 91295 for ISIS drive, 8 flute XLC INNER BEARING TOOL TO-S05 • for 24 mm with across flats or 1/2" ratchet 250 36 00800 91295 for SHIMANO cartridge inner bearing & ISIS XLC INNER BEARING TOOL TO-S06 • to extrude inner bearings 250 36 00900 250 36 00950 93495 93495 Ø 30 mm Ø 24 mm NEW! XLC CRANK PULLER TO-S07 • for 8 mm allen screw or 15 mm width across flats 250 36 01000 9895 for square inner bearings TOOLS XLC INNER BEARING TOOL TO-S08 • for bearing fitting 250 36 01100 Page 198 93995 XLC inner bearing tool www.xlc-parts.com Technical changes reserved. ware group TOOLS & WORKSHOP NEEDS x-cellent bike components article number WPE 250 article designation XLC PIN WRENCH TO-S09 250 36 01200 9595 XLC pin wrench XLC ADJUSTABLE HOOK WRENCH TO-S10 • for lock rings with 2 mortices, adjustable in angle 250 36 01400 9595 XLC adjustable hook wrench XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S11 • semi-professional usage 250 36 01600 250 36 01800 91095 9995 with chain, for 9-fold sprocket wheel with chain, for sprocket wheel up to 8-fold XLC TOOL TO DISMANTLE CASSETTE TO-S12 • semi-professional usage • easy handling 250 36 02000 91295 for SHIMANO HG cassette XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S13 • for 24 and 19 mm width across flats and 1/2" ratchet 250 36 02200 9650 for SHIMANO HG cassette XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S14 250 36 02300 9650 for SHIMANO UG freewheel gear rim XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S15 • tool holder 24 mm 250 36 02400 9795 for SUNTOUR freewheel gear rim with 4 pins XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S16 250 36 02600 9595 Technical changes reserved. TOOLS • tool holder 23mm for SUNTOUR freewheel gear rim with 2 pins www.xlc-parts.com Page 199 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC TOOL TO DISMANTLE SPROCKET WHEEL TO-S17 • tool holder 21 mm and 1/2 " ratchet 250 36 02800 9795 for gear rim with free wheel SHIMANO HG XLC PEDAL WRENCH TO-S18 • semi-professional usage 250 36 03000 9895 15 mm XLC PEDAL / CRANK SCREW WRENCH TO-S19 • 15 mm width across flats and 14/15 mm 6-point wrench head 250 36 03200 9895 15 mm XLC CRANK SCREW WRENCH TO-S20 • 14 mm 6kt screw wrench head and 8 mm allen key, bottle opener 250 36 03300 9895 14 mm/8mm XLC PEDAL WRENCH CROMO TO-S21 250 36 03400 9995 15/24 mm 250 36 03800 250 36 03900 250 36 04000 250 36 04100 250 36 04200 250 36 04300 250 36 04400 9595 9595 9595 9595 9595 9595 9595 13 mm 14 mm 15 mm 16 mm 17 mm 18 mm 19 mm 250 36 04600 250 36 04800 250 36 05000 250 36 05200 9995 9995 9995 9995 30 mm 32 mm 36 mm 40 mm XLC CONE SPANNER TO-S22 TOOLS XLC HEADSET WRENCH TO-S23 Page 200 www.xlc-parts.com Technical changes reserved. ware group TOOLS & WORKSHOP NEEDS x-cellent bike components article number WPE 250 article designation XLC TOOL TO STAVE IN HEADSET TO-S24 250 36 05400 91495 1” and 1/8” XLC Y-WRENCH TO-M01 250 36 07600 9495 8/10/12 mm Bits XLC Y-WRENCH TO-M02 250 36 07800 9495 4/5/6 mm alles 250 36 08000 250 36 08200 250 36 08400 9695 9695 9695 allen 4 mm allen 5 mm allen 6 mm TO-S30 TO-S30 TO-S30 250 36 09000 9695 torx wrench T 25 TO-S75 XLC T-FORM ALLEN WRENCH/MULTI-TOOTH WRENCH TO-S30/TO-S75 XLC T-FORM ALLEN WRENCH SET TO-S32 250 36 09500 93495 2/2,5/3/4/5/6/8/10 mm XLC ALLEN KEY TO-S31 • workshop quality • two-way usable 250 36 09100 250 36 09200 250 36 09300 9795 9795 9895 6 mm, with one side 'ball-head' blade 8 mm, with one side 'ball-head' blade 10 mm, with one side 'ball-head' blade XLC ALLEN WRENCH SET TO-S33 250 36 09700 91195 Technical changes reserved. TOOLS • with ball head 2/2,5/3/4/5/6/8/10 mm www.xlc-parts.com Page 201 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC CABLE CUTTER TO-S36 250 36 12000 91995 cable cutter XLC PLIERS TO TIGHTEN CABLES TO-S38 • for one-hand operation 250 36 12200 92595 pliers to tighten cables XLC BRAKE TUBE-CUTTER TO-S37 • avoids pinching and fraying of the brake tubes, clean precise cutting and very sharp knife blade caution: not adequate for steelflex tubes or traditional transmission cables 250 36 12100 95995 for hydraulic brake tube XLC DISC BRAKE PISTON-ADJUSTING AID TO-S34 • simple remove of disc brake pads 250 36 11000 91095 XLC disc brake piston-adjusting aid XLC BRAKE DISC-ADJUSTING TOOL TO-S35 250 36 11100 91195 XLC brake disc-adjusting tool XLC UNIVERSAL BUNG WRENCH TO-UN01 TOOLS • appropriate for a lot of XLC inner bearings and sprocket wheel tools 250 36 12400 Page 202 92595 adjustable from 16 - 32 mm www.xlc-parts.com Technical changes reserved. ware group TOOLS & WORKSHOP NEEDS x-cellent bike components article number WPE 250 article designation XLC CHAIN CLAMPING RING TO-S29 • suitable for all current available snap closure chains • helpful to open and close 250 36 07500 9795 XLC chain clamping ring XLC RIVET REMOVAL TOOL TO-S25 250 36 07000 9595 for HG, UG XLC CHAIN RIVET REMOVER TO-S26 • suitable for 3/32" till 3/16" • incl. pin-guide and spare pin 250 36 07100 91995 for 410, 408, HG, UG, BMX XLC CHAIN RIVET REMOVER TO-S27 • with ratchet function, incl. 4 allen bits 250 36 07200 91995 250 36 07300 9995 for HG, UG, IG extra pins for TO-S25 TO-S26 TO-S27 TO-S28 (10 piece, ordering unit 1 set =10 piece) TO-X01 XLC CHAIN RIVET REMOVER TO-S28 250 36 07400 9995 for HG, UG 250 36 12600 96995 torque wrench TO-S40 adjustable from 6 - 30 Nm, 3/8" 250 36 12700 98595 torque wrench TO-S41 adjustable from 3 - 15 Nm, 1/4", incl. bit set Technical changes reserved. www.xlc-parts.com TOOLS XLC TORQUE WRENCH TO-S40/TO-S41 Page 203 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC BIT SET FOR TORQUE WRENCH TO-X02 250 36 12800 9995 3/8”, 4/5/6/8 mm and T 25 XLC RATCHET WRENCH SET TO-S60 250 36 16000 92495 ratchet wrench Set 3/8" XLC CLEANING SET TO-S55 • consisting of sprocket wheel scraper and cleaning brush 250 36 14000 9695 wheel scraper / cleaning brush XLC BRUSH SET TO-S56 • consisting of 3 different brushes 250 36 14200 91095 brush set, 3 different brushes XLC DERAILLEUR GEAR CLEANING SET TO-S57 91595 derailleur cleaner, brushes, wheel scraper TOOLS 250 36 14400 Page 204 www.xlc-parts.com Technical changes reserved. ware group TOOLS & WORKSHOP NEEDS x-cellent bike components article number WPE 250 article designation XLC SPOKE NIPPLE WRENCH TO-S.. 250 36 13000 9395 plate form (Map A) TO-S42 250 36 13200 9395 bail form (Map B) TO-S43 250 36 13300 9395 round, for Ø 3.2 mm nipples (Map C) TO-S44 A B C XLC TYRE REMOVER TO-S.. 250 36 14700 9295 glass fibre, nylon added, 3-part TO-S58 250 36 14800 9595 fiber glass with steel core, 3-part TO-S59 XLC SPOKES GAUGE TO-S68 • also adequate for the measurement of crank arms and ball bearings • Material: stainless steel 250 36 17700 9995 spokes gauge XLC CHAIN WEAROUT GAUGE TO-S69 250 36 17800 9895 chain wearout gauge XLC STEER TUBE CUTTER TO-S70 • 6-38 mm (1/4" - 1 1/2"), professional version • incl. replacement cutting wheel and deflashing tool 250 36 18000 93995 steer tube cutter XLC SAW CAPTURE TO-S71 • for 1" - 1 1/4" A-Head head tubes 250 36 18100 91995 saw capture XLC MAGNET BOWL TO-S63 91295 Technical changes reserved. 