View in Full Screen Mode
Transcription
View in Full Screen Mode
LOCAL NEWS: ‘On the Press’ with Harlan Beagley, Page 4 Mostly sunny PUNXSY DOWNS DUTCHMEN High of 58˚ The Chucks beat the he Dutch 13-3 in five y. innings Wednesday. SEE PAGE 5 Thursday April 14, 2016 SMA SPLITS S WITH PUNXSY XS SY Penguins win The St. Marys Area track and field teams split with Punxsy Wednesday. SEE PAGE 5 St. Marys, Pennsylvania 50¢ Vol. 106 Mercer misappropriation case overseen by Martin By Richie Lecker Staff Writer JOHNSONBURG – On Wednesday, Magisterial District Judge James L. Martin oversaw the commencement of a preliminary hearing for William D. Mercer Jr., 50, and Kristin Lynn Mercer, 31, who are facing a combined 326 felonies in district court connected to the alleged misappropriation of $496,823.38 from MCM Trucking, LLC. William, a part-owner of MCM Trucking, LLC., and Kristen are accused of forging checks and making unauthorized transactions on behalf of MCM Trucking for personal gain and to financially support a second business that William owns, Mercer Auto & Tire. Although the preliminary hearing for William and Kristin was scheduled for Wednesday, all witnesses were not able to be called prior to adjournment; an additional time will be scheduled to allow for both sides to finish presenting evidence before closing arguments See Case, Page 8 6 SEATS AVAILABLE Myrtle Beach Tour June 5-9 th $695 Each - All Inclusive Includes: Myrtle Beach, Carolina Opry, Alabama Theater, Georgetown, Plus! Local Pickups Call Now Georgeanne 965-3056 House Washing & Roof Cleaning • • • • • • • Gutter Brightening Concrete Brick Pavers Retainng Walls Decks Rust Removal Decks/Log Home Restorations And Much More! Fully Insured & FREE Estimates PA Power Washing Call or Text 814-594-5756 PA# 092857 www.papws.com The Pittsburgh Penguins beat the N.Y. Rangers 5-2 in their playoff opener. SEE PAGE 6 smdailypress.com No. 55 Diocese of Erie announces restructuring plan ERIE – The Diocese of Erie released its preliminary plan for restructuring parishes in the Eastern Vicariate, which includes Cameron, Clearfield, Elk, Jefferson, McKean, and Potter counties on Wednesday afternoon. While some mergers are taking place throughout the six-county area, the three local parishes in the City of St. Marys – Sacred Heart, St. Mary’s, and Queen of the World – will not be impacted and will remain standalone parishes. The Diocese defines a standalone parish as being “a traditional parish with its own pastor, parish church, finances, and finance council, parish council staff, and office.” Also remaining standalone parishes are St. Bernard Parish in Falls Creek, St. Francis in Clearfield, St. Joseph in Force, St. Leo Magnus in Ridgway, and St. Tobias in Brockway. In addition to standalone parishes, secondary churches are also being created as part of the plan. The Diocese of Erie describes a secondary church as being “any church belonging to a parish, other than the parish church itself. When two or more parishes are merged together, each of which had its own church, the new parish will find itself the owner of multiple churches. One must be designated as the parish church, and the others called secondary churches.” The Diocese further explained in the release that “by law, the Eucharist must be re- served in every parish church, and for that reason, every parish church must be open to the faithful for at least some hours every day. There is no obligation to reserve the Eucharist in secondary churches, and without the Blessed Sacrament in the tabernacle, there is no obligation that the secondary church be opened every day. Secondary churches would not have regular Sunday See Diocese, Page 8 St. Marys man steals coworker’s debit card By Richie Lecker Staff Writer Bids for work on the high school’s exterior walls were also approved. A low bid from Allegheny Restoration of Greensburg for sandblasting exterior walls in the amount of $21,210 was approved along with the lowest bid from C & C Concrete and Masonry of St. A St. Marys man is currently incarcerated in the Elk County Prison after allegedly stealing a coworker’s debit card and attempting to make approximately $2,500 in purchases at the Fox Township Walmart. Patrolman Drew L. Lehman of the City of St. Marys Police Department prepared an affidavit of probable cause against Devin James Valentine, 22, of 129 Wehler Rd., St. Marys. According to Lehman, he interviewed an individual, identified as “MM” in the affidavit, about a stolen debit card on Thursday. “MM” reportedly first discovered that her card was missing after she attempted to use the card after work and couldn’t find it; after visiting her bank, she discovered that someone attempted to use the card eight times at the Fox Township Walmart. The victim reported to Lehman that she believed the debit card was stolen from her purse while she was at work at Elcam. According to Lehman, the victim reported that Valentine was the only person she would suspect of taking the card, adding that he had left work several times throughout the day and was the only person she knew had left Elcam during the day. Lehman reports in the affidavit that he traveled to Walmart on Friday and was able to obtain receipts and video surveillance that implicated Valentine. Four transactions were approved, while four were attempted but not approved. Additionally, three of the transactions required a signature, which show the name of the victim on the receipts, according to Lehman. See Board, Page 3 See Card, Page 3 Photo by Amy Cherry SMAHS HOSA state champions Leah Gabler, Michelle Bauer, Rachael Bauer, and teammates Mara Thompson and Alyssa Pontious are shown with advisor Steve Bauer in the background. HOSA students advance to nationals By Amy Cherry Staff Writer Five St. Marys Area High School students were recognized for their state titles brought home during the recent Health Occupation Students of America (HOSA) competition. Michelle Bauer, Rachel Bauer, Leah Gabler, Alyssa Pontious, and Mara Thompson each placed first in the state in the respective categories advancing to the organization’s National Leadership Conference taking place in Nashville from June 22-25. Steve Bauer, HOSA advisor, introduced each of the five state champions to the St. Marys Area School District board of directors. Superintendent Brian Toth presented each student with a medal of excellence. A total of 26 SMAHS stu- dents competed at states with 14 of them bringing home a first, second or third place finish. Their fellow competitors were from high schools, vocational technical schools, and trade schools. Bauer acknowledged the school’s athletic trainer, Ashley Mulcahy, as she provided edu- See HOSA, Page 3 School board approves projects, other items By Amy Cherry Staff Writer The St. Marys Area School District Board of Directors recently approved a motion to temporarily finance 2015-16 expenses with capital reserve funds for 2016-17 bond projects dealing with heating, ventilation, air conditioning (HVAC) and exterior wall work. As part of this decision, the board accepted the low bid from North Central Mechanical of St. Marys for HVAC mechanical and installation at Fox Township Elementary for $583,000. They also approved the low bid from Hallstrom Clark Electric of DuBois for HVAC electrical installation, also at Fox Township, in the amount of $109,443. Punxsutawney PSP, Burkett address drug culture after 17 arrested By Larry McGuire Punxsutawney Spirit PUNXSUTAWNEY — At a press conference announcing the issuance of 17 arrest warrants related to an area sweep on Wednesday, Punxsutawneybased Pennsylvania State Police and Jefferson County District Attorney Jeff Burkett spoke about the local drug culture and the effect the most recent arrests could have. Captain Bernard J. Petrovsky, commanding officer of Pennsylvania State Police, Troop C, Punxsutawney, along with Burkett, opened the press conference by announcing the issuance of 17 drug-related arrest warrants for offenders from Jefferson County and the surrounding area. According to police, the arrest warrants are the result of an investigation by Troop C Vice Unit members dating back to 2014. According to a news release, “the investigation’s focus was comprised of several items of con- traband that included heroin, cocaine, methamphetamine, marijuana and misused prescription medications.” Those arrested are all charged with possession with intent to deliver a controlled substance (felony), along with additional related offenses. Magisterial District Judge Douglas Chambers also provided bail information for those individuals who were within his jurisdiction: Eric Kerestesy, 34, Punxsutawney, heroin. Kerestesy was committed to Jefferson County Jail in lieu of posting bail in the amount of $250,000. Mary Lou Smith, 48, Rossiter, cocaine. Smith was committed to Jefferson County Jail in lieu of posting bail in the amount of $200,000. Adam Lowmaster, 32, Punxsutawney, methamphetamine. Lowmaster was committed to Jefferson County Jail in lieu of posting bail in the amount of $150,000. Stephen Bouch, 24, Punx- sutawney, heroin. David Walker, 32, Pittsburgh, cocaine. Ashley Vega, 28, Falls Creek, heroin. Vega is currently housed in Jefferson County Jail and is yet to be arraigned by Chambers. Kayla Gianvito, 31, White Oak, heroin. Gianvito was released upon posting bail in the amount of $50,000. Bobbie Jo Wright, 40, Rossiter, Subutex (pills). See Culture, Page 2 2 The Daily Press Thursday, April 14, 2016 MATTRESSES ON SALE Selling? Serta iseries and icomfort Floor Model Sale Buy A Queen size Serta iseries or icomfort and Recieve the Box Spring FREE A Savings of $225. Limited Quantities. ͻ>ĞĂŚtŚŝƚĞŵĂŶ Owner - Broker 125 Arch St., St. Marys • 781-1715 • www.arthearyandsonsfurniture.com FRIDAY 58° 66° 36° Mostly sunny and beautiful Mild with plenty of sunshine Regional Weather Today Statistics for Tuesday Temperature Erie 53/38 High ................................................ 48° Low ................................................ 29° Normal high ................................... 56° Normal low .................................... 35° Record high ....................... 81° in 2001 Record low ........................ 18° in 1967 Jamestown 55/34 Tuesday ....................................... 0.03" Month to date .............................. 2.24" Year to date ................................. 8.99" Normal year to date ................... 10.29" Meadville 58/36 Cleveland 56/40 Ridgway 58/35 Oil City 60/35 Sun and Moon Sunrise today ....................... 6:36 a.m. Sunset tonight ...................... 7:54 p.m. Moonrise today .................. 12:56 p.m. Moonset today ..................... 2:33 a.m. Youngstown 62/39 New St. Marys 58/29 City Albuquerque Asheville Atlanta Atlantic CIty Baltimore Billings Birmingham Boise Boston Burlington, VT Charleston, SC Charlotte Chicago Cincinnati Dallas Denver Des Moines Helena Honolulu Houston Indianapolis Jacksonville Kansas City Las Vegas Los Angeles Hi 76 61 61 53 62 62 65 55 48 50 65 66 58 67 76 75 71 53 84 78 65 70 72 78 73 Lo 51 41 48 41 37 40 51 38 38 29 51 44 39 46 55 46 47 35 72 56 42 59 50 57 54 Fri. W s pc c s s sh sh c s s c pc s s pc pc s sh sh pc pc t s pc pc Apr 29 May 6 May 13 Indiana 61/38 Pittsburgh 63/41 Billings 62/40 Shown is today’s weather. Temperatures are today’s highs and tonight’s lows. Lo 33 34 38 37 40 30 29 31 41 46 40 43 W s s s s s s s s s s s s Fri. Hi 64 61 61 62 67 58 62 62 65 70 65 68 Lo W 36 s 34 s 41 s 37 s 41 s 35 s 34 s 39 s 41 s 46 s 43 s 44 s Today City Coudersport Detroit DuBois Franklin Fredonia Grove City Harrisburg Ithaca Jamestown Johnstown Lancaster Lewisburg Hi 54 56 58 59 52 59 62 54 55 57 60 60 Lo 33 35 34 36 31 37 37 28 34 37 33 29 W s s s s s s s s s s s s Fri. Hi 60 64 62 63 58 63 64 60 62 59 62 62 Lo W 37 s 42 s 34 s 37 s 36 s 37 s 37 s 34 s 38 s 37 s 35 s 32 s Today City London Mansfield Meadville Morgantown New Castle Niagara Falls Philadelphia Pittsburgh Punxsutawney Rochester Scranton Smethport Hi 53 56 58 67 63 53 62 63 60 51 59 54 Lo 35 30 36 43 38 32 42 41 36 31 34 31 Fri. W s s s s s s s s s s s s Hi 60 61 62 67 67 61 64 69 62 60 63 59 Lo W 39 s 34 s 39 s 42 s 39 s 39 s 41 s 41 s 36 s 37 s 36 s 35 s Today City Hi State College 58 Syracuse 54 Toronto 48 Washington, DC 64 Wellsboro 55 Wheeling 65 Williamsport 61 Wilkes-Barre 59 Youngstown 62 Lo 35 30 30 43 30 41 35 30 39 W s s s s s s s s s Fri. Hi 61 61 54 64 60 67 64 62 65 Lo W 37 s 35 s 34 s 42 s 34 s 41 s 37 s 33 s 41 s Legend: W-weather, s-sunny, pc-partly cloudy, c-cloudy, sh-showers, t-thunderstorms, r-rain, sf-snow flurries, sn-snow, i-ice. Culture Continued from Page 1 “There are still operations going on throughout the troop, and it never stops,” Neal said, “We’ve been here two or three times in the past year with these types of raids, and you’ll see that some of these investigations go back two years.” Neal said that, in addition to these 17 individuals, two stolen firearms were seized from a residence. There were also three more individuals in custody. He said the problem extends into other areas, including Canoe Township, Indiana County, for the same thing — heroin, methamphetamine, opiates and pain pills — which are causing this opiate addiction in this area right now. “It is causing an uptick to every other type of crime we have — from child molestations to burglaries and thefts,” Neal said. “We, as law enforcement, combat this on a daily basis, 365 days a year.” Neal asked the community to help out law enforcement. “Just because you don’t hear from us doesn’t mean we aren’t doing anything,” Neal said. “We are doing something every single day.” Burkett, commended the members of the vice unit on their efforts. “We have a society right now marked by addiction,” Burkett said. “We’re seeing a lot of addiction to narcotic pain killers, which oftentimes leads to heroin addiction, and we’re reaping the benefits of it.” He said there are employers in this area who cannot find enough employees to pass a drug screen. “There is a real problem, and we have to continue plugging away,” he said. “The public can’t always see what we’re up to, because these investigations are highly secretive and have to be done in a covert manner.” Burkett said they are constantly working on drug law enforcement. “I spend a huge percentage of my time on drug law, and I know these guys (PSP) are out there plugging away every day,” Burkett said, adding that they’ll continue the battle. Hi 68 84 51 71 70 77 58 58 77 73 84 88 53 65 78 55 67 70 53 62 59 84 74 88 74 Lo 55 72 38 48 51 64 42 46 50 50 66 63 34 43 47 34 47 52 39 50 45 68 50 59 51 Fri. W sh pc s pc c r s pc pc pc t s s pc pc c pc pc sh pc c t s s pc Hi 69 84 54 71 70 76 61 57 71 76 81 80 54 65 58 59 74 74 56 67 61 82 76 81 77 Lo 54 71 42 55 48 64 44 46 40 53 66 58 38 41 31 35 54 54 44 55 45 68 53 52 54 W c t s s pc sh s s r pc t pc s s t pc s pc sh s c t pc pc pc “To those who continue to break these laws, don’t take comfort that you’re not on this list today, because we will find you,” Burkett said. “We will not quit; we’ll be back here tomorrow starting the same thing over again to find new violations and people who are pedaling these terrible drugs on the street.” Petrovsky said he took a look back over the past six years: He said that in 2010, Troop C had six total drug overdoses; in 2011, nine; in 2012, 10; in 2013, 19; in 2014, 24, which was the high point; Last year, 2015, was the first drop, to 15 drug overdose deaths. Petrovsky said that so far in 2016, there have been six drug overdose deaths, which puts Troop C on pace for 22 to 24 overdose deaths. “You can see how, over the years, this epidemic is forming, and it doesn’t seem to be going away,” Petrovsky said. Petrovsky added that there are drug drop-offs around the county for those who have used prescriptions that may be sitting around in the medicine cabinet. He also said they are having a drug drop-off on April 29 from 10 a.m. to 2 p.m. at PSP-DuBois’ station in Falls Creek. “You bring the drugs in, no questions asked, we’ll have an officer waiting for you to drop them off,” he said. Petrovsky said Burkett is sponsoring a drug drop-off program located at the Punxsutawney Borough Police Station in the Civic Center. Burkett said drop boxes are also located at Reynoldsville and Brockway police stations, and there is one at the Jeffer- son County Courthouse. Petrovsky said that it would help if everyone would just clean out their medicine cabinets. “When we talk to some of these kids, when they tell us their story, a lot of them started using the drugs in the medicine cabinet, which are mainly pills, and then it just escalates to heroin and moves on to the stronger drugs,” Petrovsky said. He also noted that the department always takes tips on suspicious activity that could be drug-related. “If someone sees something doesn’t belong on their street, people going in and out at all hours,” Petrovsky said, “you can give us a call here at (814) 938-0510. I guarantee you somebody will take that information and work on it. It may not seem like we’re doing anything, but we work around the clock on this. It will remain a priority in Troop C.” He said they can see the debilitating effect that drug abuse has on these small rural communities. Neal added that drug dealers travel to Pittsburgh daily purchasing heroin. “When they aren’t down in Pittsburgh buying dope, they are up here stealing to buy it,” Neal said. Burkett said the people involved are not in this to make money. “You find people who have an addiction, and they are fueling their addiction by going to the city, buying drugs and then selling them so they can continue their habit,” Burkett said. Neal said they were assisted with the drug sweep by Punxsutawney Borough Police officers. =+'668+)/':+?5;8(;9/4+99 128 COMMONS DRIVE (NEXT TO LOWES) OPEN 7 DAYS A WEEK DUBOIS • 814 - 371 - 8868 &+,1 +,1(6( (6( $0(5 0(5,,&$ &$1 1 %8)) 8))(7 (7 + +$%$ $%$& &+, *5,/ 5,// / 6 686+ 86+,, :;,(2:,(-66+ ,]LY`+PUULY)\MML[ 2;4).(;,,+: 3549':'3 63 '*;2:9 Free :LÀ *9()3,.:469, -YP:H[:\U+PUULY)\MML[ */44+8(;,,+: 354:.;89 63 63 '*;2:9 ,8/9': 63 63 '*;2:9 9;4*'?'22*'?*/44+8(;,,+: '363 1/*9'4*9+4/589':8+*;)+*68/)+9 )'88?5;:(;,,+:'<'/2'(2+ 2+ %$148(75220)2583723(23/( Buses Welco me Minneapolis 71/48 Detroit 56/35 New York 58/42 Denver 75/46 Kansas City 72/50 Washington 64/43 Los Angeles 73/54 Atlanta 61/48 El Paso 86/58 Houston 78/56 Fronts Miami 84/72 Cold Precipitation Warm Showers Stationary -10s -0s 0s 10s 20s T-storms 30s 40s Rain 50s Flurries 60s 70s Snow 80s 90s Ice 100s 110s Forecasts and graphics provided by AccuWeather, Inc. ©2016 ANF receives proposal to renew Tour de Forest Trail Ride special use permit MARIENVILLE – The Allegheny National Forest’s Marienville Ranger District has received a proposal from the Marienville Volunteer Fire Department to renew their special use permit for the biannual Tour de Forest Trail Ride. This organized two-day ATV and motorcycle trail ride takes place every spring and fall on the Marienville and Bradford Ranger Districts. If approved, the permit would be authorized for 5 years. The Marienville Ranger District is seeking comments about this project. Comments should be submitted by May 9, 2016 and may be submitted in several ways: Mail: Robert T. Fallon, District Ranger, Marien- ville Ranger District, 131 Smokey Lane, Marienville, Pa. 16239 Fax: 814-927-2285 Email: [email protected]. Please enter the project name (Tour de Forest Special Use Authorization project) on the subject line. Hand-delivered and verbal comments can be received weekdays between the hours of 8 a.m. and 4:30 p.m. at the Marienville Ranger District or by calling 814-927-5700 For more information about this project, go to: http://www.fs.usda.gov/ project/?project=49283 or contact Kevin Treese, Marienville Planning Team Leader at 814-927-5759. THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? su do ku Here’s How It Works: ^ƵĚŽŬƵ ƉƵnjnjůĞƐ ĂƌĞ ĨŽƌŵĂƩĞĚ ĂƐ Ă 9x9 grid, broken down into nine 3x3 boxes. To solve a sudoku, the numbers ϭƚŚƌŽƵŐŚϵŵƵƐƚĮůůĞĂĐŚƌŽǁ͕ĐŽůƵŵŶ ĂŶĚďŽdž͘ĂĐŚŶƵŵďĞƌĐĂŶĂƉƉĞĂƌŽŶůLJ ŽŶĐĞ ŝŶ ĞĂĐŚ ƌŽǁ͕ ĐŽůƵŵŶ ĂŶĚ ďŽdž͘ zŽƵ ĐĂŶ ĮŐƵƌĞ ŽƵƚ ƚŚĞ ŽƌĚĞƌ ŝŶ ǁŚŝĐŚ ƚŚĞ ŶƵŵďĞƌƐ ǁŝůů ĂƉƉĞĂƌ ďLJ ƵƐŝŶŐ ƚŚĞ ŶƵŵĞƌŝĐ ĐůƵĞƐ ĂůƌĞĂĚLJ ƉƌŽǀŝĚĞĚ ŝŶ ƚŚĞ ďŽdžĞƐ͘ dŚĞ ŵŽƌĞ ŶƵŵďĞƌƐ LJŽƵ ŶĂŵĞ͕ the easier it gets to solve the puzzle! 6 8 1 4 5 9 7 3 2 3 5 7 2 1 6 9 4 8 2 9 4 8 7 3 6 5 1 8 2 6 7 3 4 1 9 5 1 4 9 6 2 5 8 7 3 7 3 5 9 8 1 4 2 6 9 7 8 3 6 2 5 1 4 5 6 2 1 4 7 3 8 9 4 1 3 5 9 8 2 6 7 SPRING SPECIAL 2 Rooms $99* 3 Rooms $129* Steam Cleaned SUPER SHINE CARPET & TILE CLEANERS 24 Hour Emergency Service *Based on 200 Sq. Ft. 772-5235 FIRE & WATER RESTORATION THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! Tyler Siple, 21, Reynoldsville, methamphetamine. William Hutchins, 33, Brookville, marijuana. Derek Hillebrand, 18, DuBois, marijuana. Michael Bussard, 39, Reynoldsville, methamphetamine. Cole Johnson, 18, Brockway, heroin. Melissa Rubba, 48, Punxsutawney, Zanax (pills). Rubba was committed to Jefferson County Jail in lieu of posting bail in the amount of $45,000. Christian Cummings, 23, Brookville, marijuana. Raymond Marsh, 31, Punxsutawney, heroin. Marsh is currently housed in State Correctional Institute Camp Hill on other charges and is yet to be arraigned by Chambers. Ronald Cook, 45, Punxsutawney, Hydrocodone (pills). Cook was committed to Jefferson County Jail in lieu of posting bail in the amount of $50,000. Burkett started with a reminder that a charge is a mere accusation and that a person who has been charged with any crime is presumed innocent until proven guilty beyond a reasonable doubt. Petrovsky said Lt. Christopher J. Neal, criminal investigation section commander, was in charge of the operation on Wednesday. Neal said the warrants were issued for 17 individuals from Punxsutawney and the surrounding area. He said some went into Indiana County, but most of them were served was in Jefferson County. Neal said the drugs they were targeting during this under cover operation are extremely dangerous drugs and have had a huge impact in the community: heroin, opiates, prescription pain medications and methamphetamine, predominantly. “We’re seeing a huge uptick in methamphetamine and heroin right now,” Neal said, adding that those are the most dangerous drugs they have on the street. He said this was a two-year investigation, and the work to combat these drugs still continues to this day. City Memphis Miami Milwaukee Minneapolis Nashville New Orleans New York Norfolk North Platte Oklahoma City Orlando Phoenix Providence Raleigh Rapid City Reno Sacramento St. Louis Salt Lake City San Francisco Seattle Tampa Topeka Tucson Wichita Chicago 58/39 San Francisco 62/50 THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! Today Hi 62 60 54 62 64 52 56 54 62 67 56 66 Today W pc c c s s r c pc s s c c s s pc t pc sn sh pc s t pc pc s Seattle 59/45 State College 58/35 Regional Forecast City Allentown Altoona Ashtabula Baltimore Beaver Falls Binghamton Bradford Buffalo Canton Cincinnati Cleveland Columbus Lo 43 39 49 43 37 33 52 38 40 34 50 43 46 46 60 34 55 25 70 60 46 61 52 57 58 Shown are noon positions of weather systems and precipitation. Temperature bands are highs for the day. Forecast high/low temperatures are given for selected cities. Altoona 60/34 Apr 22 Hi 71 54 56 53 62 50 61 60 50 56 67 60 65 70 79 59 75 49 85 80 70 71 74 70 75 National Outlook Canton 62/41 First Coudersport 54/33 DuBois 58/34 New Castle 63/38 Moon Phases Last Warren 58/34 Kane 56/31 Corry 55/32 Precipitation Full Today SATURDAY 62° 33° 29° Precipitation elkcountyre.com The Nation TONIGHT Clear 814-781-1393 ͻĞďƌĂ^ŝĚůŝŶŐĞƌ ͻĞďďŝĞŝƉƉŽůĚ ͻĂƌď&ĞŝĚůĞƌ ͻĂǀŝĚůĂƌŬŝŶ 3-Day Forecast for St. Marys Mostly sunny and pleasant Elk County Real Estate We have buyers that need a home. We want to sell your house! ART HEARY & SONS FURNITURE TODAY www.smdailypress.com THINKING CARPET CLEANING? Think Super Shine Carpet & Tile Cleaners! THINKING CARPET CLEANING? www.smdailypress.com Records 3 The Daily Press Thursday, April 14, 2016 Daily Press Today's Obituaries Marlene A. Morgan Marlene A. Morgan, 80, of 1042 Burning Well Rd., Wilcox, died Wednesday morning, April 13, 2016 at The Lutheran Home at Kane following a lengthy illness. She was born Feb. 23, 1936 in Hazel Hurst, daughter of the late Adril and Helen Organski Ordiway. She married Robert Morgan on May 17, 1980 in the Wilcox Lutheran Church and he survives. She resided in Wilcox most of her life and was a 1954 graduate of Hazel Hurst High School. She was a Lutheran by faith. Marlene had been employed at Keystone Powdered Metals for 33 years before retiring in 1997. In addition to her husband at home, she is survived by a son, Doug Morgan of Johnsonburg; one daughter, Terri, Mrs. Gary Ribovic of Wilcox; one stepson, Jeffrey Morgan and his wife Ashley of Coal Hollow; and two stepdaughters, Debbie, Mrs. Michael Delhunty of Portland Mills, and Stacy, Mrs. Dave Sorg of Johnsonburg; 13 grandchil- dren; two great-grandchildren; one brother, James Ordiway and his wife Linda of Youngsville; and one sister, Edith Gordan of Bradford. She was preceded in death by her parents. Friends and family are invited to attend a funeral service for Marlene A. Morgan to be conducted Wednesday, April 20 at 11 a.m. at the Anthony F. Ferragine Funeral Home, 401 Chestnut St., Johnsonburg. Officiating will be Pastor David Pflieger, chaplain of the Lutheran Home at Kane. Interment will be in the Wilcox Cemetery, Wilcox. There will be no visitation. Arrangements are under direction of the Anthony F. Ferragine Funeral Home, 401 Chestnut St., Johnsonburg, Pa. If desired, memorial contributions should be made to the Alzheimer’s Association, 1128 State St., #301, Erie, Pa. 16501 or to the Wilcox Public Library. Share your condolences at www.ferraginefuneralhome.com. AAA encourages Pa. Legislature to strengthen Child Passenger Safety Law AAA East Central, along with the Pennsylvania AAA Federation, the state association of AAA clubs in Pennsylvania with over 3.1 million member motorists, supports Senate Bill 1152: (Browne, RLehigh); Amends Title 75 (Vehicles) further providing for restraint systems by requiring that any child under two years of age be fastened in a rearfacing child passenger restraint system, to be used until the child outgrows the maximum weight and height limits designated by the manufacturer. “AAA strongly supports Senator Browne’s Senate Bill 1152 to require all infants and toddlers to ride in a rearfacing safety seat until they are 2 years of age,” says AAA East Central Legislative Affairs Director, Theresa Podguski. “Industry research clearly shows infants and toddlers should continue to ride rear-facing until they reach the highest weight or height recommended by the manufacturer of the seat,” Podguski adds. Although child passenger safety has dramatically evolved over the past decade, motor vehicle crashes continue lawmakers promised to to be the leading cause of legalize medical marijua- death of children 4 years na by the summer, before and older. The American voters get a chance to decide a ballot question in the fall election. Continued from Page 1 Pennsylvania would cation and assistance to become the 24th state to HOSA students studying legalize a comprehensive athletic training. medical marijuana proHOSA is a national gram, according to the student organization National Conference of geared toward promotState Legislatures. ing careers in the health The issue has been care industry and enhancdriven by parents who ing the delivery of quality believe a marijuana oil health care to all people. It extract can help relieve is recognized by the U.S. the daily seizures that Dept. of Education and the Health Science Education have left their children in (HSE) Division of ACTE. wheelchairs or functionWhile they competed ing far below their grade against 900 students in the levels. Some parents say state competition, Bauer they worried the next said they are expected to seizure could be lethal go up against 6,000 indiand had traveled count- vidual competitors at the less times to the Capitol national competition from throughout the U.S., Canto press their case. ada, Italy, Mexico, Puerto See Marijuana, Page 10 Rico, and England. Since its inception in 1976, HOSA has grown steadily reaching over 200,000 members through davit, after the card was 51 chartered HOSA assodenied, Valentine report- ciations in American Saedly threw the card out at moa, Canada, District of Columbia, Germany, Italy, Walmart. Lehman reports that and Puerto Rico. In June 1979, PennValentine admitted that he was buying items that sylvania was awarded he could later sell in sup- its national charter for port of a heroin