24 x14 cm TOOLS 250 36 17000 www.xlc-parts.com Page 205 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC MAGNET BAR TO-S64 • ideal for all metal tools 250 36 17300 91995 45 cm XLC PU-HAMMER TO-S65 • hollow plastic hammer, with kynetic mass 250 36 17400 91795 PU-Hammer XLC MEASURING TAPE TO-S67 250 36 17600 9395 measuring tape: 3 meter XLC POCKET KNIFE TO-M03 • stainless steel • bottle opener, screwdriver 250 36 11200 91295 XLC pocket-knife TO-M0 XLC WORKSHOP ‘APRON‘ TO-S72 • useful workshop apron, to be tied around the waist • 3 large, practical pockets 250 36 19000 92495 universal size, adjustable TOOLS XLC TOOL BOX 33 PARTS TO-S61 • Contents: 6x bits (2x torx 15/20 mm; 2x slot 5/7 mm; 2x cross 1/2 mm) 1x socket wrench coupling 3x socket wrench insets ¼“ allen wrench 8/9/10 mm 1x L-grip for socket wrench / 3x nylon tyre lever 1x 2 in 1 puller / 1x tool to rivet chains 8x allen key for angles with ball head 2/2.2/3/4/5/6/8/10 mm 1x pedal wrench / 1x pinion remover 1x double cone wrench 13/14/15/16 mm 1x bearing shell wrench / 1x open-end spanner 8x10 mm 1x spoke wrench / 1x inner bearing puller / 1x free wheel puller 1x repairing box 250 36 16200 Page 206 98995 tool box www.xlc-parts.com Technical changes reserved. ware group TOOLS & WORKSHOP NEEDS x-cellent bike components article number WPE 250 article designation XLC TOOLBOX 36-PIECES TO-S62 • Contents: 1x freewheel remover, 1x inner bearing remover 1x interior hexagon-wheel wrench 4/5/6 mm 1x interior hexagon-wheel wrench 2/2,5/3 mm 1x interior hexagon wrench 8 mm 1x chain rivet's remover, 1x chain cleaning device 1x cleaning brush, 1x pedal wrench 15/24 mm 1x cable cutter, 3x spoke wrench 3x tire lever, 1x crank remover 1x chain ring removers 1x stem wrench 30/32/36/40 mm 1x ring key 8/10 mm, 1x gear ring cleaner 1x gear ring remover with chain 1x crank assembly tool 1x crank installation tool 1x inner bearing wrench, 8x cone wrench 3x screwdriver (1&2 Phillips, 5 cross) 250 36 16300 912995 XLC tool box XLC MULTI TOOL TO-M04 • screwdriver cross, screwdriver slot , • hexagon opening 2/2,5/3/4/5/6/8 mm • tin opener • 8/9/10/12/13/14 mm box wrench • spoke wrench, tyre lever, rust-free blade 250 36 15000 91595 20-parts XLC MULTI TOOL TO-M05 • screwdriver cross, screwdriver slot • hexagon opening 2/2,5/3/4/5/6/8 mm • tin opener • 8/9/10 mm box wrench • spoke wrench, tyre lever, Torx T 25, chain rivet remover 250 36 15200 91795 19-parts XLC MULTI TOOL TO-M06 • 10 in 1 tools, extra light alu frame • screwdriver slot • screwdriver cross • hexagon opening 2/2,5/3/4/5/6/8 mm & torx T 25 91295 10-parts TOOLS 250 36 15500 Technical changes reserved. www.xlc-parts.com Page 207 ware group 250 article number TOOLS & WORKSHOP NEEDS WPE x-cellent bike components article designation XLC MULTI-TOOL TO-M07 • 15 in 1 tools, extra light alu frame • screwdriver slot • screwdriver cross • hexagon opening 2/2.5/3/4/5/6/8 mm • chain rivet remover • spoke wrench 250 36 15600 91895 15 parts XLC MULTI-TOOL 'NANO' TO-M08 • 9 functions • allen key 2/2,5/3/4/5/6/8 mm • screwdriver for recessed head screws/slotted grub screws 250 36 15700 91495 9 part XLC MOUNTING PASTE MP-P01 • mounting paste for high-quality carbon, aluminium and stainless steel components • the required tightening torque decreases by 30% • perfect corrosion protection • prevents twisting and loosening of single components 250 17 85000 9195 5g pouch XLC WORKSTAND TO-S73 • collabsible • height adjustment 912900 250 36 19505 9995 workstand XLC bracket rubber pads TO-X03 for workstand TO-S73 (2 pieces)NEW! TOOLS 250 36 19500 Page 208 www.xlc-parts.com Technical changes reserved. ware group CYCLETRAINER x-cellent bike components article number WPE 250 article designation XLC HOME TRAINER CT-R02 • fluid-home trainer, very silent, round tread • aluminium fluid roll, reduces the ambient noise by up to 50% • tyre protection • dynamic rolling resistance • maintenance-free and collapsible • extremely stable • 26" and 28" 320 41 01000 929800 home trainer Alpha CT-R02 white-blue 320 41 02000 9495 spare quick release device CT-X01 for XLC home trainer Alpha, Beta, Gamma 320 41 02300 9520 XLC fixing lever for axle CT-X04 for XLC home trainer Alpha, Beta, Gamma XLC HOME TRAINER CT-R03 • magnetic home trainer with 6 different resistance levels • the elastomere roll reduces the ambient noise up to 30% • protects the tyres • foldable • 26" and 28" 320 41 01200 916900 home trainer Beta CT-R03 black-white 320 41 02000 9495 spare quick release device CT-X01 for XLC home Trainer Alpha, Beta, Gamma 320 41 02100 91395 XLC derailleur cable inclusive holder CT-X02 for XLC homet trainer Beta, Gamma 320 41 02200 9995 XLC adjusting screw for magnetic unit CT-X03 for XLC home trainer Beta, Gamma 320 41 02300 9520 XLC fixing lever for axle CT-X04 for XLC home trainer Alpha, Beta, Gamma XLC HOME TRAINER CT-R04 • magnetic home trainer with 6 different resistance levels • foldable aluminium frame • 26" and 28" 915900 320 41 02000 9495 spare quick release device CT-X01 for XLC Home trainer Alpha, Beta, Gamma 320 41 02100 91395 XLC derailleur cable inclusive holder CT-X02 for XLC home trainer Beta, Gamma 320 41 02200 9995 XLC adjusting screw for magnetic unit CT-X03 for XLC home trainer Beta, Gamma 320 41 02300 9520 XLC fixing lever for axle CT-X04 for XLC home trainer Alpha, Beta, Gamma Technical changes reserved. home trainer Gamma CT-R04 lemon yellow-black www.xlc-parts.com Page 209 CYCLETRAINER 320 41 01400 XLC SPECIALS ware group 250 article number XLC SPECIALS WPE x-cellent bike components article designation XLC GUMMI BEAR • ice bear flavor • packaging unit: box with 250 piece 340 00 00000 9065 x-tra-fresh 10 g XLC CUP • frosted glass • packaging unit: cardboard box with 12 piece 340 00 25300 9695 white, 0,25 ltr XLC CARRIER BAG - NEW DESIGN • dimensions about 420 x 500 mm • XLC photo printing on both sides • printed with environmentally sound, water-based paints • pierced carrier handle with glued in reinforcement • bottom fold for larger packing capacity • without solvent- / dispersion glue • made of polyethylene film 100% recyclable • too good for single use, a genuine re-usable container! minium order quantity: 500 pieces The price of 8.41€ for 500 carrier bags includes disposal fees according to the packing ordinance. 340 00 25000 see price list 420/430 x 500 + 2 x40 incl. disposal fees XLC CABLE BOX FOR THE WORKSHOP AND SHOWROOM • for 7 cable boxes and 14 end caps vials • wit practical deposit surface • Measures: 420 x 340 x 500 • wall fastening possible • faster access to cables, outer shells and different end caps • remarkable, attractive design • Material: metal, blue coated • delivery without assembly 340 00 10200 see price list for setting up and hanging, blue XLC TUBE PRESENTER • for 11 x 5 tubes • as SB chute for hooking on the tego metal shelving • hanging space between axles: 1000mm • easy taking of the tubes by the end user • simple outfittingof the presenter • remarkable, attractive design • Material: blue coated metal • delivery without tubes 340 00 10100 Page 210 see price list for tego panel, blue www.xlc-parts.com Technical changes reserved. XLC AND MORE XLC AND MORE ware group 252 XLC AND MORE HEADERPARTS x-cellent bike components ...these are self-service suited brands of our suppliers, packed uniformly on our header cards, so that they fit perfectly in your shop in shop system. NYLON CAPE • tearproof foil 252 01 00070 252 01 00075 91295 91295 universal kids size universal adult size FOLDABLE COVERS FOR BIKES • strengthened PE foils 200 x 100 cm 252 01 05090 9795 foldable covers, blue, for MTB UNION DYNAMO • synthetic material, black, without cable and holder 252 02 00005 252 02 00010 9395 9395 fitting on the right side fitting on the left side BASTA DYNAMO ‘8201’ • aluminium, without cable and holder 252 02 05145 252 02 05150 9995 9995 fitting on the right side fitting on the left side BASTA DYNAMO ‘TRIO’ • synthetic material, black, without cable and holder, • with 4 plug-in connections 252 02 05164 252 02 05166 9795 9795 fitting on the right side fitting on the left side BASTA DYNAMO ‘QUATTRO’ • synthetic material, graphite, without cable and holder, • with 4 plug-in connections, quiet run due to Kevlar roller 252 02 05180 252 02 05182 Page 212 9995 9995 fitting on the right side fitting on the left side www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation DYNAMO AXA 252 02 11100 252 02 11110 92195 92195 installation on the right side installation on the left side FLOODLIGHT • halogen, synthetic 252 02 05317 9595 floodlight halogen FLOODLIGHT TREKK-LITE, HALOGEN • halogen 252 02 05321 9490 with reflector, with holder, 10 Lux FLOODLIGHT B&M LUMOTEC N2 • halogen, plastic 252 02 17911 91795 with holder FLOODLIGHT B&M • lumotec oval plus 252 02 17909 93395 lumotec oval floodlight 2 holder FLOODLIGHT B&M LUMOTEC N2 • halogen, plastic 252 02 17912 92695 with standing function and holder FLOODLIGHT UNION LED • with nirosta holder, incl. reflector • 35 Lux 252 02 05350 252 02 05351 252 02 05352 252 02 05353 91795 91850 91995 92295 Technical changes reserved. reflector, 35 Lux reflector, 35 Lux & shifter reflector, 35 Lux & shifter & parking light reflector, 35 Lux & shifter & parking light, senso www.xlc-parts.com Page 213 XLC AND MORE ware group XLC AND MORE ware group 250 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation HERRMANS LED FRONT HEADLIGHT H-DIVER • 20 Lux • with switch 252 02 51600 252 02 51610 92595 93295 20 Lux with German Road Traffic Act (StVZO) omologation, with switch 20 Lux with German Road Traffic Act (StVZO) omologation, with sidelight HERRMANS LED FRONT HEADLIGHT H-ONE S • 60 Lux • with switch • with sidelight • with daytime running lights 252 02 51700 94995 20 Lux with German Road Traffic Act (StVZO) omologation, with sidelight HERRMANS LUGGAGE RACK REAR LIGHT H-TACK • 3 LEDs 252 02 51500 252 02 51501 91595 91595 50 mm 80 mm FLOODLIGHT HOLDER 252 02 40160 9295 'Low Profile', black FLOODLIGHT HOLDER 252 02 40162 252 02 40164 9395 9295 'Low Profile', black 'Low Profile', black, 60°, fork mounting DYNAMO HOLDER 252 02 40205 9295 fork mounting RUBBER RACE FOR DYNAMO 252 02 42675 Page 214 9598 for AXA high power dynamo www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 250 article designation LIGHT CABLE 252 02 42280 9295 twin version for installation inside the frame SLIDE PROTECTION CAP 252 02 43080 9195 rubber REAR LIGHT B&M 252 02 51162 9398 mudguard mounting, without cable, nut, washer REAR LIGHT B&M 252 02 51170 9598 strut attachment, without cable B&M REAR LIGHT 'TOPLIGHT' • with light bulb 6V/0,6W; with rear light, for wide areas • without cable 252 02 51200 9595 80 mm bolt distance REAR LIGHT • with test mark, without cable and nut 252 02 51350 9350 mudguard mounting REAR LIGHT • with test mark, without cable and nut 252 02 51360 9465 strut attachment PARKING TAILLIGHT 'REDFIRE' 252 02 51365 91250 Technical changes reserved. for mudguard www.xlc-parts.com Page 215 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation PARKING TAILLIGHT PICCADILLY 252 02 51376 9995 for luggage rack, with sidelight and condenser PARKING TAILLIGHT RONDO PLUS 252 02 51378 9995 for luggage rack, with sidelight and condenser LUGGAGE RACK REAR LIGHT SELECTRA • with sidelight function, bulb and 2 LEDs 252 02 54200 91895 spacing of hole: 80 mm REFLECTOR • rectangular, wide angle 252 02 61110 9275 with bore (distance 50/80 mm) REFLECTOR 252 02 61300 9295 chainstays mounting REFLECTOR 252 02 61610 9325 seat post mounting REFLECTOR 252 02 61620 9395 fastening on the saddle frame REFLECTOR 252 02 61630 Page 216 9475 fastener: luggage rack www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation MINI REAR REFLECTOR • has the light values of a large-scale reflector 252 02 61640 9450 seat post mounting FRONT REFLECTOR 252 02 65160 9325 handlebar stem fastening FRONT REFLECTOR 252 02 65300 9275 fork mounting SIDE REFLECTOR • to clip into the spoke 252 02 70120 9325 set of 4 B&M SIDE REFLECTOR • with pivotable synthetic material mounting 252 02 70600 9475 set of 4 SET OF BULBS • for floodlights and rear lights • 6V / 2,4 W + 6V / 0,6 W 252 02 95110 9295 bulb set front/rear SET OF BULBS • for halogen headlights and rear lights • 6V / 2,4 W + 6V / 0,6 W 252 02 95112 9495 bulb set front/rear halogen POINT KIDS SAFETY BRAKE LEVER • grip distance adjustable, with anti-trap facility • for canti- and side-pull brake 252 03 21120 252 03 21122 9495 9495 Technical changes reserved. right left www.xlc-parts.com Page 217 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation CABLE GUIDE FOR V-BRAKE 90° 252 03 24010 9298 90° BRAKE INNER CABLE WITH 2 NIPPLES • pears and cross nipples 252 03 80630 252 03 80635 9250 9295 2000 mm 2000 mm, Niro UNIVERSAL BRAKE CABLE • with pears and cross nipples, with outer cable 252 03 80703 252 03 80710 9295 9295 FW 830/700 mm RW 1760/1600 mm UNIVERSAL CROSSLINK • for cantilever brakes 252 03 83200 9295 380 mm TIGHTENING STRAP • with plastics handle 252 06 62125 9795 520 mm, black TRIPLE TIGHTENING STRAP • consisting of 3 flat straps 252 06 62401 9350 600 mm, black, with two hooks TIGHTENING RUBBER WITH 2 HOOKS 252 06 65250 9295 1000 mm, various colours, with 2 hooks TRILL BELL 252 07 10300 Page 218 9295 55 mm, chromed www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation REICH CITY BELL • Material: aluminium 252 07 11000 9450 silver MINI BELL 252 07 11501 9250 black MINI BELL 252 07 11502 9250 silver MINI BELL • Material: aluminium 252 07 11510 9285 black and silver sorted MOUSEBELL 252 07 12000 252 07 12100 252 07 12200 9495 9495 9495 pink blue yellow