addic- HOSA. PENN HOSA has grown steadily reaching tion. As a result of the over 3,400 members from incident, Valentine has its 97 local chapters. Among the categories been charged with a felony count of access device each student participated issued to another who in were: Michelle Bauer placdid not authorize use and misdemeanor charg- ing first in healthy lifees of identity theft and styles. This event consists of theft by unlawful taking two rounds of competition. - movable property. Valentine was ar- Round one is a written, raigned before Magiste- multiple choice test asrial District Judge Mark sessing content knowledge S. Jacob in District Court of health literacy topics such as the physical ben59-3-03 on Tuesday. He was subsequently efit of exercise, healthy placed in the Elk County eating, and avoiding risky Prison in lieu of $5,000 behaviors. In addition, Michelle had to set a personmonetary bail. A preliminary hear- al goal and document her ing is scheduled for April efforts in a personalized 19 at 9 a.m. before Jacob healthy lifestyle portfolio. Rachel Bauer placing in District Court 59-3-03. Pa. set to OK medical marijuana; Ohio could follow By Marc Levy Associated Press HARRISBURG (AP) — Pennsylvania is set to become the latest state to legalize medical marijuana as the Legislature sent a bill to the governor on Wednesday after parents of children suffering from debilitating seizures circulated the Capitol urging lawmakers to act. The House vote, 149-46, set off cheers in the ornate chamber and capped several years of door-to-door lobbying by parents. It’s more than a year and a half since the state Senate first approved a medical marijuana bill in 2014. Democratic Gov. Tom Wolf, calling Wednesday’s legislation historic, said he will sign it Sunday. Meanwhile, in Ohio, Card Continued from Page 1 The following transactions were approved: One DVD was purchased for $20.82. One Straight Talk phone and one phone card was purchased for $154.29; the phone was returned for a refund of $104.94 that was not deposited back into the victim’s account. One PS4 access card and four PS4 games were purchased for $317.45. Two PS4 games and one Anbesol were purchased for $133.22. The following transactions were attempted but not approved: Seven Xbox One games and two controllers were attempted to be purchased for $571.68. Seven Xbox One games and one controller was attempted to be purchased for $508.13. Six Xbox One games and one controller was attempted to be purchased for $444.57. Five Xbox One games and one controller was attempted to be purchased for $381.01. On Monday, Sergeant Peter Largey was able to interview Valentine at Elcam. According to Lehman, Valentine admitted to taking the victim’s card and using it at Walmart. According to the affi- Academy of Pediatrics (AAP), in a policy update published in Pediatrics in April 2011, advised parents to keep their toddlers in rear-facing cars seats until age 2, or until they reach the maximum height and weight for their seat. It also advises that most children will need to ride in a beltpositioning booster seat until they have reached 4 feet 9 inches tall and are between 8 and 12 years of age. “In addition, parents have to change safety seats as their children grow, so when they’re at a different stage in life they need to know what the requirements are for that stage,” Podguski states. “Crashes are often outside parents’ control; however, properly securing a child in a vehicle should be a parent’s number one priority. Therefore, AAA strongly encourages the Pennsylvania House to approve SB 1152 to correspond with guidelines from the American Academy of Pediatrics, to keep children rear facing until they are 2 years old, the safest way to transport a child.” AAA strongly supports Senate Bill 1152 to correspond with the guidelines See AAA, Page 10 HOSA DATE ADDED BARB & JACK OWNERS SAINT MARYS SHOWROOM 481 BRUSSELLS ST. OPEN DAILY 834-4415 first in sports medicine. This event consists of two rounds of competition. Round one is a written, multiple choice test of knowledge and understanding while round two consists of performance skills identified in a written scenario. The scenario is a timed event and will require the use of critical thinking skills. Leah Gabler placing first in dental terminology. Gabler underwent a written test dealing with selected terms which are common to all dental occupations and others unique to the varied dental specialties. Competitors are expected to recognize, identify, define, interpret or apply these terms in a 100 item multiple choice test. Alyssa Pontious and Marah Thompson placing first in forensic medicine. This event also involves two rounds of competition. Round one consists of a written test to evaluate the team’s understanding of forensic medicine. In round two the team is given a case study related to forensic medicine. Teams have six minutes to analyze a case study, which will include written information and may include physical evidence. Finally, teams will be given 30 minutes to write their conclusions. ST. MARYS MONUMENTS LOCALLY OWNED & OPERATED SUSIE & DONNY (FLIP) BOBENRIETH 148 TIMBERLINE ROAD 834-9848 1013 Trout Run Rd., St. Marys, PA 15857 [email protected] 814-781-3444 Heating and Cooling Fully Insured Police Reports State Police at Ridgway Criminal mischief FOX TWP. – The Ridgway-based State Police report an incident of criminal mischief which occurred Tuesday, April 12 between 6:45-8:45 p.m. at 236 Raven Run Rd. in Fox Township. According to police, unknown actor(s) arrived at the location and caused damage to a mailbox belonging to Aaron Kronenwetter, 39, of Kersey. Actor(s) fled the scene in unknown manner or direction. Anyone with information please contact PSP Ridgway. State Police at DuBois Two-vehicle crash HUSTON TWP. – The DuBois-based Pa. State Police report a two-vehicle crash which occurred Tuesday, April 12 at 3:52 p.m. on state Route 255 (Bennetts Valley High- way) in Huston Township, Clearfield County. According to police, the crash occurred as a 1997 Chevrolet Tahoe, operated by Joseph A. Dutry, 60, of Penfield, was traveling south on SR 255 while using a handheld phone. The vehicle crossed over the center lines and struck a 2015 Subaru WRX operated by Jessica L. O’Donnell, 24, of Kersey who was traveling north on SR 255. The Tahoe continued in its aforementioned direction and came to a final rest on the eastern berm of SR 255. The Subaru spun 360 degrees and came to final rest on the western berm on SR 255. No injuries were sustained in this crash. Zimmerman Towing and Mottman Towing assisted with transporting the vehicles. Penfield Fire and EMS assisted on scene. Board Continued from Page 1 Marys for exterior wall resurfacing in the amount of $60,750. Also submitting a bid was Allegheny Restoration for $73,400. A-One Painting of St. Marys was awarded the exterior wall painting project as part of its low bid of $38,938. Also submitting a bid was Allegheny Restoration for $162,560. During the meeting the board also approved the following items: approved to exercise the Food Service Management Company one-year contract renewal with The Nutrition Group for 201617; approved the contract for Technology PoolCounsel between Seneca Highlands IU9 and SMASD; approved a contract between Edlio and the district for website setup and management services with an annual fee of $6,000 with an initial one-time $1,000 setup fee. Multi-year agreement discounts available of $5,280 for a three-year agreement or $5,100 for a five-year agreement. The agreement outlines such services provided by the company including a project manager to guide the website setup, design and launch, one-onone website consultation to build an online identity, static content migration, and initial user account creation, and custom design featuring a mobilefriendly website optimized for cellphones and tablets, a unique design created specifically for the district, a design dictated by school colors, logo, motto, use best website practices and current design leads. Also included in the agreement is domain name registration along with training for administrators, teachers and staff, and a 2-2.5 hour web conference training. adminisapproved tration to seek proposals for network administration services. Under transportation, the board approved a bus stop for 952 S. St. Marys Rd. and Gloria Kastner and Raymond Allegretto as school vehicle drivers for Muccio School Transportation. Two items were approved under student activities including a field trip for five first-place students to attend the HOSA Nationals in Nashville, Tenn. from June 21-26 and for two students and one advisor to attend the DECA Officer Summer Workshop in Hershey from June 21-23. Among the uses of facilities approved were a request from the St. Marys Stallions Flag Football Team to use the high school cafeteria from 11 a.m. to 5:30 p.m. on Sunday, May 22 for their endof-season awards banquet. The St. Marys Recreation Board was approved to use the high school tennis courts and locker rooms from 7 a.m. to 9 p.m. on Friday, May 27-Monday, May 30 for the St. Marys Tennis Tournament. KORB MONUMENTS Since 1901 1-800-752-1601 Mary Petrucci 814-781-3063 www.korbmonuments.com 4 - The Daily Press w w w. s m d a i l y p r e s s . c o m Thursday, April 14, 2016 O PINION Letters & “On the Press” a weekly column by HJ Beagley 6RPHWKLQJ¿VK\IURP*DU\ PHUPDLGPDGQHVVXSGDWHVIURP 'HEELHDQGRXU:HVW(QG*URFHU\ WXUQVVL[«DQGRWKHU%LWV3LHFHV« &KDLQVDZPHUPDLG If you went to this year’s Chainsaw Rendezvous or read our carver stories in the newspaper, you’ll remember the colorful Mr. Gary Orange. He is the carver that shared his story about a tree falling on his Land Rover [Simon’s buddy]. Well, Mr. Orange is in the news again…he mailed me a New Zealand news clipping and a letter last week. Gary said he had “speed carved” a mermaid out of a piece of driftwood [Unfinished]. Somehow that piece drifted away “or about” and ended up on a New Zealand beach… “This happened in Golden Bay, South Island, New Zealand this past winter,” explained Gary. How funny, to think of that woodwork bobbing up and down in the waves. [See photo]. “Here…I have an article picture that caused a stir in New Zealand, it seems a mysterious mermaid appeared on a beach. I will be emailing the paper, just thought it was a bit of fun. I hope you are good and Harlan J. Beagley well, I trust my typing is easier than my Yorkshire accent to unPublisher derstand,” said Gary. I remember his horse head bench he sold in Ridgway last month. Those New Zealand folks must have a thing for mermaids. 0HDQZKLOHLQ³XQUHODWHGPHUPDLGQHZV´ This is odd…in that same paper Gary’s article [Above] appeared in, I saw the headline: “Swimming like a mermaid is the new extreme sport.” Mermaid-style swimsuits have been banned in New Zealand’s largest city after being deemed a safety risk and a distraction for beach lifeguards by Auckland council [Oh my]. “Lycra mermaid tails are a magical way to have fun in the water.” I’m not so sure that would be too safe in the Clarion River or up at the dam. The suits – which have also been banned in UK public pools – fully encase the wearer’s legs from the hips down and end in a flared fish tail [That would be fun to see]. 8SGDWHRQWKHOLWWOHSODVWLFEDJSURMHFW “We are all busy working and enjoying making more sleeping bags. Patty Greene, a member of the Hallton Church, has taken mats to Florida and has said she will take more to homeless programs in Pittsburgh. She is a blessing to so many people! She contacted several shelters in Pittsburgh and in doing so has found a home for all of the mats we can make. The Hallton Church members have a heart for all of those they can help with their homeless program. We have been receiving so many bags from many people who want to help too! Because we need more people who can crochet, we have been enlisting people who know how to crochet but can’t make it to the Tuesday afternoon group. They are taught individually, given bags to take home, work on them at home, and bring us back the sleeping mat for Patty to deliver. The Ridgway Area High School agreed to ask students to participate as their community service. As we need more hands to keep up with this growing project, groups such as the Girl Scouts, Boy Scouts, and other civic groups are invited to join. We are all amazed how so many are helping in so many ways!” said Debbie Leslie, one of the organizers of the thoughtful project. Debbie also needs crochet needles [The biggest ones] and more scissors. Debbie and her friends are making mats and blankets out of little grocery bags for the homeless vets and other folks in the city. I have yet another large load of bags to take down to her team. She said to thank the other bag donation sites for the help and our readers for the overwhelming response. Today in History Today is Thursday, April 14, the 105th day of 2016. There are 261 days left in the year. Today's Highlight in History: On April 14, 1865, President Abraham Lincoln was shot and mortally wounded by John Wilkes Booth during a performance of "Our American Cousin" at Ford's Theater in Washington. On this date: In 1775, the first American society for the abolition of slavery was formed in Philadelphia. In 1828, the first edition of Noah Webster's "American Dictionary of the English Language" was published. In 1912, the British liner RMS Titanic collided with an iceberg in the North Atlantic at 11:40 p.m. ship's time and began sinking. (The ship went under two hours and 40 minutes later with the loss of 1,514 lives.) In 1935, the "Black Sunday" dust storm descended upon the central Plains, turning a sunny afternoon into total darkness. In 1939, the John Steinbeck novel "The Grapes of Wrath" was first published by Viking Press. In 1949, the "Wilhelmstrasse Trial" in Nuremberg ended with 19 former Nazi Foreign Office officials sentenced by an American tribunal to prison terms ranging from four to 25 years. In 1956, Ampex Corp. demonstrated the first practical videotape recorder at the National Association of Radio and Television Broadcasters Convention in Chicago. In 1965, the state of Kansas hanged Richard Hickock and Perry Smith for the 1959 murders of Herbert Clutter, his wife, Bonnie, and two of their children, Nancy and Kenyon. In 1975, Academy Award-winning actor Fredric March, 77, died in Los Angeles. In 