REICH CHILDREN'S BELL 'PINGUS' • universal holder, suitable for children's bikes, scooters and trikes 252 07 15000 9485 motive bell, chromed BELL 'DECIBELL' 252 07 12121 9695 Technical changes reserved. black www.xlc-parts.com Page 219 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation CHILDREN'S BELL 'CRAZY ANIMALS' • various motives and colours 252 07 30140 9575 motive bell, various colours SECURITY BELL 'REICH' 252 07 30220 9550 alu black, 55 mm SAFETY BELL 'REICH' 252 07 30235 252 07 30240 9550 9550 cloverleaf brass chromed, 55 mm cloverleaf black, 55 mm CHILDRENS' BICYCLE BELL 252 07 12500 9495 ice bear CHILDRENS' BICYCLE BELL 252 07 12600 9495 pelican CHILDRENS' BICYCLE BELL 252 07 12700 9495 shark CHILDRENS' BICYCLE BELL 252 07 13000 Page 220 9695 cat www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation CHILDREN'S BELL 252 07 13100 9695 bear CHILDREN'S BELL 252 07 13200 9695 duck BULB HORN 252 07 50100 9425 straight form BULB HORN 252 07 50500 9695 post horn KIDS HORN 'TIGER' 252 07 50530 9395 handlebar mounting KIDS HORN 'CAMEL' 252 07 50532 9395 Technical changes reserved. handlebar mounting www.xlc-parts.com Page 221 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation KIDS HORN 'TURTLE' 252 07 50534 9395 handlebar mounting KIDS HORN 'SUMO' 252 07 50550 9395 handlebar mounting KIDS HORN 'COW' 252 07 50552 9395 handlebar mounting KIDS HORN 'PIG' 252 07 50554 9395 handlebar mounting KIDS HORN 'SEAL' 252 07 50556 9395 handlebar mounting KIDS HORN 'WHALE' 252 07 50558 Page 222 9395 handlebar mounting www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation KIDS HORN 'HIPPO' 252 07 50536 9395 handlebar mounting KIDS HORN 'RHINO' 252 07 50538 9395 handlebar mounting KIDS HORN 'SHEEP' 252 07 50540 9395 handlebar mounting KIDS HORN 'OCTOPUS' 252 07 50542 9395 handlebar mounting KIDS HORN 'CROCODILE' 252 07 50544 9395 handlebar mounting KIDS HORN 'GIRAFFE' 252 07 50546 9395 handlebar mounting KIDS HORN 'KOALA' 252 07 50548 9395 Technical changes reserved. handlebar mounting www.xlc-parts.com Page 223 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation CRAZY-STUFF BELL 'SHARK' 252 32 75000 9795 handlebar mounting CRAZY-STUFF BELL 'TIGER' 252 32 75100 9795 handlebar mounting CRAZY-STUFF BELL 'BUNNY' 252 32 75200 9795 handlebar mounting CRAZY-STUFF BELL 'BULL' 252 32 75300 9795 handlebar mounting CRAZY-STUFF BELL 'CAT' 252 32 75400 9795 handlebar mounting CRAZY-STUFF BELL 'SKULL' 252 32 75500 9795 handlebar mounting CRAZY-STUFF BELL 'CROCODIL' 252 32 75600 Page 224 9795 handlebar mounting www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation CRAZY-STUFF BELL 'EAGLE' 252 32 75700 9795 handlebar mounting CRAZY-STUFF BELL 'CHIPMUNK' 252 32 75800 9795 handlebar mounting CRAZY-STUFF BELL 'BLACK DRAGON' 252 32 75900 9795 handlebar mounting CRAZY-STUFF BELL 'TUCAN' 252 32 76000 9795 handlebar mounting CRAZY-STUFF BELL 'CHESIRE CAT' 252 32 76100 9795 handlebar mounting CRAZY-STUFF BELL 'CHINESE DRAGON' 252 32 76200 9795 handlebar mounting CRAZY-STUFF BELL 'PANTHER' 252 32 76300 9795 Technical changes reserved. handlebar mounting www.xlc-parts.com Page 225 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation CRAZY-STUFF BELL 'WHITE BUNNY' 252 32 76400 9795 handlebar mounting CRAZY-STUFF BELL 'LEOPARD' 252 32 76500 9795 handlebar mounting CRAZY-STUFF BELL 'ZEBRA' 252 32 76600 9795 handlebar mounting CRAZY-STUFF BELL 'WHITE SHARK' 252 32 76700 9795 handlebar mounting CRAZY-STUFF KIDS GLOVES • per pair 252 32 78000 252 32 78100 9895 9895 Boy Size XS/S 3 - 6 years Boy Size S/M 6 - 8 years 252 32 78300 252 32 78400 9895 9895 Girl Size XS/S 3 - 6 years Girl Size S/M 6 - 9 years CHAIN 1/2 X 1/8 252 10 10100 9395 112 links 252 10 10200 9650 112 links, rust-free Page 226 www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 250 article designation CHAIN 1/2 X 3/32" 252 10 10300 9550 116 links, 5/6/7-speed 252 10 10400 9825 116 links, 7/8-speed CHAIN 1/2 X 5/64" 252 10 10500 92195 116 links, 9-speed IMPORT FASTENING LINKS 252 10 50100 9275 1/2" x 1/8" COMPLETE SHIFT INNER CABLES • appropriate for Shimano 252 11 85005 9350 2200/1700 mm DERAILLEUR INNER CABLE • appropriate for Shimano 252 11 85070 9245 2200 mm 252 11 85075 9345 2200 mm, Niro BASIL REAR WHEEL BASKET 'CAIRO' • wire, wide meshed, bevelled, with holder • notch and hook for carrier 252 12 80320 9995 black CRAZY-STUFF CHILDREN BASKET 252 32 79100 9695 Technical changes reserved. white www.xlc-parts.com Page 227 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation DRAW BAR SACHS/SRAM 252 13 53420 9650 for hub gears (Sachs/Sram), 3-speed & 5-speed (2 cables) CLICK SHIFTER SACHS/SRAM 252 13 93210 91195 for 3-speed hub gear DERAILLEUR CABLE SACHS/SRAM 252 13 93270 9795 for hub gears, 3-speed & 5-speed (2 cables) HANDLEBAR STEEL, ALU LOOK • appropriate for city and trekking 252 15 30410 9795 silver, 590 mm HUMPERT STEEL HANDLEBAR 'CRUISER' • appropriate for bicycle tours, alu look 252 15 30540 9795 silver, 585 mm HERRMANS HANDLEBAR GRIPS PRIMERGO JET • Material: cork • ergonomic design • with screw clamping 252 15 80000 Page 228 91995 ergonomic design 140x60 mm www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation HERRMANS HANDLEBAR GRIPS 84B • Material: cork • ergonomic design 252 15 80100 9795 120 mm HERRMANS HANDLEBAR GRIPS PRIMERGO CORK • Material: cork • ergononic design 252 15 80200 91195 120 mm CAP NUT 252 16 20262 252 16 20264 252 16 20265 252 16 20270 9250 9250 9250 9250 FW, FG 7,9 mm, in pairs RW, FG 9,5 mm, in pairs FW, M 9 x 1, in pairs RW, M 10 x 1, in pairs HEX NUT • set of 3, for hub shifting • with cap nut, hex nut and guide nut 252 16 20272 9375 RW 10,5 mm for gear hub FLAT WASHER • ridged, flat 252 16 20390 9250 FW, 20 x 8,4 x 3 mm 252 16 20400 9250 RW, 20 x 10,5 x 3 mm PAIR OF CLEANING RINGS FOR HUBS • appropriate for all common hubs 252 16 20995 9250 in pairs, Perlon, colour orderd SEWING MACHINE OIL • for bicyles, sewing machines and household 252 17 10100 9220 Technical changes reserved. plastic bottle with spout, 100 ml www.xlc-parts.com Page 229 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation ATLANTIC CLEANER AND DEGREASER • Stubbornness is a foreign word for it. Removes soilings and also layer wear, oil or fat in brake and propulsion systems as well as in aluminium rims and glass. Absolutely residue-free. • spray can with snorkel! 252 17 20025 9795 150 ml spray can ATLANTIC CHAIN GREASE • high-class lubricant with molybdenum disulphide (MoS2) and adhesive supplements. 252 17 20040 9775 spray can with snorkel, 150 ml ATLANTIC BIKE GLOSS • cleaning and conserve all varnish- and metal components 252 17 20050 9795 aerosol can, 200 ml ATLANTIC LIGHTER FUEL • Optimal for adhesion and spot removal as well as the cleaning of parts due to the good cleaning effect. 