1981, the first test flight of America's first operational space shuttle, the Columbia, ended successfully with a landing at Edwards Air Force Base in California. In 1986, Americans got word of a U.S. air raid on Libya (because of the time difference, it was the early morning of April 15 where the attack occurred.) French feminist author Simone de Beauvoir died in Paris at age 78. In 1995, Oscar-winning actor-singer Burl Ives died in Anacortes, Washington, at age 85. Ten years ago: President George W. Bush rebuffed recommendations from a growing number of retired generals that he replace Defense Secretary Donald H. Rumsfeld, saying, "He has my full support." Kobe Bryant broke the Los Angeles Lakers' single-season scoring record, getting 50 points to eclipse Elgin Baylor's long-standing total of 2,719 points in a 110-99 victory over the Portland Trail Blazers. Five years ago: Libyan leader Moammar Gadhafi rolled defiantly through the streets of Tripoli the same day NATO air strikes shook the city. North Korean confirmed it was holding an American who was detained in November 2010, reportedly for proselytizing. (Eddie Jun was freed in May 2011.) ABC canceled two of its longtime soap operas, "One Life to Live" and "All My Children." One year ago: The White House announced that President Barack Obama would remove Cuba from the list of state sponsors of terrorism, a key step in his bid to normalize relations between the two countries. Percy Sledge, 74, who soared from part-time singer and hospital orderly to lasting fame with his aching, forlorn performance on the classic "When a Man Loves a Woman," died in Baton Rouge, Louisiana. Today's Birthdays: Actor Bradford Dillman is 86. Country singer Loretta Lynn is 84. Actress Julie Christie is 76. Retired MLB All-Star Pete Rose is 75. Rock musician Ritchie Blackmore is 71. Actor John Shea is 67. Actor-turned-race car driver Brian Forster is 56. Actor Brad Garrett is 56. Actor Robert Carlyle is 55. Rock singer-musician John Bell (Widespread Panic) is 54. Actor Robert Clendenin is 52. Actress Catherine Dent is 51. Actor Lloyd Owen is 50. Baseball Hall of Famer Greg Maddux is 50. Rock musician Barrett Martin is 49. Actor Anthony Michael Hall is 48. Actor Adrien Brody is 43. Classical singer David Miller is 43. Rapper DaBrat is 42. Actor Antwon Tanner is 41. Actress Sarah Michelle Gellar is 39. Actor-producer Rob McElhenney is 39. Roots singer JD McPherson is 39. Rock singer Win Butler (Arcade Fire) is 36. Actress Claire Coffee is 36. Actor Christian Alexander is 26. Actor Nick Krause is 24. Actress Vivien Cardone is 23. Actor Graham Phillips is 23. Actress Skyler Samuels (TV: "Scream Queens") is 22. Actress Abigail Breslin is 20. Thought for Today: "I am a man of fixed and unbending principles, the first of which is to be flexible at all times." — Everett Dirksen, American politician (1896-1969). The Daily Press (144920) 245 Brusselles St., St. Marys, Pa. 15857 Website: www.smdailypress.com Publisher: Harlan J. Beagley E-mail: [email protected] Cell: 509-770-6598 Office: 814-781-1596 Managing Editor: Joseph Bell E-mail: [email protected] Phone: 814-781-1596 Fax: 814-834-7473 E-mail: [email protected] Published every morning except Sunday, New Year’s Day, Memorial Day, July 4, Labor Day, Thanksgiving and Christmas. We also have a nice letter from Debbie’s friend Shauna Miller: “We can’t say “thank you” enough for the publicity about our mats for the homeless. The response has been wonderful! Today I will drop a box off at the Johnsonburg Public Library in order to collect more bags here. Patty Greene will be taking mats to Pittsburgh next week to be given to the homeless. What a heartwarming project to be involved with! With so many working together we can bless countless people. So, thanks again!” These ladies are amazing and so kind. More on this later. +DSS\\HDUDQQLYHUVDU\:HVW(QG*URFHU\RI5LGJZD\ Today is Cheesesteak Thursday at the little store along Oak Street. Stop in this month and wish the nice folks a happy anniversary. If you make it in today try one of those their [Generously oversized] cheesesteaks, they truly are brilliant and just a measly $4 [large $6.50] what a deal. Congratulations. Harlan Beagley Publisher, Daily Press Single copy price 50 cents. By carrier or mail in county: 1 month $12.50, 3 months $36.75, 6 months $70.00, 1 year $134.75. By motor route delivery: 1 month $12.50, 3 months $37.00, 6 months $73.00, 1 year $139.00, Out of county mail delivery: 1 month $16.00. POSTMASTER: Send address changes to The Daily Press, 245 Brusselles St., St. Marys, Pa. 15857. Complete information on advertising and advertising rates furnished at The Daily Press business office. Advertisers must notify the management immediately when errors appear. The publisher reserves the right to reject, edit or cancel any advertising at any time without liability. Publisher’s liability for error is limited to the amount paid for advertising. Periodicals postage paid at St. Marys, Pa. 5 www.smdailypress.com The Daily Press Thursday, April 14, 2016 SMA track teams split with Punxsy in home opener member of the 1600 relay. Armanini won the 300 hurdles and was a member of the winning 400 and 1600 relay teams. Kaitlyn Barackman was a double winner as she was a member of the winning 400 and 1600 relays. Single winners were Rachael Caretti in the 100 hurdles, Kara Reiter in the 400 relay, Rachel Bauer in the pole vault and Sierra Nunamaker in the triple jump. For the Dutchmen, Tom Bojalad, Matt Marconi and Zack Pistner were double winners. Bojalad won the shot put and discus. Marconi won the 400 dash and was a member of the winning 1600 relay team. Pistner won the pole vault and was a member The St. Marys Area of the winning 1600 relay track and field teams team. hosted the PunxsutawSingle winners were ney squads in their home Pat Schlimm in the javopener on Wednesday at elin, Isaac Caretti and Dutch Country Stadium. Richie Williamson as The teams split as the members of the winning Lady Dutch defeated the 1600 relay team. Lady Chucks 81-64 while The St. Marys squads the Chucks downed the return to action Saturday Dutch 107-47. when they will compete at The Lady Dutch had the Kane Invitational bethree triple winners in ginning at 10 a.m. Arianna Kleppinger, The results of WednesAmanda Foster and Rachday’s meets follow: elle Armanini. KleppingGirls er won the 100 and 400 St. Marys 81. dashes and was a member Punxsy 64 of the winning 1600 relay 3200 relay - 10:56.34 team. Foster won the 800 Punxsy, St. Marys. and 1600 runs and was a 100 hurdles - 20.51 Rachael Caretti - SM. 100 dash - 12.87 - Arianna Kleppinger - SM, Smith - P, Reiter - SM. 1600 run - 5:45.86 Amanda Foster - SM, Hockenberry - P, Pesce - SM. High jump - 4’10” Miller - P, McGowan - SM, Bridges - P. 400 relay - 52.74 - St. Marys (Rachelle Armanini, Kaitlyn Barackman, Kara Reiter, Arianna Kleppinger), St. Marys. 400 dash - 1:06.90 Whitman - P, Huffman - P, Cherry - SM. 300 hurdles - 56.03 Rachelle Armanini - SM, Caretti - SM. Discus - 84’6.5” - Dyson - P, Pyne - SM, Glass - SM. 800 run - 2:32.3 - Amanda Foster - SM, Whitman P, Majchrzak - SM. 200 dash - 27.02 - Smith - P, Barackman - SM, Allie Swanson - SM. Pole vault - 8’ - Rachel Photo by Becky Polaski Bauer - SM, Glass - SM, St. Marys Area’s Anthony Cortina is shown during the Raybuck - P. 300 hurdles at Wednesday’s meet against Punxsy. Long jump - 15’5.5” - By Jim Mulcahy Staff Writer Photo by Becky Polaski St. Marys Area’s Rachel Bauer is shown about to clear the bar in the pole vault during Wednesday afternoon’s meet against Punxsutawney. Kaitlyn Barackman - SM, Miller - P, Carey - P. 3200 run - 11:57 - Michelle Bauer - SM, Hockenberry - P, Cherry - SM. Triple run - 32’7.5” Sierra Nunamaker - SM, Miller - P, Carey - P. Shot put - 35’3” - Dyson - P, Edsell - P, Eckert - SM. 1600 relay - 4:30 - St. Marys (Kaitlyn Barackman, Rachelle Armanini, Amanda Foster, Arianna Kleppinger), Punxsy, St. Marys “B”. Javelin - 86’6” - Barnoff - P, Bauer - SM, Dyson - P. Boys Punxsy 103, St. Marys 47 3200 relay - 9:41.22 Punxsy, St. Marys. 110 hurdles - 16.81 Riley - P, Lyle - P. Humble - P. 100 dash - 12.09 - Stello - P, Gianvito - P, Marconi - SM. 1600 run - 4:51.22 Brantman - P, Ward - P, Dyson - P. 400 relay - 47.24 Punxsy. Shot put - 58’2” - Tom Bojalad - SM, Jones - P, Fonseca - SM. Long jump - 21’2.5” Riley - P, Manners - P. Williamson - SM. Triple jump - 38’11” - Manners - P, Jones - P, Cortina - SM. 400 dash - 55:55 - Matt Marconi - SM, Smith - P, Wehrle - P. 300 hurdles - 44.46 Dyson - P, Cortina - SM, May - P. 800 run - 2:11 - Ward P, Wehrle - P, Caretti - SM. 200 dash - 25.36 - Stello - P, McAnany - SM, McGrath- SM. Javelin - 149’3” - Pat Schlimm - SM, Jones - P, Hanley - P. 3200 run - 11:31 - May - P, Storms - P, States - P. High jump - 5’6” - Manners - P, Cortina - SM, May - P. 1600 relay - 3:52.6 St. Marys (Isaac Caretti, Richie Williamson, Zack Pistner, Matt Marconi), Punxsy “A”, Punxsy “B”. Pole vault - 11’ - Zack Pistner - SM, Presloid - P, Williamson - SM. Discus - 163’ - Tom Bojalad - SM, Pearce - P, Park - SM. Punxsutawney downs Dutchmen 13-3 in five innings By Jim Mulcahy Staff Writer The St. Marys Area Flying Dutch baseball team saw their record slip to 2-2 on the season as the Punxsutawney Chucks defeated the Dutchmen 13-3 in five innings Wednesday afternoon at Berwind Park. The Chucks outhit the Dutch 11-5. Getting the five hits for St. Marys were Jeffrey Wehler with a double, Michael Beimel with two singles, Aaron Piccolo and Nate Beimel each with a single. “We started out flat. We were flat taking infield and outfield and it carried over to the game. We were very lethargic,” said St. Marys coach Tony Azzato. “That’s one good thing about this game, we will put that one in the back pocket and show up tomorrow. That’s what we can do,” added Azzato. The Dutch will play host to the Brookville Raiders this afternoon at 4:15 p.m. at Berwind Park. Jared Groll started on the mound for St. Marys going two innings, giv- ing up eight hits, walking two and striking out one. Tim Beimel worked 1 1/3 innings giving up three hits and walking four. Brendon Rolley worked 1 2/3 innings giving up one walk and striking out one. Lance Pennington started for the Chucks going three innings giving up four hits, walking two and striking out three. Peyton Graham worked two innings giving up one hit, walking two and striking out two. The Chucks put a three-spot on the board in the top half of the first inning on three hits and a walk. With one out in the home half of the inning, Aaron Piccolo singled but he was left stranded. Punxsy left a runner on base in the top half of the second while the Dutch went down in order. Punxsy erupted for seven runs on five hits, one walk and a hit batsman to take a 10-0 lead in the top half of the third inning. The Dutch responded with three runs in the home half of the inning. Matt Bellina and Brendon Rolley both drew walks. With two outs, Wehler Punxsutawney 13 John Matthews 3-1-2, Lucas Ambler 0-0-0, Caleb Smith 0-0-0, Lucas Burkett 3-0-0, Braxton Giavedoni 3-2-1, Lance Pennington 4-2-2, Joey DiPietro 2-0-1, Dylan Bender 0-3-0, Dylan Huey 3-1-2, Peyton Graham 3-2-1, Brandon Matthews 1-1-0, Jacob FRIDAY Baseball Weaver 3-1-2. Totals 25Bradford at ECCHS, 13-11. varsity and junior varsity, 4:15 p.m. St. Marys 3 Softball Tim Beimel 2-0-0, ECCHS at Brockway, Aaron Piccolo 3-0-1, Jef3:15 p.m. frey Wehler 2-1-1, Michael Jr. high track St. Marys at Clearfield Beimel 3-0-2, Nate Beimel with Hollidaysburg, 4 3-0-1, Hayden Tettis 2-00, Hunter Fantechi 2-0-0, p.m. Jared Groll 0-0-0, Brandon SATURDAY Track Sicheri 0-0-0, Matt Bellina St. Marys and ECCHS 1-1-0, Brendon Rolley 1-1at Kane Invitational, 10 0. Totals 19-3-5. a.m. Jr. high track Score by innings R St. Marys at Clearfield Punxsy 307 30 13 Invitational, cancelled. St. Marys 003 00 3 Scholastic Schedule Schedule subject to change without notice. THURSDAY Softball Sheffield at ECCHS, 4:15 p.m. Hollidaysburg at St. Marys, varsity 4 p.m., junior varsity 5:45 p.m. Boys tennis Brockway at St. Marys, 2:30 p.m. DuBois Central at ECCHS, 3:30 p.m. Baseball Brookville at St. Marys, varsity only, 4:15 p.m. ECCHS at Brockway, varsity and junior varsity, 4:15 p.m. doubled scoring both Bellina and Rolley. Michael Beimel singled as did Nate Beimel scoring Wehler to make the score 10-3. The Chucks added three more runs in the top of the fourth on two hits and four walks to take a 13-3 lead. The Dutch went down in order in the home half of the inning. Punxsy left a runner stranded in the top half of the fifth inning. Tim Beimel led off the home half of the fifth with a walk. On a strike ‘em out, throw ‘em out play Beimel was erased at first. Wehler drew a walk and Michael Beimel singled. Both were left stranded as the final out was recorded on a strikeout. The Dutch host Brookville this afternoon. Next Wednesday’s game for the Dutchmen with Bradford has been changed to Berwind Park. Photo by Jim Mulcahy Dutch shortstop Jeffrey Wehler sets to throw out the Punxsutawney runner during the second inning of Wednesday’s game. Local & Area Sports Briefs MEMORIAL PARK VOLLEYBALL The St. Marys City Volleyball League, under the direction of the City Recreation Department, will begin its 47th season on May 23 and 24. The league, developed by the recreation department in 1969, has been a staple of its summer recreation program. Roster forms can be downloaded from the new recreation website www.smrecreation.com or they can be picked up at City Hall. The cost is $40. Games will be played on Monday and Tuesday nights at Memorial Park with rain days being Wednesdays or Sundays as needed. FOX JR. LEGION TRYOUTS SUNDAY Fox Township American Junior Legion Baseball will have second tryouts on Sunday, April 17 from 2 until 4 p.m. at the Dagus Mines Legion Field. Please contact Doug Price at 5941183 with any questions. NAMED TO PLAY IN BIG 30 GAME The following players have been named to play in the 43rd annual Don Raabe Big 30 Charities Classic set for Bradford’s Parkway Field on Saturday, Aug. 6. Named to the Pa. squad were Sheldon Van Pelt of Coudersport, a 6-0, 150 pound linebacker, Austin Doud of Cameron County, a 5-11, 165 pound wide receiver and outside linebacker and Jordan Crosby of Cameron County, a 6-1, 165 pound wide receiver and defensive back. Named to the New York team were Devon Clark of Gowanda High School, William Bays of Franklinville Central and Tyler Brandes of Wellsville High School. 