252 17 20075 9495 tin pitcher, 125 ml ATLANTIC SILICONE SPRAY • Makes plastic surfaces smooth and elastic again. The silicone is water- and dirt-repellent, acts colour-refreshing and impregnates chains and Bowden cables. 252 17 20090 9795 spray can, 150 ml 4491 ATLANTIC CHAIN CLEANSER Allows the chain to catch powerfully. Cleanses the chain und removes wear promoting sediments all in one step. In order to apply a basic lubrication to the chain afterwards, we recommend ATLANTIC chain grease with PTFE and a final impregnation with ATLANTIC silicone. 252 17 20015 9550 200 ml PlasticBottle TERRA-S TYRE SEALING GEL • Protects permanently from flat tyres with punctured holes of up to 5 mm. Also for wheel chairs, wheel barrows, mopeds, trailers, etc. 252 17 26100 Page 230 9995 bottle, 250 ml www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation BRUNOX TURBO-SPRAY • for the complete maintenance and servicing of the bike and motor cycle 252 17 26788 9695 spray can, 100 ml BRUNOX SPRING FORK SPRAY • keeps seals smooth • excellent penetrating faculty • looses screws and seat posts with ease • removes adamant soilings (e.g. tar spots) 252 17 26795 9795 125 ml spray can Rock Shox Deo ATLANTIC BREAKDOWN SPRAY 252 17 35100 9495 bike (DV, SV), 50 ml 252 17 35110 9695 moped (AV), 75 ml INNOTECH HIGH TECH CHAIN FLUID 105 Cleans and lubricates in one step. The combination of different organic solvents on hydrocarbon base with active lubricating substances allows deep penetration into all the chain inner bearings, bottom brackets, chain drive bushings and taps, to dissolve and rinse there old deposits, resinified lubricants and dirt particles. After the slow evaporation of dissolving ingredients, there remains only the active lubricating substance, which forms a non-adhesive, dry to handle and stable lubricating film on the chain, particularly in the critical areas of the chain inner bearings. Result: The dry to handle, non-adhesive surface of the chain, without excess oil or fat, significantly less dirt is absorbed, thus drastically reducing the negative emery effect in the chain. A further positive effect is that there is no more lubricating ring around the small rear pinion. 252 17 50010 91260 200m ml spray can, self-service-plus TIP-TOP REPAIRING BOX 252 17 40000 9245 TT 01 bike 252 17 40500 9325 TT 02 bike 252 17 40600 9550 TT 05 MTB REMA TIP-TOP TUBELESS REP.-SET • for tubeless tires, also suited for the repair of bike tires Content: • 3 reparation patches 3 cm, fabric-reinforced • 1 tube special cement BL 4 g • sand paper 252 17 40145 9850 Technical changes reserved. TIP-TOP repairing box for tubeless tires www.xlc-parts.com Page 231 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation KIDS/YOUTH PEDAL • light synthetic material body and with reflectors for your safety 252 18 05200 9595 9/16”, black 252 18 05205 9295 1/2”, black XLC KIDS/YOUTH PEDAL • light synthetic material body with 3 reflectors, rubberised anti-slip surface 252 18 05220 9595 black/gray BMX/FREESTYLE PEDAL • 9/16“, polycarbonate, extremely sturdy • semi-transparent colours, Weight: 361 gr. 252 18 00000 252 18 00100 252 18 00200 252 18 00300 91095 91095 91095 91095 orange with reflector blue with reflector green with reflector red with reflector BMX/FREESTYLE PEDAL • 9/16“, polycarbonat, extremely sturdy • CroMo axle, transparent with red applications • Size: 112x102,4x32,5 mm, Weight: 412 gr 252 18 00500 91995 transparent/red with reflector map transparent/black UNIVERSAL PEDAL • synthetic material with reflectorr 252 18 05300 9375 black BOW PEDAL ‘RUBBER CLAW’ • synthetic material with reflector, rubberised anti-slip surface 252 18 05500 9595 black/gray UNION UNIVERSAL PEDAL • steel-/synthetic material with reflector 252 18 10200 Page 232 9595 black www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation UNION BOW PEDAL • steel-/plastic body with reflector 252 18 10300 9695 black PEDAL REFLECTORS • for all pedals with metal body to screw 252 18 19200 9395 set of 4 SKS DUO-HEAD PUMP VX 252 19 14050 252 19 14052 252 19 14054 252 19 14056 9625 9625 9625 9625 black, frame 42-47 cm, 345-395 mm black, frame 48-53 cm, 400-450 mm black, frame 54-58 cm, 455-505 mm black, frame 59-64 cm, 510-560 mm ADAPTER NIPPLES 252 19 40710 9295 from AV pump to DV and SV valve 252 19 49124 9495 from AV (pump) to DV & SV (valve) with rubber insert and chain EXTENSION NIPPLE • with check valve 252 19 40740 9375 from DV (pump) to AV (valve) PATENT VALVE SET • set of 2, with valves, rim nuts and union nuts 252 19 70155 9345 valve set with accessories CAR VALVE SET • 2 short valve core • 2 dust cap, metal 252 19 70156 9395 Technical changes reserved. AV short & dust cap, metal www.xlc-parts.com Page 233 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation PRESTA VALVE SET • 2 SV inserts • 2 dust caps 252 19 70157 9395 SV inserts & dust caps PATENT SEAT POST •alu, length: 350 mm 252 20 66254 91395 Ø 25,4 mm, silver KIND SHOCK SPRING SEAT POST KSP-520 • form: candle, length: 350 mm, spring deflexion: 40 mm steel springs, preload adjustable 252 20 69000 252 20 69002 91795 91795 silver, Ø 25,4 mm silver, Ø 27,2 mm KIND SHOCK SPRING SEAT POST KSP-525 • patent plunger, length: 350 mm, spring deflexion: 40 mm, steel springs 252 20 69005 252 20 69007 91995 91995 silver, Ø 25,4 mm silver, Ø 27,2 mm 252 20 69008 252 20 69009 91995 91995 black, Ø 25,4 mm black, Ø 27,2 mm CYCLE CLIPS • oval, nickel-plated, Width: 13 mm 252 24 18210 9350 per pair KNEE-BAND • hook and loop fastener, signal colour 252 24 18220 9595 per pair HEBIE MUDGUARD SET consisting of Viper & X-Lander • universal-fit front wheel splash for MTB Full Suspension, suitable for 24" - 29" • fastening either on the fork in the fork stem or by means of the proven brackets • incl. 2 x doule brackets • suitable for shaft diameters of 18,5 - 26,8 mm • exclusive splash guard for the rear wheel, suitable for frames with and without suspension • special cross design • robust quick-release device for all seat post diameters (up to 42 mm tubes) • assembled in seconds • height and angle can be adjusted to perfection steplessly by means of two stable joints 252 25 00000 Page 234 92795 black, 26/28" www.xlc-parts.com Technical changes reserved. XLC x-cellent bike components article number WPE AND MORE HEADERPARTS 252 article designation SIDESTAND • with locking button for adjustment of height without tools 252 26 00000 9795 24 - 28”, silver ALU CHAINSTAYS STAND with locking button for adjustment of height without tools 252 26 00200 91195 24 - 28”, black ALU BIPOD STAND with lock button for toolless height adjustment 252 26 00400 91995 24 - 28”, black ALU SIDESTAND 252 26 01020 9595 20 - 28”, black/silver ESGE SIDESTAND • 325 mm 252 26 01430 9995 silver CHAINSTAYS STAND angle and length adjustable mounting mechanism 252 26 04350 91295 20 - 28”, black PLASTIC FOOT FOR SIDESTAND 252 26 05050 9295 black CARRYING WHEELS 252 26 20040 91195 Technical changes reserved. 