6 The Daily Press Thursday, April 14, 2016 www.smdailypress.com ECC junior varsity softball team SMA junior varsity softball team Photo by Becky Polaski Members of the 2016 Elk County Catholic High School junior varsity softball team are, front row, from left, Marlee Schaut, Brianna Weisner, and Emily Wolf; middle row, Michelle Gerber, Jenna Weisner, Maggie Dinsmore, Bobbi Fragale, and Sady VanAlstine; and back row; Brandi Clyde, Jordyn Fox; Emily Evers, Rosina Nero, and Josie Smith. Saltalamacchia’s grand slam lifts Tigers over Pirates, 7-3 PITTSBURGH (AP) — Jarrod Saltalamacchia hit a grand slam for his 100th career home run, Shane Greene pitched six strong innings in his first start since undergoing shoulder surgery last August, and the Detroit Tigers beat the Pittsburgh Pirates 7-3 Wednesday night. Saltalamacchia connected off Arquimedes Caminero (0-2) with two outs in the sixth inning, hitting a drive into the right-field bleachers that enabled the Tigers to erase a 2-1 deficit. Detroit loaded the bases on a double by Miguel Cabrera, a walk to J.D. Martinez and Nick Castellanos’ single. It was the second home run of the season for Saltalamacchia, a 10-year veteran who has taken over as the Tigers’ primary catcher after James McCann was placed on the 15-day disabled list Tuesday with a sprained right ankle. NHL Playoffs Tampa Bay at Detroit, 7 p.m. Florida at N.Y. Islanders, 8 p.m. Nashville at Anaheim, 10:30 p.m. Monday, April 18 Washington at Philadelphia, 7 p.m. Dallas at Minnesota, 8:30 p.m. Los Angeles at San Jose, 10:30 p.m. Tuesday, April 19 Tampa Bay at Detroit, 7 p.m. Pittsburgh at N.Y. Rangers, 7 p.m. St. Louis at Chicago, 9:30 p.m. Anaheim at Nashville, 9:30 p.m. Wednesday, April 20 Washington at Philadelphia, 7 p.m. Florida at N.Y. Islanders, 8 p.m. Dallas at Minnesota, 9:30 p.m. Los Angeles at San Jose, 10:30 p.m. Thursday, April 21 Pittsburgh at N.Y. Rangers, TBD Anaheim at Nashville, 8 p.m. x-Detroit at Tampa Bay, TBD x-Chicago at St. Louis, TBD Friday, April 22 x-N.Y. Islanders at Florida, TBD x-Philadelphia at Washington, TBD x-Minnesota at Dallas, TBD y-Toronto x-Boston New York Brooklyn Philadelphia Southeast Division x-Atlanta x-Miami x-Charlotte Washington Orlando Central Division z-Cleveland x-Indiana x-Detroit Chicago Milwaukee WESTERN CONFERENCE NBA W L 55 26 47 34 32 50 21 60 10 71 Pct GB .679 — .580 8 .390231/2 .259 34 .123 45 W L 48 33 48 33 47 34 40 41 35 46 Pct .593 .593 .580 .494 .432 GB — — 1 8 13 W L 57 24 44 37 43 38 41 40 33 48 Pct .704 .543 .531 .506 .407 GB — 13 14 16 24 Chicago Kansas City Detroit Cleveland Minnesota West Division y-San Antonio x-Dallas x-Memphis Houston New Orleans Northwest Division y-Oklahoma City x-Portland Utah Denver Minnesota Pacific Division z-Golden State x-L.A. Clippers Sacramento Phoenix L.A. Lakers ___ W L 66 15 42 39 42 39 40 41 30 51 Pct .815 .519 .519 .494 .370 W L 55 27 43 38 40 41 33 48 28 53 Pct GB .671 — .531111/2 .494141/2 .407211/2 .346261/2 W L 72 9 53 28 33 48 22 59 16 65 Pct .889 .654 .407 .272 .198 Tuesday’s Games Indiana 102, New York 90 Toronto 122, Philadelphia 98 Miami 99, Detroit 93 San Antonio 102, Oklahoma City 98, OT L.A. Clippers 110, Memphis 84 Wednesday’s Games Minnesota 144, New Orleans 109 Indiana 97, Milwaukee 92 Houston 116, Sacramento 81 Toronto 103, Brooklyn 96 Charlotte 117, Orlando 103 Philadelphia at Chicago, 8 p.m. San Antonio at Dallas, 8 p.m. Detroit at Cleveland, 8 p.m. Miami at Boston, 8 p.m. Atlanta at Washington, 8 p.m. Memphis at Golden State, 10:30 p.m. Utah at L.A. Lakers, 10:30 p.m. L.A. Clippers at Phoenix, 10:30 p.m. Denver at Portland, 10:30 p.m. End regular season GB — 24 24 26 36 GB — 19 39 50 56 x-clinched playoff spot y-clinched division z-clinched conference Major League Baseball By The Associated Press All Times EDT American League East Division Baltimore New York Boston Tampa Bay Toronto Central Division x-San Jose at Los Angeles, TBD Saturday, April 23 x-N.Y. Rangers at Pittsburgh, TBD x-St. Louis at Chicago, TBD x-Nashville at Anaheim, TBD Sunday, April 24 x-Florida at N.Y. Islanders, TBD x-Tampa Bay at Detroit, TBD x-Washington at Philadelphia, TBD x-Dallas at Minnesota, TBD x-Los Angeles at San Jose, TBD Monday, April 25 x-Pittsburgh at N.Y. Rangers, TBD x-Chicago at St. Louis, TBD x-Anaheim at Nashville, TBD Tuesday, April 26 x-N.Y. Islanders at Florida, TBD x-Detroit at Tampa Bay, TBD x-Minnesota at Dallas, TBD x-San Jose at Los Angeles, TBD Wednesday, April 27 x-Philadelphia at Washington, TBD: x-N.Y. Rangers at Pittsburgh, TBD x-Nashville at Anaheim, TBD Rest of schedule, TBD Southwest Division By The Associated Press All Times EDT EASTERN CONFERENCE Atlantic Division W 7 4 3 3 3 L Pct GB 01.000 — 2 .66721/2 4 .429 4 5 .37541/2 5 .37541/2 W 5 5 4 3 0 L 2 2 2 3 7 Pct GB .714 — .714 — .667 1/2 .50011/2 .000 5 W L Pct GB Los Angeles 5 4 .556 — Texas 5 5 .500 1/2 Oakland 4 6 .40011/2 Houston 3 5 .37511/2 Seattle 3 6 .333 2 ___ Tuesday’s Games Detroit 8, Pittsburgh 2 N.Y. Yankees 3, Toronto 2 Baltimore 9, Boston 5 Tampa Bay 5, Cleveland 1 Kansas City 3, Houston 2 L.A. Angels 5, Oakland 4 Texas 8, Seattle 0 Wednesday’s Games L.A. Angels 5, Oakland 1 Seattle 4, Texas 2, 10 innings Detroit 7, Pittsburgh 3 Toronto 7, N.Y. Yankees 2 Boston 4, Baltimore 2 Cleveland 4, Tampa Bay 1 Chicago White Sox at Minnesota, 8:10 p.m. Kansas City at Houston, 8:10 p.m. Thursday’s Games Detroit (Zimmermann 1-0) at Pittsburgh (Cole 0-1), 12:35 p.m. Chicago White Sox (Latos 1-0) at Minnesota (E.Santana 0-0), 1:10 p.m. Cleveland (Salazar 1-0) at Tampa Bay (Archer 0-2), 1:10 p.m. N.Y. Yankees (Eovaldi 0-0) at Toronto (Stroman 1-0), 7:07 p.m. Baltimore (Tillman 1-0) at Texas (Hamels 2-0), 8:05 p.m. Kansas City (Kennedy 1-0) at Houston (Fister 1-0), 8:10 p.m. Friday’s Games Seattle at N.Y. Yankees, 7:05 p.m. Chicago White Sox at Tampa Bay, 7:10 p.m. N.Y. Mets at Cleveland, 7:10 p.m. Toronto at Boston, 7:10 p.m. Baltimore at Texas, 8:05 p.m. Detroit at Houston, 8:10 p.m. L.A. Angels at Minnesota, 8:10 p.m. Kansas City at Oakland, 10:05 p.m. National League East Division Washington Philadelphia Miami New York Atlanta Central Division Chicago Cincinnati Pittsburgh St. Louis Milwaukee West Division San Francisco Los Angeles Colorado Arizona Lady Dutch softball downs Brookville 9-2 SMA hosts Hollidaysburg today The St. Marys Area Lady Dutch softball team evened their record at 1-1 on the young season as Daily Scoreboard By The Associated Press All Times EDT FIRST ROUND (Best-of-7) (x-if necessary) Wednesday, April 13 Tampa Bay 3, Detroit 2 Pittsburgh 5, N.Y. Rangers 2 Chicago at St. Louis, 9:30 p.m. Thursday, April 14 Philadelphia at Washington, 7 p.m. N.Y. Islanders at Florida, 8 p.m. Minnesota at Dallas, 9:30 p.m. San Jose at Los Angeles, 10:30 p.m. Friday, April 15 Detroit at Tampa Bay, 7 p.m. N.Y. Islanders at Florida, 7:30 p.m. Chicago at St. Louis, 8 p.m. Nashville at Anaheim, 10:30 p.m. Saturday, April 16 N.Y. Rangers at Pittsburgh, 3 p.m. Philadelphia at Washington, 7 p.m. Minnesota at Dallas, 8 p.m. San Jose at Los Angeles, 10:30 p.m. Sunday, April 17 St. Louis at Chicago, 3 p.m. Photo by Jim Mulcahy Members of the St. Marys Area Lady Dutch junior varsity softball team are, front row, Olivia Catalone and Gina Schlimm. Second row, Makenzie Gillen, Lexi Cunningham, Carissa Vavala and Emily Vollmer. Back row, Alexis Singer, Leah Gabler, Julie Daniels, Micayla Bothun and Maddie LeGrys. W 6 4 3 3 0 L 1 5 4 5 8 Pct GB .857 — .444 3 .429 3 .37531/2 .00061/2 W 6 5 5 4 3 L 1 2 3 3 4 Pct GB .857 — .714 1 .62511/2 .571 2 .429 3 W 6 4 3 3 L 2 4 4 5 Pct GB .750 — .500 2 .42921/2 .375 3 San Diego 3 6 .33331/2 ___ Tuesday’s Games Detroit 8, Pittsburgh 2 Arizona 4, L.A. Dodgers 2 Washington 2, Atlanta 1 Philadelphia 3, San Diego 0 Miami 2, N.Y. Mets 1 San Francisco 7, Colorado 2 Wednesday’s Games N.Y. Mets 2, Miami 1 Washington 3, Atlanta 0 Philadelphia 2, San Diego 1 Detroit 7, Pittsburgh 3 Cincinnati at Chicago Cubs, 8:05 p.m. Milwaukee at St. Louis, 8:15 p.m. San Francisco at Colorado, 8:40 p.m. Arizona at L.A. Dodgers, 10:10 p.m. Thursday’s Games Detroit (Zimmermann 1-0) at Pittsburgh (Cole 0-1), 12:35 p.m. San Diego (Pomeranz 1-0) at Philadelphia (Velasquez 1-0), 1:05 p.m. Milwaukee (W.Peralta 0-2) at St. Louis (J.Garcia 0-0), 1:45 p.m. San Francisco (M.Cain 0-0) at Colorado (Bergman 0-1), 3:10 p.m. Atlanta (Teheran 0-1) at Washington (Undecided), 4:05 p.m. Cincinnati (R.Iglesias 1-0) at Chicago Cubs (Hammel 0-0), 8:05 p.m. Arizona (Ray 0-0) at L.A. Dodgers (Stripling 0-0), 10:10 p.m. Friday’s Games Colorado at Chicago Cubs, 2:20 p.m. Milwaukee at Pittsburgh, 7:05 p.m. Washington at Philadelphia, 7:05 p.m. Atlanta at Miami, 7:10 p.m. N.Y. Mets at Cleveland, 7:10 p.m. Cincinnati at St. Louis, 8:15 p.m. San Francisco at L.A. Dodgers, 10:10 p.m. Arizona at San Diego, 10:40 p.m. they defeated Brookville 9-2 Wednesday afternoon at Brookville. Bekka Bauer struck out 13 while throwing a three-hit game for the Lady Dutch. St. Marys scored seven of their runs in the second inning. Brookville was able to score their runs in the home half of the seventh inning. The Lady Dutch are scheduled to play host to the Hollidaysburg Tigers this afternoon at 4 p.m. at the SMAHS softball field. Penguins top Rangers 5-2 in opener; Lundqvist injured PITTSBURGH (AP) — Patric Hornqvist had his first playoff hat trick and the Pittsburgh Penguins pulled away from the New York Rangers 5-2 in Game 1 of the Eastern Conference quarterfinals Wednesday night. Hornqvist added an assist, Sidney Crosby had a goal and two assists and backup goaltender Jeff Zatkoff did just fine in his first postseason start, finishing with 35 saves. Tom Kuhnhackl also scored for Pittsburgh, which took advantage when New York goalie Henrik Lundqvist left with a facial injury after the first period. Game 3 is Saturday in Pittsburgh. Lundqvist played just 20 minutes after taking a stick to the face from teammate Marc Staal. Antti Raanta was shaky in Lundqvist’s place, stopping 16 of 19 shots. Derek Stepan scored twice for the Rangers but New York never led as its quest to knock the Penguins out of the playoffs for a third straight year got off to an underwhelming start. The Penguins ripped off a 14-2 surge to end the regular season even with Fleury sidelined since March 31 with a concussion. He returned to practice this week and was the first goaltender off the ice during Wednesday morning’s skate, typically an indication of who is starting. Coach Mike Sullivan remained coy about his decision-making process, and when Pittsburgh came out for warm-ups in their vintage blackand-gold uniforms, Fleury wasn’t even in uniform, instead sitting in the press box in a blue suit. That left the job to Zatkoff, who’d played just five times since Jan. 1 after losing his spot as the primary backup to rookie Matt Murray. Yet with Murray out indefinitely with a concussion of his own, the Penguins gave Zatkoff the first postseason start of his three-year career, or 110 fewer than Lundqvist. Zatkoff didn’t exact- ly look overcome by the stage. Good thing because his teammates gave him little help early. New York dominated the opening minutes, throwing shots at Zatkoff from all angles rather than trying to set anything up. Zatkoff lacks Fleury’s athleticism but managed to scramble when required, keeping the Penguins afloat early while his teammates took time to find their legs. Then, in an instant, New York’s decided advantage in the net disappeared. Staal was fending off a Pittsburgh player in front of the New York net when his stick became wedged in between the bars on Lundqvist’s mask with 48 seconds to go in the first period. The goalie who has been the backbone of deep playoff runs each of the last two years writhed in pain for several moments before slowly skating to the bench. He stayed in the game long enough for Pittsburgh to take the lead when Hornqvist flipped a rebound between Lundqvist’s legs with 18 seconds left. Lundqvist stayed in the dressing room at the start of the second period, forcing Raanta to unexpectedly make his postseason debut. He had little to do until a stretch pass from Hornqvist sprung Crosby in alone. The wrist shot zipped over Raanta’s glove 18:56 into the second and the Penguins were up 2-0. New York’s drew to 2-1 when Stepan stuffed in a shot from the doorstep on a 5-on-3 but Pittsburgh countered with a short-handed goal from Kuhnhackl 5:31 into the third and when Hornqvist pounced on a loose puck in the Rangers’ crease and eased it in, the Penguins were up three and in control. Lightning 3, Red Wings 2 TAMPA, Fla. (AP) — Nikita Kucherov scored twice and Alex Killorn snapped a third-period tie with his 11th career playoff goal, giving the Tampa Bay Lightning a 3-2 vic- tory over the Detroit Red Wings in Game 1 of their first-round series Wednesday night. Ben Bishop had 34 saves for the defending Eastern Conference champions, who got the winner from Killorn less than two minutes after a potential go-ahead goal was waived off when Detroit coach Jeff Blashill successfully challenged that Tampa Bay should have been called for offsides before Victor Hedman scored. Tyler Johnson picked up a loose puck along the boards and fed Killorn, who slipped the puck past Jimmy Howard at 8:52 of the third. Kucherov scored in the first and second periods and also assisted on the winner. Mike Green and Justin Abdelkader scored for Detroit, which outshot the Lightning 36-34 but had few real scoring opportunities after taking a 2-1 lead in the second period. Bishop, who led the NHL in goals-against average and was second in save percentage, stopped five shots in the final 1:07 to seal the victory. Game 2 of the best-of-7 series is Friday night at Amalie Arena. This is the second straight season Detroit and Tampa Bay have met in the opening round. The Lightning advanced in seven games in launching a run to their second Stanley Cup final appearance, and it doesn’t figure to be any easier this year with leading goal scorer Steven Stamkos and defenseman Anton Stralman out with injuries. The teams split four meetings during the regular season, each winning twice at home. It took the Red Wings less than two minutes to turn a 1-0 deficit into a 2-1 lead, with Green scoring his 10th goal in 72 career playoff games at 2:11 of the second period, and Abdelkader beating Bishop 1:56 later with a shot through traffic that cleared the goalie’s right shoulder. 7 www.smdailypress.com 4. EMPLOYMENT The Daily Press Thursday, April 14, 2016 4. EMPLOYMENT MUCCIO SCHOOL TRANS. ST. MARYS BUS DRIVERS NEEDED Must have a good driving record. We provide learning material, classes and bus training to acquire a school bus license. Call 781-3400. HELP WANTED Inserter needed at the Ridgway Record Pressroom. dŚĞũŽďŝƐŝŶƐĞƌƟŶŐĂĚǀĞƌƟƐĞŵĞŶƚƐĂŶĚ ƐƉĞĐŝĂů ƐƵƉƉůĞŵĞŶƚƐ ŝŶƚŽ ƚŚĞ ZŝĚŐǁĂLJ ZĞĐŽƌĚ͕dŚĞĂŝůLJWƌĞƐƐĂŶĚ^ŚŽƉZŝŐŚƚ͘ ͻDƵƐƚďĞĂďůĞƚŽƐƚĂŶĚĨŽƌůŽŶŐƉĞƌŝŽĚƐ͘ ͻDƵƐƚďĞĂǀĂŝůĂďůĞƚŽǁŽƌŬϯƌĚƐŚŝŌĂŶĚ ŵŽƐƚ^ĂƚƵƌĚĂLJƐ͘ ͻDƵƐƚďĞĂďůĞƚŽǁŽƌŬĂƐĂƚĞĂŵ͘ ůůǁŚŽĂƌĞŝŶƚĞƌĞƐƚĞĚƉůĞĂƐĞƐƚŽƉďLJ͗ The Ridgway Record’s office at 325 Main Street Ridgway, PA No phone calls please, thank you. 4. EMPLOYMENT Kitchen Help Local restaurant now hiring full time or part time kitchen help. Experience preferred, but not required. Pay is based on experience. Please send resume to: [email protected] Executive Director The Elk County Historical Society is currently looking for a part-time Director. The perfect candidate will have an interest in history, especially local history; possess excellent communication and organization skills; possess working NQRZOHGJH RI 0LFURVRIW 2I¿FH LQFOXGing Word, PowerPoint, Excel, Publisher, and Access, and must also possess knowledge of Lotus. Must be able to speak in public settings, plan and execute fundraising activities, and coordinate volunteers. Experience preferred, but will train the right candidate. Must have personal and work references. Send resume and references with cover letter by April 20th to: The Elk County Historical Society Attn: EDP 109 Center Street Ridgway, PA 15853 LOCAL DAYCARE 4. EMPLOYMENT Shipping Room Clerk SGL Carbon, LLC, a leader in the manufacturing of Carbon and Graphite products, has an immediate opportunity for a Shipping Room Clerk at our St. Marys, PA location. This position is a bargaining unit position and is responsible for packaging products for shipment to customers. The ideal candidate will possess the following qualifications: s !BLETOUSEVARIOUSHANDTOOLSSEALERSmOORJACKSCRANES banders, table saw, etc. s !TTENTIONTODETAILTOACCURATELYPERFORMREQUIREDADMINISTRATIVE packaging tasks; s /RGANIZEDANDABLETOPRIORITIZEANDMANAGEMULTIPLE assignments; s -ATHAPTITUDE s %FFECTIVEVERBALANDWRITTENCOMMUNICATIONSKILLS s )NITIATIVEABLETOWORKWITHOUTCLOSESUPERVISION s %XPERIENCEINAMANUFACTURINGENVIRONMENTPREFERRED Qualified candidates should apply online to: http://sglcarbon.peopleadmin.com/postings/1157 3',#ARBONISAN%QUAL/PPORTUNITY%MPLOYER *.1 6LQWHU 0HWDOV WKH ZRUOG OHDGHU LQ SRZGHU PHWDOOXUJ\ KDV WKH IROORZLQJRSHQLQJVEDVHGDWRXU3$7RRO6KRS6W0DU\·VORFDWLRQ &RPH MRLQ WKH *.1 WHDP 7KH7RRO 6KRS LV DLU FRQGLWLRQHG DQG D FOHDQHQYLURQPHQWZLWKPRGHUQHTXLSPHQW MACHINISTS / TOOL & DIE MAKERS 0DFKLQLVWDQG7RRODQG'LH0DNHUDSSOLFDQWVVKRXOGKDYHD EDFNJURXQGLQ3RZGHUHG0HWDO7RROFRQVWUXFWLRQDQGWRRO PDLQWHQDQFH ([SHULHQFHLQ6LQNHU('0:LUH('0DQG&1&0DFKLQH7RROV SUHIHUUHG &RPSUHKHQVLYHNQRZOHGJHRI%OXHSULQW5HDGLQJ*HRPHWU\DQG 7ULJRQRPHWU\ +LJK6FKRRO'LSORPDZLWKDPLQLPXP\HDUVH[SHULHQFHIRU 0DFKLQLVWSRVLWLRQVDQGDQDGGLWLRQDO\HDUVIRU7RRODQG'LH $VVRFLDWH·V'HJUHHLQ7RRO0DNLQJ7HFKQRORJ\GHVLUDEOHEXWQRW UHTXLUHG %DVLFXQGHUVWDQGLQJRI/HDQSULQFLSDOVDQGFRQFHSWV &DQGLGDWHPXVWEHDEOHWRZRUNZLWKOLWWOHVXSHUYLVLRQ *.1 RIIHUV D KLJKO\ FRPSHWLWLYH ZDJH DQG EHQHÀWV SDFNDJH ZLWK DQ HPSKDVLVRQ/HDQ&RQFHSWVDQG(PSOR\HH,QYROYHPHQW3RVLWLRQVZLOO EHRQQGVKLIWRUUGVKLIW Veteran, Minorities, and Females are encouraged to reply 5HSO\LQFRQÀGHQFHE\0RQGD\WR GKN Sinter Metals 104 Fairview Road Kersey, PA 15846 Attn: Human Resources E-Mail: [email protected] ´*.16LQWHU0HWDOVSURYLGHVHTXDOHPSOR\PHQWDQGDIÀUPDWLYHDFWLRQV opportunities to minorities, females, veterans, and disabled individuals, as ZHOODVRWKHUSURWHFWHGJURXSVµ http://www.dol.gov/ofccp/regs/compliance/posters/ofccpost.htm TS16949 ISO14001 4. EMPLOYMENT OHSAS18001 is looking to hire. Must be able to pass all state and federal background checks. Experience helpful but not necessary. Please call 814-834-3918 to schedule an interview. We are an equal opportunity employer. 4. EMPLOYMENT 4. EMPLOYMENT 4am-2am 4. EMPLOYMENT FULL TIME RESIDENTIAL PROGRAM WORKERS Oak Manor, Inc. is currently accepting applications for 2 Full Time positions: • Full Time 11:30 p.m. -7:30 a.m. • Full Time Evenings & Saturdays Must have high school diploma or equivalent & PA Driver’s License. Includes great benefits. Applications available at: Oak Manor, Inc. 4 Erie Ave., Ste. 102, St. Marys, PA or call 834-3963 Also at PA Career Link Depot St., St. Marys, PA Equal Opportunity Employer QUALITY MANAGER Bluewater Thermal Solutions (Saint Marys) has an immediate opening for a Quality Manager at a local manufacturing/processing company. Ideal candidate will drive results and focus on meeting customer expectations. Key requirements for the position are a demonstrated track record of continuous improvement, deep knowledge of problem solving methodologies, and an intimate understanding of interpreting and implementing ϐ Ǥ Position reports to facility’s General Manager and serves as a member of the local management team. Candidates must have a minimum of an Associate Degree in Materials Engineering or equivalent ǡϐlography and a strong background in math and science. Experience in powder metallurgy and heat treating is desired, but not mandatory. Responsibilities include but are not limited to the following: Need to earn money for school, new car or vacation? We’re now hiring for all shifts. Free training, Free meals, Flexible hours. $7.50/hour $9.00/hour Apply in-store or online at… mcstate.com/3393 mylocalmcds.com/stmarys 4. EMPLOYMENT Ȉ maintenance of the company quality system. Ȉ standards of quality, reliability and safety. Ȉ ǡ enforce quality and safety requirements in accordance with company needs. Ȉ Ǧ instrument calibration Ȉǡǡ issue corrective and/or preventative actions Ǧ ϐǤ Ȉ including work instructions, procedures, ϐ ǡ͵ ϐ Ǥ Ȉ ǡ analysis, feasibility, and PPAP. Ȉǡǡ ǡ KPI’s, objectives. Ȉǯ including annual reviews, improvement projects, and cost reductions. ȈǤ Ȉ parties on matters relating to the quality system. Respond by emailing a resume by April 22, 2016: [email protected] FT BRANCH MANAGER ST. MARYS OFFICE Responsible for the growth and profitability of the branch, developing new business, expanding existing customer relationships, promoting various banking services, and coaching branch staff to meet established goals. The ideal candidate must possess a thorough knowledge of the St. Marys market, a previous branch management background, and a minimum of three years experience in consumer and mortgage lending. Excellent business development skills, a strong commitment to provide quality customer service, and a desire to become actively involved in local community and civic events are essential. Visit Careers section of www.farmersnb.com for more information or to apply online. EOE, M/F/V/D Merlin’s 10. REAL ESTATE BUSPERSON DISHWASHER NEEDED 6LQJOH 6WRU\ +RPH ,Q .DQH 0RYH ,Q 5HDG\%HGURRPV %DWK+DUGZRRG)ORRUV )LUHSODFH *DUDJH %DVHPHQW 'U\ 1LFH 1HLJKERUKRRG*UHDW 1HLJKERUV HIRING TRUCK DRIVERS 19. MISC. 626 So. Michael Rd. Apply in person. 2 Years CDL Experience Tanker Endorsement Necessary Retirement Plan & Health Benefits Available. Competitive Pay Beimel Transportation, Inc. 814-885-8990 $,5/,1( &$5((56 EHJLQ KHUH *HW KDQGV RQWUDLQLQJDV)$$FHU WLILHG$YLDWLRQ7HFKQL FLDQ)LQDQFLDO$LGIRU TXDOLILHGVWXGHQWV-RE SODFHPHQW DVVLVWDQFH &$// $YLDWLRQ ,QVWL WXWH RI 0DLQWHQDQFH 1$785$/ 81 632,/(' &2$67$/ 3523(57<s7KHUHLV DSODFHMXVWKRXUVDZD\ JOB COACH ZKHUH \RX FDQ ILQG Elcam, Inc. is hiring a DEXQGDQW QDWXUDO part-time Job Coach to train individuals to work EHDXW\ FOHDQ DLU DQG VSDFH/RFDWHGLQ9LU in the community. JLQLDPLOHVVRXWKRI You must have a valid 2FHDQ&LW\/RWVDUH Driver’s License and a WRDFUHVDQGSULFHG High School Diploma. WR$OO The position will be DUH QHDU WKH VKRUHOLQH between 20-29½ hours/ VRPH ZLWK H[FHOOHQW week and will be flexible ZDWHUYLHZV$PHQLWLHV depending on the hours L Q F O X G H F R P P X Q L W \ GRFNDQGVDQG\EHDFK of the job. Pay will /RZ WD[HV DQG D PLOG depend on experience. FOLPDWH&DOO Apply in person to: RU HPDLO +< 3 ( 5 / , 1 . PDLOWRRFHDQODQG WUXVW#\DKRRFRP RFHDQODQGWUXVW#\DKRR FRPZHEVLWH+<3(5 8. FOR RENT / , 1 . 9HU\DWWUDFWLYH%5 KWWSZDYHUO\ORWVFRP DSW XWLO LQFO KWWSZDYHUO\ORWVFRP 3$ '5,9(56 $XWR 9. WANTS TO RENT ,QVXUDQFH+HOS/LQH +HOSLQJ\RXILQGD&DU 6 P D O O K R X V H R U ,QVXUDQFH3D\PHQW<RX DSDUWPHQWWRUHQWRU FDQDIIRUG7ROO)UHH EX\ +< 3 ( 5 / , 1 . The Daily Press KWWSZZZ$XWR,Q is your classified VXUDQFH+HOSOLQH25* market place. To ZZZ$XWR,QVXUDQFH place an ad call +HOSOLQH25* 781-1596. SERVICE DIRECTORY Your local connection to local businesses & services! Check us out on the web at: www.smdailypress.com Construction RANDY WORTMAN ROOFING Waterproofing WET BASEMENT? ELK TOWERS rproofing Wate - ELDERLY HOUSING lties ! Specia nts An Affordable Residence You’ll mGuaranteed Dry Baseme ¯ STEEL ROOFING ASPHALT SHINGLES mNo Exterior Digging! ¯ DECKS, RAMPS mCracked Wall Repair! ¯ & SIDING ESTIMATE! FREE Estimates Insured PA 054421 35 Years Local Experience Call Randy @ 814-834-1689 Housing mFREE ¯ 4-772-9291 81Info & Referrals at: Be Proud To Call Home! CALL FOR DETAILS Preference given to extremly low income applicants 185 Center St., St. Marys, PA 15857 (814) 834-4445 waterproofyourhome.com Construction Advertising Kurtz Construction Have A Business Service To Offer? Place your ad in the Business Service Directory. “Quality is doing the right thing when no one is looking” PA #119396 ROOFING, SIDING & DECKS Fully Insured • Free Estimates ENOS KURTZ, Owner 814-553-1446 V.M. Call The Daily Press Today! 781-1596 8 The Daily Press Thursday, April 14, 2016 www.smdailypress.com Case Continued from Page 1 are made and Martin renders a decision. The commonwealth is expected to call one additional witness in the case, and the defense is expected to call two witnesses of its own. During four hours of proceedings on Wednesday, the prosecution, led by Elk County District Attorney Shawn T. McMahon, called three witnesses to the stand to testify. The first witness was John Costion, a co-owner of MCM Trucking and treasurer of the company during the time period of November 2011 to December 2012, when William and Kristin reportedly misappropriated nearly $500,000 in company funds. According to Costion’s testimony, several checks featuring forged signatures were made from the MCM Trucking bank account to support upgrades to a garage on William’s property. William’s property was home to MCM Trucking and Mercer Auto & Tire for a majority of the time period in which the acts were alleged to have occurred. Costion testified that all of the owners of MCM Trucking were aware that William was making upgrades to the garage on his property, but he said that it was informally agreed upon that no MCM Trucking funds would pay for the improvements. Several checks entered into evidence by McMahon appear to show that forgery and deception was used to use MCM Trucking funds for the garage upgrades on William’s property. The checks in question were made on behalf of MCM Trucking, LLC., and associated invoices point to William’s garage work as the source of the expense. Costion testified the checks in question were used to pay several local companies for work such as grading, stone hauling and garage erection, all activities attributed to William’s garage work by Costion. Costion further testified that the checks in question were never approved by him, saying that his name was forged on some of the checks, while others he presigned but never authorized expenses. At MCM Trucking, two owners were required to sign all checks; the checks in question featured Costion’s signature and William’s signature. Attorney Leanne Nedza, representing both William and Kristin, objected to the admission of each check. Nedza argued that Costion was unable to verify what work was done or that the checks could be connected to the invoices that the commonwealth associated with each check. She pointed out that the handwriting connecting specific checks to invoices could not be verified by Costion and could only be verified by the contractors that wrote the invoices, although those contractors were not in court Wednesday to testify. She argued that the invoices were hearsay and could have been generated by anyone. Martin overruled each of Nedza’s objections to the individual checks and allowed them to be admitted into evidence for preliminary hearing purposes. When given an opportunity to cross examine Costion, Nedza questioned whether an official motion was made during any company meeting that stated that MCM Trucking funds would not be used for the garage on William’s property. Costion stated that no official motion was ever made. Nedza also questioned Costion on the operating agreement signed by the owners, which she suggested may imply that William, as MCM Trucking’s president, had authorization to make purchases that he felt would improve the business. Nedza pointed out that several of the expenses attributed to misappropriation could have been used to improve the facilities for MCM, but Costion disagreed, saying that the work was completed for William’s personal gain, not the company’s. After Costion had delivered his testimony, Jennifer Rieder was called to the stand by the commonwealth. Rieder, a former secretary for MCM Trucking, testified that she had worked with Kristin and would see her forge the signatures of William and Costion onto checks. This testimony was given in support of the commonwealth’s assertion that William and Kristin forged five checks directly from MCM Trucking to Mercer Auto & Tire. Although William was a mechanic for MCM Trucking and would be paid by MCM Trucking for his labor, these five specific checks had no associated invoices. Rieder testified that she believed the signatures on these checks were forged by Kristin, but when questioned by Nedza, Rieder couldn’t recall any specific recollection of Kristin signing these specific checks. The final commonwealth witness was Frank Quattrone, another partowner of MCM Trucking. Quattrone’s testimony focused on an alleged stolen wire feeder and the alleged unauthorized transfer of several of MCM’s trucks. According to Quattrone, when MCM attempted to retrieve