16" till 20" www.xlc-parts.com Page 235 XLC AND MORE ware group XLC AND MORE ware group 252 article number XLC WPE AND MORE HEADERPARTS x-cellent bike components article designation PUSHING AID FOR KIDS BIKES • mounting/dismantling without the use of tools 252 30 90000 91495 mounting at the seat post DRINKING BOTTLE ALU • coating on the inside 252 32 30905 9895 silver, 800 ml 252 32 30910 9850 silver, 550 ml WATER BOTTLE • plastics, 600 ml, with scale in ml/oz and dust cap 252 32 00000 9295 orange transparent 252 32 00100 9295 green transparent 252 32 00200 9295 gray transparent 252 32 00300 9295 pink transparent 252 32 00400 9295 yellow transparent 252 32 00500 9295 blue transparent MIRROR metal, round Ø 80 mm 252 32 10100 9445 chromed, with clip SAFETY PENNON POLE • consists of 3 parts, mounting at the axle 252 32 80600 9795 safety pennon pole NUTS WRENCH IN THE FORM OF A BONE 252 36 10145 Page 236 9295 with 10 holes, chromed www.xlc-parts.com Technical changes reserved. Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de Our Premium Brands ... ... find more at http://b2b.bike-parts.de generel terms and conditions (for Germany and Austria) Status: 01.03.2012 The following conditions are valid for all our offers, sales and deliveries. Differing conditions, especially customer’s purchase conditions are only valid if agreed upon beforehand and confirmed by us in writing. They are considered validated by the acceptance of ware or benefits. They apply to all future business dealings, even without further specifications. Therefore, under waiver of §§ 366, 367 of the BGB (=German Civil Code) and notwithstanding eventual diverging provisions of the customer’s, the vendor shall decide which acounts are settled by the customer’s payment. Should the customer be in arrears, the vendor is entitled to bill interests surpassing the base rate of the European Zentral Bank by 8 percentage points. The interests are due immediately. 1. act of sale This act of sale is binding for the customer as from the moment of the acquisition. It is binding for the vendor too, unless called off by her within 10 days from issuance. If the customer does not fulfil his obligations, especially if he does not honour a cheque or a draft, if he suspends payment or if the vendor comes to know of circumstances which call into question the customer’s credit worthiness, the vendor is entitled to call in the entire rest debt, even if she has accepted drafts or cheques. In this case the vendor is furthermore entitled to demand advance payment or securities on all other contracts concluded and - after an appropriate respite - to withdraw from these contracts or to demand compensation for failure of performance. The customer is only entitled to compensation if his counter-claim is indisputable or if it has been established as final and absolute. The vendor’s offers are always subject to change without notice. An act of sale is only concluded by virtue of written acknowledgement of the order of delivery. All collateral agreements or changes need the vendor’s written confirmation for validation. 2. consignment The vendor is freed from the obligation to deliver if this is unduly hampered or rendered impossible by force majeure, official directives, interference with operations and/or transit, lack of raw materials or any other circumstances. Should the vendor come to know circumstances accounting for doubts as to the customer’s credit worthiness during the execution of an order, this also exempts her from the obligation to deliver. In such a case she is only under consignment obligation if the customer has made advance payment or produced sufficient securities. Even if the consignment should be delayed for the aforementioned reasons, the customer is still under obligation to accept the consignment. The appointed term of delivery starts when all technical details and further enquiries have been clarified with the manufacturer. The appointed term of delivery is only to be considered a firm deal in the sense of the BGB (=German Civil Code) if a corresponding arrangement has been explicitly made. The appointed term of delivery does not count in case of delays for reasons outside the responsibility of the vendor. Such reasons could be for instance force majeure, strikes, operational disruptions and so on, namely in the factory as well. The customer is only entitled to rescission of the contract because of non-compliance with the term of consignment if he concedes the vendor in writing an acceptable extension of time. An extension of time of at least 8 weeks as from the date of dispachting of the written information on the time extension is considered to be acceptable. The customer is bound to accept the consignment within 4 weeks after the appointed date. In case of call orders the ordered items have to be taken over within 3 mounths as from the appointed call date. 3. transport If not otherwise appointed the transport will be done at the customer’s expense and peril, even if the transportation is done by the vendor’s own vehicles. The prices for exercise bikes, trailers, commercial wheels are factory or from head office. 6. secret lien Until fulfilment of all present or future claims (including account balance) the vendor is entitled to, she is warranted the following securities, insofar as their value lastingly surpasses the value of the claim by more than 20%, which she is to set free upon request and according to the customer’s choice. All consignments are made under reservation of proprietary rights. The customer obtains the ownership when he has fulfilled all his current and future obligations resulting from his business connection with the vendor. This also applies to the case when certain consignments have been paid for. In case of unpaid invoices, the reservation of propriety rights serves as security for the vendor’s balance claim. If payments be made by cheques or drafts the respective bills are acquitted when the cheques/drafts have been honoured. Should the financing have been appointed in cheque/draft system, the ownership is only transferred with the final honouring of the refinancing draft according to § 950 of the BGB (=German Civil Code), without obligation. The processed ware serves the vendor as security for the amount of the bill for the processed ware. In case of the customer’s processing or combination of the vendor’s ware with other ware, not pertaining to the vendor we gain partial ownership of the new ware proportionally to the worth of the ware still in our property. The same as for the ware still in our ownership applies to the newly originated ware. In case of alienation of the ware still in our property, the customer cedes beforehand his claims to the vendor. This relinquishment also applies if the ware has been processed by the customer or if it has been sold to several employees. The relinquishment of the claim serves the vendor as security for the amount of the bill of the alienated ware. In case the vendor’s ware, processed or not, was sold together with other ware, not belonging to her, the relinquishment only applies to the vendor’s ware according to the latter’s bill. The customer is entitled to use and/or sell the ware in due form in his business dealings whilst he is not in payment arrears. Seizing or chattel mortgage are prohibited. The vendor authorises the customer revocably to collect the payments for the claims he relinquished to her in his own name. We reserve the right to bill an “extra charge for small quantities” of 3 € orders with a value below 25 €. Inside the Federal Republic of Germany we bill a flat charge of 6.95 € a the customer’s part in transport costs. For Austria we bill a customer’s part in transport costs of 7.95 €. All other countries according to our general dealer agreement. We reserve the right to change freight costs. Consignment to unknown clients only COD (=cash on delivery). The risk is transferred to customer as soon as the shipment has been given into the care of the person in charge of the transport or as soon as the consignment has left the vendor’s factory for transport. In case the delivery is delayed upon the customer’s wish, the risk is transferred to the latter as soon as the ware is ready for consignment. The vendor is entitled, but not obliged to ensure consignment in the nameof the customer and at the latter’s expense. 4. warranty and liability Defects liability is of 12 months, unless direct sale to a final consumer, under the assumption that the defect already existed at the time of the risk transfer. The customer is to admonish the defect without delay. The vendor has to be notified of defects in writing. Obvious defects have to be notified to the vendor in writing immediately, but within one week at latest. The faulty items are to be maintained in the state in which the defect was detected and kept in readiness so that the vendor can view them anytime. Every transgression of the aforementioned prescriptions rules out claims on the vendor’s liability. Furthermore the customer is to examine the consignment upon arrival for transport damages and inform the vendor without delay of any damages or losses, either through the tansporter or by means of an affidavit signed by the customer and two witnesses. In case of justified claims, the vendor is obliged to provide a cure according to her choice. If she does not fulfil the obligation within an appropriate term or if amendment fails repeatedly, the customer is entitled to reduce the purchase price or recede from the contract. Further claims, particularly concerning expenditures, compensation or indemnity on grounds of defects or consequential damages are only viable within the framework of the rules and regulations on liability limitation. Replaced parts are to be returned freight collect to the vendor upon the latter’s wish. When assembling parts or components, the skill, accuracy and technical knowledge of an engineer is taken for granted. Unauthorised reconditioning and improper handling result in loss of reconditioning work - upon previous information of the vendor - in order to avoid disproportional damage of if the vendor delays the amendment to claim refund of acceptable expense therefore. Wear and deterioration within normal limits do not constitute a reason for warranty claims. Recourse actions as per §§ 478, 479 of the BGB (=German Civil Code) are only justifiable if the customer’s demand is justified and only within legal limits; they do not extend to ex-gratia regulations agreed upon with the vendor and presuppose the observation of the own obligations by the recourse beneficiary, especially of the requirement to make a complaint in respect of a defect immediately upon receipt of the goods. Demands of damage compensation agaist the vendor, regardless of their nature, are excluded unless the damage was caused on purpose or by gross negligence. The information in the prefix of this catalogue are completive to these conditions. 5. prices and payment terms All prices are net prices, without the legal VAT, particular for each country, which the customer has to pay additionally. In case the lapse of time between the conclusion of the contract and appointed or real date of consignment surpasses 6 months, the prices at the date of delivery or readiness for delivery are effective. Acquisition and technical staffs are not authorised to cash collection. Payments shall only have discharging effect if made either directly to the vendor, to a bank account or a postal cheque account indicated by the latter. The vendor’s bills are payable either within 10 days of the issuing date less 2% discount or within 30 days of the issuing date without discount. Amounts up to 25€ are not subject to discounts. The vendor explicitly reserves the right to refuse cheques or drafts, when they are accepted; then only on account of payment. Discount and note charges are at the customer’s expense and are due immediately. In case of securitised assets, especially if they serve to secure further credit, the collection authorisation is only valid upon prior written agreement. The customer is though to disclose the cession to the vendor upon the latter’s request and make all necessary information and documents available to her. The customer is to insure the ware adequately at his expense against fire and water and relinquishes in case of liability his claim to the vendor. The cession is accepted. In case of access of third parties to the ware still in the vendor’s ownership, especially in case of seizure, the customer is bound to point out the vendor’s ownership of the same and inform the vendor immediately, enclosing the necessary papers for caveat, so that she can assert her ownership rights. The customer shall bear the expenses and damages. In case of suspension of payment or bankruptcy proceedings, legal or extrajudicial settlement proceedings, bill or cheque protests, as well as any other customer’s attitude contrary to contract and especially in case of payment arrears the right of sales, use or installation of the goods subject to retention of title ceases, as well as the authorisation to collect owing claims. In this case the vendor is entitled to take back the goods subject to retention of title at the customer’s expense and if applicable to demand the relinquishment of claims against third parties. The taking back or seizure of the goods subject to retention of title – if the law on instalment payments does not apply - do not necessarily imply rescission of the contract, unless this be explicitly stated. 7. taking back of ware In case the vendor is obliged to take back the ware for reasons incumbent the customer’s responsibility, the latter must refund the vendor all expenses and pay her furthermore an adequate compensation for impairment of value by use and for loss of profit. The customer agrees that the vendor balance the height of this claim against the already paid instalments on the purchase price. 