a wire feeder from William, they were informed that it was stolen, but upon further investigation, it appears as though William sold it for $1,100. Additionally, Quattrone discussed the transfer of three MCM trucks that William and Kristin allegedly made. According to his testimony, Quattrone claims that William and Kristin transferred ownership of three MCM trucks to Mercer Auto & Tire. Quattrone added that this occurred during financial hardship for the company, and it was significant in that the trucks that were transferred were the ones making money for the company. Nedza’s cross examination focused on Quattrone’s knowledge of the value of the trucks, the money owed on the trucks and the amount of money that the trucks were bringing into the business. Quattrone testified that he was unaware of the financial situation surrounding the trucks. In arguing relevancy, Nedza argued that William and Kristin sold the vehicle at a personal loss as they assumed the debt associated with the trucks when ownership was transferred. She questioned the idea of theft in that more money was owed on the truck than was received ception Parish in Osceola Mills as a secondary mission church, and St. Elizabeth Parish in Smethport will become a parish church with St. Joseph Parish in Mount Jewett as a secondary church. Along with parish churches and secondary churches, there will also be the creation of mission churches. According to the Diocese, “secondary churches with permission for Sunday and holy day Masses are called mission churches. Catholic tradition supports the idea that on Sundays and holy days the faithful go to the parish church for Mass.” St. Agnes Parish in Morrisdale will become a parish church with Ss. Peter and Paul Mission in Hawk Run as a secondary mission church, St. Basil the Great Parish in Coalport will become a parish church with Holy Trinity Parish in Ramey as a secondary mission church, and St. Raphael Parish in Eldred will become a parish church with St. Theresa Parish in Shinglehouse and St. Mary Parish in Sartwell both becoming secondary mission churches. There will also be the establishment of partnered parishes. The Diocese explained that partnered parishes “share some of their resources, but they continue to exist as distinct parishes. They function in many ways like sister parishes. While they have their own parishioners, parish church and finances, they share the same pastor, staff and parish office.” St. Boniface Parish in Grampian and St. Timothy Parish in Curwensville will become partnered parishes, and two other sets of partnered parishes will be created through a series of steps. In one instance, Our Mother of Perpetual Help Parish in Lewis Run will first be merged with St. Francis of Assisi Parish in Bradford. St. Francis of Assisi Parish will become the parish church with Our Mother of Perpetual Help Parish as a secondary church. St. Francis of Assisi Parish will then become a partnered parish with St. Bernard of Clairvaux in Bradford. A similar situation will play out in DuBois. St. Catherine of Siena Parish in DuBois will be merged with St. Joseph Parish in DuBois, with St. Catherine of Siena Parish being the parish church and St. Joseph Parish being the secondary church. St. Catherine of Siena Parish will then become a partnered parish with St. Michael the Archangel Parish in DuBois. As part of the plan, St. Bibiana Parish in Galton will remain a standalone parish with Sacred Heart Church in Genessee as its secondary church. St. Augustine Church, formerly a mission of St. Bibiana, will no longer be a mission church. Instead, it will become the secondary church of St. Eulalia Parish in Coudersport. St. Eulalia Parish will remain partnered with St. Gabriel the Archangel Parish in Port Allegany. Also, St. Adrian Church in Delancey, St. Anthony of Padua Church in Walston, and St. Joseph Church in Anita will all be identified as secondary churches of Ss. Cosmas and Damian Parish in Punxsutawney. Immaculate Conception in Brookville will remain a standalone parish with two churches. Immaculate Conception will continue to be a parish church with St. Dominic in Sigel as its secondary mission church. St. Callistus in Kane will remain a standalone parish with two churches. St. Callistus will be the parish church with Ss. John and Stephen in James City as the secondary church. St. Mark in Emporium remains a standalone parish with two churches. St. Mark will continue to be the parish church with St. James in Driftwood as the secondary mission church. St. Mary of the Assumption in Frenchville will remain a standalone parish with three churches. St. Mary of the Assumption will continue to be the parish church, while both Ss. Peter and Paul in Grassflat and St. Severin in Drifting will remain secondary mission churches. Additionally, Assumption of the Blessed Virgin Mary Parish in Sykesville will remain partnered with St. Mary Parish in Reynoldsville. Wednesday’s announcement was the second of three related to the planned restructuring of the Diocese of Erie. The first announcement, which was related to changes in the Northern Vicariate of the Diocese, took place on Tuesday evening. A final announcement related to the Western Vicariate will take place today. There is no Southern Vicariate. See Case, Page 10 Diocese Continued from Page 1 Masses, but would be available for weddings, funerals and feast days.” St. Boniface Parish in Kersey and Holy Rosary Parish in Johnsonburg will both gain secondary churches as part of the proposed plan. According to the Diocese, Holy Cross Parish in Brandy Camp will merge into St. Boniface Parish. The parish church will be St. Boniface, with Holy Cross being a secondary church. Likewise, St. Anne Parish in Wilcox will merge into Holy Rosary Parish in Johnsonburg. Holy Rosary will remain the parish church while St. Anne will be considered a secondary church. Holy Cross Church in Rasselas will also now be identified as a secondary church of Holy Rosary. Additional proposed parish churches and secondary churches are as follows: Christ the King Parish in Houtzdale will become a parish church with Immaculate Con- 19. MISC. 19. MISC. 19. MISC. (QWU\ /HYHO +HDY\ (TXLSPHQW 2SHUDWRU &DUHHU *HW 7UDLQHG *HW &HUWLILHG s *HW +LUHG %XOOGR]HUV %DFNKRHV ([FDYDW RUV ,PPHGLDWH /LIH WLPH -RE 3ODFHPHQW 9$%HQHILWV1DWLRQDO $YHUDJH &RQVWUXFWLRQ %LGV 1HZ 'DWHV 6WDWHZLGH -RE 2UGHU &RQWUDFWV-2&3UHE LGPHHWLQJVIRU*HQHU DO &RQVWUXFWLRQ (OHF WULFDO 3OXPELQJ +9$&&HQWUDO5HJLRQ $SULO $0 LQWKH&RUSRUDWH%RDUG 5RRP )LUVW )ORRU $U VHQDO%XLOGLQJWK +HUU 6WUHHWV +DUULV EXUJ 3$ (DVWHUQ 5H JLRQ $SULO $0 DW 8QLRQ %RXOHYDUG$OOHQWRZQ 3$SDUNLQJLQWKHEDFN RI WKH EXLOGLQJ FRP SOH[:HVWHUQ5HJLRQ $SULO $0 LQWKH83$5&$XGLWRU LXP:LOOLDP3LWW:D\ %XLOGLQJ $ 3LWWV EXUJK 3$ 0HHWVLQJOHVULJKWQRZ 1RSDLGRSHUDWRUVMXVW UHDO SHRSOH OLNH \RX %URZVH JUHHWLQJV H[ FKDQJH PHVVDJHV DQG FRQQHFWOLYH7U\LWIUHH &DOO QRZ 2&($1 &,7< 0$5</$1'%HVWVH OHFWLRQ RI DIIRUGDEOH UHQWDOV )XOO SDUWLDO ZHHNV &DOO IRU )5(( EURFKXUH 2SHQ GDLO\ +ROLGD\ 5HVRUW 6HU YLFHV 2QOLQH UHVHUYDWLRQV + < 3 ( 5 / , 1 . KWWSZZZKROLGD\RF F R P ZZZKROLGD\RFFRP *HW IXQGLQJ QRZ IRU \RXU VPDOO EXVLQHVV s XS WR PLOOLRQ LQ DV OLWWOHDVGD\V0LQLP XP\HDUVLQEXVLQHVV &DOO%)6&DSLWDO RUDSSO\RQ OLQH+<3(5/,1.KW WSZZZEIVFDSLWDOFR PQ\SZZZEIVFDSLW DOFRPQ\S ($51 $ '$< ,QVXUDQFH $JHQWV 1HHGHG /HDGV 1R &ROG&DOOV&RPPLV VLRQV3DLG'DLO\/LIH WLPH5HQHZDOV&RP SOHWH7UDLQLQJ+HDOWK 'HQWDO ,QVXUDQFH /LIH/LFHQVH5HTXLUHG &DOO 'LHVHO 0HFKDQLFV QHHGHGLQ%DUNH\YLOOH 3$ DUHD 0XVW +DYH ([SHULHQFH7RROVDQG 7RROER[ :H RIIHU D FRPSHWLWLYHZDJHSDFN DJH,ILQWHUHVWHGSOHDVH FDOO -LP DW 19. MISC. 19. MISC. WET BASEMENT? √ Guaranteed Dry Basement √ Permanently Remove Water √ No Exterior Digging √ Cracked Wall Reinforcing √ Fully Licensed & Insured √ Free Written Estimates Get rid of that damp, musty smell in yout home! Waterproofing Specialties is an Authorized Dealer of Basement Systems PA031610 Info & Referrals at: www.waterproofyourhome.com 814 - 772 - 9291 To place a classified ad call 781-1596. LEGAL NOTICE LEGAL NOTICE /(*$/127,&( (67$7(2)0$5<+(/(10,//6 '(&($6(' /HWWHUV7HVWDPHQWDU\RQWKHDERYH(VWDWHKDY LQJEHHQJUDWHGWRWKHXQGHUVLJQHGDOOSHUVRQVLQ GHEWHGWRWKHVDLG(VWDWHDUHUHTXHVWHGWRPDNH SD\PHQWDQGWKRVHKDYLQJFODLPVWRSUHVHQWWKH VDPHZLWKRXWGHOD\WRWKH([HFXWRURIKHU(VWDWH 5RGQH\-RKQ0LOOV 7HDEHUU\5RDG 6W0DU\V3$ RUWRKLVDWWRUQH\ *HUDUG56RUJ(VT 6RXWK6W0DU\V6WUHHW 32%R[ 6W0DU\V3$ W CAUTION It is impossible for The Daily Press to check each and every classified ad which is mailed to our office. The advent of “900” phone lines have opened a new type of scam. We caution our readers NOT to fall prey to “work at home ads” which sound too good to be true. If the ad required that you advance money. WE SUGGEST EXTREME CAUTION Connect with us: smdailypress.com THE DAILY PRESS CLASSIFIED RATE $2.85 PER LINE With following discounts: 3 time insertion - $2.55 6 time insertion - $2.25 10 time insertion - $2.00 30 time insertion - $1.65 Staggered ads - No discount. A minimum of 3 Lines per day on all insertions ---------A charge of $5 additional is made for blind key advertisements of a classified nature. Advertisements providing for answers to be left at The Daily Press are considered as blind or key advertisements. A charge of $5 additional to blind key advertisements to have answers mailed to advertiser. Deadlines 4 p.m. 2 days before publication. For publication on Monday, deadline is 4 p.m. Thursday. 9 www.smdailypress.com The Daily Press Thursday, April 14, 2016 ANNIE’S MAILBOX® COPYRIGHT 2001 CREATORS SINDICATE, INC. Dear Annie: I am a middle school student, and I signed up for drama at the beginning of the semester. I’ve been working really hard at it. The problem is, I failed one of my classes (out of seven). Because of that, I am not allowed to participate in drama. I have a speaking role with 17 lines and I don’t think they can replace me in such a short time. This really upsets me, especially because in the high school I’ll be attending, you only need to pass four classes to participate in drama. What’s worse is that they didn’t give me or my parents any warning about how close I was to failing. I did know that I wasn’t doing well in that class, and I was trying to bring up my grade. But I have anxiety issues and get panic attacks when I try to talk to teachers or people of authority (even my mom). My parents emailed the school with a complaint, but I was wondering what you think I should do. -- Was Ready for Showtime in New Hampshire Dear New Hampshire: We wish we could help you, but schools routinely penalize students by prohibiting them from doing special activities if they fail a required class. (It happens to football players and other athletes, too.) Such consequences are how schools hold students accountable. You can try talking to the drama teacher to see if he or she would intervene on your behalf, and you also can talk to the teacher who gave you the failing grade, explaining that you were working hard to improve and didn’t realize this would happen. If you have anxiety about talking to authority figures, try imagining that you are in a play and this is what your character does. It’s good practice. You also can ask your parents to speak to these teachers directly, instead of leaving messages. But if this is the policy of the school, there isn’t much you can do. Consider it a learning experience, and keep it in mind for high school, when you can try out for drama and be motivated to put your grades first. We know you’ll do better. Dear Annie: I am writing in response to the letter signed, “Is This Normal,” whose girlfriend bounces her 10-year-old son on her lap for 30 minutes. Your response was not strong enough. This is child abuse. This mother should immediately be reported to the Department for Children and Family Services in their local community. The entire family can then receive the help they need, and this child can be protected. The report can be anonymous and can be done by calling the Department directly or by notifying the local police. Please tell “Normal” to take the steps to protect this child from further abuse, and also to protect his young sister from having to watch her brother be abused on a daily basis. -- Social Worker Dear Social Worker: Many readers suggested that this mother is a child molester. Perhaps so. But we think she is simply misguided and has gotten into a bad situation that she doesn’t recognize or know how to fix. Whatever the case, we agree that the situation must be dealt with immediately. Annie’s Mailbox is written by Kathy Mitchell and Marcy Sugar, longtime editors of the Ann Landers column. Please email your questions to [email protected], or write to: Annie’s Mailbox, c/o Creators Syndicate, 737 3rd Street, Hermosa Beach, CA 90254. You can also find Annie on Facebook at Facebook.com/AskAnnies. To find out more about Annie’s Mailbox and read features by other Creators Syndicate writers and cartoonists, visit the Creators Syndicate Web page at www.creators.com. COPYRIGHT 2016 CREATORS.COM C R O S SWO R D GOT MUD? GET A LOAD OF THIS!! “ALL THE NEWS YOU CAN USE” 0LOOLRQ'ROODU+Z\ /,0(6721(6$1'6721($//6,=(6 No Quantity Too Large Or Too Small!! /$5*(,19(1725<3LFNXSRUGHOLYHUHG YOUR INDIVIDUAL HOROSCOPE ARIES (March 21 to April 19) TGIF! This is a lovely day to play and enjoy the company of others. Sports events, social outings, playful activities with children and romantic rendezvous will please you. Have fun! TAURUS (April 20 to May 20) You will enjoy entertaining at home today because it’s a feel-good day and your focus is on home and family. A conversation with a parent could be significant. GEMINI (May 21 to June 20) You will love schmoozing with everyone today. People are in the mood to party -- and hey, it’s Friday! This is also a strong day for those who write, sell, market, teach and act. For Friday, April 15, 2016 - by Francis Drake CANCER (June 21 to July 22) Business and commerce are favored today. Not only will you enjoy financial transactions, you also will enjoy shopping, especially for clothes that give you status. LEO (July 23 to Aug. 22) Today the Moon is in your sign, which means you have a bit of good luck. (It’s an edge that you have over all the other signs.) Enjoy parties, schmoozing and romance! VIRGO (Aug. 23 to Sept. 22) Gifts, goodies and favors from others will come your way at this time. Today, and indeed, the week ahead, is an excellent time to negotiate loans and mortgages. LIBRA (Sept. 23 to Oct. 22) What a wonderful day to enjoy the company of close friends and partners! The world is in party mode, and you are dressed and ready to go! (You are a social sign.) SCORPIO (Oct. 23 to Nov. 21) Personal details about your private life might be made public today. Hopefully, this is because you are receiving recognition for your achievements. SAGITTARIUS (Nov. 22 to Dec. 21) Do something different today! Shake it up a little. Travel if you can, or go someplace you’ve never been before, even if it’s an exotic, ethnic restaurant. CAPRICORN (Dec. 22 to Jan. 19) This is a strong day for business discussions, especially regarding inheritances, insurance issues and shared property. Minor disputes will be resolved quickly. AQUARIUS (Jan. 20 to Feb. 18) Because the Moon is opposite your sign today, you have to go more than halfway when dealing with others. This simply requires patience, tolerance and some friendly accommodation. PISCES (Feb. 19 to March 20) Although you are in party mode, nevertheless, you can accomplish a lot at work today. Just remind yourself that if you work hard, then you can party hard! YOU BORN TODAY You are a force to be reckoned with because you are realistic, dominant and always organized. You do your homework, and you know what you want to achieve, especially through building and organizational structures. This year is the beginning of a fresh, new nine-year cycle for you. Start a new business activity. Open any door! Your future is in your hands. Birthdate of: Emma Watson, actress; Seth Rogen, actor; Leonardo da Vinci, polymath. (c) 2016 King Features Syndicate, Inc. 10 The Daily Press Thursday, April 14, 2016 www.smdailypress.com Penn State survey finds sexual misconduct is common By Mark Scolforo Associated Press STATE COLLEGE (AP) — A survey of sexual misconduct at Penn State’s main campus found that more than three-quarters of undergraduate women have experienced offensive or harassing behavior from other students, university officials announced Wednesday. The Penn State Sexual Misconduct Climate Survey was completed in fall 2015 by nearly 3,000 of the campus’ approximately 40,000 undergraduates, and more than 1,600 graduate students. The survey says 28 percent of undergraduate women and 6 percent of men were the victim of at least one attempted or completed oral, vaginal or anal sexual assault, similar to the findings of 29 percent and 7 percent in a national study by the Association of American Universities. About one out every five Penn State under- graduate women responding to the survey reported being sexually assaulted while they were too drunk or incapacitated to know what was happening. Student affairs vice president Damon Sims said at a news conference in the HUB-Robeson Center student union that the results underscore the relationship between sexual misconduct and the use of alcohol and drugs, which he said was “a challenge that has been eternally vexing, it seems.” The report said 30 percent of all undergrads reported that someone had tried to establish a romantic, sexual relationship despite the students’ attempts to discourage it. For women, the number was more than 40 percent. The unwanted advances included attempts to stroke, fondle or kiss the student. The most common reason for not reporting incidents of stalking, violence or nonconsensual sexual contact was a feeling it would cause more trouble than it was worth. SignifiA-One Painting cant numbers of students Residential, Commercial also cited embarrassment Industrial-call for free and a desire not to cause estimate 594-0776 trouble for the perpetrator. The survey found unBenedictine Gift Shop dergraduate women are Sacramental Gifts experiencing the most M-F 9:30-5, Sat.10-1 problems with sexual at- 139 Church St. 834-1353 titudes and behavior, but Farmers Inn Opens also recorded significant Apr.15 Friday, Saturday, rates of problems across Sunday only gender lines, among dif814-752-2942 ferent sexual persuasions and by graduate students. Affordable Contractors Some form of stalking Everything Under Roof behavior, including being Remodelers spied on, having someone 788-0044 show up unwanted or beWe Call Back! ing given unwanted gifts, Sacred Heart Social was experienced by 21 percent of undergrads and 12 Dinner Thurs. 4/14, 4pm Stuffed Pork or Chicken percent of grad students. Violent behavior by Hollywood Hardscape intimate partners or dates Concrete/Hardscaping, was reported by 12 perDriveways, Retaining cent of undergraduates Walls, Stonework and 7 percent of gradu335-7657 ate students. Across all Simbeck's Southern categories of victims, the Carpet most common offender by far was a male Penn State Residential, Commercial & Vinyl Flooring 781-3072 student. their suffering children may not survive another day. “Every day we roll the dice on our child’s or our loved one’s life,” said Brann, whose 5-year-old son, Garrett Brann, has a severe form of epilepsy known as Dravet syndrome. The bill sets standards for tracking marijuana plants, certifying physicians and licensing growers, dispensaries and physicians. Patients could take marijuana in pill, oil, vapor or liquid form but would not be able to legally obtain marijuana to smoke or to grow their own. The Pennsylvania Medical Society opposed the bill. Its president said in a statement it has serious concerns about the effectiveness of medical marijuana but hopes patients, especially children, see positive outcomes. One opponent, Rep. Matt Baker, R-Tioga, warned that the bill violates federal drug laws and that the state would see a drastic impact on addiction and abuse. “There’s serious consequences associated with this monumental piece of legislation,” Baker told colleagues during floor speech before the vote. In Ohio on Wednesday, state lawmakers set an aggressive schedule for legislation that would allow licensed doctors to prescribe edibles, patches, plant material if the evidence warrants the case’s progression. Overall, William is charged with 160 felonies, which includes multiple felony counts of theft by unlawful taking - movable property; conspiracy - theft by unlawful taking - movable property; theft by unlawful taking - immovable property; conspiracy - theft by unlawful taking - immovable property; theft by deception - false impression; conspiracy - theft by deception - false impression; receiving stolen property; conspiracy - receiving stolen property; utters forged writing; conspiracy - forgery - utters forged writing; and conspiracy - forgery - unauthorized act in writing. Kristin faces 166 felonies; she faces felonies in the same categories as William, but Kristin also has felony charges of forgery - unauthorized act in writing. Court was adjourned shortly after 5 p.m. At press time, no date or time was given for the case to reconvene. 20% Off Flooring Sale this month Burke's Home Center ECC Athletic Assoc. Bingo - Sun. 4/17 Free Lunch opens 11:45 PA Power Washing Houses, Roofs, Concrete & More - call 594-5756 Grand Opening Fine Line Event Center 429 N. St.Marys St. 4/15, 5-9pm Ruffner's Outdoor Maintenance Mowing, Landscaping, Hedge Trimming, Mulching 512-0213 Charity Ball/Dinner Dance Johnsonburg Fire Hall Apr.16, ticket info 594-2329 H&R Block Tax Season extended until April 18 781-7130 Haddock Fish Fry in canola oil Fridays-DeLullo's Deli 834-7005 Pioneer Construction Excavation, Utilities, Auger services, pre-cast piers 814-594-1116 DeLullo's Deli Famous Hoagies 6pk $8.99 John & Stackpole 834-7005 Thompson's 834-9781 5# Sliced Pepperoni $9.99 Swiss Cheese $3.99# Concert Choir Presents "A Patriotic Salute" 5/26,27,28 tickets @Village Peddler Busperson-Dishwasher needed at Merlin's Apply in person Sacred Heart Social Dinner Thurs. 4/14, 4pm Stuffed Pork or Chicken Rip Ticket Tourney Sacred Heart 5pm Sat. 4/23, tickets @office Whissel's Open for the Season 834-4185 toric. “We’ve never had in the state’s history a time when the Statehouse has so thoroughly vetted medical marijuana, considered its positives, its negatives and brought so many people together,” he said. In Pennsylvania, the legislation’s list of 17 qualifying diagnosed conditions includes cancer, epilepsy, autism, Parkinson’s disease, post-traumatic stress disorder, sickle cell anemia, multiple sclerosis, AIDS and glaucoma. Physicians must be registered by the state to certify that a patient has an eligible condition and a patient must get a Department of Healthissued ID card. The legislation’s drafters say they expect it would be two years before regulations are written and retailers are ready to sell to patients. However, a safe harbor provision in the bill would allow parents to avoid the wait by legally buying medical marijuana from another state for their children. highest weight or height allowed by their car seat’s manufacturer. AAA urges Pennsylvania lawmakers to utilize Child Passenger Safety research by the AAP, NHTSA, the NTSB and others to increase motor vehicle safety for our youngest of passengers by approving SB 1152 with a two-year age requirement and passing the bill. Marijuana Continued from Page 3 Diana Briggs, of Export, near Pittsburgh, called her husband with the news moments after watching the House vote. “Bringing home a win tonight,” Briggs, wiping away tears, told him. Briggs said she hopes to help her 15-year-old son, Ryan Briggs, who suffered a brain injury at birth and has had daily seizures that have left him in a wheelchair, unable to talk or walk. Nothing has helped much, including pharmaceuticals, stem cell therapy, diet or electrical nerve stimulation therapy, Briggs said. Christine Brann, of suburban Hummelstown, said every day without a medical marijuana law in Pennsylvania is a risk for people who believe Case Continued from Page 8 in the transactions. McMahon countered that William and Kristin took an asset, and Martin added that debt was irrelevant to the value of the truck. When the case is scheduled to continue, three additional witnesses are expected to testify. After testimony is made, closing arguments will be made and Martin will decide whether the commonwealth has enough evidence to allow the case to proceed to the court of common pleas to be heard before President Judge Richard A. Masson. Martin will not be determining innocence or guilt in the case, that would be determined at the court of common pleas Funeral Services MORGAN – Friends tation. and family are invited to Arrangements are unattend a funeral service der direction of the Anthofor Marlene A. Morgan to ny F. Ferragine Funeral be conducted Wednesday, Home, 401 Chestnut St., April 20 at 11 a.m. at the Johnsonburg, Pa. Anthony F. Ferragine FuIf desired, memorial neral Home, 401 Chestnut contributions should be St., Johnsonburg. made to the Alzheimer’s Officiating will be Association, 1128 State The following winning numbers were drawn on Pastor David Pflieger, St., #301, Erie, Pa. 16501 Wednesday in the Penn- chaplain of the Lutheran or to the Wilcox Public LiHome at Kane. brary. sylvania Lottery: Interment will be in Share your condolencDAY the Wilcox Cemetery, Wiles at www.ferraginefunerPick 2 cox. There will be no visi- alhome.com. 6-5 Pick 3 1-5-1 Giving You Something to Smile About! Pick 4 8-4-9-3 Pick 5 0-3-3-2-6 Treasure Hunt DENTURE CENTERS, INC. 05-10-12-19-23 Lottery Numbers K& C EVENING Pick 2 2-2 Pick 3 6-0-2 Pick 4 5-1-5-1 Pick 5 6-6-0-3-1 Cash 5 18-21-33-39-42 Double Your Dentures Starting As Low As Senior Discount $ Coupon must be presented at first visit. It can’t be combined with any other offer or discount. DP 315 per plate Expires 5.31.16 0% Financing Available Dr. J. Smelko, D.M.D. 800-822-2061 Most Dental Insurance & PA Medical Assistance Accepted Call For A FREE CONSULTATION DUBOIS DENTURES ~ PARTIALS ~ RELINES ~ REPAIRS and oils. Rep. Kirk Schuring, a Canton Republican who chaired a medical marijuana task force, said it will prohibit home growing, which he says is too difficult to control. Lawmakers said that polling during a more sweeping ballot campaign that failed last year made clear to the Republican-controlled state Legislature that the issue wasn’t going away. Ian James, who led last year’s marijuana legalization effort, called the House proposal his- AAA Continued from Page 3 from the American Academy of Pediatrics (AAP): All infants and toddlers should ride in a rear facing car seat until they are at least two years of age or until they reach the “I’m excited to join The Lung Center, one of the country’s premier providers Introducing our New Pulmonologist Rajesh S. K. Rao, MD Penn Highlands Healthcare is pleased to ZHOFRPH5DMHVK5DR0'ERDUGFHUWL¼HG pulmonologist. (V6ESMWFSEVHGIVXM½IHMR TYPQSREV]QIHMGMRIGVMXMGEPGEVIQIHMGMRIERH WPIITQIHMGMRIERH[MPPFIKMRWIIMRKTEXMIRXW EPSRKWMHI(V7ERHIIT&ERWEPMR8LI0YRK'IRXIV SJ4IRR,MKLPERHW(Y&SMW(V6ES[MPPWII TEXMIRXWMRJSYVSJXLIWM\0YRK'IRXIVPSGEXMSRW ,SWTMXEP%ZIRYI(Y&SMW1IHMGEP%VXW &YMPHMRK8YVRTMOI%ZIRYI'PIEV½IPH7X1EV]W 'SQQYRMX]1IHMEP&YMPHMRK1MPPMSR(SPPEV ,MKL[E]7X1EV]WERHMRXLI4YR\WYXE[RI] 'SQQYRMX]1IHMGEP&YMPHMRK;1ELSRMRK 7XVIIX4YR\WYXE[RI] of technologically-advanced pulmonary medicine.” The Lung Center ,SWTMXEP%ZIRYI (Y&SMW4% Charles Medical Center %PPIKLIR]&SYPIZEVH7YMXI( &VSSOZMPPI4% (V6ES,IVIGIMZIHLMWQIHMGEPHIKVIIJVSQXLI /EVREXEOE9RMZIVWMX].E[ELEVPEP2ILVY1IHMGEP 'SPPIKIMR2ILVYREKEV-RHME,IGSQTPIXIHE VIWMHIRG]EX+VERX1IHMGEP'SPPIKIERH7MV.. +VSYTSJ,SWTMXEPWMR&SQFE]-RHME[LIVILI [EWEPWSXLIGLMIJVIWMHIRXMRXLI(ITEVXQIRX SJ1IHMGMRI,IEPWSGSQTPIXIHEVIWMHIRG] MR-RXIVREP1IHMGMRIEXXLI7MWXIVWSJ'LEVMX] ,SWTMXEP9RMZIVWMX]SJ&YJJEPS+VEHYEXI1IHMGEP ERH(IRXEP'SRWSVXMYQMR&YJJEPS2I[=SVO,I WIVZIHEWXLIGLMIJVIWMHIRXMRXLI(ITEVXQIRX SJ1IHMGMRIEXXLI:IXIVER%JJEMVW1IHMGEP'IRXIV EX&YJJEPS,IEPWSGSQTPIXIHEJIPPS[WLMTMR 4YPQSREV]'VMXMGEP'EVIERH7PIIT1IHMGMRIEX 7XEXI9RMZIVWMX]SJ2I[=SVOEX&YJJEPS&YJJEPS 2I[=SVO Medical Arts Building 8YVRTMOI%ZIRYI7YMXI 'PIEV½IPH4% ,ILEWI\XIRWMZII\TIVMIRGIXVIEXMRKWPIIT HMWSVHIVW,MW-RXIVIWXWEPWSMRGPYHIMRXIVWXMXMEPPYRK HMWIEWIW'34(ERHHMEKRSWXMGFVSRGLSWGST] www.phhealthcare.org %TTSMRXQIRXWQE]FIQEHIF]GEPPMRKLMWSJ½GI EX Moshannon Valley Community Medical Building 6EMPVSEH7XVIIX 4LMPMTWFYVK4% Punxutawney Community Medical Building ;1ELSRMRK7XVIIX 4YR\]4PE^E 4YR\WYXE[RI]4% St. Marys Community Medical Building 1MPPMSR(SPPEV,[]7YMXI 7X1EV]W4% 814-375-3770 A Service of Penn Highlands DuBois Most major insurances accepted.