8. data storage The vendor is entitled to use and store the customer’s personal data. 9. place of fulfilment, court of jurisdiction and partly ineffectiveness The place of fulfilment is Schweinfurt. In case the customer is a merchant, a legal person under public law or separate assets under public law, the agreed jurisdiction for contentious matters regarding the contracts, as well as for the therefrom resulting privity, is the Local Court or the Regional Court, according to the vendor’s choice. The same applies if at the time of the commencement of the suit the place of residence of the customer is unknown. In all other cases, the Local Court of Schweinfurt is the competent jurisdiction for the enforcement proceedings (§ 688 et seqq ZPO (=Code of Civil Procedure). Should individual provisions of these General Terms and Conditions prove to be ineffective, the remaining conditions continue to remain effective and binding. The ineffective provision is to be replaced by an effective one, which approaches as much as possible the economic aim pursued. Sennfeld, the 1st of March 2012 E. Wiener Bike Parts GmbH FAX ORDER FOR CONSIGNMENT WITHIN 24 HOURS Please select your corresponding number ! head office Schweinfurt Info & Order - Team Fax: 09721/6501-60 or -97 Master copy Please use at a fax order form to us, a copy of this fax form. Company stamp/Consigner sales office Hannover Mr U. Stephan Fax: 05137/908352 Cust.-No.: Date: Time: Pages: Attention second fax ! item 01 02 03 04 05 06 07 08 09 10 11 12 13 14 15 16 17 18 19 20 21 article please tick this box in case of sending the fax again article number quantity price Return consignment Company stamp/Consigner Return consignments only accompanied by this form ! *For the reasons mentioned below, I herewith return you, carriage paid: item piece article number related with invoice number ge an ch it ex red c Date Cust.-No. date 1. 2. 3. 4. 5. 6. 7. 8. Reason for the return consignment: Item 1. 2. 3. 4. 5. 6. 7. 8. * In case the return consignment is caused by an error of performance on our side, we shall credit you the forwarding expenses when processing this instance. Dear customer, we request your kind understanding for the fact that we can only process return consignments when accompanied by this form and by complete information. We can only work upon the error analysis, thus avoiding future return consignments, if you indicate the reason for the return of each article – this being in your best interests too. Thank you for your kind cooperation. Please contact our new service hotline (09721/6501-3530) for any questions which might arise. Your E. Wiener Bike Parts Team of Schweinfurt Master copy Please use for every return consignment a copy of this return form. We request ... The E. Wiener Bike Parts Logistic Centre With the help of most modern logistics, a semi-automatic storage system and a fully automatic consignment station, we are in a position to provide a still more reliable consignment service. 24 hours Service It is a pleasant feeling to be able to tell your customers that they may pick up their order the next day. The condition therefore is that the order, bearing the article numbers, is to reach us before 3 p.m. For the transport we trust our chosen specialists: Bike Parts – All Over Europe. With UPS. 7KDQNVWRRXUQHZ%LNH3DUWV/RJLVWLFV&HQWUHZHDUHQRZLQDSRVLWLRQWRFRPPLVVLRQDQGVHQG\RXURUGHUV from our Schweinfurt site faster and more efficiently than ever. In order to make sure that this flow is not inter rupted we work together with UPS in Germany, as well as all over Europe. ,QLWVTXDOLW\DVDZRUOGZLGHDFWLQJFRPSDQ\836GLVSRVHVRIFURVVERUGHUORJLVWLFVWUXFWXUHVDQGH[WHQVLYH experience with customers. :LWKWKHKHOSRIWKH836WUDFNLQJWRROV\RXFDQHDVLO\WUDFN\RXUFRQVLJQPHQWRQVFUHHQWKXVPDLQWDLQLQJ all the time the control upon incoming and outgoing of the consignments. 'LG\RXDOUHDG\GLVFRYHUWKH836:LGJHW"<RXUGLOLJHQW836PDVFRWZLOOVKRZ\RXKRZWRVLPSOLI\\RXU operational procedures in the future – meet the helpful assistant under www.ups.com/widget. Further logistic partners Schweinfurt Head Office Office address: Postal address: Phone: Fax: eMail: Homepage: Max-Planck-Str. 8, 97526 Sennfeld Postfach 15 61, 97405 Schweinfurt +49 (0) 97 21 / 65 01 - 0 +49 (0) 97 21 / 65 01 - 60 [email protected] www.bike-parts.de Hannover Sales Office North Office address: Phone: Fax: eMail: Fritz-Grimpe-Str. 33, 30823 Garbsen +49 (0) 51 37 / 90 76 69 +49 (0) 51 37 / 90 83 52 [email protected] France Winora France / Dijon Hungary VELODREAM KFT. Központi út - Lakatos út sarok 1211 Budapest Csepel [email protected] www.velodream.hu Spain Winora Spain / Barcelona Office address: Camino Antic de Valencia 38 Local 17, 08860 Castelldefels Phone: +34 (0) 93 / 664 24 92 Fax: +34 (0) 93 / 664 24 92 eMail: [email protected] Phone: eMail: Benelux Dick van Loon +31 (0) 61 / 2 53 15 47 [email protected] Phone: eMail: Bert Hiemstra +31 (0) 62 / 3 73 25 76 [email protected] Phone: eMail: Will Haagmans +31 (0) 65 / 1 35 39 21 [email protected] Phone: eMail: Italy Mauro Carminati +39 0 35 / 93 63 61 [email protected] Phone: eMail: Poland Arkadiusz Jenek +48 (0) 8 83 / 94 66 72 [email protected] Phone: eMail: Marcin Nowak +48 (0) 6 01 / 33 93 98 [email protected] Phone: eMail: Switzerland Reto Romano +41 (0) 798 / 633 603 [email protected] Phone: eMail: Czech Republic/Slovak Republic Stanislav Stepanek +42 (0) 777 / 65 19 72 [email protected] Phone: eMail: Denmark Mads Egebjerg +45 (0) 20 / 23 77 01 [email protected] Bike Parts International Bike Parts Departments in Europe Office address: 21, Rue René Coty F-21000 Dijon Phone: N° Vert: 0 800 64 65 66 Fax: +33 (0) 3 50 52 81 22 eMail: [email protected] Greece Molho Group Industrial Zone Nea Santa 61100 Kilkis [email protected] www.Molho.com Slovenia Vizija Sport d.o.o. Trzaska cesta 87b 1370 Logatec [email protected] www.cult.si Romania SC MOS ION Roata SRL Comana No 4 11274 Bucharest [email protected] www.mosionrota.ro United Kingdom Greyville 20-21 Europa Way, Britannia Enterprise Park WS149TZ Lichfield, Staffordshire [email protected] www.greyville.com Croatia Huni-bike-shop d.o.o. Matije Gupca 92 40323 Prelog [email protected] www.huni-bike-shop.hr Cyprus TASOS ALETRAS LTD 266 Tseriou Ave Strovolos 2044 Nicosia [email protected] www.aletras-megabike.com White Russia Bike Sport Novatorskaja 2A 220053 Minsk [email protected] www.s-medved.com Lithuania UAB "VASARE" Turgaus a. 25 91246 Klaipeda [email protected] www.vasare.lt Ukraine Aleksandr Golovko Horevaya 22/28, off. 20 04071 Kyiv [email protected] Bulgaria Malvex Group D-r Lyuben Rousev 6 Str. 1000 Sofia [email protected] www.velocity.bg International All other countries Please contact us under: [email protected] Mitglied der Accell Gruppe My client number: