ambara groundnut, Vigna subterranea (L.) Verdc.

Transcription

ambara groundnut, Vigna subterranea (L.) Verdc.
CONTENTS
i
Vigna subterranea (L.) Verdc.
Proceedings of the workshop on
Conservation and Improvement of Bambara Groundnut (Vigna subterranea (L.) Verdc.)
14–16 November 1995
Harare, Zimbabwe
J. Heller,
F. Begemann and
J. Mushonga,
editors
ii
&%1&%6% GROUNDNUT
The International Plant Genetic Resources Institute (IPGRI) is an autonomous international
scientific organization operating under the aegis of the Consultative Group on International
Agricultural Research (CGIAR). The international status of IPGRI is conferred under an
Establishment Agreement which, by January 1997, had been signed by the Governments of
Australia, Belgium, Benin, Bolivia, Brazil, Burkina Faso, Cameroon, Chile, China, Congo, Costa
Rica, Côte d’Ivoire, Cyprus, Czech Republic, Denmark, Ecuador, Egypt, Greece, Guinea,
Hungary, India, Indonesia, Iran, Israel, Italy, Jordan, Kenya, Malaysia, Mauritania, Morocco,
Pakistan, Panama, Peru, Poland, Portugal, Romania, Russia, Senegal, Slovak Republic, Sudan,
Switzerland, Syria, Tunisia, Turkey, Uganda and Ukraine. IPGRI's mandate is to advance the
conservation and use of plant genetic resources for the benefit of present and future
generations. IPGRI works in partnership with other organizations, undertaking research,
training and the provision of scientific and technical advice and information, and has a
particularly strong programme link with the Food and Agriculture Organization of the United
Nations. Financial support for the research agenda of IPGRI is provided by the Governments of
Australia, Austria, Belgium, Canada, China, Denmark, Finland, France, Germany, India, Italy,
Japan, the Republic of Korea, Luxembourg, Mexico, the Netherlands, Norway, the Philippines,
Spain, Sweden, Switzerland, the UK and the USA, and by the Asian Development Bank, CTA,
European Union, IDRC, IFAD, Interamerican Development Bank, UNDP and the World Bank.
The Institute of Plant Genetics and Crop Plant Research (IPK) is operated as an
independent foundation under public law. The foundation statute assigns to IPK the task of
conducting basic research in the area of plant genetics and research on cultivated plants.
The Department of Research and Specialist Services in the Ministry of Agriculture is
responsible for conducting research in agricultural science, and on all crops and livestock, with
the exception of tobacco, sugarcane and pigs. Forestry is also excluded from its competence.
The Department is mandated to provide services to the agricultural industry, and is entrusted
with regulatory functions under various Parliamentary Acts. It was established in 1948,
although some of its research units are over 80 years old. It is funded by the Zimbabwean
government, but aid from donor agencies has also contributed to running its agricultural
research activities.
The geographical designations employed and the presentation of material in this
publication do not imply the expression of any opinion whatsoever on the part of IPGRI, the
CGIAR or IPK concerning the legal status of any country, territory, city or area or its authorities,
or concerning the delimitation of its frontiers or boundaries. Similarly, the views expressed are
those of the authors and do not necessarily reflect the views of these participating
organizations.
Citation:
Heller, J., F. Begemann and J. Mushonga, editors. 1997. Bambara groundnut (Vigna
subterranea (L.) Verdc.). Promoting the conservation and use of underutilized and neglected
crops. 9. Proceedings of the workshop on Conservation and Improvement of Bambara
Groundnut (Vigna subterranea (L.) Verdc.), 14–16 November 1995, Harare, Zimbabwe.
Institute of Plant Genetics and Crop Plant Research, Gatersleben/Department of Research &
Specialist Services, Harare/International Plant Genetic Resources Institute, Rome, Italy.
ISBN 92-9043-299-3
IPGRI
Via delle Sette Chiese 142
00145 Rome
Italy
Dept. of Research & Specialist Services
PO Box CY 550
Causeway, Harare
Zimbabwe
© International Plant Genetic Resources Institute, 1997
IPK
Corrensstrasse 3
06466 Gatersleben
Germany
CONTENTS
iii
Contents
Foreword
v
Preface
vi
Opening Address
D. Mungate, on behalf of the Hon. D. Norman, Minister of Agriculture
1
Introduction
A.E. Goli
3
Bibliographical Review
A.E. Goli
4
Country Reports
Botswana
S.K. Karikari, D.J. Wigglesworth, B.C. Kwerepe, T.V. Balole,
B. Sebolai and D.C. Munthali
Burkina Faso
I. Drabo, P. Sérémé and C. Dabire
Cameroon
F.C. Nguy-Ntamag
Ghana
E.V. Doku
Kenya
G.W. Ngugi
Northern Nigeria
B. Tanimu and L. Aliyu
South Africa
C.J. Swanevelder
Tanzania
W.H. Ntundu
Togo
B. Nambou
Zambia
D.N. Mbewe, M.S. Mwala and G.P. Mwila
Zimbabwe
V. Mabika and P. Mafongoya
Agronomy
Nitrogen fixation and nitrogen nutrition in symbiotic bambara
groundnut (Vigna subterranea (L.) Verdc.) and Kersting’s bean
(Macrotyloma geocarpum (Harms) Maréch. et Baud.)
F.D. Dakora and L.M. Muofhe
Pests and diseases of bambara groundnut in Zimbabwe
Y. Gwekwerere
Evaluating the potential for bambara groundnut as a food crop in
11
19
27
30
33
45
50
53
59
64
68
72
72
78
iv
&%1&%6% GROUNDNUT
semi-arid Africa: an approach for assessing the yield potential and
ecological requirements of an underutilized crop
Sarah Collinson
Towards increased food legume production
J. Mulila-Mitti
Preliminary studies on the germinability and vigour of Zimbabwean
bambara groundnut genotypes
S.B. Zengeni and J. Mupamba
An overview of bambara groundnut production and research by
the Farming Systems Research Unit (FSRU) in Zimbabwe:
a case study in the Chivi Communal area
C. Chibudu
Characterization and evaluation of IITA’s bambara groundnut collection
A.E. Goli, F. Begemann and N.Q. Ng
The ORSTOM bambara groundnut collection
R.S. Pasquet and M. Fotso
Development of the International Bambara Groundnut Database
F. Begemann
Breeding bambara groundnut varieties suitable for Zimbabwean conditions
R. Madamba
An experiment to cross bambara groundnut and cowpea
F. Begemann
The potential role of NGOs in promoting conservation and use
of bambara groundnut
D. Shumba
81
89
93
98
101
119
124
128
135
138
References
143
Recommendations of Working Groups
150
Establishment of the International Bambara Groundnut Network
(IBGN) and planned activities
154
Appendix A. Workshop Programme
156
Appendix B. List of Participants
158
Appendix C. Bambara Groundnut Research
(Scientists and their Affiliations)
163
Appendix D. Institutions Maintaining Collections
165
FOREWORD
v
*SVI[SVH
Humanity relies on a diverse range of cultivated species; at least 6000 such species are
used for a variety of purposes. It is often stated that only a few staple crops produce
the majority of the food supply. This might be correct but the important contribution
of many minor species should not be underestimated. Agricultural research has
traditionally focused on these staples, while relatively little attention has been given
to minor (or underutilized or neglected) crops, particularly by scientists in developed
countries. Such crops have, therefore, generally failed to attract significant research
funding. Unlike most staples, many of these neglected species are adapted to various
marginal growing conditions such as those of the Andean and Himalayan highlands,
arid areas, salt-affected soils, etc. Furthermore, many crops considered neglected at a
global level are staples at a national or regional level (e.g. tef, fonio, Andean roots and
tubers, etc.), contribute considerably to food supply in certain periods (e.g. indigenous
fruit trees) or are important for a nutritionally well-balanced diet (e.g. indigenous
vegetables). The limited information available on many important and frequently
basic aspects of neglected and underutilized crops hinders their development and
their sustainable conservation. One major factor hampering this development is that
the information available on germplasm is scattered and not readily accessible, i.e.
only found in ‘grey literature’ or written in little-known languages. Moreover,
existing knowledge on the genetic potential of neglected crops is limited. This has
resulted, frequently, in uncoordinated research efforts for most neglected crops, as
well as in inefficient approaches to the conservation of these genetic resources.
This series of monographs intends to draw attention to a number of species
which have been neglected in a varying degree by researchers or have been
underutilized economically. It is hoped that the information compiled will
contribute to: (1) identifying constraints in and possible solutions to the use of the
crops, (2) identifying possible untapped genetic diversity for breeding and crop
improvement programmes and (3) detecting existing gaps in available conservation
and use approaches. This series intends to contribute to improvement of the potential
value of these crops through increased use of the available genetic diversity. In
addition, it is hoped that the monographs in the series will form a valuable reference
source for all those scientists involved in conservation, research, improvement and
promotion of these crops.
This series is the result of a joint project between the International Plant Genetic
Resources Institute (IPGRI) and the Institute of Plant Genetics and Crop Plant
Research (IPK). Financial support provided by the Federal Ministry of Economic
Cooperation and Development (BMZ) of Germany through the German Agency for
Technical Cooperation (GTZ) is duly acknowledged.
Series editors:
Dr Joachim Heller
Institute of Plant Genetics and Crop Plant Research (IPK)
Dr Jan Engels
International Plant Genetic Resources Institute (IPGRI)
Prof. Dr Karl Hammer
Institute of Plant Genetics and Crop Plant Research (IPK)
vi
&%1&%6% GROUNDNUT
4VIJEGI
This workshop was jointly organized by the Department of Research and Specialist
Services, Harare, Zimbabwe, and the International Plant Genetic Resources
Institute, Rome. Financial support for the workshop was provided by the neglected
crops project, funded by the German Federal Ministry of Economic Cooperation
and Development (BMZ).
OPENING ADDRESS
1
3TIRMRK%HHVIWW
D. Mungate, on behalf of the Hon. D. Norman, Minister of Agriculture
Mr Chairman, Distinguished Delegates, Ladies and Gentlemen –
I would like to welcome you all to this workshop, for which the goal is to improve
awareness among scientists of their mutual problems and of the possible
approaches to solving them, as well as strengthening international cooperation on
bambara groundnut. I would like to extend my welcome to those participants from
various African and European countries, and from international organizations. I
would also like to take the opportunity to thank the International Plant Genetic
Resources Institute (IPGRI), the Department of Research and Specialist Services for
organizing this workshop, and the German Federal Ministry of Economic
Cooperation and Development, who sponsored the event.
The specific objectives of the workshop are to:
(i) exchange information on conservation and utilization of genetic
resources on bambara groundnuts;
(ii) identify gaps and constraints in the conservation and use of this crop;
(iii) foster collaborative activities among scientists and to consider the
establishment of a network, and
(iv) develop an African plan of action for the conservation, use and research
of bambara groundnut.
Bambara groundnut, locally known as ‘nyimo’ (Shona) or ‘indlubu’ (Ndebele),
is an indigenous African crop that has been cultivated in Africa for centuries. It is a
highly nutritious plant, which plays a crucial role in people’s diets. The crop is now
grown in the continent from Senegal to Kenya, and from the Sahara to South Africa
and Madagascar. However, bambara groundnut remains one of the crops that is
most neglected by the scientific community. It is commonly referred to as a ‘poor
man’s crop’, and the plant has never been allocated a large-scale research programme.
Yet empirical evidence and the results of specific research programmes indicate that
bambara groundnut is a crop with considerable promise. As one of the two most
drought-tolerant legumes, it deserves greater attention than it has received to date.
Indeed, efforts should be intensified to conserve, improve and utilize genetic
resources in general in Zimbabwe and the rest of Africa in a sustainable manner.
It has been shown that farm yields are in the region of 500 kg/ha, yet under
research conditions, this figure can be raised to 4000 kg/ha. The difference, Mr
Chairman, lies in selecting high-yielding varieties and using well-researched
agronomic practices. The challenge, therefore, is to narrow this gap and improve
food security at household level. It is acknowledged that bambara groundnut can
be used for relish and stock fodder. It can also be used as a soil conditioner, owing
to its ability to fix much-needed nitrogen in the soil. Unconfirmed observations
indicate that the crop can suppress Striga species, a parasitic weed found in sandy
soils. The great majority of humans are now living off a maximum of 12 plant
species, compared with 100 000 edible plant species during the primitive ages. This
is because of the introduction of modern farm machinery and transport methods,
which have led farmers to concentrate on a few crops. A small group of usually very
high-yielding cereal and legume crops have replaced most of the heterogeneous local
landraces. World food production has been boosted by modern farming methods, but
at a considerable price, which may even be greater in the future. Many heterogeneous
2
&%1&%6% GROUNDNUT
local varieties of crop species have been lost forever. The loss of local species or
landraces means an irreversible loss of invaluable genetic diversity, including the
traits for local adaptation to the site where the species or variety evolved.
In our attempts to increase production, we are consciously reducing the
biodiversity that took millions of years to achieve. This process of genetic erosion
has depleted the genepool available for natural selection processes. If it is
unchecked, genetic erosion reduces genetic resistance and at the same time
increases the vulnerability of agricultural crops to sudden and abrupt changes in
climate or weather, or to the appearance of new pests and diseases. Underlying the
devastating potato famine which ravaged Ireland in the 19th century and caused
some 2 million Irish people to starve to death is the extremely narrow genetic base
of the potato cultivated at that time in Europe, as the Food and Agriculture
Organization of the United Nations (FAO) has reported.
It is my view that if we are not careful, history will repeat itself. Ways must be
found to control the genetic erosion currently occurring in our agricultural systems.
To achieve this, we need to maintain collections of representative samples of local
landraces of bambara groundnut for possible future use. The crop could also be
improved by replacing natural with artificial selection. Such strategies involve
altering the genetic composition of a plant, so that they become more ergonomically
productive, and easier to harvest and process. Scientists could improve crop yield
by increasing the harvest index. Yields of cereals such as wheat, maize and rice
have been increased primarily by raising the weight of grain relative to the straw.
Another improvement strategy involves grain quality. In theory each crop
could be improved in different ways, such as by the enhancement of nutritional
composition and cooking quality. An improved crop should resist waterlogging,
drought, pests and diseases too, and these problems also need to be addressed by
researchers and breeders.
The ability of plants to symbiotically fix atmospheric nitrogen is another aspect
of their cultivation which deserves the attention of crop breeders. A rigorous
breeding programme could be embarked on with a view to improving the nitrogenfixation capacity of the existing varieties of bambara groundnut, on which subject
few studies have been recorded to date. As nitrogen fixation is increased, soils will
become more productive. This will in turn increase food production, particularly
on African soils, which have a low inherent fertility compared with European soils.
In summary, while crop improvement strategies are desirable to increase
productivity and hence food security at the household level, there is an even greater
need to conserve genetic diversity. Bambara groundnut is one example of a crop
where the farmer still maintains some diversity. The onus is therefore on the
scientific community to increase research on bambara groundnut and to facilitate
conservation of such diversity.
But what precise role can researchers play to achieve this objective? A starting
point might be the collecting, characterization, classification and storage of
germplasm in genebanks. Members of the Southern African Development
Community (SADC) have genebanks in Zambia and Zimbabwe for this specific
purpose. However, mechanisms need to be put in place whereby material may be
returned to farmers periodically, to enable them to maintain the genetic diversity of
their crops and determine their natural resource use.
The challenge is a great one, and I look forward to reading the proceedings of
your workshop. May I now declare the workshop officially open. I hope that you
will enjoy your discussions and your stay in Zimbabwe.
INTRODUCTION
3
-RXVSHYGXMSR
A.E. Goli
IPGRI, Cotonou, Benin
It is my pleasure on this occasion to say a few words on behalf of Dr Geoffrey
Hawtin, Director General of the International Plant Genetic Resources Institute
(IPGRI), and also on behalf of Dr Franck Attere, IPGRI Regional Director for SubSaharan Africa.
IBPGR (International Board for Plant Genetic Resources), IPGRI’s predecessor,
was established in 1974 as a CGIAR centre, and operated under the administration
of FAO. Its major activity was originally the collecting and conservation of crop
germplasm for future use. With the increasing degradation of the environment,
however, IBPGR progressively expanded its role. It became a fully independent
institute in 1994, and was renamed IPGRI. The structure of the institute comprises
three thematic groups (Germplasm Maintenance and Use; Genetic Diversity;
Documentation, Information and Technology), based at headquarters in Rome, and
five regional groups across the continents (America; Asia, the Pacific and Oceania;
Europe; Western Asia and Northern Africa; Sub-Saharan Africa). The regional
office for Sub-Saharan Africa is based in Nairobi, with a local office for West Africa
in Niamey, Niger [Ed. note: now in Cotonou, Benin].
IPGRI has four principal objectives in its mandate:
(i) to assist countries, particularly developing nations, to assess and meet
their needs for conservation of plant genetic resources, and to strengthen
links with their users;
(ii) to strengthen and contribute to further international collaboration in the
conservation and use of plant genetic resources;
(iii) to develop and promote improved strategies and technologies for plant
genetic resource conservation, and
(iv) to provide an international information service on plant genetic
resources.
Distinguished participants, it will be apparent to you that the present gathering
falls within the second objective of IPGRI, i.e. the development of international
collaboration on the conservation and use of bambara groundnut genetic resources.
It is well known that bambara groundnut is an indigenous crop to this continent,
and is widely grown by rural communities in many African countries. Yet at the
same time, bambara groundnut is a crop that is neglected by our research centres.
A substantial effort to improve bambara groundnut has not been made, and yet
our countries possess all the genetic diversity needed for the improvement for this
crop, of importance to Africa’s future. It is precisely because action needs to be
taken in this regard that we are assembled here this morning.
Once again, on behalf of IPGRI’s Director General and the Regional Director for
Sub-Saharan Africa, I wish you every success with this timely workshop on
bambara groundnut.
4
&%1&%6% GROUNDNUT
&MFPMSKVETLMGEP6IZMI[
A.E. Goli
IPGRI, Cotonou, Benin
Introduction
Bambara groundnut is a popular crop in the whole of Sub-Saharan Africa. Its
cultivation seems to have preceded the introduction of the common groundnut
(Arachis hypogaea), of American origin. In many traditional farming systems, it is
found intercropped with cereals and root and tuber crops. Bambara groundnut is
reported to have been carried as far as India, Sri Lanka, Indonesia, the Philippines,
Malaysia, New Caledonia and South America, particularly Brazil (Rassel 1960), but it
seems that the present degree of cultivation outside Africa is negligible.
Taxonomy and origin
Bambara groundnut belongs to the family Leguminosae, subfamily Papilionoideae,
although further refinement of its taxonomy has been subject to some controversy.
The crop is first mentioned in the 17th-century literature (Marcgrav de Liebstad 1648),
where it is referred to as ‘mandubi d’Angola’. In 1763, Linnaeus described it in Species
Plantarum, and named it Glycine subterranea, in accordance with his system of
nomenclature. Du Petit-Thouars (1806) found the crop in Madagascar, under the
vernacular name ‘voanjo’, subsequently written as ‘voandzou’ in French. He then
proposed the name Voandzeia subterranea (L.) Thouars, which was widely used by
subsequent researchers for over a century. Recently, detailed botanical studies were
undertaken by Maréchal et al. (1978), who found great similarities between bambara
groundnut and plant species of the genus Vigna. This confirmed studies done by
Verdcourt, who seized the opportunity in 1980 to propose the current name Vigna
subterranea (L.) Verdc.
Investigators interested in the origin of bambara groundnut (Dalziel 1937;
Jacques-Felix 1946; Rassel 1960; Hepper 1963; Begemann 1988a) all agreed that the
crop originated from the African continent. The common name actually appears to be
derived from a tribe, the Bambara, who now live mainly in Mali. The exact area of
origin of the crop in Africa has been a matter of debate, however. No spontaneous or
wild forms of the crop have been found in Mali, although Guillemin et al. (1832)
reported the probable occurrence of wild forms in nearby Senegal. Bambara
groundnut was found by Dalziel in its genuinely wild state in 1901, in the North Yola
province of Nigeria. He reported that Ledermann also found the wild plant the same
year, near Garoua in northern Cameroon. Dalziel’s finding was confirmed by Hepper
in 1957. The distribution of wild bambara groundnut is now known to extend from
Jos Plateau and Yola in Nigeria, to Garoua in Cameroon, and probably beyond.
As further confirmation, Begemann (1988a) carried out detailed analyses of the
seed-pattern diversity within the large collection of bambara groundnut at IITA. He
found that samples collected less than 200 km from the putative centre of origin,
between Yola and Garoua, consistently showed a greater seed-pattern diversity.
Diversity indices for the number of days to maturity, pod length, number of stems per
plant and internode length, were comparatively higher for accessions from Nigeria
BIBLIOGRAPHIC REVIEW
5
and Cameroon. His conclusion confirmed the hypothesis that the centre of origin of
bambara groundnut is in the region of northeastern Nigeria and northern Cameroon.
The plant
Bambara groundnut is a herbaceous, intermediate, annual plant, with creeping stems
at ground level (Fig. 1a). Differences in the length of internodes result in bunched,
intermediate (semi-bunched) and spreading types. The general appearance of the
plant is bunched leaves arising from branched stems which form a crown on the soil
surface. Stem branching begins very early, about 1 week after germination, and as
many as 20 branches may be produced. Each branch is made up of internodes, and
those near the base are shorter than the more distant ones. The plant has a welldeveloped tap root with profuse geotropic lateral roots. The roots form nodules for
nitrogen fixation, in association with appropriate rhizobia. Leaf and flower buds arise
alternately at each node. Leaves are pinnately trifoliate, glabrous with erect petiole,
thickened at the base. Two stipels subtend the terminal leaflet, while only one is
assigned to each of the two lateral leaflets. The oval leaflets are attached to the rachis
with marked pulvini. The terminal leaflet is slightly larger than the lateral leaflets,
with an average length of 6 cm and an average width of 3 cm.
The flowers are borne on hairy peduncles, which arise from the nodes of the
stems. Usually, two flowers are attached to the peduncle by pedicels. A good
knowledge of the flower structure is essential for breeding the crop. Important
observations have been reported by Doku and Karikari (1971a). The flowers are
typically papilionaceous (Fig. 1b). The peduncles reach their maximum length at the
initiation of pod formation, but their pedicels reach theirs at the time of anthesis. The
interval between the opening of successive flowers in a raceme varies from 24 to
48 hours; that of flowers on the same peduncle does not exceed 24 hours, but rarely do
they open at the same time. When flowers open during the early hours of the
morning, they are yellowish-white, but towards the evening, the colour changes
through various shades of yellow to brown. Flowers that are produced towards the
end of the plant’s life are usually light brown.
The flower has a pair of hairy epicalyces. The calyx consists of five hairy sepals
(four on the upper side and one on the lower side). The four upper sepals are almost
completely joined, while the lower sepal is largely free. The epicalyx and calyx
completely enclose the corolla in the early budding stage. The epicalyx drops off
during the course of entry of the fertilized flower into the soil, but the calyx persists
on the developing pod. The standard encloses the wing and keel until the flower
opens. When the standard petal opens, it is bent over to about half its length. There is
a hollow at the tip of the keel, through which ants occasionally enter both the
unopened and open flowers (Doku and Karikari 1971b). The stamens are
diadelphous, nine with partly fused filaments, and one isolated vexillary stamen.
Upon pollination and fertilization, the peduncle elongates to bring the ovaries to or
just below ground level.
Apparently, reproductive development is not completely inhibited by light. The
pod grows first, and reaches its mature size about 30 days after fertilization. The seed
develops in the following 10 days. Mean temperature during the seasons influences
the time taken to achieve physiological maturity. Bunch types tend to mature earlier
than spreading types. Fruit development has been reported to be influenced by
photoperiod (Linnemann and Azam-Ali 1993). Long photoperiods delay or even
prevent fruit set in some cultivars. Flowering is considered day-neutral, but
6
&%1&%6% GROUNDNUT
continuous light was shown to delay flowering by 6-11 days in a few genotypes
(Nishitani et al. 1988).
The pods usually develop underground, and may reach up to 3.7 cm, depending
on the number of seeds they contain. Most varieties have single-seeded pods, but
pods with three seeds were frequently found in ecotypes collected in Congo (Fig. 1c)
(Goli and Ng 1988). Mature pods are indehiscent, often wrinkled, ranging from a
yellowish to a reddish dark brown colour. Seed colour also varies, from white to
creamy, yellow, brown, purple, red or black. Various testa patterns are found,
including mottled, blotched or striped, in addition to the predominantly uniformly
coloured seeds (Fig. 1d).
Uses
Bambara groundnut is essentially grown for human consumption. The seed makes a
complete food, as it contains sufficient quantities of protein, carbohydrate and fat.
Several workers have examined the biochemical composition of the seed (OwusuDomfeh et al. 1970; Oluyemi et al. 1976; Oliveira 1976; Linnemann 1987). On average,
the seeds were found to contain 63% carbohydrate, 19% protein and 6.5% oil. Despite
the relatively low oil content, some tribes in Congo reportedly roasted the seeds and
pounded them for oil extraction (Karikari 1971). The gross energy value of bambara
groundnut seed is greater than that of other common pulses such as cowpea, lentil
and pigeonpea (FAO 1982).
Bambara groundnut seeds are consumed in many ways. They can be eaten fresh,
or grilled while still immature. At maturity, they become very hard, and therefore
require boiling before any specific preparation. In many West African countries, the
fresh pods are boiled with salt and pepper, and eaten as a snack. In Côte d’Ivoire, the
seed is used to make flour, which makes it more digestible. In East Africa, the beans
are roasted, then pulverized, and used to make a soup, with or without condiments.
Bread made from bambara groundnut flour has been reported in Zambia (Linnemann
1990).
Seeds can also be pounded into flour and used to make a stiff porridge, which is
often kept for a long period (Holm and Marloth 1940). Roasted seeds can be boiled,
crushed and eaten as a relish. Another common use of bambara groundnut is to make
a paste out of the dried seeds, which is then used in the preparation of various fried or
steamed products, such as ‘akara’ and ‘moin-moin’ in Nigeria (Obizoba 1983).
Another favorite Nigerian dish is ‘okpa’, which is a doughy paste that is wrapped in
banana leaves and boiled. In Ghana, the beans used to be canned in gravy at GIHOC
cannery in Nsawam. The product was thus available throughout the year, and over
40 000 cans of various sizes were produced annually (Doku and Karikari 1971a;
Begemann 1986a).
Recently, a trial of bambara groundnut milk was carried out which compared its
flavour and composition with those of milks prepared from cowpea, pigeonpea and
soybean (Brough et al. 1993). Bambara groundnut was ranked first, and while all
milks were found to be acceptable, the lighter colour of the bambara groundnut milk
was preferred. Bambara groundnut has long been used as an animal feed, and the
seeds have been successfully used to feed chicks (Oluyemi et al. 1976). The haulm was
found to be palatable (Doku and Karikari 1971a), and the leaves were reported to be
rich in nitrogen and phosphorus, and therefore suitable for animal grazing (Rassel
1960).
BIBLIOGRAPHIC REVIEW
a
b
c
d
7
Fig. 1. a. Bambara groundnut – growth habit; b. bambara groundnut flowers and
stems; c. bambara groundnut pods; d. bambara groundnut – various seed colours
and testa patterns.
Genetic resources
Bambara groundnut germplasm is abundant in Sub-Saharan Africa, as the crop is
grown in every tropical region of the continent. So far, wild relatives of cultivated
bambara groundnut have only been found in northeastern Nigeria and northern
Cameroon. It is believed that the crop originated from this part of the continent.
Electrophoretic studies conducted by Howell (1990) did not reveal a significant
difference between the cultivated genotypes and the supposedly wild forms, and it
was concluded that the wild plant might simply be an escape from the cultivated
ecotype. Successful intraspecific hybridization has not yet been reported in bambara
groundnut, despite growing interest in the crop. This could limit full exploitation of
the available diversity.
The major germplasm collection held by IITA has been characterized and
evaluated, and the results are presented in this section. A few other countries such as
Zambia have also characterized their germplasm. Countries or institutions holding
important and reliable collections of bambara groundnut are listed in Table 1.
The large collection of IITA has been gathered from countries across Sub-Saharan
Africa. The provenance of the various accessions is indicated in Table 2.
Bambara groundnut seeds are orthodox, and can be stored at temperatures below
0°C. IITA maintains its base collection in a cold room at –20°C, while the collection
for distribution is kept in another cold room operating at 5°C and 30% RH. Most
national programmes maintain their collections for medium-term conservation at
temperatures above 0°C. Deep freezers are successfully used for conservation of the
base collection in a number of countries. Examples are Ghana, Niger and Zambia.
Problems reported in some countries are frequent and prolonged power failures, or
breakdowns of the refrigerating systems. Efforts have to be made by those countries
to provide standby generators and qualified technicians for maintenance of the
8
&%1&%6% GROUNDNUT
equipment. Although the collection may not be entirely characterized in some
national programmes, the accessions, as well as their passport data, are readily
available in the countries or institutions listed in Table 1. Part of the main collections
(i.e. IITA and Zambia) are compiled in the International Bambara Groundnut
Database (available on the Internet via http://www.dainet.de/genres/bambara/
bambara.htm).
The collections of bambara groundnut available in most national programmes
may not reflect all the diversity existing in the respective countries. The crop
germplasm is often collected in an opportunistic manner. Plant collectors use a
collecting mission for a major crop to include sampling of bambara groundnut. For
example, scientists at IITA have usually collected bambara groundnut samples during
collecting missions for cowpea or rice. Collecting missions primarily devoted to
bambara groundnut need to be organized in many countries producing the crop.
Where no research programme on the crop exists, an expedition organized by the
International Bambara Groundnut Network should be organized to save those
ecotypes that are in the process of extinction. Begemann (1988a) emphasized that the
existing germplasm collections hold insufficient population samples from Chad,
Ethiopia, Niger and Sudan.
†
Table 1. Countries or institutions holding bambara groundnut collections .
‡
No. of accessions
Country/institution
Benin
3
Botswana
26
Burkina Faso
143
France, ORSTOM
ca. 1000
Ghana, University of Ghana
80
Ghana, SARI
90
Ghana, PGRC
166
Guinea
43
Kenya, National Genebank
6
Kenya, KARI
2
Kenya, National Museums
2
Mali
70
Mozambique
12
Namibia
23
Nigeria, IITA
2035
Nigeria
n.a.
Niger
79
South Africa, Grain Crops Institute
198
South Africa, Institute for Veld and Forage
Utilization
117
South Africa, Department of Agriculture
20
Tanzania, NPGRC
22
Zambia, University of Zambia
463
Zambia, NPGRC
124
Zimbabwe
129
† Compiled from information provided by workshop participants, and the FAO
Early Warning System on Plant Genetic Resources databases.
‡ See Appendix D for full addresses of institutions.
n.a. = no data available.
BIBLIOGRAPHIC REVIEW
9
Table 2. Countries of origin of the bambara groundnut accessions held at IITA
Country
No. of accessions Country
No. of accessions
Benin
27
Mali
28
Botswana
5
Niger
33
Burkina Faso
97
Nigeria
310
Cameroon
207
Senegal
36
Central African Republic
103
South Africa
1
Chad
70
Sudan
7
Congo
42
Swaziland
11
Cote d’Ivoire
4
Tanzania
28
Ethiopia
1
Togo
139
Gambia
11
Zimbabwe
245
Ghana
120
Zambia
284
Kenya
2
Unidentified
101
Madagascar
49
Malawi
59
Total
2008
Breeding
Doku and Karikari (1971c) studied the evolution of bambara groundnut as a species.
These authors’ observations of 27 genotypes in Ghana led them to conclude that the
cultivated bambara groundnut originated from Vigna subterranea var. spontanea and
evolved through a series of gradual changes. Those include switching from open to
bunched growth habit, from outbreeding to inbreeding, and a reduction in shell
thickness. From the cytological point of view, all that is known is that the species has
a chromosome number of 2n=22, like many other grain legumes.
Reports on critical genetics and the breeding of bambara groundnut are limited.
Through many years of successive cultivations, farmers have selected genotypes with
desirable traits, such as high yields and bunched habit (Smartt 1985). Plants with a
bunched growth habit are easier to harvest than the spreading types. Even in
agricultural research, to date, breeding of bambara groundnut has focused on
selection between and within population samples, for yield performance, disease
resistance and drought tolerance. During characterization of the bambara groundnut
collection at IITA, single plants or entire accessions were selected on the basis of their
vigour, resistance to fungal diseases and seed yield. A total of 25 promising
accessions were retained for further yield trials at two locations in Nigeria and one
location in Burkina Faso. Yields varied from one year to another, with a strong
location effect being observed. Nonetheless, accessions such as TVSU 751, 879, 922,
1034 and 1231 (Goli and Ng 1988) and TVSU 395, 401, 501, 674, 942 and 1162
(Begemann 1988a) performed reasonably well.
A useful tool in plant breeding for selecting delicate traits is the analysis of correlations
among measurable characters, done using the results of the collection characterization at
IITA. Highly significant correlations between pairs of traits can be exploited.
Bambara groundnut’s geotropic pod development makes breeding through
artificial hybridization difficult, and such breeding has yet to be carried out. Strategies
involving crosses between different ecotypes could be used to increase the yield
potential, or to incorporate valuable genes into desirable cultivars. Unfortunately, no
reports on such experiments are available. An attempt was made at IITA to intercross
genotypes differing in seed coat and petiole colour; hand-pollination was carried out at
different times in the day, but without success (Goli et al. 1991; Begemann, pers. comm.).
10
&%1&%6% GROUNDNUT
Yet, Doku and Karikari (1971b) indicated that pollen maturity and stigma receptivity
both occur just before or soon after the standard and wing petals open. Doku (pers.
comm.) used boric acid in an unsuccessful attempt at making hand-crosses.
Agronomy
Cultivation of bambara groundnut on a large scale and in pure stand is not very
common. The crop is mostly grown by women, intercropped with major commodities
such as maize, millet, sorghum, cassava, yam, peanut and cowpea. Grown in rotation,
bambara groundnut improves the nitrogen status of the soil (Mukurumbira 1985).
Bambara groundnut thrives better in deep, well-drained soils with a light, friable
seedbed (Johnson 1968). Many farmers grow the crop on a flat seedbed, but the use of
ridges or mounds is also common in a few countries. Planting density is usually low in
farmers’ fields, especially when crops are not in rows. In experimental plots,
2
recommended plant density ranged from 6 to 29 plants/m (Rassel 1960). Farmers do
not normally apply chemical fertilizers to bambara groundnut fields. The nitrogen
requirement is met by natural N2 fixation, as indicated by several nodulation studies
(Doku 1969a; Somasegaran et al. 1990). Yield increase as a result of phosphate or
potassium application has not always been confirmed (Johnson 1968; Nnadi et al. 1981).
Bambara groundnut has a reputation for resisting pests, and compares favourably
with other legumes such as groundnut or cowpea in this regard. In humid
environments, however, fungal diseases such as Cercospora leafspot, Fusarium wilt
and Sclerotium rot are common (Billington 1970; Begemann 1986b, 1988a). In such
circumstances, spraying with the fungicide benlate (1 kg/ha) has proved beneficial.
Viral diseases are widespread in most environments, especially in areas where
other grain legumes such as cowpea are grown. Common diseases are cowpea mottle
virus (CMeV) and cowpea aphid-borne mosaic virus (AbMV) (Ng et al. 1985). A
combination of unusually heavy virus attack and Cercospora leaf spot on one
particular accession (TVSU 218) resulted in zero yield during a trial at Kaboinse,
Burkina Faso (Goli et al. 1991).
Harvesting of bambara groundnut is done by pulling or lifting the plant. For the
bunched-habit type, most pods remain attached to the root crown. Detached pods left
in the ground are collected manually. In a dry environment, harvesting takes place
when the entire foliage dries up. In humid ecosystems, however, pod-rotting or early
seed germination (in the pod) may take place while the leaves are still partially green.
Harvesting is then recommended before full foliage drying.
Harvested pods are air-dried for several days before threshing. The raw product is
sold at markets, as pods or seeds. In dry areas, materials for planting the following season
are usually kept by farmers as pods. This reduces or eliminates attacks by insects.
Future prospects
Bambara groundnut is a promising commodity which needs more publicity, both as a
crop and as a food. Even in tropical Africa, few people in the forest zones are aware
of its existence. It should be emphasized that it is a low-cost, dependable crop that
grows in harsh environments where many other crops fail. Its high nutritive value
should also be made known to the general public, and, in particular, to the rural poor.
However, to ensure the wider adoption of bambara groundnut, the general mode of
consumption of the crop needs improving. Modern processing methods would
enable distribution of bambara groundnut to non-producing areas.
COUNTRY REPORTS
11
'SYRXV]6ITSVXW
&SXW[ERE
S.K. Karikari, D.J. Wigglesworth, B.C. Kwerepe, T.V. Balole, B. Sebolai and
D.C. Munthali
Botswana College of Agriculture, Gaborone, Botswana
Introduction
The Republic of Botswana is a landlocked country covering 582 000 km², located
between latitudes 17 and 27ºS and longitude 20ºE. It is bordered by South Africa to the
south, Zimbabwe to the east, Angola and Zambia to the north, and Namibia to the west
(Fig. 1). The average rainfall varies from a maximum of over 650 mm in the Kasane area
(the Chobe enclave), located to the extreme northeast of the country, to a minimum of
just under 250 mm in the Kgalagadi district, lying to the extreme southwest. The main
rainy season is from November to March, with October and April as spring transition
months, respectively. Almost all the rainfall occurs between October and April, with
very little rainfall recorded during the winter months (May-September). Drought is a
recurrent element of the climate of Botswana. Rainfall is erratic, and occurs mainly
during the summer months, when evapotranspiration rates are high.
The climate of Botswana has important consequences for arable agriculture.
Frequent low soil moisture levels, often below those necessary to sustain continuous
crop growth, commonly result in crop failures. Consequently, dryland crop farming is
limited to short-season cereals and legumes that also have inherent drought tolerance.
Production
One of the crops which features prominently in Botswana’s farming systems is
bambara groundnut (Vigna subterranea) (called ‘ditloo’ in the local language,
Setswana). In the Ministry of Agriculture statistics (Ministry of Agriculture 1993),
bambara groundnut is grouped with pulses, and it is therefore difficult to obtain
accurate production figures. According to von Rudloff (1993), however, the crop is
grown over an estimated area of 1500 ha, from which a total yield of about 400 t of
seed is obtained annually. Bambara groundnut has the third highest production of
the grain legumes, coming after cowpea and groundnut, and is more common in
markets than mung bean (Vigna radiata) and tepary bean (Phaseolus acutifolius)
(Karikari, private survey).
Throughout the country, bambara groundnut is often cultivated in
mixed/intercropping systems. However, production is more concentrated in the
northern and eastern parts of the country, along the railway, where population
densities are relatively high and land availability limits farm size. Sorghum, millet
and maize are the principal crops, grown mainly for subsistence, and these are
intercropped with cowpea, bambara groundnut, melons and vegetables. In the
Tutume, Francistown and Tati districts, where millet is the main cereal staple, it is
usually intercropped with bambara groundnut. It is in these areas, therefore, that
bambara groundnut production is most concentrated (Chaba 1994).
12
&%1&%6% GROUNDNUT
Fig. 1. Republic of Botswana, boundaries and location of bambara groundnut
germplasm collecting sites.
Uses
In Botswana, bambara groundnut is predominantly grown for human consumption.
Consumers often prefer the immature seeds, which are boiled in the pod, salted, and
consumed, either on their own or mixed with maize seeds. When the seeds are ripe
and dry, they are pounded into a flour and used to make a variety of cakes, or are
mixed with cereals and used to prepare several types of porridge. Livestock,
especially goats, are very fond of the haulm, which they are allowed to graze on at the
end of the season, after the pods have been harvested. The seeds of the mature black
landrace are used in traditional medicine.
COUNTRY REPORTS
13
Genetic resources
The first collecting and evaluation of bambara groundnut germplasm was carried out
before 1947 (Ministry of Agriculture 1947). This report mentions that bambara
groundnut was grown throughout what was then the Bechuanaland Protectorate,
where it was never grown as a cash crop on a large scale, but was consumed chiefly as
a dietary supplement and as a delicacy. The report also mentions the drought
tolerance of bambara groundnut, which meant that it tended to do better on sandier
soils and in the drier areas of the country.
The first trial to evaluate the yield of seven landraces was planted at the Ministry
of Agriculture Research Station at Sebele in December 1958, and was harvested in
April 1959. The varieties were collected from native crops and classified by seed
characteristics, including colour of the testa, seed size and eye pattern. The total
rainfall during the crop’s growing period was 494 mm, and yields ranged from 0.163
to 0.197 t/ha. It is interesting to note that the yield of the bambara groundnut was
about twice that of groundnut planted in a variety trial in an adjacent field.
The next germplasm collection was made in April 1985. The two-man collecting
team consisted of a plant geneticist and an IBPGR consultant. The trip, which was
funded by IBPGR, was mainly aimed at collecting groundnut, bambara groundnut
and finger millet germplasm. Collecting was done in the northeastern, Tutume and
Kgatleng districts, and the members of the team observed that there were three
distinct types of bambara groundnut in Botswana. These were chiefly based on
pericarp colour, and comprised the white, amber and black pericarp types. Bambara
groundnut was found being grown on ridges, in small patches in sorghum and pearl
millet fields. One-seeded types were common but two-seeded types were also found.
Under severe moisture stress, where groundnut did not produce kernels, bambara
groundnut produced small filled pods, revealing its drought tolerance (Mazhani and
Appa-Rao 1985).
The germplasm collected (Table 1) was characterized and conserved by Mazhani.
The material collected by Mazhani (Department of Agricultural Research (DAR)
collection) has been widely distributed. However, none of these varieties is known to
have been officially released by the DAR.
The Botswana College of Agriculture (BCA) collection is only a recent one, and
was created to obtain more materials for evaluation work, and also for the European
Union-funded International Bambara Groundnut Research Project (see Dr Sarah
Collinson’s paper, this volume). A total of 26 landraces have been collected to date,
and have been characterized using the IBPGR Descriptors List (IBPGR/IITA/GTZ
1987).
The classification criteria are as follows:
• location – area of Botswana where the seeds were collected, or where they
originated (Botswana, Gaborone, Diphiri, Tshesebe, Zimbabwe, etc.)
• base colour of testa and pattern – red, black, cream, white, specked, mottled, etc.
• growth habit – bunch, semibunch, spreading
• individual collector – OM 1, OM 2, etc.
• peculiar features – short stemmed, long stemmed, leaf arrangement, venation,
etc.
14
&%1&%6% GROUNDNUT
Table 1. Bambara groundnut samples collected in Botswana (April 1985).
Collection no.
District
Exact location
MA 14
North East
Tsamaya
MA 15
North East
Tsamaya
MA 56
North East
Masunga
MA 57
North East
Masunga
MA 73
Kgatleng
Rasesa
MA 74
Kgatleng
Rasesa
MA 75
Kgatleng
Rasesa
MA 76
Kgatleng
Rasesa
MA 77
Kgatleng
Rasesa
(IWGVMTXMSRSJWSQISJXLIEZEMPEFPIPERHVEGIW
The following landraces have been described and evaluated over four seasons (199195), on the basis of the above characteristics. Other landraces not listed here are in the
process of being evaluated.
>MQFEF[I6IH2EXMSREP8IWXIH7IIH6IHr2876
The source of this seed is the National Tested Seed of Zimbabwe, and it was obtained
in 1991, for the experiments contained in the EU project described in Collinson’s
paper. The seeds are large (100-seed weight is 53 g). Seeds are oval shaped, and have
a mean length and width of 10.8 and 9.1 mm respectively, with a white hilum, but no
peculiar eye characteristics. The seeds are quite uniform in colour, with very little
segregation into different colours, although different shades of red do appear.
&SXW[ERE6IH&SX6
The Botswana Red landrace was obtained from the Botswana Agricultural Marketing
1
Board (BAMB). The colour of the seeds, light reddish brown, is similar to that of the
Zimbabwe Red, but the seeds are smaller. It also does not have peculiar eye
characteristics. Over three evaluation seasons, it has shown less seed colour
segregation.
+EFSVSRI6IH+EF6
All the red-seeded varieties obtained from three markets in Gaborone (the main mall,
Broadhurst mall and the railway station markets) have been classified as Gaborone
Red (GabR1, GabR2 and GabR3, respectively).
+EFSVSRI'VIEQ+EF'
A cream-seeded landrace obtained from the same markets in Gaborone (the main
mall, Broadhurst mall and the railway station), and classified as GabC1, GabC2 and
GabC3, respectively.
(MTLMVM'VIEQ(MT'
The only landrace obtained from the southern district. This has the characteristic
uniform cream colour, and has also been classified into two varieties: black eye
(DipC1 ) and brown eye (DipC2).
1
Courtesy of Mr Felix T. Mmopi, Chief Crop Production Officer.
COUNTRY REPORTS
15
8WLIWIFI'VIEQ8WL'
Tshesebe is in the heart of the bambara groundnut growing area of the northern part
of the country, where the cream colour predominates. This landrace is cream with no
eye pattern. Over the years, this landrace has segregated, with two white landraces
identifiable from the original TshC; these have been named Tshesebe White 1 (TshW1)
and Tshesebe White 2 (TshW2).
+EFSVSRI&PEGO+EF&
Although the black-seeded landrace is not very popular with local consumers, it is
more expensive than other landraces, owing to its use in traditional medicine (when
eaten, it is reputed to act as a strong male aphrodisiac). It has a characteristic shiny
black colour with white eyes. It segregates into other colours, especially brown, and
the occurrence of both black and brown seeds in one single pod is common.
31SXW[EWIPI31
The landraces OM1 and OM2 were named after the collector O. Motswasele (now
deceased). The seeds of both are light brown in colour, and have characteristic specks
of black on the seed. In OM1, the specks are concentrated around the hilum, but in
OM2 they are uniformly distributed on the seed, and are described as entire specks.
OM6 also has light brown seeds, but without the characteristic specks observed in
OM1 and OM2.
:EVMEFMPMX][MXLMRXLIPERHVEGIW
4L]WMGEPGLEVEGXIVMWXMGW
The seeds of the landraces are all oval-shaped, and the mean seed length is 10.8
(±0.1 mm). The physical characteristics of all the seeds were measured as part of a
project to design a commercial planter for large-scale cultivation of the crop (Nape
1995), and Zimbabwe Red (NTSR) was found to have the largest seeds. However, it
has not been established that seed size is genetic, as under severe moisture stress,
OM6 produced the largest seed.
2YXVMXMSREPWXYHMIW
The chemical composition of the landraces has been determined: protein content
varied from 8.2 to 16.6%; carbohydrate from 51.2 to 57.0%; fat from 5.5 to 6.8%; fibre
from 5.5 to 6.4% and ash from 3.2 to 4.0%. The different landraces were also high in
mineral content (mg/100 g), with the following ranges: Ca 95.8-99; Fe 5.1-9.9; K
1144.7-1435.5 and Na 2.9-10.6. The dark-seeded landraces (red and black) tended to
have higher nutrient and mineral contents than the light-seeded ones (cream and
white) (Gibbons 1994). Local people are unaware of this fact, however, and tend to
prefer the light-coloured seeds for consumption, perhaps owing to their shorter
cooking time and superior flavour.
+VS[XLLEFMX
Two growth habits occur in the landraces in Botswana: bunch and spreading. The
local red and black landraces are spreading types, but the cream and white landraces
are all of the bunch type. Under various spacing and irrigation conditions, Zimbabwe
Red (NTSR) had a semibunch growth habit. The spreading types were also found to
produce a few tillers. In actual field measurements, the spreading types could attain a
canopy spread of 120 cm or more, but at average spacing of 30 x 30 cm, the bunch
types did not form close canopies.
16
&%1&%6% GROUNDNUT
(E]WXSJMVWXJPS[IVMRKJPS[IVMRKERHQEXYVMX]
Days to first flowering took 44-60 days after sowing, and generally within 80 days,
50% of plants had flowered. It took 120-155 days for pods to mature. The cream
landrace produced more flowers and also matured earlier than the red landrace. OM6
had a tendency to germinate in the pod, if not harvested soon after maturity.
0IEJWLETIERHGSPSYV
The terminal leaflet shape was characteristic for the landraces. We observed that the
red and black landraces had broad leaves, and the cream and white had narrow-tolanceolate leaves. It was difficult to distinguish the varieties by leaf colour, but in
general, the primary leaf colour at maturity was deep green for the black and the red
landraces, and light green for the cream varieties (Kebadumetse 1994).
=MIPHSJWIIHWERHWLIPPMRKTIVGIRXEKI
Yields were very variable: the highest yield obtained was 1.7 t/ha for Zimbabwe Red.
All other red-seeded landraces had low yields. Lower yields have always been
recorded for the cream-seeded landraces, and on some occasions, no yields were
obtained from these landraces at all. Shelling percentage ranged from 18 to 22%, and
shell thickness from 0.35 to 0.47 mm. The cream and white-seeded landraces had
thinner shells and seed coats.
Conservation of germplasm
The repository for all germplasm in Botswana is the Department of Agricultural
Research of the Ministry of Agriculture, which has a Plant Genetic Resources Unit.
All germplasm activities are coordinated by a National Plant Genetic Resources
Committee (NPGRC), based at Sebele. Botswana College of Agriculture (BCA) is a
member of this committee. The DAR implements all the Committee’s activities, and
employs a full-time curator, whose office must be liaised with on all matters relating
to germplasm collecting. However, where institutions involved in research (such as
BCA) have the capacity, some germplasm is maintained in ex situ collections. Owing
to a lack of proper long-term storage facilities, the BCA collections are maintained
both on-farm and under short-term ex situ storage conditions. Records of accessions
are kept at the NPGRC centre.
Breeding/selection procedures
No breeding work on bambara groundnut has been done in Botswana, although
selection based on a number of agronomic characters has always been practised. For
example, within each landrace, early maturing lines, bunch habit and higher number
of leaves, stems, flowers, pegs and pods have been favoured. Large seed size and
pods with thicker shells, as well as those containing more than one seed, were also
favoured.
Agronomic studies
COUNTRY REPORTS
17
A number of agronomic studies of the landraces have been carried out. In a series of
sowing-date experiments, it was established that early sowing produced higher yields
than late sowing, and also that irrigation was helpful, as irrigated crops yielded twice
as much as rain-fed ones. In Botswana, however, growing bambara groundnut under
irrigation does not seem feasible for a long time to come. Studies involving
intercropping with cereals indicated that bambara groundnut did not withstand
intercropping with maize and sorghum as it did with millet. Furthermore, the
landraces responded differently; the semi-spreading ones, such as Zimbabwe Red
(NTSR), did not suffer a decline in yields under intercropping with millet, whereas
Tshesebe Cream (a bunch type) did (Chaba 1994).
Diseases and pests
The major diseases affecting bambara groundnut are Fusarium wilt, which attacks the
young seedlings of all landraces in wet weather, particularly under waterlogged
conditions, and Cercospora leaf spot, which also has been observed on crops under
irrigation. In dry weather, pod attacks by termites also have been consistently
observed, and in one particular year, 1994-95, a particularly severe attack resulted in
the loss of an entire crop. Root knot nematode (Meloidogyne javanica) also attacked the
roots of the plant in sandy soils. In storage, shelled bambara groundnut seeds were
extremely susceptible to attack by bruchids (Callosobruchus maculatus). All landraces
were attacked by this pest, but the black-seeded landrace was affected less severely.
The unshelled seed was extremely resistant to bruchid attack.
Prospects
+ETWMRI\MWXMRKGSPPIGXMSRW
Groundnut germplasm collection in Botswana is far from being completed, and
existing collections are quite limited in terms of both genetic diversity and geographic
representation. At the recent Botswana International Trade Fair, held in August 1995,
farmers exhibited a wide array of seeds, some of which were varieties not collected
during our mission. There is therefore a need for a further exploratory collecting
mission to other areas of the country not covered by the previous expedition. These
areas would include the Chobe enclave, Ngamiland and the central Kalahari.
Germplasm would continue to be made available to farmers and other interested
parties within the country and outside.
The Botswana landraces have already been distributed among all the
collaborating partners in the European Union bambara project, including Sokoine
University of Agriculture in Tanzania, Njala University College, Sierra Leone,
Wageningen Agricultural University, the Netherlands, and the University of
Nottingham, UK. Efforts made to import germplasm from outside Botswana have
yielded accessions from Malawi (16 varieties), Zambia (6 varieties) and Tanzania
(2 varieties). These should be evaluated alongside the local germplasm. All the
landraces we have collected within Botswana seem to tolerate long dry periods,
which makes them ideal for such areas of low, erratic rainfall. On several occasions,
the crop has succeeded in yielding on residual moisture, after cessation of rain, and
under conditions where even sorghum failed.
4VMRGMTEPPMQMXEXMSRW
18
&%1&%6% GROUNDNUT
The characteristics of bambara groundnut are highly variable, particularly its yield.
The poor average seed yields throughout our four evaluation seasons point to an
important limitation of the crop – a lack of broad adaptation of the species and its
landraces.
Even where moisture deficit was irrelevant, instability was still
characteristic of our bambara groundnut yields. Undoubtedly, there is genetic
variation owing to factors limiting bambara groundnut’s response to the
environment. The Zimbabwe Red and all the cream-coloured landraces showed more
stability in their seed yields than the local red and black landraces. It therefore
appears that, through judicious selection and breeding, it ought to be possible to
develop cultivars possessing greater flexibility or broad adaptation to specific
environmental niches.
Initial attempts should be made to identify those
characteristics of bambara groundnut which would be required to meet the particular
economic circumstances created by large-scale mechanized farming on one hand, and
by small-scale cultivation by peasant farmers on the other.
-QTVSZMRKXLIKIRIXMGTSXIRXMEPSJFEQFEVEKVSYRHRYX
The cultivation of bambara groundnut in Botswana suggests two ideotypes, namely:
• a bunch ideotype, for large-scale mechanized farming, where a very high
plant population would be aimed at for maximum yield, and
• a spreading ideotype, to be grown exclusively as a subsistence crop by
smallholders in a cereal-based farming system.
The important research priority would be to develop appropriate agronomic and
nutritional packages. It appears that, for this purpose, the cream-to-white landraces
would serve as a genebank for the commercial production of bambara groundut,
while the red and black landraces could provide a genebank for the ideotype required
for the rain-fed, cereal-based subsistence farming system. Researchers at the
Botswana College of Agriculture are currently working towards achieving these
objectives.
COUNTRY REPORTS
19
&YVOMRE*EWS
I. Drabo, P. Sérémé and C. Dabire
Institut d’Etudes et de Recherches Agricoles (INERA), Burkina Faso
Introduction
Given the rapid rate at which the world’s population is currently increasing in
relation to agricultural production, the goal of agronomic research must be to improve
the productivity not only of our main crops, but also of certain crops that have
hitherto been neglected. Among the latter group of crops, particular attention should
be focused on the bambara groundnut, Vigna subterranea (L.) Verdc., which flourished
before the introduction of the peanut, Arachis hypogaea (Goli et al. 1991).
Between 1982 and 1985, an attempt was made to improve bambara groundnut in
Burkina Faso. This initiative followed the collection of local cultivars in 1981, and
involved the participation of plant breeders in the Grain Legumes Programme. In the
adaptation trials we conducted, bambara groundnut was severely affected by leaf
spot and viral diseases (Sérémé 1989), and the preliminary work undertaken led us to
decide that it would be necessary to include a plant pathologist in the research team,
before continuing our bambara groundnut research (Drabo 1987). With the arrival of
two plant geneticists, the research work was carried out in 1986, and a number of
significant results have been obtained to date.
Since 1989, collections of local varieties of the bambara groundnut have been
undertaken several times in Burkina Faso. Local varieties from other countries in the
subregion (Mali, Nigeria, Niger, etc.) have also been introduced into our collection.
This paper reviews current knowledge of bambara groundnut germplasm and the
state of research on this crop in Burkina Faso.
Production and use
In Africa, the bambara groundnut is generally cultivated by women on small plots.
Production is primarily at subsistence level, and only the surplus is sold. In 1982,
world bambara groundnut production was around 330 000 t (Linnemann 1994). A
total of 150 000-160 000 t, or 45-50% of world production of the crop, came from West
Africa (Kiwallo 1991).
The bambara groundnut is grown in all regions of Burkina Faso (Table 1). In
1989, the country produced an estimated 20 000 t, making it the third largest grain
legume crop, after peanut (160 000 t) and cowpea (74 000 t) (Kiwallo 1991). Like
cowpea, bambara groundnut is produced according to traditional methods, and is
intercropped with cereals (sorghum, millet and maize), although in poorer soil, it is
mainly grown in monoculture.
The bambara groundnut is primarily consumed by its producers, during the
period before the cereals are harvested. Along with the cowpea (Vigna unguiculata
(L.) Walp.), it constitutes the main source of vegetable protein for the rural
populations of Burkina Faso. Its leaves, which are rich in protein and phosphorus, are
used as fodder for livestock.
20
&%1&%6% GROUNDNUT
Table 1. Distribution of production (t) of bambara groundnut, cowpea and peanut,
†
by crop and by CRPA (Kiwallo 1991).
CRPA
Bambara groundnut
Cowpea
Peanut
Central
360
1411
8741
East-Central
265
16 103
43 826
Comoé
714
559
20 863
North
3990
5054
8234
Mouhoun
3742
1645
10 857
West-Central
2422
11 280
9067
Sahel
231
10 570
1154
Upper Valleys
3490
3517
8879
Southwest
528
899
8483
North-Central
1201
12 695
9336
South-Central
627
1853
11 108
East
2541
8793
12 625
Total
20 111
74 379
160 075
†
Centre Régional de Promotion Agro-Pastoral (Regional Centre for Agropastoral Promotion).
Genetic resources
In 1981, local cultivars were collected in Burkina Faso by IBPGR (now IPGRI), in
collaboration with the former Institut Voltaïque de Recherches Agronomiques et
Zootechniques (IVRAZ), now called the Institut d’Etudes et de Recherches Agricoles
(INERA), with the aim of increasing the world bambara groundnut collection
established at IITA. This made it possible to launch an improvement programme.
The collection in Burkina was almost entirely lost, following very severe attacks of leaf
diseases and viruses, which occurred from one year to the next. Twice the number of
samples collected in 1981 (a total of 90 ecotypes from southwest Burkina Faso) was
submitted to IITA.
In addition to this collection, there were approximately 10 samples from the
central and other regions of Burkina Faso, 15 from Nigeria, 1 from Niger and 1 from
Ghana. Following this initial collection, a second one was conducted by a plant
pathologist from the Protein Plants Programme. This collection comprised 110
ecotypes, with the following distribution:
•
17 from southwest Burkina Faso, collected in 1990
•
57 from central, north, east and west Burkina Faso, collected in 1990
•
14 from central, east and north Burkina Faso, collected in 1989
•
17 from Mali
•
5 from Nigeria.
The collecting sites of the ecotypes in Burkina Faso are shown in Figure 1; the
overall distribution is presented in Annex A. In 1993, a collecting programme was
carried out in the southeastern, eastern and northern regions of Burkina Faso. A total
of 33 samples was obtained (see Annex B). Currently, 143 local varieties of bambara
groundnut are available in Burkina Faso, at the Kamboinse Research and Training
Station. The seeds of each accession are preserved in polyethylene containers with a
capacity of 300 g of seed. All the containers are stored in a climate-controlled room.
To maintain the viability of accessions, they are planted every 2 or 3 years.
The collection of local ecotypes in Burkina Faso is incomplete because the
sampling has been very irregular. A more intensive project needs to be undertaken,
COUNTRY REPORTS
21
to collect all existing genetic variation. In our programme, the germplasm of the
bambara groundnut was not described as such, but there are some preliminary data
on yield, 50% flowering (30-36 days) and the reaction to leaf and viral disease of many
accessions (Kiwallo 1991; Sérémé 1992, 1993).
Fig. 1. Geographic distribution of the varieties of bambara groundnut collected in
Burkina Faso between 1989 and 1991 (Source: Direction de la Vulgarisation Agricole
(Agricultural Extension Directorate).
Research
Research on the cultivation of the bambara groundnut in Burkina Faso has been very
limited, compared with that on the cowpea, and did not really begin until 1986. The
following results have been obtained.
4PERXTEXLSPSK]
0IEJWTSXHMWIEWIW
The seeds of 110 bambara groundnut cultivars (88 indigenous and 22 exotic varieties)
were analyzed according to the ISTA method, and planted in fields at the Kamboinse
and Farakoba research stations. This made it possible to identify the presence of
several major pathogens responsible for the leaf diseases of bambara groundnut that
22
&%1&%6% GROUNDNUT
are known in Burkina Faso, such as Phoma sorghina, Macrophomina phaseolina,
Phomopsis sojae, Fusarium oxysporum and Rhizoctonia solani. The role of P. sorghina and
P. sojae in the etiology of leaf spot disease was established by testing for pathogenesis.
5
6
Tests showed that 4-week-old plants, and doses of 10 or 10 spores/ml of water,
constituted ideal conditions when screening for resistant varieties (Sérémé et al. 1991).
The influence of planting date on the development of leaf diseases was examined
for 20 varieties of bambara groundnut in the central region of Burkina Faso, in a
multilocation (Kamboinse, Gampéla) and 2-year trial (1991, 1992). In the first year,
results showed a low level of grain production (23-369 kg/ha) of these varieties, and a
decrease in the severity of the disease, with early planting. This did not affect the
yield, however (Sérémé et al. 1991).
In 1992, using a wider range of planting dates, seven relatively productive
varieties were identified for at least one planting date, from 24 June to 9 July in
Kamboinse or Gampéla, with yields from 552 to 1027 kg/ha. The Benlate T20 used to
treat the seeds totally eliminated all the bambara groundnut seed pathogens. Field
treatments made it possible to gain a better understanding of the low productivity of
bambara groundnut plants resulting from leaf diseases, and to estimate the yield loss
at 83% (Sérémé 1993).
:MVEPHMWIEWIW
The use of current technologies made it possible to identify several viruses
transmitted by seeds of 17 bambara groundnut samples (Sérémé 1989). Viruses
associated with cowpea aphid-borne mosaic (CAMV), blackeye cowpea mosaic virus
(BLCMV) and peanut mottle virus (PMV) were observed. We were not able to
identify all the viruses, even if all the ones we observed were potyviruses. These
results suggest that there may be a complex of several bambara groundnut viruses in
Burkina Faso, transmitted by seed. The effect on the biomass of virus-infected
bambara groundnut plants caused was measured. In some cases, the biomass was
reduced by 63%; this demonstrates the significant extent to which these parasites
contribute to reducing the productivity of the bambara groundnut.
)RXSQSPSK]
The traditional method of preserving the bambara groundnut in Burkina Faso consists
of putting small quantities of seed in terracotta pots and mixing them with ashes.
Although bambara groundnut has been described as a healthy crop, resistant to
insects (Duke et al. 1977) in Burkina Faso, the most severe damage to this crop has
been chiefly in storage by the bruchid Callosobruchus subinotatus. The cowpea
bruchid, Callosobruchus maculatus, causes less damage. These two species of bruchids
are the main insects which attack stored bambara groundnut in West Africa
(Begemannn 1986b). However, the bambara groundnut is much less susceptible than
the cowpea to bruchids. The first collections in the southwestern area of the country
carried out in 1981 were all screened for resistance to bruchids, and no resistant
variety was identified (Dabire, unpublished).
7IPIGXMSR
Since 1994, the plant breeders in the Grain Legume Programme have conducted
adaptation trials, in order to identify the varieties of bambara groundnut with high
yield potential. Seeds are planted on flat-topped ridges, following a treatment of NPK
(14-24-14) at the rate of 100 kg/ha. Rows are planted 40 cm apart, with 15 cm between
seed holes. The 1994 and 1995 trial results are given below.
COUNTRY REPORTS
23
This trial in Kamboinse consisted of 20 entries, originating from national germplasm.
Differences in yield between the entries were significant. The difference between the
varieties was not significant for leafspot diseases or flowering. With respect to yield,
the varieties to be retained were: CVS/BF 066 (799 kg/ha), CVS/BF 065 (697 kg/ha),
CVS/BF 003 (600 kg/ha), CVS BF 038 (592 kg/ha) Yalgo local-1 (532 kg/ha), CVS/BF
004 (517 kg/ha), Douna-3 (515 kg/ha) and Dassanga (497 kg/ha).
This trial, which comprised the nine best ecotypes for 1994, was conducted in
Kamboinse on two dates (26 June and 9 July) recommended for planting in the
Central region of Burkina Faso. The average yield obtained is presented in Table 2.
Statistical analysis shows no significant difference between the planting dates and the
ecotypes. Given the high coefficient of variation (33.2%), the trial is inconclusive.
However, the low yields obtained may be explained by periods of drought during
plant growth, and the high incidence of leaf diseases and viruses. The varieties
CVS/BF 066, CVS/BF 065 and CVS/BF 003, which ranked first in 1994, reconfirmed
their superior performance in 1995.
Table 2. Average yield for two planting dates of the bambara
groundnut landraces examined in 1995 (Programme
Protéagineux 1995).
Variety
Yield (kg/ha)
CVS/BF 066
757.5
CVS/BF 065
800
CVS/BF 003
722.2
CVS/BF 038
661.3
Yalgo local
660.7
CVS/BF 004
654.2
Douna-3
527.8
Dassanga
632.9
Kamboinsé local (control)
658.8
CV (%)
33.2
Source: Rapport annuel 1995 (unpub.), Ouagadougou, Burkina Faso.
Conclusions
The various collecting missions for local varieties of bambara groundnut conducted in
Burkina Faso have made it possible to gather 143 ecotypes. Collecting was not
exhaustive, and projects to collect bambara groundnut in all regions of the country
must be planned in the short term in order to preserve the genetic variability of this
crop. Research on the resistance of the bambara groundnut revealed a complex of
pathogens that severely affect its productivity, particularly Phoma spp., Phomopsis sojae
and viruses. Methods of resisting leaf spot disease were developed by combining the
best planting dates (late June/early July) with treatments of Benlate T20. Considering
the weak purchasing power of Burkina Faso’s producers, our research programme on
the bambara groundnut aims at the genetic enhancement of the most productive local
varieties, by introducing genes resistant to Phoma spp., P. sojae, to viruses and, if
possible, to bruchids. This requires the availability of a wide range of appropriate
scientific equipment and of local varieties (indigenous and exotic), which will be
screened by plant pathologists and entomologists to identify resistant components.
24
&%1&%6% GROUNDNUT
Annex A. List of the varieties collected, 1989-93.
Accession no.†
Origin (CRPA‡ or country)
CVS BF 001
North-Central
CVS BF 002
North-Central
CVS BF 003
North-Central
CVS BF 004
North-Central
CVS BF 005
North-Central
CVS BF 006
North-Central
CVS BF 007
North-Central
CVS BF 008
North-Central
CVS BF 009
North-Central
CVS BF 010
North-Central
CVS BF 011
North-Central
CVS BF 012
North-Central
CVS BF 013
North-Central
CVS BF 014
North-Central
CVS BF 015
North-Central
CVS BF 016
North-Central
CVS BF 017
North-Central
CVS BF 018
East
CVS BF 019
East
CVS BF 0201
East
CVS BF 0202
East
CVS BF 0203
East
CVS BF 0204
East
CVS BF 021
East
CVS BF 022
Central
CVS BF 023
Central
CVS BF 024
Central
CVS BF 025
–
CVS BF 026
South-Central
CVS BF 027
–
CVS BF 0281
–
CVS BF 0282
–
CVS BF 0283
–
CVS BF 029
–
CVS BF 030
Comoé
CVS BF 031
Comoé
CVS BF 0321
South-Central
CVS BF 0322
South-Central
CVS BF 0323
South-Central
CVS BF 033
Sahel
CVS BF 035
West-Central
CVS BF 036
West-Central
CVS BF 037
West-Central
CVS BF 038
West-Central
CVS BF 039
West-Central
CVS BF 040
West-Central
CVS BF 041
West-Central
CVS BF 042
West-Central
CVS BF 043
East-Central
CVS BF 044
West-Central
CVS BF 046
West-Central
CVS BF 047
Black Volta River Loop
CVS BF 048
East
CVS BF 0491
East
Locality (or village of origin)
Banguessom
Bobo
§
–
Pissila
Pissila
Kongoussi
Barsalogo
Barsalogo
Kongoussi
Zeguedeguin
Zeguedeguin
Zeguedeguin
Samtaba
Samtaba
Zambanga
Boulsa
Toaga
Fada2
Fada1
Komyanga1
Komyanga1
Komyanga1
Komyanga1
Komyanga2
Tingandogo
Zouma
Samtenga
Gnintaya
Goulagon
–
–
–
–
–
Sidéradougou
Kassidé
Thiougou
Thiougou
Thiougou
Falagountou
Didyr
Kikiyi
Konkourou
–
Tenado
Kouyouani
–
–
Tenkodogo
Ténado
Ténado
Ténado
Nienna (Djibasso)
Bogandé (1)
COUNTRY REPORTS
Accession no.†
CVS BF 0492
CVS BF 0493
CVS BF 0494
CVS BF 050
CVS BF 051
CVS BF 052
CVS BF 053
CVS BF 054
CVS BF 055
CVS BF 056
CVS BF 057
CVS BF 058
CVS BF 059
CVS BF 060
CVS BF 061
CVS BF 062
CVS BF 063
CVS BF 064
CVS BF 065
CMV 8-4
CMV 7-1
CMV 5-3
CMV 34
CMV 39
CMV 1-15
CMV 6-1
CMV 1-2
CMV 2-2
CMV 28
CMV 20
CMV 52
CMV 21
CMV 9-1
CMV 36
CMV 40
CMV 8-2
TVSU 32
TVSU 33
TVSU 609
TVSU 649
TVSU 1140
06 K
16 K
19 K
20 K
29 K
31 K
32 K
34 K
43 K
48 K
49 K
78 K
87 K
92 K
Origin (CRPA‡ or country)
East
East
East
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Upper Valleys
Mouhoun
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Mali
Nigeria
Nigeria
Nigeria
Nigeria
Nigeria
Sahel
Sahel
North
North
Sahel
–
–
Sahel
North
East-Central
North
–
–
North
Locality (or village of origin)
Bogandé (2)
Bogandé (2)
Bogandé (2)
Satiri (1) (salla)
Satiri (2) (ramatoulaye)
Satiri (3) (niefiélaye)
Dandé (1)
Dandé (2)
Dandé (3)
Bekuy (1)
Bekuy (2)
Bekuy (3)
Karangasso vigué (1)
Karangasso vigué (2)
Karangasso vigué (3)
Koumbia (1)
Koumbia (2)
Koumbia (3)
Diouroum
Silgué (Pobé)
Gargaboulé
Zamsé
Zonon
Silgué (Pobé)
Sabraoghin
Kagbilin
Bougué
Bogoya
Cella
Soula
Tassagha
Galbogo
Bogoya
25
26
†
‡
§
&%1&%6% GROUNDNUT
Subscripts denote different colours recorded in the same accession.
Centre Régional de Promotion Agro-Pastorale (Regional Centre for Agropastoral Promotion).
– = no information available.
Annex B. List of ecotypes collected, 1993-95.
Name of collection
Origin (CRPA or country)
Kamboinsé local-1
Kamboinsé local-2
Pobé local
Titao-1
Titao-2
Titao-3
Titao-4
Pouytenga local-1
Pouytenga local-2
Pouytenga local-3
Pouytenga local-4
Pouytenga local-5
Pouytenga local-6
Pouytenga local-7
Dassanga local
Kambo local-1
Kambo local-2
Kambo local-3
Kambo local-4
Kambo local-5
Nyaogo local-1
Nyaogo local-2
Youngo local-1
Youngo local-2
Youngo local-3
Youngo local-4
Gombousgou local-1
Gombousgou local-2
Sanga local
Bagré local-1
Bagré local-2
Douna local
Kayao local
Central
Central
Sahel
Yatenga
Yatenga
Yatenga
Yatenga
North-Central
North-Central
North-Central
North-Central
North-Central
North-Central
North-Central
South-Central
South-Central
South-Central
South-Central
South-Central
South-Central
East-Central
East-Central
East-Central
East-Central
East-Central
East-Central
East-Central
East-Central
East-Central
East
East
Comoé
Southwest
Locality (or village)
Kamboinsé
Kamboinsé
Pobé-Mengao
Titao
Titao
Titao
Titao
Pouytenga
Pouytenga
Pouytenga
Pouytenga
Pouytenga
Pouytenga
Pouytenga
Dassanga
Kambo
Kambo
Kambo
Kambo
Kambo
Nyaogo
Nyaogo
Youngo
Youngo
Youngo
Youngo
Gombousgou
Gombousgou
Sanga
Bagré
Bagré
Douna
Kayao
COUNTRY REPORTS
27
'EQIVSSR
F.C. Nguy-Ntamag
University of Dschang, Cameroon
Introduction
Cameroon covers an area of 474 442 km², and contains exceptionally diverse physical
environments. The country extends from latitudes 2º to 13°N, its altitudinal range
from sea level to over 4000 m, and spreads from coastal mangrove swamp to the
remote continental interior. Above latitude 6°N, rainfall varies from 800 to 1700 mm
annually, and the mean temperature is 28°C, with an annual amplitude of 10-15°C
depending on latitude, and a daily amplitude of 20°C. Below latitude 6°N, annual
rainfall ranges even more widely, from 1900 to 4000 mm, and the mean temperature is
around 25°C, with an annual amplitude of 3°C and a daily amplitude of 5-10°C.
Bambara groundnut is successfully grown above and below latitude 6°N, which
reveals its great adaptability to a wide range of environmental conditions. It is a
staple food for the population of part of the central, littoral and the most northern
provinces.
Research
Predictably, bambara groundnut is one of the crops that is most neglected by
researchers in the Cameroon, and as far as is known, it has not yet been studied by
any of the country’s agricultural research institutes. The crop’s advantages have been
reported (National Academy of Sciences 1979), and dishes prepared with bambara
groundnut are highly valued in the author’s tribe. She began her research on the crop
mainly in the littoral and western provinces in March 1989, and divided it into a
number of phases, described below. So far, phases 1 and 2 have been carried out.
1. Survey, collecting and characterization of local cultivars.
2. Tests for yield potential and yield variability among the cultivars collected.
3. Biochemical analysis, and screening for superior cultivars, on the basis of
yielding ability and nutritional value.
4. Investigation of the physiological parameters that could account for yield
variability.
5. Improvement of the crop’s management in the traditional farming systems of
Cameroon.
Survey
In the areas surveyed, bambara groundnut is mainly cultivated by women, on small
farms, and is primarily destined for home consumption. Part of the harvest, however,
is given away as presents to relatives and friends living in urban areas. Some may
also be sold to obtain cash. As is mentioned elsewhere in this book, statistics on
bambara groundnut production do not exist. The crop is mainly consumed fresh.
The whole pods are boiled, and the seeds are eaten as a snack. Fresh testa-free seeds
are cooked with seasoning and eaten as a complete meal, or they are ground to make
a pudding (traditional cake), to which taro leaves are sometimes added.
28
&%1&%6% GROUNDNUT
Bambara groundnut is often mixed with the other crops, including peanut, maize,
cassava, cocoyam, common bean and yams. It is sown on ridges or mounds. Ridges
are 30-40 cm apart and 2-3 seeds are sown per hole, 20-25 cm apart. Mounds vary
greatly in size, depending on the farmer. The average mound is 40 cm wide
(diameter) and 30 cm high. They are approximately 50 cm apart. Each mound
contains one hole, which receives 2-4 seeds at sowing.
Large and hole-free seeds (which should be
previous harvest for
undamaged)
are chosen from the sowing.
No
sowing. In some areas,
fertilizer or any other chemical treatment is applied.
bambara groundnut can
Weeding and earthing-up are carried out
be sown twice a year, in
simultaneously, 2-3 times before harvesting. Whole
February-April and in
pods are sun-dried and kept in bags for the next
August. Harvesting is
cropping season. Occasionally, the pods are shelled,
done by hand, 3-5 months
and the dry seeds are carefully wrapped in
after
calabashes, with or without wood ashes.
No major diseases of bambara groundnut have
been identified to date, owing to the lack of research
carried out on the crop. Although no farmer has complained of a serious reduction in
production caused by diseases or pest attacks, it was obvious from the author’s survey
that all parts of the plant (leaves, roots and pods) were attacked.
In the rare instances where bambara groundnut is grown by men, the crop is
cultivated in pure stand, and is usually destined for commercialization. Cultivation is
carried out on ridges or beds, with an average plant spacing of 30 x 25 cm.
Collecting and characterization
Cultivars were collected from farmers and local markets. The following testa colours
have been identified: black, cream, dark brown, light brown, dark red, light red,
brownish red, dotted brown and dotted cream. In the environmental conditions
prevailing in Dschang (West Province), plants emerged 7-10 days after planting
(DAP). Flowering occurred 57-69 DAP, with an average of 64 DAP. Cultivars
exhibited different growth habits: spreading, bunch and semi-bunch type. Seed
weight varied from 380 to 470 mg/seed, with an average of 430 mg/seed.
=MIPHZEVMEFMPMX]ERHTL]WMSPSKMGEPXVEMXW
A mathematical equation relating the estimated leaf area (ELA, length x width of
leaflets) to the actual leaf area (ALA) was found:
ALA = 0.71 ELA+ 0.23
This equation is useful to researchers who lack adequate tools for determining leaf
area. The leaf area index, the ratio of the leaf area of a group of plants to the area
occupied by those plants, is an important parameter in growth analysis, and appears
to be a useful criterion in the search for high yielding ability (as are other
physiological features in crop selection). Total crop growth rate ranged from 0.44 to
-1
-1
-1
-1
1.27 g·plant ·day , and averaged 0.72 g·plant ·day , while pod growth rate varied
from 0.52 to 0.72 g, with an average of 0.61 g. Partitioning coefficients ranged from
104 to 130% for most cultivars (only brown cultivars had partitioning coefficients of
less than 50%, approximately 48%).
COUNTRY REPORTS
29
Harvest index, expressed as the ratio of pods to the whole plant, ranged from 0.42
to 0.49 and averaged 0.45. Shelling percentage was highly variable, ranging from
about 17 to 55%, with an average of 35%. Yield on a plant basis varied from 13.40 to
47.16 g/plant and averaged 28.89 g/plant. Considering the plant spacing used in the
trial (40 x 25 cm), this would give a yield range of 130-470 kg/ha, with an average of
290 kg/ha. These values fall into the range indicated in bambara groundnut literature
for African yields.
Prospects
Subject to the availability of funds, the author intends to:
• extend the survey in the northern regions of the country, where bambara
groundnut seems to be important, as it is grown in pure stand and apparently
receives fertilizers
• continue collecting accessions (having found cultivars with different testa colours)
• continue investigations of the crop through the implementation of phases 3, 4 and
5 of the research programme described above, leading to:
(i) evaluation of the nutritional value of different cultivars
(ii) assessment of the nature and extent of the relationships between leaf area
index, harvest index, partitioning coefficient, grain/pod-filling period and
yields
(iii) determination of the optimal harvest period, in order to minimize losses due
to overmaturity (where pods will rot), or immaturity, as harvesting cannot be
done gradually, owing to underground fruiting
(iv) improvement of cropping techniques (optimal plant density in sole and
multiple cropping; the best species in the association; plant arrangement in
intercropping; the use of fertilizers, including type, dose and application
period; type of sowing beds, i.e. ridges, mounds or flat).
In collaboration with colleagues in the Plant Protection Department, pathological
and entomological aspects will be addressed, as the author has noticed leaf, root and
pod damage in the field. The author hopes to publish her research on bambara
groundnut in a PhD thesis, and wishes to exchange information on the crop, through
the Bambara Groundnut Research Network.
30
&%1&%6% GROUNDNUT
+LERE
E.V. Doku
University of Ghana, Accra, Ghana
Introduction
According to the 1970 Ghana Agricultural census, there were 28 700 ha of bambara
groundnut under cultivation in the Upper Region, and only 2800 ha in the rest of the
country. In recent years, a number of factors have contributed to a decline in the
importance of the crop in Ghana. These include inadequate research and funding to
improve existing varieties and cropping systems, and, most significantly, the
introduction of soybean. Although it is not as drought-tolerant as bambara groundnut,
soybean appears to be much easier to cultivate, and the yields of improved varieties are
much higher. Soybean has also received such considerable material and financial
support that in about 5-10 years, it is likely to be the leading food legume crop in Ghana.
Statistics are not available on the area under cultivation, the average yield, and total
national production of bambara groundnut, all of which have decreased. Nonetheless,
bambara groundnut still remains the third most important food legume crop in Ghana,
after cowpea (Vigna unguiculata) and peanut (Arachis hypogaea).
Although the crop has not received government or international support in Ghana,
work on bambara groundnut in the late 1960s and early 1970s gained international
recognition. The University of Ghana believed that IITA had been mandated to work
on the crop, and passed our germplasm collection to it, in the hope that our research
workers and students would have the opportunity of working on the crop at IITA. As is
well known, IITA’s mandate for the crop was very short-lived. In the interim our
germplasm collection disappeared, so we are now having to build it up from scratch.
Cropping system
Bambara groundnut is cultivated in the drier Sudan, Guinea and coastal savanna
zones of Ghana, where the annual rainfall ranges from 800 to 1200 mm. In the Guinea
savanna zone, the crop is usually grown during the minor season (SeptemberNovember), when the rainfall is reliable. In the Sudan savanna zone, it is usually
cultivated towards the end of the single long rainy season.
There are very few bambara groundnut cropping systems, and these have
changed little. In southeastern Ghana (the eastern Greater Accra and southern Volta
regions), and also in northern Ghana, the crop is always grown at high densities, in
pure stand and in rotation with cereals, etc. Recently, however, some farmers in the
southern regions have started growing mixed stands of bambara and peanuts, the
seeds being mixed before broadcasting. In the other growing areas of northern
Ghana, it is usually grown as a mixed crop, with sorghum and millet. There is also a
trend towards mixed cropping with yams, the bambara groundnut being planted on
yam mounds that would otherwise have remained bare (except for the straw cap or
mulch) for a long period. The bambara crop protects the mounds from erosion,
conserves moisture and creates fewer temperature fluctuations in the mound. There
are no yield or crop performance data for the various cropping systems. However,
farmers’ yields are believed to be very low, ranging from 0.5 to 0.8 t/ha. In the
absence of improved varieties and cropping systems, yields are likely to decline.
COUNTRY REPORTS
31
Uses
The high carbohydrate (65%) and relatively high protein (18%) content of bambara
groundnut make it a complete food. In northern Ghana, the fresh immature beans are
boiled and consumed after adding a little salt. The dry beans are also boiled, crushed
and made into cakes or balls, which are then fried and used to prepare stews. In
southern Ghana, the beans are usually soaked overnight, after which they are boiled
until soft, to produce a kind of porridge/blancmange. Capsicum pepper and salt may
be added during the boiling process. This preparation, called ‘aboboi’, is served with
‘gari’ (roasted, grated cassava) or with mashed, fried, ripe plantain. In the early 1960s,
bambara groundnut was canned in Ghana, in tomato sauce with pieces of meat, in
brine, or as ‘aboboi’. Canned bambara groundnut was very popular, and competed
favourably with Heinz baked beans, but the state-owned cannery has now collapsed.
Genetic resources
Local germplasm collecting and foreign introductions began in the early 1960s. The
local materials were from the principal growing areas, and the foreign introductions
came from northern Nigeria, East Africa and Zimbabwe. Accessions are normally kept
in cold storage in bottles or polythene bags. Institutions holding germplasm collections
in Ghana are: the Crop Science Department, University of Ghana (80 accessions); the
Savanna Agricultural Research Institute (SARI) (formerly Nyankpala Agricultural
Experimental Station) (NAES, 90 accessions) and the Plant Genetic Resources Centre
(PGRC, 166 accessions). Both SARI and PGRC are institutions under the aegis of the
Council for Scientific and Industrial Research (CSIR).
Primary evaluation of collections is carried out for yield, maturity period, pest
and disease resistance, and characters by which they can be readily identified. These
include seed coat and eye colour, growth habit (bunch or spreading), colour of stem,
petiole length and leaflet size. The findings of research completed at the Crop Science
Department, University of Ghana, on some 70 local and exotic accessions, indicated a
three-fold categorization of characters with respect to their variation:
(i) plant base spread and petiole length (the most variable)
(ii) number of branches/plant (moderately variable)
(iii) canopy spread, leaflet length and width (the least variable).
It was suggested that the characters in category (i) could be most usefully
employed in a primary grouping, and those in categories (ii) and (iii), in secondary
and tertiary groupings, respectively. However, preliminary visual grouping into
open, bunch and intermediate types indicated quite clearly that, taken by themselves,
the numerical values representing the character did not match the observed form. For
example, some visually observed open types had similar values to the intermediate
and bunch types for canopy and plant base spread, as well as for petiole length.
Further examination of the data revealed that the ratio of plant canopy spread to base
spread was the only parameter that could accurately represent the observed forms,
without any overlap between the groups. Group A cultivars (open type) had canopy:
base ratios of from 1:1-1.4:1, Group B cultivars (intermediate), from 1.9:1-3.5:1, and
Group C cultivars (bunch), of 4:1 and above.
32
&%1&%6% GROUNDNUT
Research
Very little work is being done on the bambara groundnut crop at present, and the
main research efforts are concentrated on variety characterization, and testing to
assess yield potential, components and yield-related characters. Some work is in
progress on Bradyrhizobium relationships and nitrogen fixation (Samasegaram et al.
1993; Kumaga et al. 1994). Research is also being carried out to ascertain the
relationships between growth habit and breeding system, and to confirm an earlier
finding (Doku 1969a) that open and semi-bunch cultivars depended more on the help
of ants for effective pollination, fertilization and pod formation than the bunch types.
The flower stalk is very brittle (and there appear to be no varietal differences in this
character), and so flower handling for emasculation is not possible, as flowers drop very
readily. Boric acid (H3BO4) application to the flower buds (0.1 ml of 200 ppm) prevented
pollen sac dehiscence and pollen tube germination with subsequent flower dropping.
The task now facing researchers is to find boric acid concentrations (150-180 ppm) that
will induce male sterility, without immediate flower dropping, to permit pollination
and fertilization by nearby plants with the aid of ants. This information is needed
before any meaningful hybridization work can start.
The crop is relatively pest- and disease-free. Apart from weevil attack during
storage, there are no serious field pests. Diseases affecting bambara groundnut
include leaf spot (Sclerotium rolfsii, Phyllosticta spp.) and late blight (Corticium solani).
Cowpea mild mottle virus has recently been confirmed on bambara groundnut
(P. Lamptey, pers. comm.).
COUNTRY REPORTS
33
/IR]E
G.W. Ngugi
National Museums of Kenya, Nairobi, Kenya
Introduction
The Republic of Kenya covers an area of 587 900 km2, of which 576 700 km2 (about
2
98% of the total area) is land surface, while the remaining area of 11 200 km is
inland waters, mostly Lake Turkana and part of Lake Victoria (about 2% of the total
2
area). About 80% of the land surface (461 400 km ) is arid and semi-arid land
2
(ASAL). The remaining 20% (115 300 km ) of the total area (which includes inland
water) is of medium to high agricultural potential.
Land use and population distribution
About 80% of Kenya’s population, which stands at around 24 million people, lives
on land of high agricultural potential (20%). Land is considered the most valuable
resource in Kenya, where a recent report described the situation as follows:
“The demands on the available land for various uses are many, and
often create tremendous pressures and conflicts. Sustainable land-use
planning becomes crucial, as it enables the available land to be used in
such a way that it brings optimal benefits to the users, while having
minimal negative impact on the environment.”
(Page 116 in Kenya National Environment Action Plan (NEAP) Report,
June, 1994, Ministry of Environment and Natural Resources, Nairobi.)
The ASALs are thinly populated, and mainly support pastoral communities.
Kenya’s population is made of about 60 ethnic groups and subgroups, and the
majority of Kenyans live in the medium- to high-potential areas, where crop
growing is the main economic activity. Population pressure in these higherpotential areas has resulted in migrations to the ASAL areas, which are suitable for
livestock keeping. Mixed farming is predominant in most of the areas that can
support agriculture. Diverse farming systems have been developed by the various
ethnic groups, who possess a high level of indigenous agricultural knowledge.
An average of 6.5% of the rural population migrates to urban centres annually.
This has resulted in a large city-dwelling population, which presently stands at over
5 million (5.2 million in 1992, 22% of the country’s population). The production,
marketing and use of traditional crops have been affected by the urban population’s
tendency to adopt exotic feeding habits, leading to loss of traditional knowledge on
food preparation.
Climate
Kenya can be divided into seven climatic zones, based on rainfall and potential
evaporation, and nine temperature zones, ranging from the cold highlands of the
interior to the hot coastal and desert regions (Tables 1 and 2, Fig. 1). Reliable
rainfall, adequate for cultivation, can only be expected over 15% of Kenya. Rainfall
is greatest at the coast, in the west of the country, near Lake Victoria and in the
34
&%1&%6% GROUNDNUT
highlands. The extensive plains below 1200 m asl are arid or semi-arid, however.
In the region of Lake Victoria, and in the highlands west of the Rift Valley, rain falls
in one long rainy season. East of the Rift Valley, there are two distinct seasons: the
long rains (March-May) and the short rains (September-October).
The Kenyan soils can be divided into 10 groups, on the basis of various
properties related to crop production and soil management (Table 3).
Table 1. Agroclimatic zones of Kenya.
Zone
I
II
III
Average annual
Rainfall,
Potential
mm (r)
evap., mm (E°)
1100-1700
1200-2000
1000-1600
1300-2100
800-1400
1450-2200
Classification
r/ E° (%)
80 humid
65-80 sub-humid
50-65 semi-humid
Typical vegetation
moist forest
moist to dry forest
dry forest and moist
woodland
IV
600-1100
1550-2200
49-50 semi-humid/
dry woodland and
semi-arid
bushland
V
450-900
1650-2300
25-40 semi-arid
bushland
VI
300-550
1900/2400
15-25 arid
bushland and
scrubland
VII
150-350
2100-2500
15 very arid
desert scrub
Source: Braun, H.M.H et al. 1980. Agro-climatic zone map of Kenya, scale 1:1,000,000.
Ministry of Agriculture, Kenya Soil Survey. Nairobi, Kenya.
Table 2. Temperature zones of Kenya.
Zone
9
Mean annual
temp. (°C)
<10
Classification
very cold
Night frost
very common
Altitude
(m)
>3050
8
10-12
cold/very cold
common
2750-3050
7
6
12-14
14-16
cool
fairly cool
occasional
rare
2450-2750
2150-2450
5
4
3
2
1
16-18
18-20
20-22
22-24
24-30
General
description
Afro-Alpine
highlands
Upper
highlands
Lower
highlands
cool temperate
very rare
1850-2150
warm temperate none
1500-1850 Midlands
fairly warm
none
1200-1800
warm
none
900-1200
fairly hot/very
none
0-900
lowlands
hot
Source: Braun, H.M.H et al. 1980. Agro-climatic zone map of Kenya, scale 1:1,000,000.
Ministry of Agriculture, Kenya Soil Survey. Nairobi, Kenya.
Crops
Maize is the most important cereal cultivated, followed by sorghum. Other cereals
grown include rice, wheat (in the highlands), pearl millet and finger millet. Beans
are the most important pulses, followed by cowpea, lablab, green gram and pigeon
peas (in the eastern lowlands). Crop distribution is influenced not only by climate
and soil type, but also by cultural factors. Different communities tend to grow and
eat specific foods, and adaptation to other foods has been slow or non-existent.
COUNTRY REPORTS
35
Fig. 1. Agroclimatic zone map of Kenya (source: Braun, H.M.H et al. 1980. Agroclimatic zone map of Kenya, scale 1:1,000,000. Ministry of Agriculture, Kenya Soil
Survey. Nairobi, Kenya).
Fig. 2. Distribution of bambara groundnut.
36
&%1&%6% GROUNDNUT
Bambara groundnut
Bambara groundnut (Vigna subterranea (L.) Verdc.) is a minor crop in Kenya. It is
used as a traditional food by the Luhya, by the Giriama and Kambe at the coast, and
to a lesser extent by the Luos (who probably borrowed bambara groundnut’s name
and its culinary and other uses from the Luhya). The crop can usually be grown in
relatively poor soils, and is found in hot, low-lying regions, often with sandy to
loam soils. It can be intercropped with maize, sorghum or millet, and is mainly
grown at altitudes ranging from 0 to 1550 m. Ethnobotanical surveys have shown
that bambara groundnut used to be produced in abundant quantities. Although it
is still considered a delicacy by the communities who use it in Kenya, current levels
of production are lower than those of the past.
Considering that bambara groundnut has its origin in West Africa, and taking
into account that the Bantu (within which larger group the Luhya, the Kambe and
the Giriama fall) originated from West Africa, it is the author’s opinion that the crop
migrated with them. The Bantu peoples migrated into Kenya via two routes:
1. Through Uganda (as in the case of the Luhya). According to an Elder that
the author interviewed, when the Luhya encountered those migrating
southwards from Sudan (e.g. the Luo, who are not Bantu), conflicts would
usually take place between them, with the victorious tribe appropriating the
possessions of the defeated tribe, including its seeds. It seems probable that
bambara groundnut passed into the Luo culture in this way. That the Luo
name for bambara groundnut appears to be borrowed from the Luhya
would support this hypothesis, as would the fact that the crop is not as
widespread among the Luo as it is among the Luhya culture. It is also
interesting to note that those Luo who settled at greater distances from the
Luhya recall that although bambara groundnut is no longer grown in their
areas, it was in the past.
2. To the coast and interior, via Tanzania (the migratory route of the coastal
and central Bantu, for the most part). This group may have brought seeds
with them, including those of the bambara groundnut, but the crop’s
distribution was probably affected by the environment in the places the
various groups settled in. This may explain the fact that bambara
groundnut is only found among a few Bantu peoples of the coast, notably
the Giriama and the Kambe. There is also a possibility that the crop was
introduced there from the western parts of Kenya, owing to their vicinity to
the coastal towns of Mombasa and Malindi. The majority of people
interviewed by the author who came from the central regions of Kenya
claimed not to know bambara groundnut. The few who did know the crop
recognized it from the Swahili name, and some said they had only seen it at
the coast. The Kambe the author talked to said that they only eat bambara
groundnut when other vegetables are scarce. These reports would seem to
support the crop’s introduction to the coast from the western areas of
Kenya.
According to one Luo man the author interviewed, his tribe brought bambara
groundnut with them when they migrated to Kenya from Sudan (that such a
migration occurred is supported by research findings). The same man emphasized,
however, that different tribes followed the same migratory routes, and cultural
interchange and exchange of seeds may well have occurred in the process.
According to Christopher Ehret (1985), the introduction of crops that were often of
COUNTRY REPORTS
37
considerable economic importance, represented one aspect of the gradual changes
that occurred in Kenya in the 19th century. He observes that:
“...if naming data, for instance, imply an introduction from a plant
earlier from one direction and oral evidence, its introduction from a
second direction at a later period, the normal inference would be that
linguistic data reflect first bare knowledge of the plant, and oral data,
the beginning of cultivation of the crop in significant quantities”.
Ehret (1985) also observes that terms used to name the American peanut
(Arachis hypogaea L.) raise additional historical inferences from word distribution.
Several different names are applied in different areas of East Africa to bambara
groundnut, in keeping with expectations that things develop a variety of names in
different languages, having been around through many years of language change.
But contrary to this, only two terms for the peanut, both probably being of Swahili
provenance and adopted from names of indigenous plants, developed, i.e. ‘njugu
karanga’. ‘Njugu’ is probably the early Coastal Bantu name for bambara groundnut
(but in Upland Bantu the name of pigeon pea instead), and ‘karanga’ was probably
the name for the wild plant Desmodium abscendans, which today is called ‘karanga
mwitu’ to distinguish it from the peanut. It is thus possible that the Swahili name
for bambara groundnut was later changed to describe its characteristics (‘njugu
mawe’: ‘njugu’ meaning hard, ‘mawe’ meaning stone), and to distinguish it from
the now adopted plant of similar characteristics – peanut (‘njugu karanga’).
Distribution
Bambara groundnut is chiefly grown in the western parts of Kenya, and to a limited
extent, in the coastal provinces. In western Kenya, it is mainly found throughout
the Western Province, i.e. the Bungoma, Kakamega, Busia and Vihiga districts. It is
also found in parts of the Siaya district, especially in Gem, in Masiro in East Ugenya
and in Usonga in Alego. In South Nyanza, it is found in Nthiwa, Kologi, Homabay,
Migori, Macalder and Miuru. At the coast, it is mainly found in the Kilifi district,
especially in Bahari, Kaloleni and Malindi (Fig. 2).
Bambara groundnut is generally found in agroclimatic-temperature zones I-3, I4, II-3, II-4, III-1, III-3 and IV-3, and in IV-1, VI-1, V-1 and VII-1 at the coast (Tables 1
and 2, Fig. 1), and in areas where rainfall pattern is bimodal. Rainfall at the coast is
generally low, but there is high humidity from the ocean, which probably favours
the growth of bambara groundnut. The soils in which it is found are generally welldrained, deep to moderately deep, and reddish to brown, sandy clay loam to clay.
At the coast, however, it is found in well-drained, deep fine to very fine, sandy to
sandy loamy soils, ranging in colour from yellow brown to reddish brown (Table 3).
The natural fertility status is high, moderate and low in the western parts of Kenya,
and moderate at the coast.
Local (vernacular) names for bambara groundnut in Kenya
Swahili
‘njugu mawe’
Luo
‘bande’
Luhya (Wanga/Kisa/Maragoli)
‘tsimbande’
Luhya (Bukusu)
‘chimbande’
Luhya (Tiriki)
‘simbande’, ‘zimbande’
Giriama
‘nzugu mawe’
Kambe
‘tendegwa’
38
&%1&%6% GROUNDNUT
Table 3. Summary of the broad soil groups in Kenya (Kenya Soil Survey).
Natural fertility
Group
Area (ha)
status
FAO 1974 classification
weakly developed soils 3 638 235
low
xerosols; yermosols
shallow/juvenile soils
6 697 809
moderate/high
lithosols; regosols, rankers
and rendzinas
sodic and/or saline
13 489 985 low
solonetz; solonchaks;
soils
solodic planosols
alluvial soils
1 936 582
high
fluvisols
deep/very deep soils
3 796 669
moderate
nitosols; andosols
sandy soils
436 683
very low
arenosols
poorly drained soils
5 604 302
moderate
vertisols; gleysols; other
planosols; greyzems;
chermozems; vertoluvic
phaeozems
moderately deep/deep 7 408 426
high
luvisols; cambisols;
soils
phaeozems; chernozems
deep red, strongly
6 839 464
low
ferralols, acrisols;
weathered acid soils
ironstone soils
shallow to moderately 7 688 796
high
shallow cambisols;
deep soils
luvisols; phaeozems
Source: Ministry of Environment and Natural Resources. 1994. Kenya National Environment
Action Plan (NEAP). Nairobi, Kenya.
Uses
+IRIVEPGYPMREV]YWIW
Each community has its own way of preparing bambara groundnut. Among
communities from western Kenya, for example, seeds are cooked with maize
(occasionally after overnight soaking), or on their own, then mashed, fried and
made into a stew. Stomach ache can result from eating this stew in large quantities,
although it is reported to be less upsetting to the digestion than beans. It is claimed
by some that bambara groundnut requires careful preparation, as it has a rather
bitter taste.
'YPMREV]YWIWF]XLI/EQFI+MVMEQE
Among the Kambe and Giriama peoples of the Coast Province, bambara groundnut
is normally cooked or used when vegetables are in short supply.
• When the seeds are dry, they are pounded in a ‘kinu’ (mortar) to remove the
seed coat (they do not break), winnowed and boiled until they are cooked. They
are then pounded using a ‘kipawa’ (serving spoon made from the coconut shell)
or ‘mwiko’ (wooden spoon), and ‘tui’ (coconut juice) is added. The mixture is
boiled until cooked, and stirred with a wooden stirrer (‘lufidzo’) until smooth. It
is then served with rice or ‘ugali’ (a stiff maize meal porridge).
• When the seeds are still green, the seed coat is peeled off by hand and the seeds
are then prepared in the same way as the dry ones (described above).
COUNTRY REPORTS
39
'YPMREV]YWIWF]XLI0YL]E
The Luhya consume bambara groundnut in the following ways:
• Cooked fresh in its pods (green pods are washed and boiled in salted water,
which is said to penetrate the pods). This is reported to be the tastiest snack
among the many that are made from bambara groundnut, and is rated even
more highly than the peanut.
• The dry seeds are salted while roasting (the seeds may be washed before
roasting). Owing to the hardness of the seeds, this dish is not a favourite,
especially with children. Sometimes, a small number of seeds is reportedly
roasted with a greater proportion of peanuts, to reduce the hardness effect.
• Dry seeds can either be pounded or ground and the resultant meal made into
some stew (or sauce). The stew/sauce is then added to the traditionally
prepared leafy vegetables, particularly ‘sikhubi’/‘elikhubi’ (cowpea) and
cooked. This may be served with ‘ugali’ or potatoes.
• Boiled with maize and beans and served as a snack, especially with tea.
• Fried (like peanuts), usually with sesame seeds.
• Boiled, then mixed with boiled sweet potatoes and mashed (a popular children’s
dish). It is also consumed plain, after being boiled and mashed.
• Unshelled pods are boiled, fried and served with potatoes, bananas or ‘ugali’.
'YPMREV]YWIWF]XLI0YS
Bambara groundnut is also prepared in a number of ways by the Luo:
• Used in the same way as kidney beans, to make ‘nyoyo’ (a mixture of beans and
maize boiled together), or plain boiled. This is served with tea, ‘nyuka’
(porridge), or on its own.
• Dried, ground using a ‘pong’ (grinding stone), or pounded in a ‘pany’ (mortar),
then cooked in the same way as greengrams, in a sauce traditionally known as
‘ogira’. This is served with other foods, such as potatoes. Traditionally it was
eaten using a ‘sare’ (bivalve shell from lake Victoria).
• Roasted like the peanut. This is not common, because the seeds remain hard
after roasting. Peanuts are normally added, probably to reduce the effect of
hardness.
1IHMGEPYWIWF]XLI0YSEGGSVHMRKXSSRIMRJSVQERX
• Water from the boiled maize and pulse mixture is drunk to treat diarrhoea.
• The leaves are pounded with those of Lantana trifolia L. (‘nyabend winyo’,
‘nyamrithi’), then water is added to make a solution used to wash livestock as a
preventative against ticks. This solution is used as a pesticide on vegetables too.
• The leaves can be combined with those of ‘nyajagra’ (mexican marigold) and
L. trifolia, pounded, and water added. This mixture can also be used as an
insecticide. When applying the solution to vegetables, care needs to be taken to
apply it to the ground, and not to pour it on the leaves, as it is reported to burn
them.
• When dry, the leaves are pounded with traditional salt (‘mbala’, harvested at
Sindo and Homalime), and fed to cattle infected with ‘tuoolao’ (a type of mouth
disease). The leaves cauterize and heal the animals’ wounds.
40
&%1&%6% GROUNDNUT
1MWGIPPERISYWYWIW
Among the Luhya, bambara groundnut is said to be mainly cooked for
consumption at ceremonies such as weddings, or by dignitaries. The leaves are
used for animal fodder. Also of interest are some studies undertaken by the Kenya
Energy and Environment Non Governmental Organisation (KENGO) of the
bambara groundnut as a substitute ingredient for peanut in weaning foods.
Researchers worked on traditional recipes provided by several collaborating
women’s groups, and developed four new recipes. Nutritional analysis of the new
recipes was carried out, but no palatability tests were done (Table 4).
†
Table 4. Weaning food recipes (KENGO unpublished).
Ingredients
Proportion (%)
1
Finger millet
70 (the most nutritious)
Bambara nut
25
Amaranthus (dry leaf powder)
5
†
2
Finger millet
Bambara nut
70
30
3
Sorghum
Bambara nut
Amaranthus (dry leaf powder)
70
25
5
4
Sorghum
Bambara nut
70
30
Kenya Energy and Environment Non Governmental Organization.
Agronomy
Bambara groundnut is planted in rows, or randomly. In western Kenya, the crop is
normally planted in March and harvested in August. If intercropped, it does not do
well unless the other crop (usually maize) is quite scattered (i.e. there are few
plants). It takes 5-6 months to mature, at which stage the leaves turn brown and fall
off. Harvesting is usually done by uprooting or digging out the entire plant and
picking the individual pods. The yield is said to be low during the short rains.
Unlike the peanut, however, the plants are said not to be destroyed by hailstorms.
Pests and diseases
It has been reported that if the seeds remain underground for a long period, they are
eaten by termites, but that, unlike peanuts, insects do not attack them during the
growth period. If stored when shelled, they are said to be attacked by the common
bean weevil. Some of the seeds brought to the National Museums of Kenya were
infested with insects which were identified as the cowpea bruchid (Callosobruchus sp.
probably maculutus; identification by P. Kamau of the Department of Invertebrate
Zoology, National Museums of Kenya). Some pigeon pea (Cajanus cajan (L.) Huth)
seeds, which were also affected by this pest, were mixed with the bambara groundnut
seeds and may have infested them. This corroborates an earlier report by Hepper
COUNTRY REPORTS
41
(1963) on bambara seeds found to be infested with bruchid beetle, which were
identified as Callosobruchus subinnotatus Pic.
Harvesting and storage
The pods, which are produced underground, are pressed by hand, or more often
sun-dried, threshed and winnowed to obtain the seeds. These are then sun-dried
and stored. Traditionally, the seeds were left in the pods, which would then be
stored in a pot, and would only be shelled when they were needed for cooking.
This storage method is still used by some people, especially in Bungoma district.
Production and markets
Table 5 gives production figures per district for bambara groundnut. Surveys
undertaken in Nairobi indicated that bambara groundnut is more expensive than
other pulses in the city. It is mainly found in three markets in Nairobi: Gikomba,
on the outskirts of the city, Nyamakima, near the city centre, and at Kawangware,
in the suburbs. In the Nyamakima market, the crop is sold at Ksh. 80/kg, and for
Ksh. 120/kg at Kawangware (the average price of beans in most parts of Nairobi is
Ksh. 28/kg.) The demand for bambara groundnut in Nairobi is quite low, and for
this reason, few stallholders stock it. At Gikomba market, which is the largest of
these, only one woman (from the Kakamega district) sells the crop. At the
Kawangware market, it is only sold by one stallholder (also from Kakamega), who
seemingly buys his stock from the stallholder at the Gikomba market. Bambara
groundnut is also sold in other urban centres, such as Kakamega, Bungoma,
Kisumu (at the Mbero and Kibuya markets), Homabay, Nthiwa, Mirogi, Ratang’a,
Aorachuotho, Macalder and Migori.
Genetic resources
Most of the germplasm found in Kenya can be classified as traditional landraces or
local cultivars. No major work has been done on bambara groundnut in Kenya, and
for this reason, no modern varieties have been developed. The country’s
germplasm-holding institutions and their accessions are described in Table 6. The
germplasm held at the National Genebank of Kenya has not been characterized.
There are 6 accessions at the Genebank, 1 from Nigeria, 1 from England, 1 from
Australia and 3 from Kenya. The Kenyan accessions are the following:
(i) a primitive cultivar/landrace from Busia (South Teso Kwangamor),
collected at 1290 m asl
(ii) a wild landrace from Siaya (South Sakwa bar Kowino sublocation)
(iii) a primitive cultivar/landrace from Kilifi (Chasimba sublocation).
According to G.O. Rachier (pers. comm.), however, at the Kakamega Regional
Research Centre of the Kenya Agricultural Research Institute (KARI), under whose
aegis groundnut research falls, local farmers hold seeds belonging to traditional
landraces/local cultivars, of the following size and colour: medium-sized brown
and purple, and large brown tinted.
42
&%1&%6% GROUNDNUT
COUNTRY REPORTS
43
A number of seeds held at the National Museums of Kenya were purchased
from the Kawangware and Nyamakima markets, while others were personal
donations to the institution. The lot from Kawangware is a mixture of more than 10
varieties, differentiated on the basis of size and colour, which ranges from
cream/white, through orange, brown, red, dark red/maroon and black, to cream-,
brown- and red-speckled. The lot from Nyamakima is homogenous, containing
dark brown/red large seeds. The seeds of one sample given to the museum are
black (some very tiny, and others medium sized). The range of diversity in the
collections is not presently known, as no survey has been carried out. Both Dr J.K.
Kimei of the National Genebank and G.O. Rachier of Kakamega RRC admit that the
existing collections are highly incomplete, both in terms of genetic diversity and
geographic representation. At the NMK, ethnobotanical information on bambara
groundnut is inadequate.
Table 6. Germplasm-holding institutions and the state of their collections.
Institution
Accessions/storage conditions
National Genebank of Kenya
Seeds viable, but the amount held was not
specified
KARI - Kakamega Regional Research
2 kg of a mixture of brown and purple
Centre (RRC)
medium-sized seeds, which have not been
sorted out or characterized
National Museums of Kenya (NMK)
Seeds sorted according to colour and size
(14 groups) and stored under long-term
storage conditions at The Plant
Conservation and Propagation Programme
'SRWIVZEXMSRQIXLSHWYWIH
The bambara groundnut accessions at the National Genebank are placed in longterm cold storage at –20ºC. Seeds for the base collection are dried until their
moisture content is 3-7%. This is done with a cool-drying system, using a
dehumidifier running at –20ºC and 15% relative humidity, until the correct
moisture content is achieved. The seeds are then hermetically sealed in aluminium
foil containers. Seed viability testing is carried out after drying, just before storage,
to determine the viability of the seeds before final storage. The recommended
viability standard is 85% and above. Subsamples for regeneration/multiplication,
distribution, characterization and monitoring viability are kept at 5ºC and/or –20ºC.
At Kakamega RRC, short-term conservation at 5ºC is used. Materials are stored in
the form of seeds and unshelled pods.
Major limitations and constraints
The following problems have been reported in bambara groundnut (G.O. Rachier,
pers. comm.):
1. Agronomic
• individual cultivars are not very adaptable, although the crop is found in
vastly different environments
• careful cultivation is needed, as the flower stalks are much weaker in
comparison to those of groundnuts, and cannot penetrate hard soil crusts.
44
&%1&%6% GROUNDNUT
2. Pathological and entomological
• Fusarium with leaf spot, root rot nematodes and virus are known to attack
bambara groundnuts.
No information exists on the use of germplasm in research/breeding/crop
improvement and selection procedures, because no work has been undertaken on
bambara groundnut by the Kenyan research centres in particular. Nor are any
individual research findings available.
Conclusions
Ethnobotanical research indicated that bambara groundnut production is declining.
One of the reasons for the decline to which attention was drawn, is the cost of
purchasing the seeds, which farmers find a strain on their finances. The price of
seeds is determined by the level of production of the crop: the lower the quantity
produced, the higher the cost. This also affects utilization of the crop, as consumers
buy what they can afford. In the rural areas, the cost of a glass (about 200 ml) of
bambara groundnut is Ksh. 20, while that of beans is Ksh. 10-15/kg (most people
indicated that beans were quite affordable, and preferred to buy them). Despite its
prohibitive cost, bambara groundnut is still considered a delicacy by the
communities which eat it and they would like something to be done to promote its
production and use.
One clear cause for concern is the high level of genetic as well as cultural
erosion occurring in bambara groundnut, a situation that requires swift action to be
taken. Cultural erosion of a crop increases genetic erosion, as it promotes nonusage, which causes production to decrease. It also contributes to non-utilization of
the crop by other communities, owing to its unavailability, and a lack of indigenous
knowledge pertaining to its use, and thus to its various methods of preparation.
Over the last 30 years, bambara groundnut has declined significantly in importance.
The majority of those who confirmed that production of the crop is falling are
young people, who said that while it was grown abundantly in their youth, it is
now cultivated in few areas. One clear cause for concern is the high level of genetic
as well as cultural erosion occurring in bambara groundnut, a situation that
requires swift action to be taken. There is an urgent need for:
• collecting bambara groundnut germplasm to fill the gaps in the existing
collections described above
• intensification of ethnobotanical research, to help fill these gaps
• the use of newly collected germplasm in research, breeding and crop
improvement, to help increase bambara groundnut production
• collecting and documenting the indigenous knowledge (IK) pertaining to
bambara groundnut before it disappears, and incorporating this into
selection and breeding procedures
• research to determine which of the various varieties of bambara groundnut
is nutritionally superior
• encouragement of germplasm exchange, to help improve the local varieties,
and to make the improved varieties available to farmers.
COUNTRY REPORTS
45
2SVXLIVR2MKIVME
B. Tanimu and L. Aliyu
Ahmadu Bello University, Zaria, Nigeria
Introduction
Bambara groundnut (Vigna subterranea (L.) Verdc.) is believed to originate in several
areas of Nigeria, notably that between Jos and Yolas (Hepper 1970). The crop is
presently grown throughout the country, with the exception of the riverine and
swampy areas. It is grown by subsistence farmers, on small patches of land, and is
frequently intercropped with cowpea, sorghum and cotton, among other crops.
The research activities of the Institute for Agricultural Research (IAR), Ahmadu
Bello University cover the savanna ecological zone of Nigeria (latitudes 7-13ºN)
(Fig. 1). Rainfall there varies from less than 500 mm in the Sahel and Sudan zones to
1200 mm in the southern Guinea zone, and is spread over periods that range from 3 to
7 months. The climate during the remaining months of the year is characterized by
dry weather, with Harmattan winds lowering night temperatures to 18-20ºC between
October and February.
Production
It is difficult to obtain accurate production and yield figures for the bambara
groundnut crop in Nigeria. However, Rachie and Roberts (1974) estimated that the
country produces about 100 000 t of the crop annually. The area under bambara
groundnut cultivation in the Sahel and Sudan savanna zones of Nigeria has declined
over the past two decades. Farmers in these areas estimated that the present area is
about 5-20% of that of 20 years ago. They attributed this decline to drought. On the
other hand, the area under bambara groundnut cultivation has increased during the
same period in the southern Guinea and forest zones of Nigeria. The increase in the
amount of the crop produced in these areas is thought to be due to the fact that the
crop fetches higher prices now than it did previously.
The majority of the farmers cultivate the crop primarily for food; however, they
may sell part of it when they produce a surplus, or when they need money to pay
taxes, loans or school fees (Linnemann 1988). The shift in cultivation of bambara
groundnut from the drier to the wetter parts of the country has reduced overall
production of the crop, for the following reasons: (i) there are fewer farmers
producing the crop in the wetter areas; (ii) land clearing is difficult and costly; (iii) the
soils in the wetter areas are more difficult to cultivate, as they are heavier and more
prone to weeds, and (iv) more disease problems are encountered in the wetter areas
because of the prevalent high humidity.
Uses
In Nigeria, most of the bambara groundnut produced is consumed locally. No
industrial use of the crop has been reported. The haulm is used for livestock feed, while
the fresh pods are boiled and eaten as a snack. Seeds are often crushed into flour, to
prepare the following dishes: ‘alele’, ‘alelen ganye’, ‘danwake’, ‘gauda’, ‘kosai’, ‘kunu’,
‘tuwo’ and ‘waina’ (Linnemann 1988). The fresh immature seeds are also eaten raw.
46
&%1&%6% GROUNDNUT
Fig. 1. Major vegetation/agro-ecological zones of Nigeria.
Genetic resources
Nigeria is believed to be one of the centres of origin of this crop, and possesses extensive
bambara groundnut genetic resources. This can be observed from the wide range of
differences in the seed coat colour, seed sizes, pigmentation around the eye, pod shape,
growth habit and other characters. In April 1984, a collecting mission was organized by
the Institute to various parts of the country. About 80 accessions were collected,
multiplied and maintained, and the most promising ones were subjected to yield
evaluation trials. Foreign accessions have not yet been received, although requests for
seeds have been sent to various researchers outside Nigeria. Some seeds were collected
from northern Namibia, but were lost in transit. Because of inadequate modern storage
facilities at the Institute of Agricultural Research, Samaru (IAR, see below), collections
were sent to Dr A.R. Linnemann, and some to IITA for conservation.
&VIIHMRK
Bambara groundnut is self-pollinating. The small, yellowish flowers are borne on the
plant’s short, creeping stems, and are fertilized before opening. After fertilization, a
peduncle grows positively geotropic, and the fruits develop and ripen underground
(Sands 1931). The breeder’s aim is to combine desirable traits from all available
genetic resources into a single new variety. The starting point for any breeding
programme is therefore to establish a germplasm collection containing the widest
COUNTRY REPORTS
47
possible range of the genetic variability available within the species. Such a genetic
resource will play a key role in crop improvement and its protection against drought,
pests and disease, etc.
A bambara groundnut breeding programme was begun in 1984 at IAR, with the
aim of collecting and preserving local germplasm, and developing superior varieties
through selection and hybridization. Evaluation trials were carried out to establish
the potential of local germplasm as source material for future crop improvement. A
number of different bambara groundnut accessions collected from various parts of the
northern states of Nigeria were evaluated at Samaru. The phenotypic and genotypic
performance of these accessions is presented in Tables 1 and 2, respectively. A wide
range of genotypic and phenotypic variation was observed in a number of characters,
such as seed yield, 100-seed weight and shelling percentage (Tanimu et al. 1990). The
variation observed, especially for seed yield and 100 seed-weight, was then used as
the basis for selection and genetic improvement of the crop.
As a self-pollinating crop, any population of bambara groundnut may consist of
numerous homozygous pure lines. For this reason, the selection method used was
single plant selection, where individual plants manifesting desirable traits were
selected and grown separately, to produce several parallel pure lines. Rogueing is
also used to maintain the standard of any chosen line; plants showing undesirable
characteristics are generally removed from the selected population, leaving the more
typical plants to grow and produce seed.
Major problems/constraints
%KVSRSQMG
Most of the varieties are local, and are thus limited in their genetic potential. Both
haulm and seed yields are therefore invariably low. Until very recently, there were
no recommended sowing dates, optimum plant density values, or fertilizer rates.
There is also inadequate information on the type and intensity of mixture with other
crop types in the farming systems practised by local farmers. Pod-shedding is also a
problem with certain varieties, or the crop may fail to set pods, owing either to the
wrong timing of agronomic practices, or to crop injury during weed removal.
4EXLSPSKMGEP
Because bambara groundnut is grown during the rainy season, a period of high
temperatures and humidity, it is highly susceptible to fungal diseases, which are
common during this period. Attacks of rust and leaf blight, caused by Puccinia sp. and
Colletotrichum sp., respectively, have been reported in the crop when grown on station.
Isolated cases of rosette disease also have been reported in bambara groundnut.
)RXSQSPSKMGEP
Bambara groundnut is relatively free of the insect pests that plague other legumes,
such as the cowpea and peanut. On the whole, pesticides are hardly used by farmers
when cultivating bambara groundnut. However, the presence of some viral diseases
transmitted by insects suggests simultaneous infestation of the crop by hemipterans,
such as aphids, mealy bugs and scale insects. Local farmers store the bambara
groundnut seeds with various substances, including tobacco, peppers and sand
(Linnemann 1988), to protect them from storage pests (which represent a major
problem). At the Institute for Agricultural Research in Samaru, seeds are packed with
phostoxin tablets in sealed drums, to control Callosobruchus sp.
48
&%1&%6% GROUNDNUT
Table 1. Phenotypic performance of bambara groundnut accessions at Samaru in
1986 (Tanimu et al. 1990).
Plant
Days to
†
100-seed
Shelling
Height
Spread
flowerAccess
Seed yield
wt. (g)
percentage (cm)
(cm)
ing
-ion
Source
(kg/ha)
005
Rigachikun 1417.22 a
135.5
49.0
16.5
40.7
42
7007
Pategi
1348.33 ab
68.1
57.8
15.9
40.4
42
9009
Pategi
1308.11 ab
62.5
56.2
16.5
40.8
42
006
Pategi
1302.56 ab
67.5
54.0
16.5
40.4
41
001
Zaria
1263.11 ab
77.3
53.8
17.0
39.5
41
011
Pategi
1217.89 ab
95.2
57.4
16.2
40.7
42
010
Giwa
849.56 abc
80.7
59.2
16.5
40.4
42
008
Zaria
804.11 abc
77.2
59.3
16.5
40.2
43
004
Pategi
634.67 bc
50.7
51.6
16.5
40.8
42
003
Makarfi
408.11 c
90.2
54.1
16.2
40.2
42
002
Zaria
390.11 c
64.9
50.8
16.2
38.7
42
Mean
994.89
79.1
54.7
16.4
40.3
42
SE±
160.14
4.06
4.50
0.69
0.03
0.59
†
Means followed by the same letters in a column are not significantly different using Duncan’s
Multiple Range Test (DMRT) at 5% levels.
2
Table 2. Estimates of heritability (h ), environmental variance (δ²e), genotypic
variance (δ2g) and phenotypic variance (δ²ph), with their respective standard errors
(SE) in bambara groundnut (Tanimu et al. 1990).
Character
Seed yield
100-seed weight
Shelling percentage
Plant height
Plant spread
No. of days to
flowering
δ²e
62298.10
± 18783.58
24.72 ± 7.453
30.41 ± 9.169
0.706 ± 0.2129
1.041 ± 0.3139
0.530 ± 0.1598
δ²g
101956.30
± 6252.454
502.54 ± 68.343
12.04 ± 3.463
0.155 ± 0.07255
0.05 ± 0147
0.015 ± 0.05323
δ²ph
164254.40
± 82.46238
1.26 ± 5.3199
4.45 ± 1.1084
0.551 ± 0.06671
1.091 ± 0.1483
0.514 ± 0.946
2
h
62.07
± 75.870
95.31 ± 12.8467
28.37 ± 3.1243
20.87 ± 1.0875
0.946 ± 0.7060
2.91 ± 0.5627
2YXVMIRXHIJMGMIRGMIW
The alternating wet and dry seasons (the latter characterized by intense heat) cause a
rapid decomposition of soil organic matter in the savanna, which is the major
bambara groundnut production area (Owonubi and Yayock 1987). Indiscriminate
burning of fallow and crop residues by farmers also reduces the accumulation of soil
organic matter. Thus, under continuous cultivation, the soils rapidly lose their
fertility and productivity (Jones 1971). Because soil organic matter is low, native soil
nitrogen and phosphorus are also very low (Jones 1971). Phosphorus and sulphur
deficiencies are thus widespread (Goldsworthy and Heathcote 1963).
*YRHMRKWXSVEKIJEGMPMXMIWIUYMTQIRX
Bambara groundnut has a low priority on the agenda of the Ahmadu Bello
University’s Institute for Agricultural Research, and is therefore receiving less
attention than many crops whose research is funded externally. The poor viability of
bambara seeds, especially when they are stored for a long period of time, is a frequent
complaint of farmers. Storage is normally at room temperature, without the
application of any techniques to enhance the shelf-life and longevity of the seed.
COUNTRY REPORTS
49
Research may be needed to determine optimum storage conditions/structures and
methods of enhancing seed viability, but our Institute lacks the cold-storage facilities
which the seeds require. Research is also hampered by the scant availability and high
2
cost of equipment for tissue and soil analysis. These and other constraints make it
impossible to conduct adequate research on this crop.
(VSYKLX
Prolonged dry spells during the wet season, and the abrupt cessation of the rains
prior to full crop maturity, are perennial problems in the savanna ecological zone.
Either the crop fails, or growth is retarded, resulting in low yields. The solution to this
problem may require the development of a day-neutral crop that could be grown
under irrigation during the dry season.
Industrial uses
Presently, bambara groundnut is not being utilized for industrial purposes, hence the
degree of neglect it suffers, compared with other legumes such as the peanut.
Biochemical analysis of the crop may yield useful information on its industrial
potential.
2
Post-graduate agronomic researchers have only been able to perform tissue analysis of bambara
groundnut thanks to the assistance of Dr A.R. Linnemann.
50
&%1&%6% GROUNDNUT
7SYXL%JVMGE
C.J. Swanevelder
Agricultural Research Council, Potchefstroom, South Africa
Introduction
Despite possessing considerable commercial (including export) potential, bambara
groundnut or ‘njugo’ is a neglected crop in South Africa. It was brought to the
country by the migrating peoples from Central Africa, and is chiefly grown in the
northern and eastern regions of the country, where it is most popular. The crop is
mostly cultivated by small farmers in an intercropped system, or in family gardens,
although a lack of statistics makes overall production of bambara groundnut in South
Africa difficult to estimate. Owing to the crop’s labour-intensive harvesting process,
farmers have shown little interest in the crop and its commercial production, although
this situation is now changing. Because it is cultivated on a small scale, there is a
constant shortage of the fresh vegetable for consumption. Expansion of bambara
groundnut production in South Africa is hampered by these shortages, and also by a
lack of good varieties of the species.
Production
In the Northern and Eastern Transvaal, bambara groundnut is grown extensively in
the Letaba and Louis Trichardt districts, and fairly extensively in the Baberton,
Pietersburg, Pilgrims Rest and Potgietersrust districts. In KwaZulu-Natal, it is grown
in the Greytown, Msinga, Nkadla, Nguthu, Makhatini and Kosibaai areas. It is also
grown on a minor scale in the Tugela Ferry, Izopo and Maphumulo areas. Somewhat
unsuccessful attempts have been made by agricultural cooperatives to grow bambara
groundnut for local consumption and for export.
Uses
The following culinary uses of the crop have been reported.
• ‘Sekome’ (Sesutho), ‘tihove’ (Shangaan) or ‘tshidzimba’ (Venda) is prepared by
adding ‘njugo’ beans and peanuts, or just one of the two, to maize or millet-meal
and boiling the mixture until it forms a stiff dough. This is salted and pounded
into a ball, and will often keep fresh for several days.
• Bambara groundnuts are boiled and then stirred, to make a thin porridge, which
is known as ‘tshipupu’ (Venda ). Like maize, they may also be added to ‘lupida’,
a porridge made from peanuts.
• ‘Njugo’ beans are often eaten when still immature, simply boiled until soft, and
shelled. When quite dry and hard, they are generally shelled, and then boiled to
make a stiff porridge.
• Bambara groundnut can be cooked with maize and pounded into a thick, sticky
dough known as ‘dithaku’ (in Sesutho).
The only use of bambara groundnut observed among the local white population
was of the dried beans, to make a soup.
COUNTRY REPORTS
51
Folklore
In the past, a number of superstitions and taboos existed regarding the bambara
groundnut, which probably extended to other crops whose fruits develop and ripen
underground. For example, when a chieftain died, or when drought was predicted,
planting of the crop was prohibited for periods varying from one to five seasons.
Bambara groundnut might not be planted before the maize crop had germinated, and
was pulled up if the rains were late. Males were forbidden to walk through ‘njugo’
fields, as it was believed that bad yields would result.
Furthermore, land belonging to males was only planted with bambara groundnut
every other year, for fear that the male landowners might otherwise die, or some evil
come to them or their families. Land belonging to women, however, was allowed to
be planted annually with the crop. Young people were not permitted to eat the fruit
of unmounded bambara groundnut, as it was believed that permanent or temporary
sterility would result if this rule was not observed. Planting of the crop in virgin soil
was also forbidden.
It is not known to what extent these traditional beliefs persist, but the Venda still
consider that bambara groundnut should not be planted before the maize crop. It is
likely that many of these beliefs have a practical explanation. For example, the taboo
against young people crossing bambara groundnut fields probably had the useful
function of protecting the small, intensively cultivated plots. It seems likely, on the
other hand, that the taboo against eating unmounded bambara groundnut fruit
served to ensure that women cultivated the crop properly.
Chewing and swallowing raw bambara groundnut beans is alleged to check
nausea and vomiting (also for years afterwards), a remedy that is often used to treat
morning sickness in pregnant women.
Genetic resources
The three bambara groundnut collections in South Africa (see Appendix D for their
addresses), are all frequently regenerated. They are situated at the following locations:
1. Potchefstroom (Oil and Protein Seed Centre of the Institute for Grain Crops).
Most of the accessions are landraces, which have been acquired over the past
10 years, from the Seed Control division of the Department of Agriculture,
local markets, seed firms and local farmers. No specific South African cultivar
is available, and seeds of mixed colours and sizes are usually planted. The
collection contains a total of 198 lines, but it is believed that duplicates exist. It
is being regenerated in 1995-96. The whole collection will be planted out, and
the major features described, to eliminate most of the obvious duplicates. The
seed colour and hilums are recorded, but no other features.
2. White River (Department of Agriculture, Mpumalanga). This recent collection
(with 20 accessions in total) contains a number of landraces, and also material
obtained from Potchefstroom.
3. Roodeplat (Institute for Veld and Forage Utilization). This holds 117 lines, a
number of which have been fully or partly described.
These collections possess a wide range of variation in leaf colour and shape,
growth habit, pod colour and shape, seed size, seed colour, eye colour and testa
pattern. Photoperiodical requirements have not been determined. Accessions in the
three collections are in the process of being described, and information on all of these
should be available in the next few seasons. It is not currently possible to specify gaps
in the existing collections.
52
&%1&%6% GROUNDNUT
Germplasm exchange
Potchefstroom has supplied germplasm to Roodeplaat and White River, and also to
researchers in Zambia, Swaziland, Zimbabwe, Malawi, Botswana, Namibia, the
United Kingdom and the Netherlands.
Research
Research on bambara groundnut is carried out at the research institutions described
below.
Institution
Potchefstroom
Roodeplaat
University of Natal
University of Pretoria
University of Cape Town
Department of Agriculture,
Mpumalanga
Activities
• germplasm collecting and evaluation
• cultivar development and evaluation for smallscale and commercial farmers
• development of a mechanical harvesting process
for bambara groundnut
• research and development of indigenous edible
leaves and seed vegetable crops
• genetic description of legumes
• agronomic evaluation of legumes
• seed storage conditions
• tissue-culture protocols
• calcium requirements for flower formation and
pollination
• tolerance and organic admentment as integrated
pest management components for the control of
root knot nematode (Meloidogyne spp.) on
bambara groundnut
• nitrogen fixation
• cultivar evaluation
• planting dates x earthing-up
• planting depth x spacing x earthing-up
• cultivar x earthing-up
COUNTRY REPORTS
53
8ER^ERME
W.H. Ntundu
National Plant Genetic Resources Centre, Arusha, Tanzania
Introduction
Tanzania is a tropical country occupying an area of 943 000 km², with a population of
about 28.5 million. It comprises 20 administrative regions on the mainland, and five
in Zanzibar and Pemba. The country extends from about latitudes 1º30’ to 11º45’S
and from about longitudes 29º21’ to 40º45’E. Elevation starts from sea level on the
eastern coast, rising to 5895 m above Mount Kilimanjaro. Tanzania’s natural
vegetation comprises coastal forests, open woodlands, dense mountain forests,
wetland vegetation, and scrub and bushland.
Climate
Tanzania has various climatic conditions, ranging from very hot and humid at the
coast, to very hot and dry in central regions, and very humid and cool in highland
areas. Mean annual rainfall varies widely, from 320 to 2400 mm. Most of the country
has a unimodal rainfall distribution, which is generally restricted to the period
between November and May. A bimodal rainfall distribution pattern is characteristic
of the area around Lake Victoria, and of the northeast part of the country. Mean
monthly temperatures are generally above 10ºC and rarely exceed 30ºC, and
temperature is closely correlated with altitude. This diverse climate allows a range of
crops to be grown. Food crops include maize, paddy, wheat, sorghum, millet, beans,
sweet potatoes, cassava, Irish potatoes, bananas, cucurbits, pigeon peas, cowpeas,
bambara groundnut, cocoyams, yams and various vegetables. Cash crops include
coffee, cotton, sisal, cashew, tea, tobacco, pyrethrum, sugarcane and coconuts.
Bambara groundnut (among other crops) is not one of the research priorities of the
National Agricultural Research System (NARS) (see Table 1). It can therefore be
categorized as a neglected crop in Tanzania.
Production and distribution
A study by the International Trade Centre (Coudert 1982) estimates annual global
production of bambara groundnut at 330 000 t, of which about half is produced in
West Africa. The exact date of bambara groundnut’s introduction into East Africa is
unknown. The production of bambara groundnut in Tanzania is associated with
traditional peasant farming systems, in which it is mixed with other crops, and grown
in small patches in monoculture (Smyth 1968). The crop is mainly intercropped with
cereals such as millet, sorghum or maize, root and tuber crops, and other legumes.
Bambara groundnut production areas are indicated in Figure 1. Yields per plant
are fairly high, but since bambara groundnut is mostly grown as a mixed crop at wide
spacing, yields per unit area are usually low. It is difficult to obtain accurate
production figures for Tanzania, as the crop is cultivated and consumed by families,
and very little finds its way to urban markets.
54
&%1&%6% GROUNDNUT
Table 1. Commodity Research Programmes under the National Agricultural
Research System (NARS).
Programme
Crops
Maize
Maize (Zea mays)
Rice
Rice (Oryza sativa)
Sorghum and millet Sorghum (Sorghum bicolor), pearl millet (Pennisetum
americanum), finger millet (Eleusine coracan)
Wheat and barley
Wheat (Triticum aestivum), barley (Hordeum vulgare)
Grain legumes
Cowpea (Vigna unguiculata), black gram (Vigna mungo),
pigeon pea (Cajanus cajan), soyabean (Glycine max)
Common bean
Common bean (Phaseolus vulgaris)
Oil seeds
Sesame (Sesamum indicum), sunflower (Helianthus annuus),
groundnut (Arachis hypogaea)
Root and tubers
Cassava (Manihot esculenta), sweet potato (Ipomoea batatas),
potato (Solanum tuberosum)
Coffee
Coffee (Coffea arabica and C. robusta)
Cotton
Cotton (Gossypium hirsutum)
Tea
Tea (Camellia sinensis)
Sisal
Sisal ( Agave sisalana)
Coconut
Coconut (Cocos nucifera)
Cashew
Cashew (Anacardium occidentale)
Sugarcane
Sugarcane (Saccharum officinale)
Tobacco
Tobacco (Nicotiana tabacum)
Horticultural crops
Fruits, vegetables and ornamentals
Viticulture
Grapes (Vitis spp.)
Pyrethrum
Pyrethrum (Chrysanthemum cinerariifolium)
Results from Ukiriguru Agricultural Research Institute indicate that under good
management, yields of up to 2.6 t/ha have been achieved (Akonaay and Mazige
1982). Recently, Sibuga et al. (1994) reported that Dodoma Red (DodR94), a local
cultivar from Dodoma can produce pods yielding up to 3 t/ha. The crop yield
reported in Tanzania also compares well with that reported by Johnson (1968) in
Central Africa, which was 2 t/ha of shelled seeds. Smyth (1968) reported that in the
Western Lake regions in Tanzania, bambara groundnut is grown on highly infertile
Rweya grassland soils every 7 years, in rotation with the grass.
Uses
In semi-arid parts of the country, bambara groundnut is considered as an insurance or
a security crop. It is therefore eaten in a variety of ways, ranging from the freshly
cooked pods to the cooked dry grains. The crop is incorporated into main dishes,
such as cooked plantains and cereals. Kinyawa (1969) indicated that Ukiriguru
bambara groundnut cultivars constitute a well-balanced food source; he found that
the composition of 100 g of bambara groundnut contains water, protein, fat,
carbohydrates and minerals, in the proportions given in Table 2. The vegetative parts
of the plant, and sometimes the haulms, are used to feed livestock. The crop is also
useful in crop rotations, as it contributes nitrogen to the soils, which benefits
subsequent crops.
COUNTRY REPORTS
55
Fig. 1. Shaded areas indicate the general distribution of Bambara groundnut
growing areas in Tanzania. (Source: Atlas of Tanzania, Survey and Mapping
Division, Dar es Salaam, 1976)
†
Table 2. Composition of bambara groundnut (Platt 1965) .
Components
Platt (1965)
Major (%)
Water
10
Protein
18
Fat
6
Carbohydrates
60
Fibre
3.3
Minor (mg/100 g)
Calcium
65
Phosphates
n.a.
Iron
6
Magnesium
n.a.
Potassium
n.a.
Thiamin
0.3
Riboflavin
0.1
Nicotinamide
2
Ascorbic acid
insufficient
†
‡
Analyzed by Kinyawa (1969) at Ukiriguru.
n.a. = not available.
Kinyawa (1969)
11
15.6-21.9
5-7.5
64
‡
n.a.
30-100
100-200
7
100
1.2
n.a.
n.a.
n.a.
n.a.
56
&%1&%6% GROUNDNUT
Genetic resources
Owing to its broad geographic distribution in Tanzania, a wide range of bambara
groundnut cultivars (landraces) exists. Most of the current cultivars have arisen by
random selection during the course of cultivation, and during migrations of various
peoples, and are very local in their distribution. Farmers distinguish them by the size
and shape of the leaves, and also by seed colour. In Tanzania, initial selection of
landraces was based on colours of the testa, eye colour and collection site (Smyth
1968). Some of the landraces grown in Tanzania, such as the red-coloured BA/48/1,
the cream-coloured, red-eyed Mwanza, the black-coloured Shinyanga, the creamcoloured, speckled or mottled Singida, the black-patched Dodoma, the creamcoloured, brown-patched Tabora, the cream non-eyed BA/2 and the cream, blackeyed Mpwapwa, were identified at Ukiriguru in the l968/69 season. Very little
research work has been done in the past to improve the crop’s yield performance
(Smyth l968).
A collection of over 400 accessions was held at Ukiriguru between 1967 and 1971,
but because of priority and staff changes, coupled with a lack of proper storage
facilities, these accessions have since been lost (Marandu and Ntundu 1995). Recent
multi-crop collecting missions by the National Plant Genetic Resources Centre
(NPGRC) have gathered 22 accessions of bambara groundnut. These are stored
according to genebank standards. Bambara groundnut is also threatened by
competition from other legumes such as beans, which are available in almost all
markets in the country.
Changing farming systems have gradually resulted in individual farmers
cultivating fewer crops, which has contributed to bambara groundnut’s further
marginalization. Furthermore, in southern Tanzania, the crop is being threatened by
the recent use of elemental sulphur to save the cashew crop from powdery mildew
devastation. The consequence of this chemical treatment seems to be an increase in
soil acidity, which may reduce production of most legumes in the affected areas.
Research
Although the Bambara groundnut is an important food crop in Tanzania, very little
research has been done on it to improve the crop. Neither improved varieties nor
agronomic recommendations exist for Tanzania. Research on the production of
bambara groundnut was initiated at Ukiriguru in 1967-68, when a total of 62 cultivars,
some local (from Tabora, Mwanza, Musoma, Singida, Rungwe and Kagera), and
others foreign (from Nigeria, Malawi, Zambia, Uganda, Sudan and Dahomey), were
evaluated for yield and other important characteristics, including insect pest and
disease resistance. Preliminary results indicated that there was scope for selection for
high yield within local cultivars. The main results of breeding work carried out
between 1967 and 1971 at Ukiriguru are summarized below.
• Varieties collected both from within and outside the country differed greatly
in terms of yield and other important characteristics.
• Selection within the varieties themselves showed that many of the local
cultivars and several of the introductions were genetically variable.
• Three purple-coloured cultivars – 70/1, BA 48/1 and BA/48/2 – showed
good resistance to Fusarium wilt disease caused by Fusarium oxysporum.
COUNTRY REPORTS
57
Bambara groundnut appears to be quite adaptable to different environments,
except that cultivars from wetter areas such as Bukoba were less promising under
drier conditions. Of the 23 cultivars which were evaluated for yield, 9 were identified
as the best yielders. Their yields ranged from 888 to 2600 kg/ha.
Agronomic research was done at Ukiriguru on the time of planting and on
spacing, and comparisons were made between planting on ridges and on flat land. It
was reported that bambara groundnut sown after December suffered more heavily
from early attack by Cercospora leaf spot, virus rosette diseases and powdery mildew,
which reduced yield significantly. Research results indicated that there was no
significant difference in yield from bambara groundnut grown on ridges and flat land.
Local and exotic collections were assessed for resistance to the most common
diseases, such as Cercospora leaf spot, virus rosette disease and powdery mildew.
Leaf spot caused by Cercospora canescens, producing severe premature defoliation, was
the most serious disease affecting bambara groundnut. Two races of virus which had
been found to be latent in peanuts (Arachis hypogaea) were shown to have a rosetting
effect on bambara nuts. One variety from Bukoba (BA/30) and another from
Mwanza (BA/25) had high resistance to both Cercospora leaf spot and virus rosette
diseases. Kindale, a local variety from Ukiriguru, was among the most resistant to
rosetting. Powdery mildew, although widespread, was reported to be a late-season
disease and was found to be economically unimportant. This initial interest in
bambara groundnut research in Tanzania decreased during the 1970s, but the crop
has remained an important food for the rural poor, especially in semi-arid areas.
In 1992, the Sokoine University of Agriculture at Morogoro, and Nottingham
University, UK, initiated a multilateral project on bambara groundnut improvement.
Other collaborating institutions in the project include Njala University College, Sierra
Leone, Wageningen Agricultural University, The Netherlands, and Botswana College
of Agriculture, Botswana. The project’s objectives are to:
• evaluate local genotypes (landraces) grown under rain-fed and irrigated
conditions
• study the growth and development of these genotypes
• identify suitable agronomic practices for the cultivation of bambara
groundnut in Tanzania and other collaborating countries.
Two local cultivars, Dodoma Red (DodR94) and Dodoma Cream (DodC94),
purchased from a farmer in Dodoma, are being used in this study. The cultivars are
being evaluated both in Dodoma and at Sokoine University of Agriculture in
Morogoro.
Generally, the project’s findings, as reported by Sibuga et al. (1994), indicated
severe leaf damage caused by mildew and Cercospora leaf spot at Morogoro, under
irrigated sowings. However, the results at both sites revealed a general decline in leaf
and flower number and dry weights with later sowing. This was reflected in pod
yields, with a decline from approximately 6 g per plant, when sown in January, to less
than 1 g per plant, when sown after May. Furthermore, DodR94 was reported to
produce 3 t/ha of pods under rain-fed conditions in Dodoma.
58
&%1&%6% GROUNDNUT
Future crop improvement programme strategies
•
•
•
•
Systematic country-wide collecting of bambara groundnut germplasm has been
planned for April-May 1996, initially in southern Tanzania, and subsequently in
other parts of the country, as the initial phase in an improvement programme.
Characterization of all collected accessions of bambara groundnuts, to provide
necessary information for breeding purposes.
Evaluation for yield and other important characteristics, including insect pest and
disease resistance in multilocational trials.
Studies of antinutritional factors, to promote utilization of the crop, and
collaborative studies on various aspects of bambara groundnut improvement.
Conclusions
Although bambara groundnut is an important crop in Tanzania, especially in parts
which are more arid and marginal for other legumes, little work has been done to
improve its yield and utilization. The species could be developed into a major crop,
and research efforts made to improve existing germplasm in the country, for:
• high yield
• agronomic purposes
• improved disease and pest resistance
• utilization as a food crop
• possible use as a rotation crop in areas which are marginal for other legume
crops.
%GORS[PIHKIQIRXW
The author of this report thanks the Director of the Tropical Pesticides Research Institute and
the curator of the National Plant Genetic Resources Centre of Tanzania, for facilitating this
publication. Grateful thanks is also extended to the International Plant Genetic Resources
Institute, Rome, Italy and the Department of Research and Specialist Services, Harare,
Zimbabwe, for inviting Tanzania to participate in the bambara groundnut workshop.
COUNTRY REPORTS
59
8SKS
B. Nambou
INCV, Lomé, Togo
Introduction
In Togo, two different types of climate prevail: a Guinean climate in the southern
part of the country, with two rainy and two dry seasons; in the northern half of the
country, one rainy and one very dry season. Togo is a predominantly agricultural
country where all the tropical and subtropical crops of the subregion can be grown.
Bambara groundnut (Vigna subterranea (L.) Verdc.) is a grain legume that is rich in
protein. The crop is known and cultivated in Togo, but to a much lesser extent than
other vegetables such as cowpea, peanut and soyabean.
Despite its high protein content, bambara groundnut has yet to become an
integral part of the diet of the Togolese populations. It is considered a ‘poor man’s
crop’, and is traditionally cultivated in home gardens and in farmers’ fields, which
may explain its marginal status. Bambara groundnut is cultivated sporadically
throughout Togo, and produces low yields of 0.25-0.6 t/ha. The crop is mainly
found in the Savannah, Kara and Central regions of the country, and in small
quantities in the Plateaux and Maritime regions.
Togo’s Grain Legume Programme does not contain a programme of specific
activities relating to bambara groundnut, but collecting has been done, and
preliminary characterization was initiated in 1985 by the National Food Crops
Institute (NFCI).
Production
The crop is usually grown on ploughed ridges 20 cm high and on mounds. It has
been observed that planting density varies from area to area, as do the soil
preparation techniques and the tools farmers use. Planting density is either 80 x
20 cm, 75 x 10 cm, or 75 x 20 cm. Bambara groundnut is planted in July, one grain
being planted per hole, and has a vegetative cycle of 4 months. Farmers use local
varieties and the preceding crop may be maize, sorghum millet, or other vegetables,
if they are not affected by the same pests or diseases. Farming techniques are
traditional: the use of fertilizers and peticides is almost nonexistent. Average yields
are usually about 0.5 t/ha, and throughout Togo, the crop is largely cultivated by
women.
Figures from the Direction des Enquêtes et Statistiques Agricoles of Togo
(Office of Agricultural Investigations and Statistics) between 1982 and 1994
(Table 1) show that acreages as well as production fluctuate, owing to the
socioeconomic conditions peculiar to this crop. Total acreages can be seen to have
risen from 6800 ha in 1982 to 10 400 ha in 1985. From 1986 until 1988, a downward
trend is apparent. From 1988 to 1993, total acreage averaged 3728 ha. As can also
be seen from Table 1, the highest production of bambara groundnut of 6527 t was
recorded in 1986, while between 1988 and 1993, production averaged 2059 t.
Table 2 lists local varieties of bambara groundnut.
60
&%1&%6% GROUNDNUT
COUNTRY REPORTS
61
Table 2. Location of bambara groundnut accessions in Togo.
Location
Accession no.
Tchitchao
4 NVS - 56
Tchitchao
2 NVS - 56
Tchitchao
11 NVS - 63
Koumonde
2 NVS - 118
Sarakawa
3 NVS - 45
Lassa
2 NVS - 118
Awandjaleo
2 NVS - 67
Ketao local
n.a.
Sarakawa
4 NVS 54
Aleheride
n.a.
n.a. = not available.
Use
Despite its status as a marginal crop, bambara groundnut is much appreciated by
Togolese consumers throughout the national territory, and sells briskly at local
markets and those in urban centres, usually at a higher price than beans. The
greater part of the crop produced (80%) is consumed by the local producers
themselves, and markets are generally undersupplied
Consumers prefer the ivory-cream coloured grains, of 6-8 mm diameter; small
grains and black-coloured varieties are not particularly popular. Bambara
groundnut is a complete food, which is more palatable when fresh, semi-dry, or not
fully mature, as it becomes tough when dry. It can be consumed boiled or fried,
and fried or boiled puddings may be prepared with a dough/paste made from
bambara groundnut flour, which may also be used as a base for many other dishes.
Plant genetic resources
Since 1977, 12 collaborative collecting missions have been undertaken by Togolese
and foreign institutions, with the financial support of such institutions as the
University of Maryland, USA, and the International Board for Plant Genetic
Resources (IBPGR). These missions, which each involved different crops, aimed to
meet the objectives of the Plant Genetic Resources Programme of the National Food
Crops Institute. Between 1983 and 1985, 326 different accessions of bambara
groundnut were collected on missions participated in by the University of
Maryland and NFCI (the former Office of Agronomic Research). These collecting
missions were undertaken across the whole of Togo. By 1992, introductions from
other countries (Cameroon and Ghana) had increased the number of different
bambara groundnut accessions to 420.
'LEVEGXIVM^EXMSRERHTVIPMQMREV]IZEPYEXMSR
Since 1988, many working descriptors have been recorded for a total of 249 bambara
groundnut accessions. These have been used to describe plants during their
vegetative state, and their fruits and grain crops 2 months after harvesting.
62
&%1&%6% GROUNDNUT
2YQFIVSJHE]WXSKIVQMREXMSR
For 15 sampled plants, the number of days from planting to germination was
observed to vary from 8 to 9 days.
-RMXMEPPIEJGSPSYVEXKIVQMREXMSR
It has been observed that the young shoots of bambara groundnut are of a green or
violet colour, depending on the dominant colour of the seeds. Often, the deep redviolet colour of the seeds gives the leaves a violet colour at germination, while the
young leaves of white, grey or white-grey seeds are green. It is observed that 77%
of the plants sampled have green leaves, and 23% have violet leaves at germination.
7LETISJXLIETMGEPPIEJPIXERHKVS[XLLEFMX
Observations 10 weeks after planting show that 0.43% of leaflets are round, 93.8%
are oval and 5.75% are lanceolated. A total of 38% of plants sampled have a bushy,
18.1% have a semi-bushy and 43%, a creeping growth habit.
2YQFIVSJHE]WJVSQTPERXMRKXSJPS[IVMRK
The number varies from 37 to 45 days, with the first flowers appearing 1 week
earlier.
7LETISJXLITSH
The shape of the pod is characterized by the existence or absence of a beak: 66% of
the samples are beak-free and 34% are beak-shaped. None of the samples described
has two beaks.
+VEMRGSPSYV
At 2 months after harvesting, 25% of grains are observed to be brown to yellowish,
while 75% are mid-brown.
4SHXI\XYVIXLMGORIWWPIRKXLERH[MHXLERHTIVGIRXEKISJKVEMRWEXXLVIWLMRK
At 2 months after harvesting, 57.2% of pods are observed to be wrinkled, 20.3% to
be folded, 6.3% to be smooth and 15.3% to have small wrinkles. The average
thickness of 10 pods is observed to vary from 0.2 to 0.59 mm. Pod length varies
from 14.4 to 19.5 mm, and width from 10.2 to 16.5 mm. Percentage of grains at
threshing varies from 60.5 to 85.8%.
+VEMRW
All the characters are recorded 2 months after harvesting. Colours are specified
according to the Munsell Colour Charts. The texture of the testa, as well as its
underlying and secondary colours, and the eye type, main colours and
pigmentation have been described
Exchange of germplasm for research purposes
Exchanges of germplasm have taken place between NFCI and the University of
Maryland, and with Cameroon and Ghana.
Conservation technique
Treated grains are stored in sealed polythene bags, which are placed in sealed
plastified aluminium bags. Bags are stored in a drawer of a 24 m³ cold room, at a
COUNTRY REPORTS
63
temperature of 9-10°C. For each variety, three bags are packaged, of which two are
put in the cold room and one into a 650-L capacity freezer at –18°C.
Use of germplasm in research
Because of the lack of a programme for improvement of varieties of bambara
groundnut, not all of the samples characterized morphologically have been used in
research.
Selection
Selection work has not taken place, owing to the lack of an improvement programme
for bambara groundnut.
Main problems
Generally speaking, the bambara groundnut plant withstands drought and diseases,
with the exception of Fusarium, which hardens pods and grains. Cercospora disease
is also sometimes observed on bambara groundnut leaves.
Conclusions
It is the hope of the National Food Crops Institute (NFCI) that this workshop will lead
to the creation of a solid programme for the improvement of bambara groundnut
varieties in this country. New collecting and characterization work is anticipated,
which will replace material lost as a consequence of the social and political unrest in
Togo over the past 3 years. It is to be expected, however, that monitoring and
improvement of plant genetic resources conservation will be required for the success
of any bambara groundnut programme.
64
&%1&%6% GROUNDNUT
>EQFME
D.N. Mbewe¹, M.S. Mwala¹ and G.P. Mwila2
¹
2
University of Zambia, Lusaka, Zambia
National Plant Genetic Resources Centre, Mount Makulu Research Centre,
Chilanga, Zambia
Introduction
Bambara groundnut (Vigna subterranea (L.) Verdc.) is one of the minor grain legumes
in Zambia, together with cowpea, pigeon pea, chickpea, mungbean, lentils and adzuki
beans. Its advantages include a balanced nutritional composition, adaptability to
marginal land, and relatively high tolerance to diseases and pests. The crop is
cultivated on a small scale, and is concentrated in the western, southern and eastern
provinces, where the greatest diversity is exhibited. Average yields reported are 300400 kg/ha. The dietary and soil amelioration potential of the crop in farming systems
is yet to be fully exploited. The crop fares rather poorly in terms of research interest,
although this is increasing. Numerous studies have been carried out on various
aspects of the crop, but most of these have been exploratory in nature, with few
conclusions being drawn.
Although it is rated as a minor legume crop, the need to conserve bambara
groundnut germplasm was recognized in the 1980s, and collecting missions were
carried out (see below). Unfortunately, characterization and evaluation of the
collections has been slow. There is a need to exploit the diversity and potential of the
crop, through focused plant genetic management, breeding, plant protection and
agronomic strategies. This paper outlines the status of the crop in Zambia, with
respect to its genetic resources and breeding, and the major agronomic, pathological
and entomological problems that have been experienced.
Production
Bambara groundnut is grown in all provinces of Zambia, cutting across a wide range
3
of agro-ecological zones and farming systems. The crop is most important in the
farming systems of marginal areas, from the point of view of moisture availability and
soil conditions. As it is grown by farmers on a small scale, the crop does not enter the
formal marketing system, and aggregate production figures are not available.
However, given that there are estimated to be approximately 600 000 smallholders in
the country, each cultivating less than 0.25 ha of bambara groundnut, total production
can be estimated to be very low. Bambara groundnut is usually intercropped, with a
small proportion grown as a sole crop. Planting is done flat, or on ridges, between
November and December in agro-ecological region III, and in January, in regions I
and II. Fertilizer and manure are never applied.
No detailed studies have been carried out to estimate the yields obtained at farm
level, but empirical evidence and exploratory studies involving a wide range of
landraces in the country have shown that yields rarely exceed 500 kg/ha. This is a
3
Agro-ecological zone I is located in the southern part of the country, which includes the valley area;
the semi-arid area with rainfall of less than 800 mm. Agro-ecological zone II covers the broad central
belt, which includes the soils of highest potential, and is the main area of commercial farming. The
annual rainfall is 800-100 mm. Agro-ecological zone III covers the northern and northwest parts of the
country. It is a high-rainfall area, with annual precipitation of more than 1000 mm.
COUNTRY REPORTS
65
problem that researchers face when multiplying seed. All seed for planting is from
local landraces, and differs in size and colour. Farmers usually keep their seed for
planting. There is no commercial variety of bambara groundnut in Zambia.
Uses
Bambara groundnut is mainly used as a relish for food. The fresh or dry legume is a
4
very common snack, although in some parts of the country it is eaten as a main meal.
Genetic resources
'SPPIGXMSRWERHXLIMVHMZIVWMX]
Almost all the material grown by the farmers are traditional landraces that have been
selected and maintained by local communities over a long period. A number of these
landraces are maintained as uniform lines with distinct characteristics, e.g. seed
colour. Others, however, are kept as mixtures. Farmers are not in possession of
modern and improved varieties suitable for the climatic conditions in Zambia.
There appears to be significant genetic variation across the country in the
bambara groundnut germplasm collected. Purseglove (1968) indicated that Zambia
and Togo had the greatest variety of cultivars. In Zambia, the western and southern
provinces have the most varied landraces. Recent collections, however, have revealed
substantial variation in some parts of Northern province.
Much of the variation found in local landraces is in seed colour, eye pattern and
seed size. Variation in growth habit and yield is also found. Although a number of
seed colours exist, the most dominant and common is white or cream ground colour
with black and white eye. Seed size does not show much variation, with most seeds
being medium sized.
Bambara groundnut germplasm held in the local collections has been obtained
from within Zambia and from other countries. Accessions of traditional landraces
occurrring in different parts of the country have been collected through
internationally and locally organized missions. Quite a number of accessions were
collected through IBPGR/FAO sponsored missions, which began in the early 1980s.
5
Locally organized missions, such as the University of Zambia’s SACCAR -funded
mission, and that funded by the National Plant Genetic Resources Centre (NPGRC) at
Mount Makulu Research Centre, have also contributed to the collections. Their
foreign accessions came mainly from West Africa, as IITA collections, and from
Zimbabwe.
Bambara groundnut germplasm is being held at two institutions. The major
collection, with 463 accessions, of which 146 are locally collected and the rest are
foreign, is held by the University of Zambia. The other collections are held at the
6
National Plant Genetic Resource Centre (NPGRC) at Mount Makulu Research Centre.
A total of 152 accessions from the collections held at the Crop Science Department has
been characterized, and some preliminary evaluation has been done on these. The
characterization of material held at the NPGRC is planned for the 1995/96 season.
Some germplasm from outside the country continues to come in through the Food
4
United Nations University (UNU). 1993. Field Survey of Indigenous Food Crops and Useful Plants, and
their Food Preparation in Zambia (unpublished).
5
Southern African Centre for Co-operation in Agricultural & Natural Resources, Research & Training.
6
The total number of accessions held by the NPGRC in Zambia is 4619.
66
&%1&%6% GROUNDNUT
Legume Improvement Programme, mainly for the purposes of screening for possible
adaptation and yield assessment studies.
The diversity of the Zambian collections was found to be less than in other West
African collections (Begemann 1990a). In particular, the collection at the University of
Zambia was the least diverse with respect to quantitative characters. For a more
accurate picture of Zambia’s current collections, however, diversity studies need to be
carried out.
+ETWMRI\MWXMRKGSPPIGXMSRW
Characterization of the Zambian collections is in progress, but needs to be accelerated,
as its slowness has delayed the utilization of germplasm in breeding and crop
improvement programmes. Accessions are lacking from certain parts of the country,
such as the Central and Copperbelt provinces. The collections seem to include much
of the existing variation, however.
7XSVEKIXIGLRMUYIW
Both at the University of Zambia and the NPGRC, bambara groundnut germplasm is
o
being conserved through seed storage in deep freezers operating at –20 C. The seed
samples are dried to below 10% moisture content, and are then packed in aluminium
foil packets, which are hermetically sealed before being placed into the deep freezers.
+IVQTPEWQYWI
The use of the current collections in crop breeding and improvement activities has been
limited, due to the slow characterization and evaluation of the germplasm. However,
important information, on which use could be based, is gradually being accumulated.
At the University of Zambia, efforts to develop selection protocols are underway.
&VIIHMRK
No full-scale breeding work has been done on bambara groundnut in Zambia. Some
preliminary work has nonetheless been done by the Food Legumes Programme of the
Ministry of Agriculture, Food and Fisheries. Scarce funding and staff (time) are the
main constraints to more breeding work being done on the crop. At the University of
Zambia, genetic studies have been carried out to get a deep understanding of the
heritability of important bambara groundnut characters. Analysis of the components’
genetic variance has revealed a large environmental influence. The highest estimate
of heritability was for 100-seed weight (0.22-0.25). Table 1 shows the range of
heritability estimates for traits found to be important for seed yield in bambara
groundnut. Other studies that looked at the associations among the important
characters for yield have confirmed the importance of 100-seed weight and pods per
plant. It is planned to initiate a single plant selection in some of the accessions
characterized and evaluated at the University of Zambia in the 1995/96 season.
Table 1. Heritability estimates of traits of bambara groundnut grown
in the 1992/93 and 1994/95 season in Zambia (Nkumba 1993).
Trait
1992 estimate
1993 estimate
No. branches/plant
0.07
0.11
No. pods/plant
0.01
0.21
100-seed weight
0.22
0.35
Plant height
0.09
0.13
COUNTRY REPORTS
67
Problems and constraints
•
•
•
•
•
•
•
•
•
Adaptation (poor yields)
Cultivation practices
Planting methods
Planting dates
Planting density
Nutrient requirements
Weeding
Pathogens: notably Cercospora leaf blight, scab and Fusarium wilt. There
have been no crop loss assessment studies to confirm the importance of these
and other diseases
Insect pests: several important ones have been identified, from sucking pests
(jassids and aphids) to chewing insects (leaf beetles, termites and
grasshoppers).
Conclusions
The little research being carried out at present on bambara groundnut is attributable to:
• a lower allocation of resources to the crop, compared with other (major)
legumes
• a lack of economic and nutritional information on the crop, at both
producer and consumer levels.
Bambara groundnut is unfortunately considered a smallholder’s crop, of marginal
importance. This is a misguided perception, and promotion of the crop is needed to
change it.
The current state of bambara groundnut is encouraging, and attempts have been
made to address various aspects of the crop. These now need to focus on producing
concrete results in exploiting the potential of the crop. The realization of the Bambara
Improvement Programme, which was conceived in 1990, would be an important first
step towards this goal. Undoubtedly, the formation of a local, regional and
international network will be necessary if all the objectives for the crop are to be met.
68
&%1&%6% GROUNDNUT
>MQFEF[I
V. Mabika and P. Mafongoya
Agronomy Institute, Causeway, Zimbabwe
Introduction
The bambara groundnut is one of the most important local crops in Zimbabwe, where
it is known as ‘nyimo’ (Shona) or ‘indlubu’ (Ndebele). It is used both as a food and a
fodder crop. The plant is an indeterminate, annual herb, growing to a height of up to
30 cm, with prostrate, highly branched, leafy lateral stems just above ground level
(Linneman and Azam-Ali 1993). In 1981, the area under bambara groundnut
cultivation on resettlement farms was estimated to be around 4000 ha, with an annual
production of 2200 t, while the area under bambara groundnut cultivation by small
farmers was estimated to be 1300 ha, with annual production of about 750 t of
unshelled nuts (Central Statistical Office 1993, unpublished data). Although the 1993
figures are not yet available for the rural sector, it is widely believed that more than
50% of bambara groundnut annual production comes from the sector. A total of 91%
of the rural areas are situated in Natural Regions III, IV and V, which receive low
rainfall (800 mm or less) in relatively short seasons, making them unfavourable for
intensive dryland cropping (Vincent and Thomas 1961). In addition, the rural area
soils are generally coarse-textured sands derived from granite, largely deficient in
organic matter. Commercial farmers produce very little of the crop.
The aim of this survey was to increase the amount of information available on
production, agronomic practices, utilization of the crop and the limitations upon it.
Materials and methods
The survey was conducted during the growing season of 1989. It covered all aspects
of bambara groundnut production in rural areas, agronomic practices and constraints,
marketing, and socioeconomic factors affecting production of the crop. The survey
involved interviews with farmers, using a questionnaire, and also observations.
Certain measurements such as row spacings, plant densities and nodule count were
conducted in the field. Variables such as the cropped area per farmer, bambara
groundnut hectarage and yield were estimated. Between 20 and 23 farmers were
interviewed in each province. The survey was conducted in all eight provinces of the
country, in the districts shown in Table 1.
Table 1. Provinces and districts surveyed in the 1989 growing season.
Province
District
Masvingo
Zaka-jerera
Midlands
Chiundura
Matabeleland South
Esgodini
Matabeleland North
Ntabazinduna
Manicaland
Marange North
Mashonaland West
Zvimba
Mashonaland Central
Rushinga
Mashonaland East
Mutoko
Results
COUNTRY REPORTS
69
8SXEPGVSTTIHEVIEEVIEYRHIVFEQFEVEKVSYRHRYXGYPXMZEXMSR
The total cropped land per farmer varied considerably from one district to another.
Generally, the three districts of Mashonaland province included in the survey
(Zvimba, Mutoko and Rushinga) had higher cropped areas than those in the southern
provinces. However, the average area under bambara groundnut cultivation was
2
extremely low throughout the country, reaching a maximum of 2400 m in Zaka, and
2
a minimum of 400 m in Zvimba. The average area planted with bambara groundnut
was only 0.135 ha per farm. On average, the area cropped with the legume, expressed
as a percentage of the total cropped area, was 7%, which is rather low. About 50% of the
farmers interviewed indicated that they planned to decrease the area cropped with
bambara, owing to land scarcity, shortage of seed and other factors; 7% had no plans to
change their hectarage; 43% said they would increase the bambara groundnut cropped
area because the crop fetches higher prices now than it did previously.
Farmers identified land shortage as a major contributing factor in their plans to
reduce production, and stated that there was not enough land available to allocate to
the various crops they would like to grow. As maize is the main staple food crop, and
has now become an important cash crop, more and more land is being allocated to
maize at the expense of the other crops. Some farmers also leave a sizeable
percentage of land fallow each season, for a number of reasons, which include labour
and draught power shortages.
7SMPJIVXMPMX]TVSFPIQW
A decline in soil fertility was the major reason for the decrease in bambara groundnut
yield. Rural area soils are generally coarse-textured sands, derived from granite, and
largely deficient in nitrogen, phosphorus and sulphur (Grant 1988). They are low in soil
organic matter and have low water-holding capacity. Farmers said they used to grow
the crop on virgin land with high nutrient levels (which is no longer available). The
practice of leaving some land fallow, to improve fertility, is also fast disappearing,
owing to shortages of land. Farmers’ inability to buy mineral fertilizer worsens the
nutrient status of the soil, and the decline in the number of farm animals per household
also resulted in reduced amounts of manure. The decreasing soil fertility represents a
major challenge, to farmers and to all those involved in local agriculture.
7IIHZMEFMPMX]ERHZEVMIXMIW
Shortage of seed, lack of improved varieties and the planting of seed retained by
farmers (which usually has germination and viability problems) are other important
factors contributing to low production and yield. It should, however, be noted that
there are virtually no improved varieties commercially available, and farmers have little
choice in those that they plant. About 24% of the farmers interviewed rated the
germination of the crop as fair to poor. Most of the farmers who rated the germination
as poor were from the Ntabazinduna and Marange North districts.
There are no varieties of bambara groundnut, sensu stricto, but farmers distinguish
different seedlots by their appearance (Linneman and Azam-Ali 1993). Seed colours
observed during the survey varied from white, black, red and brown, through to
cream, with different eye colours. Various combinations of these colours were
observed, as well as speckled, mottled and mosaic testa patterns. The distribution of
these varieties varied from region to region. For example, in Matabeleland, the black
as well as the cream and red-seeded varieties were dominant, and in Mashonaland,
the cream and red-seeded varieties. The cream-seeded type of bambara groundnut
was the most widely grown in the country.
70
&%1&%6% GROUNDNUT
4PERXMRKQIXLSHWHEXIWERHTPERXTSTYPEXMSR
On average, 75% of the farmers interviewed plant the crop in rows. The remainder
grow it in a scattered pattern, but they do not broadcast. Planting dates ranged from
late October to early January, but more than 80% of farmers plant the crop between
2
mid-November and mid-December. The highest number – 12 plants/m – was
obtained in the Zvimba district. The Rushinga district had an average of
2
11 plants/m ; planting densities in the other districts were between 8 and 10
2
plants/m . The drought occurring over the past few years, especially in Masvingo
and Matabeleland, reduced germination and other processes. The consequences of
this have been reduced yield and even reduced seed supply.
*IVXMPM^IVETTPMGEXMSRERHRSHYPEXMSR
On average, only 18% of the farmers apply fertilizer directly to bambara groundnut,
and it is this group who registered yield increases in some years. They apply fertilizer
in the form of organic manure, compound D and ammonium nitrate. Most farmers
lack knowledge of the appropriate fertilizers, and most of them indicated that even if
they knew which fertilizers to apply, they could not afford to buy them. Another
group of farmers stated that since they apply fertilizers to maize, the subsequent
bambara groundnut crop benefits from the residual fertility. It is important to note,
however, that the fertilizer applied to maize is sometimes not adequate. Partly due to
a lack of nutrients, about 60% of the bambara groundnut crop had yellowish green
leaves. Only 17% of the crop appeared dark green in colour (indicating adequate
nutrition) and 23% of the crop was green.
The average number of nodules per plant in Zimbabwe was only 11. This seems
to be lower than that recorded in countries such as Ghana, where the number of
nodules per plant ranged from 92 to 318 (Thompson and Dennis 1977; Mafongoya
1988). The lowest number of nodules per plant was at Zaka, and the highest at
Esgodini. There was no relationship between the number of nodules per plant and
2
the plant density (number of plants/m ). One reason for the low nodule number is
the fact that most farmers do not inoculate seed with Bradyrhizobium at planting.
;IIHGSRXVSP
In only two out of the eight districts is the crop weeded at 2 weeks after planting. In
the remaining six districts, weeding takes place at 3 weeks after planting. Farmers
expressed concern over the critical labour shortage, especially during weeding,
earthing-up and harvesting.
Pests and diseases
The incidence of pests and diseases in bambara groundnut has increased in recent
years, and this causes substantial production losses. Aphids represent 65% of the
insect pests on the crop. The aphid problem is encouraged by late planting, and by
periods of heavy rainfall, followed by days of sunshine. Extension staff attribute the
aphid problem to low plant populations. Ants and termites constitute another 15% of
bambara groundnut pests, and the remaining 20% are accounted for by such pests as
cutworms, nematodes and weeds. Current bambara groundnut diseases of note are
die-back, rosette and a virus disease, spread by aphids. These pests and diseases are
not considered very serious problems on the crop, however. Only 5% of the farmers
interviewed chemically control the pests and diseases. Others are not familiar with
COUNTRY REPORTS
71
control methods and cannot afford to buy the chemicals. However, 94-100% of the
farmers practise rotation of bambara groundnut with other crops (both legumes and
non-legumes), which is one way of controlling some of the pests.
Crop yields
Yield is one of the most important aspects to be considered in efforts to improve the
level of production. Current yields are generally low, ranging from 400 kg/ha to just
under 1400 kg/ha of unshelled seed. In the survey, the highest yields were obtained
in the Esgodini district and the lowest in the Mutoko district. Some of the recorded
yields, especially at Mutoko, are inaccurate, however, because farmers harvest a great
part of the crop for consumption at immature stages. Farmers expressed different
opinions on whether the total production and yield of bambara groundnut are
increasing, although more farmers stated that yields were decreasing, due to a
number of constraining factors, mentioned above.
Use at household level
The crop has distinct advantage over many other crops, because it is easy to prepare
for consumption and has many culinary uses. The beans are prepared in various
ways. The seeds can be boiled and eaten as a soft porridge. At maturity, the dry
seeds are eaten after being boiled, either on their own or mixed with maize grain.
Many farmers also preserve bambara groundnut as a relish, mainly for consumption
during the dry season. Alternatively, some farmers eat it roasted as a snack. Other
farmers leave the dry leaves in the field so that livestock can feed on them.
Research needs
The survey revealed some areas to be targeted, to increase production and improve
the marketing of bambara groundnut.
• Immediate attention must be given to improving production and distribution of
seed, to overcome the present seed shortage.
• The extremely low current yields need to be improved through breeding
programmes, and also through developing better crop husbandry techniques
(these include: identification of the best fertilizers to be used, and appropriate
levels and methods of application; economic methods of pest and disease control,
and improved plant populations).
• The development of a better marketing strategy to exploit any increased
production of the crop.
%GORS[PIHKIQIRXW
The authors thank Mrs D. Hikwa and Mrs R. Madamba for their comments during the
preparation of this paper, and Mr E. Hungwe for helping in the collection and analysis of the
data.
72
&%1&%6% GROUNDNUT
%KVSRSQ]
2MXVSKIRJM\EXMSRERHRMXVSKIRRYXVMXMSRMRW]QFMSXMGFEQFEVE
KVSYRHRYX:MKREWYFXIVVERIE0:IVHGERH/IVWXMRK
WFIER
1EGVSX]PSQEKISGEVTYQ,EVQW1EVÁGLIX&EYH
F.D. Dakora and L.M. Muofhe
University of Cape Town, Rondebosch, South Africa
Introduction
In terms of both production and consumption, bambara groundnut (Vigna subterranea
(L.) Verdc.) is the most important food legume in Africa after cowpea (Doku and
Karikari 1970), and has numerous agronomic and nutritional attributes which make it
an excellent legume crop to develop. This legume is adapted to both the poor and the
fertile soils of the entire continent, and produces seeds that are high in protein (1424%) and carbohydrate (60%) content (NAS 1979). Bambara groundnut seed protein
is richer in the essential amino acid, methionine, than most other grain legumes.
Kersting’s bean (Macrotyloma geocarpum (Harms) Maréch. et Baud.), a related,
similarly geocarpic species, also has a seed protein content of 21.5% and high levels of
the sulphur-containing essential amino acids – lysine (6.2%) and methionine (1.4%).
Thus, from a nutritional point of view, these two legumes are unique in providing the
essential dietary amino acids that are lacking in most food legumes. From an
agronomic standpoint, both are disease-free, exhibit considerable tolerance and grow
in soils with varied nutrient fertility, including low and high NO3 levels. They
produce yields in poor soils where no other crops can survive.
Despite their nutritional and agronomic attributes, very little work has been done
on improving the yields of these legumes. The aim of this paper is to examine the
relative physiological improvements of these crops, with respect to the dependence of
each on symbiosis vs. soil sources for their N nutrition.
Selecting for symbiotic performance
Bambara groundnut and Kersting’s bean are both tropical legumes that nodulate with
cowpea-type bradyrhizobia. An earlier study by Doku (1969b) demonstrated the ability
of bambara groundnut in particular to cross-nodulate with isolates from different
tropical legumes, which indicates that the species is less selective in its bacterial
requirements. However, because these legumes grow over a wide range of soil factors
(low fertility, low moisture, vs. high fertility, high moisture, or low temperature vs. high
temperature), their symbioses with root-nodule bacteria are bound to differ from one
locality to another within Africa. The bradyrhizobia strains nodulating these legumes
will not only differ between dry and well-moistured soils, but also between low and
high NO3 soils, and low and high temperature conditions.
Studies of cowpea (Ahmad et al. 1981) have shown that bradyrhizobia nodulating
this host plant in the much drier, hotter and infertile Maradi soils of Niger are
serologically and morphologically different from those occurring in Ibadan soils, which
are wetter, humid and more fertile. Colonies of Maradi strains are ‘dry’ (colonies
AGRONOMY
73
<2 mm, circular and convex, with an entire margin), and serologically very reactive,
while those of Ibadan strains are ‘wet’ (colonies >2 mm, irregular margins, and
confluent growth, with abundant extracellular polysaccharide production (EPS) and
antigenically less reactive. This wet/dry colony characteristic, together with differences
in EPS production, could possibly account for the ability of bradyrhizobia nodulating
African legumes such as bambara groundnut, Kersting’s bean and cowpea to survive in
soils with the highly differing moisture, temperature and pH levels found in Africa.
Whether these features affect bacterial strain survival and persistence in soil as a
saprophyte has not been examined. However, the historically marked variation in
farm yields (600-3000 kg/ha) of bambara groundnut in Africa (Rachie and Silvestre
1977), and the fact that high-yielding cultivars from one country can perform poorly
in another (NAS 1979), suggest considerable differences in the symbiotic efficacy of
native bradyrhizobia which nodulate this species. It is therefore not surprising that
recent interest in increasing bambara groundnut production in Africa has targeted
symbiotic effectiveness as a way to yield improvements.
Although it has been suggested that bambara groundnut does not require
inoculation (Johnson 1968), growing evidence indicates the need for inoculation with
an effective Bradyrhizobium, especially where newly cultivated fields are involved
(Stanton et al. 1966). It has been demonstrated in Togo that inoculating bambara
groundnut with suitable strains of Bradyrhizobium can significantly increase yields
(Dadson et al. 1988). The increase in symbiotic performance and grain yields was
higher when cultivars were inoculated with indigenous bradyrhizobia, rather than
with foreign strains (Table 1). Similar data have recently been reported in Senegal
(Gueye 1990). These findings clearly indicate the potential for increasing yields in
Thus,
bambara groundnut through enhancement of symbiotic N2 fixation.
programmes which select for effectiveness in Bradyrhizobium/bambara groundnut
symbioses are indirectly selecting for high grain yields. Programmes initiated in Togo
(Dadson et al. 1988), Senegal (Gueye and Bordeleau 1988; Gueye 1990) and Nigeria
(Mulongoy and Goli 1990) have already started to select for effective symbioses as a
way of increasing bambara grain yields. Unlike bambara groundnut, which has
started to attract research interest, virtually no data exist on Kersting’s bean.
Table 1. Bradyrhizobial strain effects on grain yield of field-grown
bambara groundnut in Africa.
Treatment
Togo
Uninoculated
Nitrogen
TAL 169
TAL 1380
TMUN
TBAM
MAO 11
MAO 26
Grain yield (kg/ha)
cv. Kara
742 d
2003 bc
2167 b
2448 a
2665 a
2084 bc
2482 a
1888 c
cv. Ada
396 d
1873 a
1318 b
870 c
1931 a
1860 a
1807 a
892 c
Senegal
cv. 79-1
cv. 83-131
Uninoculated
2989 b
3080 b
Nitrogen
2992 b
3833 ab
MAO 113
3512 ab
4661 a
TAL 22
4492 aa
4864 a
Values in a column with the same letter are not significantly different. Adapted
from Dadson et al. (1988) and Gueye (1990).
74
&%1&%6% GROUNDNUT
,SWXTPERXHITIRHIRGISRW]QFMSXMG2
Although both bambara groundnut and Kersting’s bean nodulate freely with
bradyrhizobia, little is known about the amounts of N fixed by these symbioses and
their relative dependence on fixation for N nutrition. In a recent study by Dakora et
al. (1992), the separate contributions of NO3 and fixed N to total plant N were
assessed, for both bambara groundnut and Kersting’s bean. Our findings showed
that nodulated plants of both species depend largely on symbiotic N for their N
nutrition, even when free NO3 is available for uptake by roots (Table 2). In general,
N2-fixing legumes require 16 moles of ATP per unit NH3 produced, compared with 14
moles of ATP per unit NO3 absorbed, indicating a greater energy cost, if bambara
groundnut and Kersting’s bean are to depend on Bradyrhizobium for their N
requirements. The preference for symbiotic N utilization shown by these species
therefore clearly suggests that their symbioses evolved in N-rich soils. This would
account for their ability to grow in soils with different N fertility.
Table 2. Proportional dependence on N2 fixation by species grown in the presence
of NO3 .
Nitrogen (%) derived from fixation
Bambara groundnut
Kersting’s bean
†
NO3 conc. (mM)
56 DAP
25 DAP
46 DAP
28 DAP
‡
0
100(0)
100(0)
100(0)
100(0)
2
99(1)
93(8)
95(5)
91(9)
5
96(4)
79(21)
91(9)
80(20)
15
95(5)
50(50)
80(20)
52(48)
†
Days after planting.
Proportional dependence by plants on mineral N supplied as NO3.
Adapted from Dakora et al. (1992).
‡
,SWXTPERXHITIRHIRGISRQMRIVEP2
Some legumes prefer NO3 to NH4, and vice versa. Preference shown for these N types
was tested using Macrotyloma geocarpum supplied with 2 mM NO3, 2 mM NH4 and
2 mM NH4NO3. Nitrogenase activity remained unaltered relative to control within
6 hours after applying treatments (Table 3). However, nodule functioning declined
by 39% within 3 days in the 2 mM NH4 plants, 56% in those at 2 mM NH4NO3, and
increased by 13% in 2 mM NO3 plants. By 8 days, nitrogenase activity had decreased
to 77% of control for NO3-treated plants, 35% for NH4 and 14% for plants in 2 mM
NH4NO3. These findings suggest that NO3 is the likely source of N uptake by
nodulated V. subterranea and M. geocarpum plants grown in soil.
15
The use of NO3 in the study by Dakora et al. (1992) permitted a measure of NO3
uptake by both V. subterranea and M. geocarpum plants. Except during the first
sampling period (up to 28 days after planting), when V. subterranea took up
considerably less NO3 than M. geocarpum, the amount of plant N derived from NO3 in
the two species was similar (Table 3). In each case, increasing external NO3 resulted in
progressively more NO3 being translocated in xylem (Table 4). Furthermore, the
concentrations of NO3 in xylem exudate, at comparable levels in the nutrient solution,
were similar for the two species (Table 4), indicating that the distribution of
assimilation sites between roots and shoots was not likely to be greatly different for
the two legumes.
AGRONOMY
75
Table 3.
Nitrogenase activity (µmol C2H4 produced per hour-1 plant-1) of
Macrotyloma geocarpum plants after supplying combined N.
N source
No. of days after N supply
(mM)
0.25
3
6
8
15
†
0
6.4±0.3
7.8±0.7
9.3±0.9
9.0±0.7
6.4±0.5
2 NO3
6.9±2.0
7.2±0.3
8.7±0.5
7.2±0.5
3.0±0.1
7.9±0.1
3.9±0.6
3.2±0.4
3.3±0.5
2.1±0.1
2 NH4
6.6±1.3
2.8±0.5
2.7±0.4
1.3±0.6
0.5±0.1
2 NH4NO3
†
Values are mean ± SE (n = 4 pots, each with 4 plants) (Dakora, unpublished).
Table 4. NO3-N and fixed N concentration (µg N/ml) in root bleeding xylem
†
exudates. Plants were supplied with NO3 at 22 DAP (bambara groundut), 18 DAP
(Kersting’s bean) and harvested at 35 DAP (bambara groundnut) and 46 DAP
(Kersting’s bean).
Bambara groundnut
Kersting’s bean
NO3 conc. (mM)
Ureide-N
NO3
Ureide-N
NO3
†
0
7
1171
28
993
2
698
45
1003
49
5
279
103
1161
224
15
303
192
364
525
†
DAP = days after planting. Adapted from Dakora et al. (1992).
Assays for nitrate reductase activity (NRA) in M. geocarpum, made using an in vivo
method with intact tissue from all component organs of the plant, showed a
progressive increase in total activity, as the NO3 level in the medium was raised
(Fig. 1). As has been found for other species belonging to the tribe Phaseoleae
(Andrews et al. 1990), M. geocarpum, and particularly the leaves, contained significant
constitutive NRA and it was the activity in leaves which was substrate-induced
(Fig. 1). This pattern of induction of NRA is similar to that found previously for
cowpea, and is consistent with an increasingly shoot-based reduction of incoming
NO3 (Atkins et al. 1980), as the level of NO3 in the transpiration stream increases
(Table 4). In these respects, both legumes were similar to other members of the
Phaseoleae (Atkins et al. 1980; Pate and Atkins 1983; Andrews et al. 1990).
6IWTSRWISJW]QFMSXMGFEQFEVEKVSYRHRYXERH/IVWXMRK
WFIERXS23
Estimates of N2-fixing rates in V. subterranea and M. geocarpum show large differences
in symbiotic effectiveness in the presence of NO 3 (Dakora et al. 1992). Providing
mineral N to nodulated bambara groundnut and Kersting’s bean can initially
stimulate N2 fixation in both species. However, with a prolonged supply of external
N, fixation in bambara groundnut is severely reduced, a common observation in
many legume/Rhizobium, or Bradyrhizobium, symbioses. With Kersting’s bean, on the
other hand, continued NO3 supply for up to 4 weeks did not alter N2 fixation,
compared with purely symbiotic plants. Even at 15 mM NO3, plants still showed N2fixing rates higher than plants depending solely on symbiotic N nutrition.
In many ways, the degree of NO3 tolerance exhibited by Kersting’s bean is rather
intriguing. In a recent study, we have shown that the difference in inhibition of
nitrogenase activity exhibited by these two species is not due to different intensities of
NO3 uptake, or patterns of distribution and assimilation of NO3, but rather to some
76
&%1&%6% GROUNDNUT
specific effect of NO3 on nodule functioning in Kersting’s bean. The mechanism
involved in NO3 inhibition of nitrogenase activity has not been clearly defined. Most
hypotheses are based either on direct toxicity of NO2 from NRA on nitrogenase and
leghemoglobin (Rigaud and Puppo 1977), NO2 conversion of leghemoglobin to
nitrosylleghemoglobin (Kanayama and Yamamoto 1990), or on an indirect effect of
NO3 assimilation elsewhere in the plant, which results in reduced photosynthate
supply to nodules (Harper and Gibson 1984; Oghoghorie and Pate 1971).
Fig. 1. Distribution of NO3 reductase between component organs of nodulated
Macrotyloma geocarpum plant supplied with NO3 from 18 to 30 DAP (L = leaves, S =
stems, R = roots, N = nodules) (Dakora, unpublished).
Although one or the other of these have been regarded as more relevant in
particular symbioses (Wasfi and Prioul 1986), recent studies indicate that NO3
treatment results in increased resistance of nodules to gaseous diffusion, with
consequent limitation of O2 supply to bacteroids (Minchin et al. 1986; Vessey et al.
1988a). Vessey et al. (1988b) have further shown that NO3 treatment reduces phloem
supply to nodules which, although possibly restricting the supply of assimilates for
nitrogenase, also results in a lowered supply of water for export of the products of N2
fixation (Walsh et al. 1989). Where and how in such a scenario M. geocarpum differs
from bambara groundnut, or other nodulated legumes, remains to be determined.
However, the degree of tolerance shown by the species to NO 3 provides a useful
experimental basis with which to test the components of these hypotheses, and to
examine the possibility of exploiting such traits to improve the tolerance of other
legumes to combined N. Traditional farming in Africa is based largely on mixed
AGRONOMY
77
cropping, a system which does not easily permit N fertilizer application to associated,
N-starved cereal and vegetable crops. Identifying naturally occurring NO3-tolerant
legumes would be an added advantage to mixed cropping systems.
)JJIGXWSJGSX]PIHSRVIQSZEPERHFSVSRRYXVMXMSRSRW]QFMSWMW
Data from another study (Muofhe and Dakora, unpublished) have shown that
adequate boron supply is important for effective symbiosis in bambara groundnut.
Insufficient boron supply causes a marked decrease in nodule formation in this
species. Nodules formed by boron-deficient plants are smaller in size, and paler in
colour, with an expected reduced dry weight, compared with those formed under
boron-sufficient treatment. As a consequence of the reduced nodulation, N2 fixation
in such boron-deprived plants decreases by almost 50%.
Removal of cotyledons from seedlings of bambara groundnut resulted in marked
reduction in photosynthetic leaf area, an effect likely to decrease photosynthate
supply for nodule formation and nodule functioning.
This reduction in
photosynthetic area was about twice as great when boron was deficient in the rooting
medium. Cotyledon removal also inhibited nodulation, particularly in borondeficient bambara groundnut plants. The physiological response of Kersting’s bean to
both boron and cotyledon removal has still to be determined.
Conclusions
Inoculating bambara groundnut with suitable strains of Bradyrhizobium can markedly
increase yields of this crop. So, any programme aimed at promoting bambara
groundnut production must consider cultivar selection for effective symbiosis,
preferably with native bradyrhizobial strains. A continent-wide programme on
collecting germplasm of both bambara groundnut and Kersting’s bean, followed by
testing of bradyrhizobial strains on various cultivars, needs to be initiated. The
relative NO3 tolerance observed in the symbiosis of both species is also an important
trait worth re-evaluating with native strains. No doubt, more research needs to be
done, especially on the physiology of N2 fixation in these nutritionally important
geocarpic species.
78
&%1&%6% GROUNDNUT
4IWXWERHHMWIEWIWSJFEQFEVEKVSYRHRYXMR>MQFEF[I
Y. Gwekwerere
Department of Science and Maths Education, University of Zimbabwe, Harare,
Zimbabwe
Introduction
The bambara groundnut (Vigna subterranea (L.) Verdc.) is one of the indigenous
African crops currently receiving interest from researchers, owing to its high yield
and resistance to diseases (Hepper 1970), as well as its adaptability to poor soils and
low rainfall. During a survey carried out by agronomists in 1989 to establish the
current bambara groundnut production practices and constraints on the crop in
Zimbabwe, the incidence of pests and diseases was found to be high. Since bambara
groundnut is not a major crop in Zimbabwe, very little work has been done so far to
establish the extent of damage caused by pests and diseases on this crop. The
information given in this paper is based solely on advisory records from the Plant
Protection Research Institute, and from the findings of the 1989 survey.
Diseases
Diseases which have been recorded on bambara groundnuts in Zimbabwe include
leaf spot (Cercospora canescens), powdery mildew (Erysiphe sp.), leaf spot (Phyllosticta
voandzeia), wilt (Fusarium sp.), leaf blotch (Phomopsis sp.) and Sclerotium rolfsii
(Pathology advisory notes, unpublished). Leaf spot caused by C. canescens was
7
recorded in Zimbabwe by Rothwell in 1983. This disease was also recorded at Gwebi
in 1986, and by the Crop Breeding Institute in 1994. Symptoms of isolated brown
spots appear on the leaflets, and a severe attack can cause defoliation. Pod size can be
reduced significantly if infestation occurs before flowering. Wilting and yellowing of
bambara groundnut, caused by Fusarium sp., is another disease of bambara
groundnut, recorded in Zimbabwe by the Crop Breeding Institute in 1994.
Characteristically stunted plants with vascular discolouring appear about 50 days
after sowing. Symptomatic yellowing, necrosis and wilting will occur, and the
affected plant eventually dies. Fusarium wilt has also been reported from Kenya
(Cook 1978), and in Tanzania it has been described as Fusarium oxysporum (Ebbels and
Billington 1972).
Powdery mildew, which is caused by the fungus Erysiphe pisi, was also recorded
by Rothwell on bambara groundnut in 1983. Symptoms of a whitish powder are
visible on both sides of the leaflets, but it is more frequent on the abaxial side. Infected
leaves dry out and die prematurely. Powdery mildew is a widespread disease in
Madagascar, and has been named Sphaerotheca voandzeia (Bouriquet 1946).
Phyllosticta voandzeia causes leaf spots on bambara groundnuts. In Zimbabwe, it
was recorded at three sites in 1986: Gwebi, Chiduku and Muzarabani. The disease is
recognized by the characteristically ill-defined, irregular, circular, brownish purple
spots that are visible on the leaves.
Bambara stem rot caused by S. rolfsii is another disease of bambara groundnut
that was recorded at Kadoma in Zimbabwe, in 1986. The initial symptoms of rot, at
7
Rothwell, A. 1983. A revised list of plant diseases occurring in Zimbabwe (unpublished).
AGRONOMY
79
the base of the stem, are followed by the production of black sclerotia on infected
tissue. The rot, which begins below soil level, spreads into the crown of the plant, and
in severe cases, to the pods, and downwards into the root system. Sclerotia can
survive in the soil between crops.
The bambara groundnut leaf blotch caused by Phomopsis sp. has been recorded at
only one site in Zimbabwe, and it is not as widespread as the other diseases that have
been mentioned.
Viruses
Bambara groundnuts were found to be susceptible to rosette during the 1989 survey.
This is a virus disease, which is spread by aphids. The two main strains of rosette
disease are chlorotic rosette and green rosette. The symptoms of chlorotic rosette are
a mosaic pattern of dark green banding on light green leaflets, or alternatively, the
leaves may be completely necrotic. In the latter case, leaves are slightly reduced in
size, and usually have distorted leaflets. The most common symptoms of green
rosette are a dark green foliage mottle on a light green background, and a marked
reduction in leaflet size.
Pests
Insect pests which have been recorded on bambara groundnut in Zimbabwe include
aphids (Aphis sp.), bruchids (Callosobruchus sp.), leafhoppers (Hilda patruelis) and
termites (Entomology advisory notes, PPRI). In the field, pests feed on leaves and
sap, thereby disrupting photosynthesis and causing low yields. Other pests feed on
the seed, reducing its quality and viability. From the 1989 survey, it was found that
aphids (Aphis sp.) represented 65% of the insect pest problem on bambara groundnut
8
in Zimbabwe. Aphids feed on young shoots, causing leaves to curl and growth to be
stunted. Sap loss from feeding by aphids leads to stress during dry periods. Aphis sp.
is an important bambara groundnut pest because it transmits the rosette virus.
The sap-sucking leafhopper, Hilda patruelis, was recorded on bambara groundnut
in Manicaland in 1983. Leafhoppers attack the underground parts of the plant. Plants
wilt and collapse, due to sap sucking by the leafhoppers. These insects coexist with
black ants, which also protect them.
Termite damage to bambara groundnut in Zimbabwe was recorded during the
1989 survey. Two basic forms of termite damage to bambara groundnuts have been
noted, namely scarification of the pods by Odontotermes, and penetration and
hollowing of the tap root by Microtermes. Scarification of the pods weakens them,
resulting in shattering or cracking during harvest. Hollowing of the tap root causes
wilting of the plants.
The bambara groundnut seed is liable to attack by bruchids, Callosobruchus sp.
This weevil, which was recorded by the Agronomy Institute in 1987, causes loss of
quality, quantity and seed viability. Bruchid infestations start in the field, and in most
cases, continue in storage. In a few cases, field infestations soon terminate under
storage conditions. Damage to the embryo by the feeding bruchids impairs
8
Mafongoya, P. and V. Mabika. 1988. Bambara nut (Vigna subterranea) production in communal areas
of Zimbabawe (unpublished).
80
&%1&%6% GROUNDNUT
germination. Poor grain quality will also result from reduction in the amount of
carbohydrates and proteins.
Nematodes
The root-knot nematode Meloidogyne javanica has been found to seriously infect
bambara groundnut in Zimbabwe (Martin 1959). These nematodes were also
recorded during a survey carried out by the Plant Protection Research Institute in
1989. Meloidogyne larvae invade the roots and feed in the vascular system of the
bambara groundnut, causing formation of giant cells. In severe cases, the roots of
infested plants are completely covered with swellings caused by hypertrophy of the
cortical cells. Damage to roots impairs the normal growth of the bambara groundnut,
causing stunted growth, yellowing and wilting. Reduced dry matter accumulation,
and more frequent flower abortion, has been observed.
Current research
None.
Future research
Since very little work has been done on the pests and diseases of bambara groundnut,
there is a need to carry out a country-wide survey, to make an inventory of all the
pests and diseases of this crop, and to establish which ones cause serious damage, and
hence yield loss. Field research work on yield loss assessment is also important.
Since bambara groudnut is said to be resistant to diseases, work needs to be done on
screening different varieties for resistance/tolerance to pests and diseases, and this
must be collaborative work between breeders and plant protectionists. Bambara
groundnut is only grown as a supplementary food crop in Zimbabwe, and it is not
economical to chemically control pests and diseases. Therefore, research on cultural
and biological control methods also needs to be done.
AGRONOMY
81
)ZEPYEXMRKXLITSXIRXMEPJSVFEQFEVEKVSYRHRYXEWEJSSHGVSTMR
WIQMEVMH%JVMGEERETTVSEGLJSVEWWIWWMRKXLI]MIPHTSXIRXMEPERH
IGSPSKMGEPVIUYMVIQIRXWSJERYRHIVYXMPM^IHGVST
Sarah Collinson
University of Nottingham, UK
Introduction
In 1992 the European Union initiated funding for a 3-year programme of research to
evaluate the yield potential and ecological requirements of bambara groundnut
(Vigna subterranea (L.) Verdc.). Controlled environment studies have been carried
out at Nottingham University in the UK and Wageningen Agricultural University
in the Netherlands, and combined with field experiments in Botswana, Tanzania
and Sierra Leone. The development of a crop growth simulation model at
Nottingham University serves to integrate data from controlled environment work
and field studies, and to highlight gaps in understanding in the growth and
development of the crop.
The specific objectives of the EU project are to:
1. Identify suitable agro-ecological regions and seasons for the cultivation
of bambara groundnut in Tanzania, Botswana and Sierra Leone.
2. Produce a validated model of bambara groundnut for predicting the
total biomass and pod yield of different genotypes in contrasting soils
and atmospheric environments.
3. Identify the physiological attributes associated with the ability to
produce yields under semi-arid conditions.
4. Recommend suitable management practices to stabilize the yields of
bambara groundnut under rain-fed conditions.
5. Outline a methodology for applying a similar approach to rapidly assess
the potential of other underutilized species in tropical environments.
This project not only assesses the potential for bambara groundnut but also
appraises an innovative approach which could be applied to any under-researched
species. Research within the International Agricultural Research Centres focuses
almost exclusively on the major crop species and agroclimatic regions, and funds
are rarely directed towards those crops considered to be of secondary importance.
Limited, piecemeal research has been carried out on crops such as bambara
groundnut at various African universities and National Research Institutes, but as
yet there has been no major funding provided for these minor crop species. It is
envisaged that through the integration of controlled environment and field
experiments a more comprehensive understanding of the physiology and
agronomic requirements of the crop can be established.
Field experiments
The three African partners within this project are Botswana College of Agriculture,
Sokoine University of Agriculture, Tanzania, and Njala University College in Sierra
Leone. These three locations encompass much of the rainfall environments and
latitudes of the major bambara groundnut growing regions in Africa, and hence are
82
&%1&%6% GROUNDNUT
ideally placed for conducting research on the crop. Within each partner country
experiments have been focused on two local landraces usually grown at two field
sites. A primary concern has been the effect of sowing date on growth,
development and yield, due to the photoperiodic control of pod-filling.
Experiments at Botswana College of Agriculture began in the 1992/93 cropping
season when two landraces (Gaborone Cream and Zimbabwe Red) were sown at
three dates and under both rain-fed and irrigated conditions at the main site at
Sebele (24°33’S, 25°54’E, 994 m). At the secondary site at Tshesebe (21°11’S, 27°32’E,
300 m) three sowings of the same two landraces were carried out under rain-fed
conditions. At Sebele five plant populations were sown at the second sowing date,
2
from 5 to 66 plants/m . However, plant population at final harvest varied from
2
only 5 to 22 plants/m , and there were no consistent trends in dry matter
production in response to plant population. Delaying sowing at both sites resulted
in a reduction in total dry matter and pod yields. However, pod yields were poor
2
across all sowings with a maximum yield of 18 g/m .
During the following season, five sowings were carried out at Sebele and
Tshesebe from October 1993 to February 1994. The landraces grown were the
progeny of those grown in the previous season. At both sites later sowings resulted in
fewer leaves and flowers than the earlier sowings. The last two sowings at Sebele
resulted in no pod yields, perhaps due to the lower temperatures experienced during
May to July. The maximum pod yield was achieved by Gaborone Cream seed sown
2
at the end of November, resulting in a pod yield of about 120 g/m . A comparison of
yields from both seasons indicates that the highest yields would be achieved by
sowing before the end of December (e.g. Tshesebe, Fig. 1).
In Tanzania the first experiment was carried out under irrigation in the dry
season at the main site, Morogoro (6°49’S, 37°40’E, 300 m), and a secondary site,
Miwaleni (3°21’S, 37°19’E, 700 m). Two landraces, one cream-seeded and one redseeded, were obtained from a farmer in the Dodoma region. Three sowings were
carried out between 30 June and 30 August. In general, pod production declined
with later sowings. However, pod yields at Morogoro were low (a maximum yield
2
2
of 10 g/m ) compared with those at Miwaleni (up to 80 g/m ).
Three irrigated sowings were carried out at Morogoro between February and
April 1994, and five rain-fed sowings between January and May 1994. The second
site was moved to Dodoma (5°54’S, 35°57’E), which was thought to be more
representative of the bambara groundnut growing regions in Tanzania. At this
second site three sowings were carried out under rain-fed conditions from January
to March 1994. Unfortunately the irrigated treatments at Morogoro had to be
abandoned because of leaf damage by mildew and Cercospora leaf spot. For the
rain-fed treatments, pod yields declined with later sowings: combining pod yields
for 1993 and 1994 at Morogoro indicates a clear decline in pod yields per plant with
delayed sowings (Fig. 2).
At Dodoma the first sowing produced higher total dry matter and pod yields
2
than the two later sowings (Fig. 3), with DodR94 producing a yield of 300 g/m .
The failure of the second two sowings was probably due to the short rainy season at
Dodoma as there was little rain from April onwards.
In Sierra Leone two landraces were obtained from farmers in the Kabala
(KabC93) and Lunghi (LunT93) regions. These were sown on five occasions from
April to August 1993 at two sites: Njala (8°1’N, 12°8’W, 51 m) and Kabala (9°5’N,
11°6’W, 464 m). At both sites later sowings resulted in reduced total dry matter
production. Pod production was poor in both landraces, with a maximum yield of
2
17 g/m produced by LunT94. There were problems with fungal diseases causing
AGRONOMY
83
leaf damage, especially at the Njala site where total dry matter production reached a
2
2
maximum of 120 g/m , compared with 340 g/m at Kabala. The trials were sown
on flat land at high densities in contrast to the practice of local farmers, who sow on
ridged land. Therefore in 1994 an experiment was carried out to investigate the
effect of plant population and raised/flat beds on growth and development, at both
2
Njala and Kabala. Increasing plant population (from P1, 2.8 plants/m to P5,
2
44 plants/m ) resulted in fewer leaves and flowers per plant (Fig. 4) at both sites.
Dry matter production was much higher at the Kabala site.
At final harvest, plants sown at the highest populations produced higher pod
yields per unit area. Pod yields were higher than in the previous year, with a
2
maximum of 60 g/m produced by LunT93. This may be attributed to a reduced
incidence of fungal attack due to a more open canopy, and better drainage from the
raised beds.
Fig. 1. Pod yields at Tshesebe, in response to sowing date.
Fig. 2. Pod yields at Morogoro, Tanzania, 1994, in response to sowing date.
84
&%1&%6% GROUNDNUT
Fig. 3. Pod yields at Dodoma, Tanzania, 1994, in response to sowing date.
Fig. 4. Mean leaf number per plant, for five populations (P1-P5) and one flat-bed
treatment (P6) at Kabala, Sierra Leone, 1994.
Controlled environment experiments
The two European partners in the project have a history of research on bambara
groundnut: at Wageningen Agricultural University the focus has been on the
effects of daylength and temperature on the rates of phenological development. In
1993, experiments showed that Gaborone Cream was slightly sensitive to daylength
with respect to the time to flowering, and both Gaborone Cream and Zimbabwe
Red were sensitive to daylength with regards to pod filling. In long daylengths,
assimilates continue to be partitioned to the leaves, resulting in a greater leaf area
than under short daylengths. In 1994, experiments showed that the rate of progress
to flowering could be modelled as a linear function of temperature in three
landraces. In two of these landraces (GabC92 and NTSC92) the rate of progress to
podding could be modelled as a function of temperature and daylength (Fig. 5).
Experiments investigating the timing of photoperiod sensitivity found that the
inductive period started around 71 DAS for GabC92, and 43 DAS for NTSC92 and
NTSR94.
AGRONOMY
85
In 1995 an experiment was carried out in the Tropical Crops Research Unit
(TCRU) glasshouses at the University of Nottingham to examine the growth,
development and yield of one landrace from each partner country. Two irrigation
treatments were imposed: one treatment was irrigated to 90% field capacity on a
weekly basis (irrigated); the second treatment was maintained at 50% field capacity
until 27 DAS after which there was no further irrigation (stored). Preliminary
results indicate that all three landraces produced small pod yields under the stored
moisture treatment, and yields in the irrigated treatment ranged from 2.1 to
4.4 t/ha. There were small differences in landraces in terms of resource use, and
subtle differences in stomatal number accounting for higher transpiration rates
from the landrace from Sierra Leone.
Fig. 5. Days to 50% podding in relation to temperature and photoperiod for
GabC92.
Modelling
A preliminary version of the model was based on controlled environment work
carried out at Nottingham University prior to the start of the EU project. This has
been upgraded using data from Wageningen to simulate the rate of progress to
flowering and podding, and data from the TCRU experiment in 1995. The model is
based on the PARCH model (Predicting Arable Resource Capture in Hostile
Environments) which incorporates a soil profile divided into layers, coupled with a
crop growth module (Fig. 6). As this acronym suggests, this model has been
developed primarily for harsh environments where water availability is scarce. On
each day, light and water are intercepted and converted into dry matter.
If water is non-limiting then growth is equal to the amount of radiation
intercepted multiplied by the conversion coefficient for intercepted radiation. If
water is limiting, growth equals the amount of water transpired multiplied by the
transpiration equivalent (g dry matter produced per kg water transpired). An index
of crop stress is derived from the ratio of light-limited to water-limited growth,
depending on the availability of these resources and the crop’s ability to intercept
86
&%1&%6% GROUNDNUT
them.
Partitioning of dry matter between plant organs depends on the
developmental stage and the level of stress – increased stress results in increased
partitioning to roots and reduced partitioning to pods. Initially most assimilates are
partitioned to the leaves, increasing the leaf area and enabling more light to be
intercepted. When podding occurs there is a gradual decline in partitioning to
leaves and stems as assimilates are preferentially partitioned to pods instead.
Fig. 6. Pictorial representation of the PARCH model.
Progress
The brief summary of field and controlled environment experiments above
indicates the immense effort which has been made at each partner institute
involved in this project. Data have been collected on leaf and flower numbers, and
dry matter production over a wide range of sites, sowing dates and management
practices. However, model development has been slow owing to a lack of detailed
physiological measurements in the field. For example, Sokoine University has the
mandate for crop physiology, and yet until recently there was no equipment in
place to carry out detailed physiological measurements. A neutron probe for
estimating soil moisture content and an AccuPAR ceptometer for measuring light
interception have recently been shipped to Tanzania, and so these measurements
will be made in the 1995/96 experimental season. The model is therefore based on
data from controlled environments, and will need careful validation against field
data if it is to predict field performance accurately.
AGRONOMY
87
Although the literature states that bambara groundnut is resistant to pests and
diseases, our experience is that in high moisture environments, for example in
Sierra Leone, and even in Morogoro, Tanzania, fungal diseases have been a
problem. The most prevalent appear to be Cercospora leaf spot, Rhizoctonia solani
and downy mildew. In some cases whole experiments have been wiped out, and in
others it is difficult to estimate how much damage was caused by disease, as
although leaves were damaged the crop did not fail completely. We must conclude
that bambara groundnut is not as resistant to pests and diseases as was previously
reported, and future research efforts need to consider this aspect.
Pod yields in many of the field experiments have been poor, with a notable
exception being Dodoma where yields up to 3 t/ha were recorded. The reasons
behind these poor yields are not known, but possibilities include: management
factors, such as earthing-up and growing on ridges; disease problems; nutrient
deficiencies, and poor seed quality, although most landraces (from the same seed
source) grown in controlled environments have produced high yields. With the
benefit of hindsight, it may have been more appropriate to carry out a survey of
bambara groundnut growers within each partner country prior to establishing field
experiments. This would have highlighted the problems facing bambara groundnut
farmers before field experiments were initiated. Ideally, research on minor crop
species should be directed by problems identified by those growing the crop, as
they are ultimately the targets for any improvements which can be made in
managing the crop, or through breeding improved cultivars. A farm survey was
carried out in Botswana in February 1995, and some of the findings will be
incorporated into the final project report.
One problem in working on an underutilized crop has been the seed supply.
Initially, seed was supplied by National Tested Seeds in Zimbabwe, but for the
most part seed has been bought from farmers. Hence there is concern over the seed
quality due to poor storage conditions and lack of seed treatments available to
subsistence farmers. With major crop species a named cultivar can be obtained
commercially, and the genetic variability within that cultivar will have been
reduced or removed through plant breeding over the years. However, bambara
groundnut landraces are an unknown entity, with no local cultivar names and large
variation within a so-called landrace. Although seeds can be sorted according to
size, colour and eye pattern/colour, this does not eliminate the genetic diversity
within a landrace. Therefore across all experiments there has been large variation
between plants within the same landrace and under the same treatment, which has
sometimes masked treatment differences. The question remains whether the laws
which have been learnt from major crop species can be applicable to such nonuniform landraces. For example, can a ‘mean’ and ‘standard error’ be applied to a
population containing extremely heterogeneous material? As yet there are no
alternative ways of describing populations, but a group at the Scottish Crops
Research Institute, led by Dr Geoff Squires, is investigating ways of quantifying the
variability within bambara groundnut landraces.
An important part of the project is to communicate research findings to other
bambara groundnut researchers, through a series of reports and publications in the
international literature. A workshop will be held at the University of Nottingham
in July 1996, where it is hoped a wider audience will learn in more detail of our
findings during this project. During the final year there will be field experiments in
Tanzania and Botswana, and further model development based on information
from field and controlled environment work and the farm survey. Ideally,
information from other sources such as indigenous knowledge, and experience
88
&%1&%6% GROUNDNUT
from other researchers will be incorporated into the model. An essential
component will be the development of a strategy, based on the learning experience
gained by all project scientists, to identify the potential of any other underutilized
crop.
Although this project will end in September 1996 it is hoped that our research
on bambara groundnut will be of benefit to those working on the crop in Africa.
The bambara groundnut simulation model will be a potentially powerful tool, for
example in predicting yield under a set of well-defined conditions, or in defining
responses to sowing date at specific locations. At a broader level extrapolation of
results from the model could help in setting research priorities, and in agricultural
planning for a specific region. It is envisaged that model development will
continue after the end of the project, with the development of parameters for other
types of bambara groundnut, and further validation across agro-ecological zones.
Application of the model could also be made in breeding programmes for improved
bambara groundnut types, by defining the most suitable ideotype for a specific
environment.
AGRONOMY
89
8S[EVHWMRGVIEWIHJSSHPIKYQITVSHYGXMSR
J. Mulila-Mitti
Integrated Crop Management/Food Legume Project, Lusaka, Zambia
Introduction
During the past 10 years, health, nutrition, education and other key indicators of
social development have deteriorated in Zambia, causing hardship for the majority
of people. Zambia is facing a severe food security problem, at both household and
national levels. Sufficient calories and protein are not provided by traditional
starchy foods, and high-protein foods are not available at affordable prices and in
sufficient quantities to the majority of the population throughout the year.
Zambian agriculture is predominantly rain-fed, and drought has occurred
frequently in the past decade. Agricultural activity is dominated by small farmers,
who comprise over 90% of the farming population. Crop production is the main
agricultural output, even though livestock, wildlife, fisheries and forestry are also
important. Zambia’s agro-ecology permits a wide variety of farming systems and
crops. In spite of this, in the past, little was done to diversify production.
Subsidies and other counterproductive policies contributed to a decline in
agricultural yields. Maize production was overemphasized, at the expense of
farming systems’ productivity and sustainability. Extension activities did not
adequately cater for all growers, especially for female farmers. Morever, the lack of
an integrated approach to crop development has contributed to research results not
being fully utilized by farmers.
Food legumes in Zambia
Food legumes are important crops: they possess the highest protein content of all
plant foods, and their amino acids complement those of cereals. Peanut is popular
with women farmers, and is grown by housewives, mainly to supplement the
dietary needs of rural families. Food legumes also enrich the soil, by fixing
atmospheric nitrogen and resulting in reduced fertilizer requirements for
subsequent crops. Since these crops are adapted to produce some yield, with little
input, they are the ideal crops for the multitude of resource-poor smallholder
farmers.
Availability of the marketable surplus of peanut, beans, cowpeas and bambara
groundnut to small farmers depends on stable and higher yields, which affect
national food security. Furthermore, peanut, cowpea, pigeonpea and chickpea have
very high export potential, and can contribute to the country’s foreign exchange
earnings. Principal constraints in the production of food legumes include insect
pests, diseases, poor adaptability to abiotic and environmental stresses such as
moisture, soil acidity, temperature, poor agronomic practices and the unavailability
of improved seed.
The increase in the national production of food legumes requires an increase in
the area under these crops and/or the enhancement of productivity in the existing
cultivation area. The scope for increasing food legume hectarage is limited by the
smallholder farming system, where the families must grow other crops, such as
maize, to meet their financial and dietary needs. Competition for land to use for
90
&%1&%6% GROUNDNUT
other purposes or crops also affects the commercial production of food legumes. To
increase productivity, the smallholder needs improved technology packages. Most
of those currently available are for improving peanut varieties. The extension
services will be able to contribute to such increased productivity, only after the
research team has developed appropriate technology packages, suitable for the
different cropping systems in which food legumes are grown. Continuing research
is, therefore, the only real means of achieving increased national production,
leading to Zambian self-sufficiency in food legume grains.
8LILMWXSV]SJJSSHPIKYQIWVIWIEVGL
The Food Legumes Research Team (FLRT)9 is charged with conducting research on
all major food legume crops in the country. Most of the research efforts are
concentrated on peanut, bean and cowpea. A limited amount of research is also
conducted on three minor legume crops: bambara groundnut, pigeonpea and
chickpea.
In 1978, with UNDP/FAO assistance (under the NODP), intensive research
work was begun on legume improvement for peanut breeding. In 1982, such
agronomic research was begun on beans and cowpea, as well as peanut, with
IBRD/IFAD loan assistance, as an integral part of the Eastern Province Agricultural
Development Project (EPADP), based at Msekera Regional Research Station. In
1986, the peanut breeding component was also taken up by the EPAD Project,
whose funding terminated in June 1988.
The Integrated Crop Management/Food Legume Project
-RXVSHYGXMSR
The Integrated Crop Management/Food Legume Project (ICP/FL) was formulated
to address the problem of food security, and to improve the process of transferring
to farmers the food legume technologies that have been developed hitherto. Unlike
the previous UNDP-funded Maize and Food Legume Project, which confined itself
to funding food legume crop research, the ICP/FL was designed to support
research, extension and training, seed multiplication and the utilization of food
legumes.
The project, which became operational in March 1993, is funded by the
Government of the Republic of Zambia and the United Nations Development
Programme (UNDP). The Ministry of Agriculture, Food and Fisheries (MAFF) is
reponsible for its implementation, assisted by the Food and Agriculture
Organization (FAO). The aim of the project is to improve the productivity and
sustainability of the smallholder farming systems in the three agro-ecological zones
of Zambia. This is to be done through emphasis on increased production, on-farm
storage, home utilization, and when possible, the export of food legume crops.
The project strategy involves working through the GRZ extension services, nongovernmental organizations (NGOs) and the private sector, and concentrates on
smallholder farmers in 30 (out of 57) districts in the three agro-ecological zones.
9
Funded by the UNDP/FAO since July 1988.
AGRONOMY
91
3FNIGXMZIW
The development objectives of the project are to improve the agricultural
productivity and sustainability of the smallholder farming systems, and to improve
the country’s nutritional status by increasing the production and utilization of food
legume crops. The immediate objectives of the project are to:
• increase national food legume improvement capabilities, with farmers and
extension agents playing leading participatory and diagnostic roles in the
formulation of production packages
• increase national food legume production capabilities, by disseminating
environmentally sound production packages among smallholder farmers,
focusing on the needs of female farmers
• contribute to the enhancement of food security in the country and to
improved health, especially among the children and mothers, by promoting
home utilization of food legumes, and methods of preventing HIV/AIDS.
%GXMZMXMIW
The major activities to achieve the project’s objectives are:
• the establishment of an economic database on food legume crops
• variety development tests in the three agro-ecological zones
• participation by farmers in diagnosing research needs and assessing
research recommendations
• agronomic studies, on-farm tests and economic analysis of crop production
packages for productive and sustainable farming systems
• training of farmers and trainers from government, NGOs and the private
sector, on seed production and storage techniques
• seed multiplication of food legume crops, and their distribution to farmers
through NGOs
• training programmes and demonstration plots for female farmers in crop
production techniques, utilization of food legume crops, health science, and
the prevention of malaria and HIV/AIDS.
4VSNIGXWXVEXIKMIW
The project encourages farmers to participate and play a leading role in the
development of crop production packages, where an integrated crop development
approach has been adopted. The project focuses on the needs of the small/
medium-scale farmers. The agro-ecological region approach to development has
been followed for all the project activities.
All the field work is production-oriented. The project collaborates with the
government agencies, NGOs and the interested cooperatives, as well as with the
private sector. The project activities are directed by a steering committee, whose
members are drawn from these and from gender and development groups.
Cooperative activities with other groups involved in similar work are also designed
to enhance the effectiveness of the project. Gender-sensitive personnel are involved
in developing its extension activities, to ensure that equal attention is given to the
needs of female and male farmers. Mobile training courses held in the villages, and
demonstration plots, form part of the strategy to achieve the project’s objective of
reaching more women farmers.
92
&%1&%6% GROUNDNUT
The status of bambara groundnut research and development
Research in bambara groundnut began in 1971, when a series of agronomic trials
were conducted in the Western and Southern Provinces. The results showed
considerable variation in yield within varieties, with an extremely high coefficient
of variation. The mean yields of some varieties were unexpectedly high, and the
local varieties outyielded introductions so convincingly that the latter were
excluded from future work. More agronomic trials on fertilizer use, ridging and
spacing were conducted from 1972 to 1975. No significant results could be obtained
from this series of trials, as the variation was too great.
The most significant activity undertaken by the Food Legume Research Team
on this crop was the collection of a large number of local landraces in a collecting
mission undertaken with FAO/IBPGR. The germplasm was evaluated for yield
potential and tolerance to disease and insect pests. Results from the few variety
trials have been too varied to be useful.
Responsibility for bambara groundnut research in the country currently lies
with the University of Zambia, which has continued with germplasm
augmentation.
Other research activities undertaken include germplasm
conservation, multiplication, characterization and evaluation. In 1989/90, a start
was made in establishing a breeding programme, with the first single-plant
selections. Multiplication and adaptability trials have also been conducted. From
the multilocational trials, three local landraces (ZVS 544, ZVS 545 and ZVS 546)
have been found to be promising. Efforts are now being made to multiply these
three lines for testing in on-farm trials.
In the 1994/95 season, 43 accessions obtained from South Africa were tested in
an observation trial in Msekera. A total of 21 accessions recorded higher grain
yields than the three local landraces. The seed of the promising accessions will be
multiplied for testing in adaptation and yield trials.
In addition to the research efforts, the project has identified and contracted
three farmers to multiply popular local landraces of bambara groundnut. Once
multiplied, the seed will be distributed to other farmers, through NGOs.
AGRONOMY
93
4VIPMQMREV]WXYHMIWSRXLIKIVQMREFMPMX]ERHZMKSYVSJ
>MQFEF[IERFEQFEVEKVSYRHRYXKIRSX]TIW
S.B. Zengeni and J. Mupamba
National Tested Seeds, Harare, Zimbabwe
Introduction
Bambara groundnut (Vigna subterranea (L.) Verdc.) is an indigenous African
leguminous crop. Its common English name is derived from the Bambara, a tribe of
agriculturists who now live mainly in Mali. The crop is called ‘nyimo’ in the Shona
language and ‘indlubu’ in Ndebele. Bambara groundnut has been cultivated in the
tropical regions of Sub-Saharan Africa and in Madagascar for many centuries
(Linnemann and Azam-Ali 1992). In Zimbabwe, small-scale communal farmers grow
the crop mainly on a subsistence level, although surpluses are often sold in urban
centres. Bambara groundnut is traditionally grown as an intercrop, with millet,
sorghum, maize, or even vegetables such as okra or pumpkin (Doku 1967; Doku and
Karikari 1971a; Ezueh 1977; Haque 1980; Linnemann 1990). The crop may also be
grown as a sole crop (Stanton et al. 1966). Bambara groundnut is useful in crop
rotations, because it can improve the nitrogen status of the soil (Mukurumbira 1985).
In many dry, hostile environments, bambara groundnut is able to produce some
yield, where groundnut and other drought-tolerant legumes may fail completely
(Nyamudedza 1989; Lewitt 1990).
Bambara groundnut is predominantly grown for human consumption, although
it also has the potential for use as an animal feed. The seeds of bambara groundnut
are often described as a complete food, as they contain protein, carbohydrate and fat
in sufficient proportions to provide a nutritious food (Poulter and Caygill 1980).
Seeds can be boiled in the immature, green state, either shelled or unshelled, until
quite soft. Dry shelled nuts can be pounded to flour and then boiled to a stiff
porridge. An alternative is to roast, boil, crush and eat the seeds as a relish with the
maize-meal porridge, ‘sadza’.
The empirical evidence, and limited research, indicate that bambara groundnut is
a promising crop, which has been largely neglected by national and international
agricultural researchers. Previous research work on the physiology and agronomy of
bambara groundnut has been carried out on a short-term, trial-and-error basis, mainly
owing to the limited funds available for research on underutilized crop species
(Linnemann and Azam-Ali 1992). The development of improved genetic material
should be pursued in conjunction with the search for optimal management practices
for commercial and subsistence production.
There is a dearth of reported data on bambara groundnut seed quality tests. In
1992, The International Seed Testing Association (ISTA) stipulated the optimum
10
conditions for the germination of bambara groundnut. In Zimbabwe, the minimum
gazetted germination for a bambara groundnut seed crop is 75%. Sowing seed that
does not have the capacity to produce an abundant crop of the required cultivar is one
of the greatest hazards in crop production (Mupamba, pers. comm.). Large bambara
10
Section 5.9 of the ISTA rule states that when reporting the result of a germination test, the following
items should be entered in the analysis certificate: (i) duration of test; (ii) percentage of normal
seedlings, abnormal seedlings, hard seeds and dead seeds. If the result for any of these categories is
found to be nil, it is entered as ‘0’.
94
&%1&%6% GROUNDNUT
groundnut seeds reportedly produce more vigorous seedlings (Karikari 1969). Zulu
(1989) reported that small seeds emerge at a faster rate. Maximum fractional
germination, i.e. an emerged radicle of 10 mm length, occurs at 22-36ºC in contrasting
genotypes (Zulu 1989). The highest levels of final germination of two bambara
groundnut landraces from Zimbabwe were obtained at 30-35ºC (Mabika 1991).
Assessing the germination of different genotypes under controlled environments
and seedling emergence in the field is a useful rapid screening technique, which can
facilitate the selection of germplasm with good early vigour for moisture-stressed
edaphic conditions (Perry 1981). Indeed, seeds of high germination and vigour are
highly desirable in the establishment of most crops.
Concomitantly, the effect of the duration of storage on germination is an
important determinant of the physiological quality of a seedlot. Prolonged storage for
18 months of bambara groundnut seeds reportedly reduced germinability, delayed
germination, reduced root and epicotyl growth, and increased the number of stunted
seedlings (Sreeramula 1983).
This paper examines the germination of three contrasting bambara groundnut
genotypes, from different seedlots, grown on two inert media or substrates (sand and
between paper (BP)), and seed vigour under field conditions.
Materials and methods
Germination tests were conducted on six seedlots from three bambara groundnut
genotypes. The test media used for the controlled environment evaluation were sand
and paper. A field test to record seedling emergence/early vigour was also done at
The National Tested Seeds Research Station, Sigaro. The seeds of the bambara
groundnut genotypes were originally from seed grown and bulked at Sigaro during
the 1991/92 season. After each harvest, the seed was hand-shelled, treated with
Natsan (a.i. – Captan, 76%; Pirimiphos-methyl, 1.60%), bagged and stored under
ambient temperature and humidity. This process was repeated for subsequent crops.
Because there are no local improved bambara groundnut varieties, sensu strictu, we
used three genotypes or landraces, distinguished by their testa colour: red, cream and
black were used. The final number of test entries was 6, randomly drawn from pure
seedlots harvested from the 1992/93 and 1994/95 crops. Thus the test entries were:
Black 92, Cream 92, Red 92, and Black 94, Cream 94 and Red 94, respectively. The
genotypes with a 92 suffix had been stored for 20 months.
)\TIVMQIRX
River sand was sieved through a 0.08 cm diameter sieve and then washed and
sterilized before use. Fifty seeds per entry, arranged in eight replicates, were planted
on a level layer of moist sand, in plastic trays measuring 24.5 x 20 x 3.5 cm. The seeds
were then covered with 2.5 cm of uncompressed sand. The sand was kept moistened
to about field capacity for the duration of the test. Trays were placed in an airconditioned germination laboratory, at a constant temperature of 20ºC. After 10 days,
the germination evaluation was done according to the ISTA rule, section 5.9. The
result of the germination test was calculated as the average of eight 50-seed replicates,
and expressed as a percentage by number of normal seedlings. Normal seedlings
were those which showed the potential for continued development into satisfactory
plants when grown in good quality soil, and under favourable moisture, temperature
and light conditions.
AGRONOMY
95
)\TIVMQIRX
The number of seeds per test entry and the number of replicates were as described
above. The seeds were placed with three papers below and one paper on top. The
newsprints were 50 x 25 cm. The papers were carefully rolled, and then put into a
transparent polythene bag. Each bag was secured with an elastic band and placed in an
upright position in a cabinet germinator, where relative humidity was maintained near
saturation. Day and night temperatures were kept at 30 and 25ºC, respectively. At
10 days after sowing, the germination percentage was determined, as in Experiment 1.
)\TIVMQIRX
As the optimum conditions provided in the germination test rarely, if, ever, occur in
the field, a simplified vigour test was conducted to identify genotypes/seedlots with
rapid synchronous emergence, or those which produce large robust seedlings under
field conditions (Perry 1981). Randomly selected pure seed samples of the same six
entries as in Experiment 1 and 2 were planted in a complete randomized block design,
four replicates, with 50 seeds per replicate. Seeds were sown to a depth of 2.5 cm.
The soil at the trial site is a reddish brown, medium-grained, sandy-clay with a
pH of 6.2. The soil was analyzed, and had the following nutrients, prior to sowing:
nitrogen, initial and after incubation, 26 and 50 parts per million (ppm), respectively;
available phosphorus, 47 ppm; potassium, 0.25 mg/100 g. The trial was irrigated
daily, to field capacity, for 10 days. At the end of the test period, replicates were
examined, and actual counts were made of emerged seedlings and converted to
percentage seedling emergence. Results from the three experiments were subjected to
analysis of variance (ANOVA), using a software database for plant breeders.
Results and discussion
Results of the three germination experiments and vigour tests are summarized in
Table 1. The highest mean germination, 83.13%, was obtained between paper,
followed by in sand (77.17%). Only 45% of the bambara groundnut seeds germinated
and produced robust seedlings in the field. The low emergence could have been due
to low temperatures; more time (>14 days) would have been needed to assess
emergence. This trend was observed across genotypes and seedlots, which were
stored for varying periods. The genotype with the black seed coat consistently
performed well across the three media.
Results from Experiment 1 show that there are significant differences between the
bambara groundnut genotypes regarding germinability (P=0.05). The germination
percentage for the three genotypes was over and above the 75% minimum
germination stipulated by the Seed Certifying Authority of Zimbabwe, for a bambara
groundnut seedlot to be fit for commercial sale. However, for reasons which are
unknown, the red-seeded genotype from the 94 seedlot gave a low germination (only
54.5%). Statistically, the results show that sand gives a more precise indication of the
germinability of the different genotypes, as shown by the low coefficient of variation
and the lowest %E among the three media. The germination on sand suggests that
seed storage did not adversely influence viability and germinability, as reported by
Sreeramulu (1983). Brook et al. (1977) reported that shelled seeds deteriorate at
ambient temperature, and seeds should be shelled as near to their planting as
possible, in order to maximize their viability. Our findings did not confirm this
observation, but our experimental data agree with observations made at the
96
&%1&%6% GROUNDNUT
University of Nottingham. These showed that there was no loss of germinability in
red seeds stored at ambient temperatures for 2 years (Mabika, pers. comm.).
Table 1. Germination and field emergence of bambara groundnut genotypes tested
at Sigaro in 1995.
Germination (%)
Genotype
Sand
Between paper
Field emergence (%)
†
79.3
84.5
19.0
Cream 92
Cream 94
82.5
81.0
55.6
†
80.3
93.0
51.6
Black 92
Black 94
88.0
72.5
64.0
†
78.5
84.3
51.6
Red 92
Red 94
54.5
83.5
33.0
Trial means
SD
CV (%)
‡
%V
§
%E
LSD (5%)
†
77.17
2.42
6.27
95.67
4.33
6.84
83.13
3.41
8.21
73.30
26.70
9.66
45.8
2.36
20.67
91.85
8.15
6.69
Stored for 20 months.
‡
%V is the ratio of the variance among entries to the total phenotypic variance being calculated
on an entry mean basis. %V is equal to heritability, when the entries are a random set of lines
from some reference population. The range of %V is from 0 to 100. A high %V indicates (1)
that there is variability among the entries in the test, and (2) that the differences among the
entries is repeatable from replicate to replicate and from environment to environment.
§
%E is the ratio of the plot-to-plot error variance (pooled over environments) to the total
phenotypic variance. It is an estimate of the precision of the measurements for the trait of
interest. %E will usually decrease with increasing number of replicates and environments.
Results from Experiment 2 indicate that between paper (BP) is probably the most
ideal inert media, as is shown by the generally high percentage germinations.
Compared with sand, BP recorded 7% more normal seedlings than the number noted
across the bambara groundnut genotypes. Differences in germination percentages
among the genotypes were significant (P<0.05). The black seeds gave the highest
germination percentage, compared with the cream and red seeds from the 92 seedlots.
The enhanced germination capacity of the black-seeded genotype could have resulted
from operational selection, among other factors, which has hitherto focused on
genotypes which facilitate harvesting and have faster and more uniform germination
(Hepper 1970).
Of interest is the significant difference between the Black 94 and Black 92. The
seed, which had been under storage for 20 months, gave a higher germination than
fresh seed, perhaps as a result of the seed dormancy of the black-seeded landrace.
This observation contradicts data from other investigators (Sreeramula 1983; Mabika
1991). Based on LSD analysis, the differences between the Black 92 and Black 94
seedlots were significant (P=0.05). This observation was not reflected in the red and
cream-seeded genotypes. Germination of the black-seeded genotype originating from
the 1994/95 crop was below 75%. Thus, the 1994/95 crop would have been rejected
for seed production.
AGRONOMY
97
Predictably, the proportion of seeds that produced robust seedlings in soil under
field conditions was less than the germination obtained in sand and BP. The overall
reduction in germination/emergence between the two inert media on one hand, and
in soil on the other, was 34%. However, there were discernible differences among the
genotypes regarding the numbers of seedlings recorded. Hence, genotypes and seeds
from different seedlots could be broadly categorized into (i) seeds that performed
well/high-vigour seeds, and (ii) those that performed poorly/low-vigour seeds.
In the former category, the black-seeded genotype (94) produced the highest
number of robust seedlings, equivalent to 64% field emergence. Cream 94 gave 55%
field emergence. The worst performer in the category of low-vigour seeds was
Cream 92, which had a field emergence of 19%. Statistical differences in percentage
field emergence among the bambara groundnut genotypes were significant (P<0.001).
Generally, on inert media, field emergence was positively correlated to germination
capacity. Perry (1981) stated that the causes of variations in vigour are several.
Among these, genetic constitution was highlighted as being crucial. Table 1 shows
that %V (91.85) for field emergence was high. This indicated high heritability for
vigour, and that the differences between the entries could be repeated in other
edaphic environments.
Overall, experimental data across the three media indicate that there is variability
among the test entries, as shown by the high %V. The high %V also shows that
germination and early seedling vigour in bambara groundnuts have high
heritabilities. Thus genetic enhancement of these two traits would be a feasible
breeding objective. Testa colour is not always a reliable descriptor for a genotype;
several instances of re-segregating populations have been recorded (Mittelholzer
1969; Linnemann 1990). Additional criteria, besides the use of the appearance of the
seed coat as a means of genotypic identification, could facilitate the implementation of
an integrated programme to assess and improve the genetic potential of bambara
groundnut in the future.
%GORS[PIHKIQIRXW
The authors wish to thank Godfree Chigeza and Lameck Chatyoka for their valuable
contributions to the research project. Many thanks to Fungai Simbi for his helpful comments
and Gilbert Mutseyekwa for his help with the statistical analysis.
98
&%1&%6% GROUNDNUT
%RSZIVZMI[SJFEQFEVEKVSYRHRYXTVSHYGXMSRERHVIWIEVGLF]
XLI*EVQMRK7]WXIQW6IWIEVGL9RMX*769MR>MQFEF[IEGEWI
WXYH]MRXLI'LMZM'SQQYREPEVIE
C. Chibudu
Department of Research and Specialist Services, Causeway, Zimbabwe
Introduction
&EGOKVSYRHXSXLIWXYH]EVIE
Chivi lies in the semi-arid southern part of Zimbabwe. Rainfall is low, variable and
unpredictable. An annual average range of rainfall of 400-600 mm falls between
October and May. Various soil types are found in Chivi, ranging from heavy clays to
sandy soils. Generally, soils are of poor-to-medium fertility, with low levels of
organic matter, and have low pH values, ranging from 4.2 to 4.8.
*EVQMRKW]WXIQWVIWIEVGL
The Farming Systems Research Unit (FSRU) was initiated in Zimbabwe after
independence, and was mandated to study mixed crop and livestock production
systems in order to identify opportunities for, and major constraints to, improved
crop production. Two representative sites, Chivi and Mangwende, were chosen for
carrying out the study. Mangwende is a high-potential area in the northern part of
Zimbabwe. Just after the formation of the Farming Systems Research Unit in 1984,
surveys were conducted to identify constraints in crop production. These were
identified as low soil fertility, unreliable rainfall, lack of established market outlets
and lack of adequate cash.
&EQFEVEKVSYRHRYXTVSHYGXMSR
Bambara groundnut did not emerge as a priority crop for production. The probable
reasons for this are (i) farmers give priority to satisfying food requirements first, and
(ii) the perception of bambara groundnut as a less important ‘woman’s crop’. The
total hectarage of bambara groundnut is very low, compared with crops such as
maize, peanut and sorghum. A recent monitoring survey carried out by the FSRU
revealed that as long ago as 1990-91, the average area under bambara groundnut
cultivation was 2-5% of arable land. Female-headed households allocated a high
percentage of arable land to bambara groundnut, i.e. 4%, while male-headed
households allocated about 1%.
Bambara groundnut is usually grown on sandy soils, either as a single crop or in
mixed stand with other crops, notably maize, but also groundnut, cotton or sorghum.
Harvesting of bambara groundnut is very labour-intensive. Historically, bambara
groundnut was grown in once-fallow land; however, with an increasing population,
the average land-holding per household is currently 2 ha, making it difficult to leave
fallow land that could be planted with the crop. Although bambara groundnut is
cultivated on the poorest soils, no fertilizers are added.
1EVOIXMRK
Bambara groundnut has always been traded informally, which probably explains the
low hectarage put to the crop. In Chivi, particularly during the 1994/95 season, there
was a great change in the marketing of bambara. Traders from all over the country
AGRONOMY
99
and abroad have been buying the crop at Ngundu, at an average price of US$ 0.50/kg.
The reasons for this lie in the 1994/95 drought, which increased the importance of the
bambara groundnut crop in the area, owing to its higher yields compared with such
crops as maize.
Research
For many years, there was no research on bambara groundnut by FSRU in the area.
Research efforts were concentrated on crops such as maize, peanuts, pearl millet and
sorghum. Bambara research only began after participatory rural appraisals in
1993/94, when two groups of farmers, mainly composed of women, drew attention to
the need to carry out soil fertility studies on bambara groundnut on sandy soils. This
has created gender awareness, particularly in the cultivation of crops such as bambara
groundnut. Farmers experiencing problems with the production of bambara on
sandy soils grouped together to discuss with researchers ways of enhancing soil
fertility. Local varieties, which included a mixture of red and cream lines, were
planted in 45-cm rows, spaced 10 cm apart. The treatments applied (Table 1) included
leaf litter (7.13 t/ha), ant-heap soils (12.1 t/ha), gypsum (200 kg/ha) and a
combination of gypsum and single superphosphate (200 kg/ha each). As can be seen
from Table 1, it appears that ant-heap soils improve bambara groundnut yield.
Although labour requirements are high when these soils are used, farmers opt for
these less costly treatments.
Table 1. Farmer assessment of various fertility options (1994/95).
Treatment
Labour
Cost
requirements (US$)
Leaf litter
5
1
None
0
0
Gypsum
2
6
Single superphosphate (SSP) +gypsum
3
9
Ant-heap soils
10
4
Total scores
20
20
Yield
(kg/ha)
2170.10
2209.01
1820.39
2151.27
2278.85
4VIPMQMREV]VIWYPXW
Days to physiological maturity ranged from 102 to 115 days. Bambara groundnut
emerged within 10-12 days. Number of pods per plant ranged from 13 to 38, and
shelling percentage ranged from 25 to 93%, depending on the season and the
treatments applied. Generally, yields were lower for the 1993/94 season, ranging
from 403.74 to 1039 kg/ha.
8LIVSPISJFEQFEVEKVSYRHRYXMRGVSTVSXEXMSR
Being a leguminous crop, bambara groundnut can be used in rotation with maize.
Compared with maize, the hectarage put to bambara groundnut is so low that
rotation would only be feasible on small areas. Some farmers in Chivi have reported
that bambara ‘kills soil’, or damages the field. It is believed to produce little organic
matter, and only a few of its leaves can be incorporated in the soil for nutrient cycling.
While the potential of bambara in cereal/legume rotation has been scientifically
proven, some farmers remain unconvinced.
100
&%1&%6% GROUNDNUT
Mukurumbira (1985) reported that higher yields were obtained when a maize
crop succeeded a bambara groundnut crop on station than when it succeeded peanut,
maize and fallow. Nitrogen uptake was also highest in maize succeeding a bambara
crop, which was attributed to the ease of mineralization of the bambara leaves,
compared with those of groundnut and maize. Researchers should test this
hypothesis, together with farmers, so that both gain confidence in the role of bambara
groundnut in soil fertility improvement on-farm.
Germplasm diversity
The various types of germplasm available in the area are little known to researchers,
and appear to include the cream, red and black-seeded varieties. Characterization of
such germplasm in terms of days to physiological maturity, shelling percentage, yield,
disease resistance, drought tolerance and biomass production has not been carried
out. If farmers were to characterize such attributes as the taste and suitability for
cooking of the varieties they grow, this might form a practical basis for bambara
breeding.
If diversity of bambara groundnut germplasm exists in the Chivi area, how might
scientists and farmers maintain this diversity? The experience of working with
groups of farmers, particularly those growing bambara groundnut, showed that more
women than men participated in the trials. Women possess a high level of
indigenous knowledge of the characteristics of bambara groundnut and its storage (it
is stored in its shells and kept in jute sacks, and only when the rainy season starts is it
shelled; seed selection is carried out after shelling, on the basis of size, colour and
condition). Future research on bambara groundnut, therefore, should make use of
women’s valuable knowledge of the crop.
Conclusions
For a long time, bambara has received little attention from the Farming Systems
Research Unit in the Chivi Area. Farmer assessment of trials does not depend on
yield alone, but also on such economic aspects as labour and cost.
The contribution of bambara to soil fertility, particularly in sandy soils, is a grey
area for some farmers. Further research on such aspects are recommended. There is
considerable potential to improve bambara groundnut breeding in the country, by
using farmer groups, particularly women, to assess germplasm.
Bambara groundnut hectarage is quite low in Chivi, ranging from 2 to 5% of
arable land. Given the crop’s high potential in dry years, efforts should be made to
promote its cultivation in the Communal areas.
AGRONOMY
101
'LEVEGXIVM^EXMSRERHIZEPYEXMSRSJ--8%
WFEQFEVEKVSYRHRYX
GSPPIGXMSR
A.E. Goli1, F. Begemann2 and N.Q. Ng3
1
2
3
International Plant Genetic Resources Institute, Cotonou, Benin
Information Centre for Genetic Resources, Centre for Agricultural Documentation
and Information, Bonn, Germany
Genetic Resources Unit, International Institute of Tropical Agriculture, Ibadan,
Nigeria
Introduction
Bambara groundnut is an important food legume in Africa, which has a long tradition
of cultivation in the continent. However, no significant research has been undertaken
to improve the crop. The availability of germplasm materials is vital to crop breeding.
The International Institute of Tropical Agriculture (IITA) made a commendable effort
to gather nearly 2000 accessions of the crop from most countries in Sub-Saharan
Africa. Thanks to a GTZ-funded special project at IITA, this important bambara
groundnut collection was effectively characterized, evaluated and documented, and
11
its data made available to all potential users around the world.
Materials and methods
Field characterization and evaluation of the accessions mainly took place at the IITA
research station, located in Nigeria. A total of 1384 accessions were planted for
characterization and evaluation in 1985 and 1986. Planting took place on ridges,
spaced 100 cm apart. Intra-ridge spacing was about 20 cm. Each accession occupied a
single row, the length of which varied from 1.5 to 6 m, depending on the quantity of
seeds available. Pesticides and irrigation were applied whenever it was necessary.
The accessions were evaluated for 38 characters, according to the internal
bambara groundnut descriptor list (IBPGR, IITA and GTZ 1987), which is presently
under revision, and measured, both in the field during vegetative growth, and after
harvesting.
Results
Table 1 provides a summary of the basic statistics for the quantitative characters. For
most characters, including the qualitative ones not listed in Table 1, the high- and
low-scoring accessions are listed. It is worth noting that the results for most
quantitative traits were environment-specific. The humid ecology of Ikenne
somewhat depressed the growth and productivity of the plants. The frequency
distributions of the accessions are indicated in Figures 1-23 for each continuously
varying character.
11
All data can be accessed online via internet at http://www.dainet.de/genres/bambara/bambara.htm.
102
&%1&%6% GROUNDNUT
(E]WXSQEXYVMX]
Accessions maturing within 100 days:
• TVSU 459, 460, 604, 606, 607, 610, 614, 615, 616, 618, 620, 622, 623, 624, 626, 662,
1154, 1155.
Accessions maturing after 160 days:
• TVSU 30, 123, 557, 701, 956, 957, 961, 964, 971, 1060, 1116, 1215.
:MKSYVMRHI\
Accessions rated 9 for vigour index:
• TVSU 726, 1071, 1299, 1341.
+VS[XLLEFMX
This character was visually rated, 11 weeks after planting, taking into consideration
both the spreading of the plants and the internode length. The scale used was:
1 = plants in a bunch conformation; leaves in a cluster as a result of short
internodes
2 = plants have a semi-bunch conformation; in general, internodes moderately
elongated
3 = plants with spreading or trailing stem system; internodes usually long.
It was observed that plants of poor vigour tended to have a bunch conformation.
Distribution of the accessions over the three growth-habit groups was 45, 47 and 8%,
for groups 1, 2 and 3, respectively.
4PERXLIMKLX
Accessions with plant height equal to or greater than 35 cm:
• TVSU 747, 1254, 1279, 1280, 1281, 1366, 1376.
Accessions with plant height equal to 10 cm:
• TVSU 44, 90, 101, 110, 166, 168, 201, 241, 245, 302, 306, 420, 425, 528, 964.
'ERST][MHXL
Accessions with canopy width equal to 90 cm:
• TVSU 1277, 1344, 1351, 1356, 1357, 1359, 1361, 1362, 1366, 1374, 1377.
Accessions with canopy width less than 20 cm:
• TVSU 30, 90, 110, 166, 168, 241, 306, 525, 528, 623, 629, 701, 846, 964, 1057, 1095,
1199, 1209.
2YQFIVSJPIEZIWTIVTPERX
Accessions with more than 300 leaves per plant:
• TVSU 1157, 1170, 1174, 1208, 1235, 1244, 1338, 1340, 1351, 1358.
Accessions with less than 20 leaves per plant:
• TVSU 30, 162, 285, 388, 394, 525, 528, 701, 1057.
0IEJPIXWLETI
A visual rating of the shape of the medium leaflet took place 11 weeks after planting,
according to the following scale:
1 = narrow leaflet
2 = oval shape
3 = broad, roundish leaflet.
The distribution of the accessions over the three groups of leaflet-shape patterns
was 8, 78 and 14% for groups 1, 2 and 3, respectively.
AGRONOMY
103
8IVQMREPPIEJPIXPIRKXL
Accessions with median leaflet length equal or greater than 90 mm:
• TVSU 227, 318, 1046,1289, 1291, 1292, 1299, 1303, 1304, 1331, 1341, 1344, 1351,
1354, 1356, 1357, 1359, 1360, 1362, 1367, 1373.
Accessions with median leaflet length less than 35 mm:
• TVSU 17, 90, 166, 168, 205, 263, 325, 326, 425, 525, 528, 701, 838, 1057, 1199, 1334.
8IVQMREPPIEJPIX[MHXL
Accessions with median leaflet width equal to or greater than 50 mm:
• TVSU 194, 295, 579, 672, 703, 1360.
Accessions with median leaflet width equal to or less than 12 mm:
• TVSU 90, 101, 211, 212, 525, 528, 701.
4IXMSPIPIRKXL
Accessions with petiole length equal to or greater than 27 cm:
• TVSU 1309, 1334, 1341, 1351, 1356, 1357, 1359, 1361, 1362, 1368, 1372, 1374, 1376,
1377.
Accessions with petiole length less than 6 cm:
• TVSU 90, 261, 425, 428, 1057, 1078.
4IXMSPIGSPSYV
The petiole and veins of the leaves were either green or reddish. These two
colourations were assigned the indexes 1 and 2, respectively. Out of 1307 accessions
observed, only 14 were assigned the index 2. In other words, almost 99% of the
accessions had a green petiole and veins.
2YQFIVSJWXIQWTIVTPERX
Accessions with more than 14 stems per plant:
• TVSU 104, 114, 218, 226, 737, 742, 743, 879, 880, 896, 941, 946, 951, 985, 1089, 1223,
1231, 1246, 1249.
Accessions with less than 4 stems per plant:
• TVSU 30, 47, 591, 702, 858, 1060.
2YQFIVSJFVERGLIWTIVWXIQ
Accessions with more than 7 branches per stem:
• TVSU 29, 256, 258, 276, 369, 376, 638, 732, 742, 743, 880, 951, 985, 1089, 1223, 1231,
1246, 1248.
2YQFIVSJRSHIWTIVWXIQ
Accessions with more than 22 nodes per stem:
• TVSU 116, 136, 376, 571, 687, 732, 951, 1015, 1089, 1141, 1176, 1223, 1231, 1246,
1304, 1341, 1359, 1367.
-RXIVRSHIPIRKXL
Accessions with internodes longer than 18 mm:
• TVSU 29, 92, 225, 234, 235, 490, 537, 574, 635, 637, 1057, 1113, 1223, 1283, 1309.
Accessions with internodes shorter than 6 mm:
• TVSU 90, 174, 302, 425, 428, 487, 509, 525, 787.
104
&%1&%6% GROUNDNUT
AGRONOMY
105
106
&%1&%6% GROUNDNUT
4SHPIRKXL
Accessions with pods longer than 30 mm:
• TVSU 258, 472, 637, 669, 839, 948, 1076, 1285, 1348, 1366.
Accessions with pods shorter than 12 mm:
• TVSU 126, 175, 201, 542, 559, 596, 611, 521, 626, 676, 755, 814, 862, 977, 1062, 1068.
4SH[MHXL
Accessions with pod width greater than 20 mm:
• TVSU 82, 213, 426, 549, 585, 669, 1362.
4SHWLETI
Pod shape was visually rated, using the following scale:
1 = pod almost spherical
2 = pod pointed at one end, and round at the other
3 = pod pointed at one end, with a hook at the other
4 = pod pointed at both ends.
Distribution of the accessions over the different types of pod shape was 10, 81, 7.5
and 1.5%, respectively, for groups 1, 2, 3 and 4.
4SHXI\XYVI
A visual rating of pod texture took place after harvesting, according to the following
scale:
1 = smooth pod
2 = slightly grooved pod
3 = moderately grooved pod
4 = heavily grooved pod.
The distribution of the accessions over the four types of pod texture was 2, 13, 70.5
and 14.5% for groups 1, 2, 3 and 4, respectively.
4SHGSPSYV
A visual rating of pod colour took place after harvesting and drying, according to the
following scale:
1 = yellowish-brown
2 = brown
3 = reddish dark brown.
The distribution of the accessions over the three colour groups was 81, 16 and 3%
for groups 1, 2 and 3, respectively.
7LIPPXLMGORIWW
Accessions with shells thicker than 1 mm:
• TVSU 575, 1271, 1276, 1278, 1283, 1285, 1291, 1320, 1336, 1362, 13674, 1377, 1378,
1461.
Accessions with shells thinner than 0.12 mm:
• TVSU 269, 300, 383, 615, 754, 774, 790, 799, 826, 873, 909, 919, 924, 935, 1068, 1092,
1126, 1190, 1195, 1210.
7LIPPTIVGIRXEKI
Accessions with more than 70% shell:
• TVSU 181, 219, 262, 362, 428, 451, 558, 1252, 1253, 1328.
Accessions with less than 10% shell:
AGRONOMY
•
107
TVSU 613, 804, 809, 823, 931, 1200, 1269.
7IIHPIRKXL
Accessions with seed length greater than 16 mm:
• TVSU 22, 1076, 1124, 1133, 1144, 1220, 1225.
Accessions with seed length less than 4 mm:
• TVSU 1050, 1233, 1237, 1251.
7IIH[MHXL
Accessions with seed width equal to or greater than 12 mm:
• TVSU 561, 1143, 1220, 1240.
Accessions with seed width less than 7 mm:
• TVSU 123, 239, 249, 676, 969, 978, 985, 1050, 1232, 1429, 1251, 1252, 1255.
7IIHWLETI
Seed shape was rated using the following index:
1 = round
2 = oval
3 = flat at one end.
Distribution of the accessions over the three types of seed shape was 30, 60 and
10% for groups 1, 2 and 3, respectively.
8IWXETEXXIVR
Nine testa patterns were observed in the collection. These patterns contained in the
bambara groundnut descriptors are shown in Fig. 24. Frequency distribution for testa
pattern is shown in Fig. 18.
)]ITEXXIVR
In total, eight eye patterns were identified in the collection, reported in the bambara
groundnut descriptors booklet, as shown in Fig. 25. Frequency distribution for eye
pattern is shown in Fig. 19.
+VSYRHGSPSYVSJXIWXEERHI]I
The colour of the seed testa and eye was assessed using the Munsell colour charts.
Subsequently, the range of colours was subdivided into 19 groups. This grouping is
presented in detail in the bambara groundnut descriptors. About 55% of the
accessions had a creamy seed coat, while up to 86% had a dark brown eye.
4MKQIRXEXMSREVSYRHXLII]I
About 47% of the accessions had pigmentation around the seed eye, while the
remaining 53% did not. These two groups were designated by the symbols ‘+’ and
‘0’, respectively.
2YQFIVSJTSHWTIVTPERX
Accessions with 100 pods/plant or more:
• TVSU 173, 372, 380, 855, 935, 938, 963, 1057, 1086, 1108, 1223, 1231, 1244, 1254,
1316.
2YQFIVSJWIIHWTIVTSH
Accessions with 1.81 to 2 seeds per pod:
108
•
&%1&%6% GROUNDNUT
TVSU 142, 253, 260, 714, 993, 1065, 1128, 1189, 1193, 1196, 1283, 1284, 1449.
;IMKLXSJWIIHW
Accessions with a 100-seed weight higher than 85 g:
• TVSU 1, 22, 36, 176, 366, 572, 613, 864, 916, 1076, 1201, 1327, 1337, 1341, 1346, 1351.
Accessions with a 100-seed weight less than 10 g:
• TVSU 49, 81, 185, 194, 219, 270, 440, 472, 799, 1082, 1253, 1301, 1303, 1311, 1329,
1334, 1368, 1378.
7IIH]MIPHTIVTPERX
Accessions with seed yield equal to or higher than 60 g/plant:
• TVSU 119, 173, 515, 613, 688, 702, 840, 870, 879, 880, 922, 924, 938, 949, 1023, 1034,
1061, 1231, 1244, 1254, 1279, 1347, 1378.
:MVYWVIWMWXERGI
As can be seen from Fig. 26, about 11% of the accessions were assigned the index 1.
'IVGSWTSVEHMWIEWIVIWMWXERGI
Nearly 27% of the accessions had very little, or no, leaf spots (see Fig. 27).
'SVVIPEXMSREQSRKWIPIGXIHGLEVEGXIVW
The correlation matrix in Annex A helps to determine pairs of characters that vary in
the same or opposite directions. It is a useful guide, especially for plant breeders who may
want to associate a set of traits in their selection programmes. Correlations between pairs
of characters are reliably significant, when the absolute values of the coefficient are greater
than 0.20. Some of the relationships discovered are discussed below.
The characters most strongly correlated with yield per plant (YLD) were the
number of pods per plant (POD), shell thickness (SHL), number of leaves per plant
(LPP), and weight of 100 seeds (SWT). The correlations were all positive, and these
traits were obviously also positively correlated with each other.
Plants with more stems, branches or nodes matured later. This is indicated by the
positive correlation between days to maturity (DMT), and the number of stems,
branches or nodes. In fact the latter three characters are highly positively correlated.
The negative correlations between DMT and Cercospora or virus indexes provided
evidence that diseased plants matured earlier. A negative correlation was also
revealed between DMT and SWT, indicating that small-seeded plants matured later.
The number of days to 50% flowering was only positively correlated with MAT.
The number of seeds per pod (SPP) could be an important character to consider, but it
was not significantly associated with most of the selected traits. Plants with short
petioles tended to have more seeds per pod.
Conclusions
The characterization and evaluation of the bambara groundnut collection at IITA
revealed an enormous agromorphological diversity, which can be used for crop
improvement. Nevertheless, the agromorphological diversity should be confirmed by
molecular and genetic studies. The germplasm materials as well as all related data are
available to all potential users at the Genetic Resources Unit of the Institute. It is
hoped that national agricultural research services in Africa will build upon this initial
work on bambara groundnut to develop strategies for the crop’s adoption,
improvement and use.
AGRONOMY
109
Fig. 1. Frequency distribution for days to
emergence (EMG).
Fig. 2. Frequency distribution for days to 50%
flowering (HFL).
Fig. 3. Frequency distribution for days to
maturity (DMT).
Fig. 4. Frequency distribution for vigour index
(VIG).
110
&%1&%6% GROUNDNUT
Fig. 5. Frequency distribution for plant height
(PHT).
Fig. 6. Frequency distribution for canopy spread
(SPR).
Fig. 7. Frequency distribution for number of
leaves per plant (LPP).
Fig. 8. Frequency distribution for terminal leaflet
length (TLL).
AGRONOMY
111
Fig. 9. Frequency distribution for petiole length
(PTL).
Fig. 10. Frequency distribution for stems per plant
(STM).
Fig. 11. Frequency distribution for number of
branches per stem (BRC).
Fig. 12. Frequency distribution for number of
nodes per stem (NOD).
112
&%1&%6% GROUNDNUT
Fig. 13. Frequency distribution for internode
length (INL).
Fig. 14. Frequency distribution for pod length
(PDL).
Fig. 15. Frequency distribution for shell thickness
(SHL).
Fig. 16. Frequency distribution for shell
percentage (SHP).
AGRONOMY
113
Fig. 17. Frequency distribution for seed length
(SDL).
Fig. 18. Frequency distribution for testa pattern
(TPA).
Fig. 19. Frequency distribution for eye pattern
(EPA).
Fig. 20. Frequency distribution for number of
pods per plant (POD).
114
&%1&%6% GROUNDNUT
Fig. 21. Frequency distribution for number of
seeds per pod (SPP).
Fig. 22. Frequency distribution for seed weight
(SWT).
Fig. 23. Frequency distribution for seed yield per
plant (YLD).
GENETIC RESOURCES/BREEDING/PROMOTION
0 No pattern
3 Marbled
6 Little rhomboid
spotting on both
sides of hilum
1 Entire line
2 Striped
4 Dotted
5 Little rhomboid spotting
only on one side of hilum
7 Much rhomboid
spotting on both
sides of hilum
8 Holstein pattern
Fig. 24. Kinds of testa pattern.
0 No eye
1 Eye as a thin
circle around
hilum
4 Eye forms 5 Large eye, more
an almost
or less shapeless,
triangular
becoming frayed
shape
Fig. 25. Kinds of eye pattern.
2 Eye as 2 thin 3 Eye as 2 thick
lines on both
lines on both
sides of hilum
sides of hilum
6 Eye like a
butterfly
7 Mottled eye
115
116
&%1&%6% GROUNDNUT
Fig. 26. Frequency distribution for virus disease
incidence.
Fig. 27. Frequency distribution for cercospora
disease incidence (CER).
GENETIC RESOURCES/BREEDING/PROMOTION
117
118
&%1&%6% GROUNDNUT
GENETIC RESOURCES/BREEDING/PROMOTION
119
8LI367831FEQFEVEKVSYRHRYXGSPPIGXMSR
R.S. Pasquet1 and M. Fotso2
1
2
ORSTOM and Dept. Agronomy and Range Science, University of California,
Davis, USA
IMPM, Centre de Nutrition, Yaoundé, Cameroon
Introduction
Cameroon lies on the edge of the Guinea Gulf, between West and Central Africa,
and crosses both Guinean and Sudanian phytogeographical areas. All along this
south-north axis, there is a continuous contrast between lowland and highland
areas. Cameroon is the home of numerous ethnic groups, belonging to three
different linguistic phyla, and material cultural traits are well conserved. These
factors make Cameroon a valuable resource for ethnobotanic studies (Figs. 1, 2 and 3).
The ORSTOM-MESIRES project, ‘Agrosystems and cultivated plant diffusion’
was initiated and coordinated by Christian Seignobos. Within this project, a study
of pulses was undertaken by the authors. Results on cowpea have been published
(Pasquet and Fotso 1994) and results on Phaseolus beans are in preparation.
Fig. 1. Administrative map of Cameroon.
Fig. 2. Linguistic phyla of Cameroon.
120
&%1&%6% GROUNDNUT
Fig. 3. Ethnic groups in south Cameroon.
Collecting
Pulse seed samples were collected in 893 localities (but only 702 localities yielded
bambara groundnut samples). Collecting trips, lasting more than a total of
6 months, were undertaken by the authors during several dry seasons, between
March 1985 and December 1989. The expected collecting density was one locality
2
for every 100 km . However, this was often modified according to ethnolinguistic
criteria. At the same time, seed samples were collected by village representatives
from the following parapublic organizations:
• SODECOTON, Société de Développement du Coton, in the Nord and
Extrême Nord provinces
• NEBBP, Nord-Est Bénoué Basin Project, in Nord province
• MIDENO, Mission de Développement du Nord-Ouest, in Nord-Ouest
province
• UCCAO, Union des Coopératives de Café Arabica de l’Ouest, in Ouest
province
• SODECAO, Société de Développement du Cacao, in Centre and Sud
provinces.
A slight correlation between population density and density of localities
sampled was observed. In highly settled areas – the northern Mandara mountains
(densely surveyed because of the high variability encountered), southern Diamaré,
and west Cameroon highlands – collecting density was high. On the other hand,
poorly settled areas such as the southeastern forest areas and the savannas south of
Adamaoua had a markedly lower collecting density.
Condition and size of the bambara groundnut collection
GENETIC RESOURCES/BREEDING/PROMOTION
121
The collection presently includes approximately 1200 cultivated accessions (Table 1)
from 702 localities (Fig. 4). However, many accessions are a mix of several different
cultivars, which are not yet divided. When the mixed accessions are separated, the
collection is expected to exceed 2000.
The collection also includes 60 wild and weedy accessions from 29 localities
(Fig. 5). The map shows many more localities with wild and weedy bambara
groundnut than previously known through herbarium specimens from K, P and YA
herbaria. Wild bambara groundnut seems to be widely distributed, although rare,
between 7°N and 11°N.
Table 1. Origin of Cameroonian bambara groundnut accessions.
Collecting trips
Pasquet et al.
Parapublic societies surveys
SODECOTON
NEBBP
MIDENO
UCCAO
SODECAO
Total
No. localities
No. accessions
190
298
227
60
24
27
174
702
533
111
26
32
219
1219
8VEHMXMSREPPERHVEGIW
According to seed colour, colour pattern, seed size and number of seeds per pod,
accessions were assigned to approximately 30 different cultivars. Most cultivars are
traditional landraces, but some large-seeded cultivars have been introduced during
the last 20 years. No bred varieties seem to have been distributed by agricultural
services, either before or after the independence of Cameroon.
'SRWIVZEXMSRXIGLRMUYIW
A collection of 1-50 seeds per accession is now housed at ORSTOM, Montpellier
(France) in a cold room at 5°C and 20% humidity.
(IWGVMTXMSRSJXLIVERKISJHMZIVWMX]MRXLIGSPPIGXMSR
A total of 50 accessions, including two weedy and one wild, were morphologically
characterized. Analysis of the data produced the following results (see Table 2). As
expected, the wild and weedy accessions show smaller leaves, smaller seeds
(unfortunately, seed size was not accurately recorded), very long internodes and a
spreading growth habit.
Most interestingly, cultivated accessions could be split into two distinct groups:
a northern group, characterized by 1-seeded pods, and a southern group,
characterized by 2-4 seeded pods, as those reported by Rassell (1960), a slightly less
bushy habit, and more robust plants. This latter group does not seem to have been
studied by Begemann (1988a).
122
&%1&%6% GROUNDNUT
Fig. 4. Localities where bambara
groundnut was sampled.
Fig. 5. Wild and weedy bambara
groundnut: localities of previously
known herbarium specimens and
localities of recently collected
accessions.
Table 2. Characterization results (Pasquet and Fotso, unpublished data)
Character
1st leaflet length (mm)
1st leaflet width (mm)
leaflet length (mm)
leaflet width (mm)
petiole length (mm)
4th internode length (mm)
stem number
flower length (mm)
flower width (mm)
percentage of 1-seeded pods
Accessions
Wild
Weedy
48.0
73.0
9.0
18.0
49.0
64.0
16.0
13.0
53.0
82.5
74.5
76.0
–
–
–
–
–
–
100
97.6
North
63.0 ± 7.0
18.2 ± 4.6
50.5 ± 6.3
22.3 ± 2.9
85 ± 15
21.1 ± 7.4
6.3 ± 1.5
9.7 ± 0.6
8.38 ± 0.98
90.9 ± 9.5
South
64.1 ± 6.1
22.0 ± 2.0
63.4 ± 4.0
33.3 ± 3.6
96 ± 21
22.8 ± 2.1
7.2 ± 1.9
10.2 ± 0.4
9.00 ± 0.36
53.8 ± 12.8
West
64.5 ± 7.4
25.5 ± 1.9
59.5 ± 2.7
33.6 ± 2.5
142 ± 15
28.5 ± 4.0
8.5 ± 1.7
10.8 ± 0.3
9.02 ± 0.48
49.8 ± 10.7
Other important issues
The border between the area of cultivation of these groups follows a line south of
Adamaoua, which separates the two main areas of Cameroon: the northern
(sorghum) area, where only one crop per year is viable, and the southern (maize)
area, where two crops may be grown annually. A similar phenomenon is observed
with cowpea. To the north of this line, the cultigroups Biflora and Melanophthalma
GENETIC RESOURCES/BREEDING/PROMOTION
123
(which display low ovule numbers) are found, and to the south, the cultigroup
Unguiculata (which displays high ovule numbers) (Pasquet and Fotso 1994). As
cultigroups Biflora and Melanophthalma are photosensitive, and Unguiculata is photoindependent, it seems reasonable to suppose that the bambara groundnut
cultigroups in the northern localities may be photosensitive and those in the south,
photo-independent.
This frontier is also a cultural boundary between the Chadic and Adamawa
linguistic groups of the north, and the Bantoid and Bantu linguistic groups of the
south (Fig. 2). The ethnobotanical and linguistic data gathered suggest that
bambara groundnut is associated with Adamawa, Bantoid and Bantu language
speakers, and cowpea with the Chadic language speakers (Pasquet and Fotso 1991).
It is also interesting to note the three areas which are more or less devoid of
bambara groundnut. There is no bambara groundnut in the flooded plains which
surround Lake Chad. In precolonial times, bambara groundnut was imported for
consumption, primarily from the Mandara mountains. Bambara groundnut was
not cultivated and used by the ethnic groups from southwest Cameroon, perhaps
because some of these groups were yam bean cultivators, and other groups relied
on hunting for their protein needs. Bambara groundnut was not cultivated by the
Béti, who expressed a preference for, and were proud of possessing, peanut. In this
area, bambara groundnut cultivation is restricted to the former Bassa area, which
was conquered by the Béti a few decades before the colonial period. Legumes are
traditionally cultivated by women, and as the Béti kept the Bassa women, the
existence of bambara groundnut in this region continues as remnant of the Bassa
culture. Bambara groundnut is found throughout the Lophira alata forest area,
which formed part of the once much more extensive Bassa region (Letouzey 1968).
%GORS[PIHKIQIRXW
We would like to thank Mr Audebert and Njigi Fouda (SODECAO), Mr Gaudard and
Mambou (SODECOTON), Mr Custers, Dewaele and Meurillon (NEBBP), Mr Asah and
Parkinson (MIDENO), Mr Piedjou and Mr Simon (UCCAO), who allowed us to carry out the
surveys.
The characterizations of bambara groundnut were done within the SODECAO-CCCE
‘Nyong et Mfoumou’ project. We thank Mr Simon (CCCE), Mr Audebert (Directeur des
Opérations Agricoles, SODECAO), Mr Paul Mbida (Directeur de la station de Mengang) and
Mr Bernatin Mvondo Nkoe.
We also thank S. Bahuchet, D. Barreteau, M. Dieu, E. Dounias, J.G. Gauthier and Ch.
Seignobos for the seed samples they kindly provided.
124
&%1&%6% GROUNDNUT
(IZIPSTQIRXSJXLI-RXIVREXMSREP&EQFEVE+VSYRHRYX(EXEFEWI
F. Begemann
Information Centre for Genetic Resources (IGR), Centre
Documentation and Information (ZADI), Bonn, Germany
for
Agricultural
Introduction
&MFPMSKVETLMGMRJSVQEXMSR
A first attempt was made to provide comprehensive information on bambara
groundnut (Vigna subterranea (L.) Verdc.), previously known as Voandzeia subterranea
(L.) Thou. ex DC.), when the International Institute of Tropical Agriculture (IITA)
published the first bibliography with abstracts of world literature from 1900 to 1978
(IITA 1978). A total of 260 entries were listed, and grouped according to their
relevance in (a) general and reference works, (b) agronomy, (c) physiology, growth
and development, (d) chemical composition, (e) botany, taxonomy and geographical
distribution, (f) genetics and plant breeding, (g) insect pests and control, (h) plant
pathology, (i) nutritional studies and (j) other uses.
In addition, IITA provided some specific background information in the areas of
crop production, plant breeding, and crop protection, utilization and economics
(Begemann 1986a,b; Ng et al. 1985). IITA´s bibliography was subsequently updated
by A. Linnemann (1992). Her revised and updated bibliography comprises some 500
references, mostly annotated, and covers the period up to the year 1992. No regular
updating of bambara groundnut bibliographic information has yet been established.
For many years, additional information on the origin of genetic resources
collections, and the qualitative and quantitative properties of numerous landraces,
has been recorded at numerous research institutions. These records, however, are
scattered, and difficult to trace and interpret, partly due to a lack of appropriate
communication tools, and partly, to the lack of standardization of the format and
content of collections. It was for this reason that central crop databases and standard
descriptor lists have been established for many crops (Hazekamp 1995; Knüpffer
1995).
&EQFEVEKVSYRHRYXHIWGVMTXSVW
In the mid 1980s, F. Begemann and N. Q. Ng proposed standard descriptors. These
were accepted and published by IBPGR, IITA and the German Agency for Technical
Cooperation (GTZ) (1987), to facilitate the exchange of data and comparison of
research results between different germplasm collections. They were structured
according to the recommendations of IBPGR, who had by then adopted the following
definitions in genetic resources documentation:
(i) passport (the recording by collectors of accession identifiers and information)
(ii) characterization (the recording of those characters which are highly heritable,
can be easily seen by the eye, and are expressed in all environments)
(iii) preliminary evaluation (the recording of a limited number of additional traits
thought desirable by a consensus of users of the particular crop).
Hence, the bambara groundnut descriptors included passport, characterization
and preliminary evaluation, as well as further characterization and evaluation data.
GENETIC RESOURCES/BREEDING/PROMOTION
125
(EXEHSGYQIRXEXMSR
As IITA’s collection can be regarded as the largest collection of this crop, it was crucial
to examine the properties of its accessions. With the support of GTZ, IITA undertook
a detailed investigation of its collection (Begemann 1988a, 1988b; Goli et al. 1991).
Based on these trials, in 1985, an initial database was established in ORACLE format.
Passport, characterization and evaluation data of 1378 accessions had been recorded.
Present status of the International Bambara Groundnut Database
The International Bambara Groundnut Database (Fig. 1) was compiled by D. Jiménez
Krause and F. Begemann in 1995, by merging data from various sources, the main
ones to date being:
• the joint research project between GTZ and the Genetic Resources Unit of IITA
(Begemann 1988a)
• the Genetic Resources Unit of IITA (Begemann 1988a; Goli et al. 1991)
• the Zambian Bambara Groundnut Improvement Programme at the University
of Zambia (UNZA) (Begemann 1990, 1991; Mbewe and Begemann 1990).
The International Bambara Groundnut Database contains:
• passport data on about 2100 accessions, originating from 28 countries
• characterization data on about 1400 accessions
• evaluation data on about 1400 accessions (Fig. 2).
The database is being offered on Internet by the Information Centre for Genetic
Resources (IGR) of the Centre for Agricultural Documentation and Information
(ZADI) in Bonn, Germany, and is located at the following web site:
http://www.dainet.de/genres/bambara/bambara.htm. The database can also be
obtained from the author on four diskettes as a Foxpro 2.6 application, to be installed
in MS Windows (approx. 6MB) (Jiménez Krause 1995). Yet to be included in the
database are project, literature and meta data, and updated information on these will
have to be provided by members of the new International Bambara Groundnut
Network (IBGN). A very limited number of projects are listed in the SPAARdatabase, and are available through the same above-mentioned internet web site, or
upon request from the author.
Recommendations
6IZMWMSRSJXLIFEQFEVEKVSYRHRYXHIWGVMTXSVW
Based on the experience of using the bambara groundnut descriptors as they are
published, some of them seem to be very difficult to follow, i.e. the seed colour and
pattern descriptors. The passport data requested seem too numerous to record.
Furthermore, the present structure no longer matches the latest IPGRI format
(Hazekamp 1995). A revision of the descriptor list is therefore recommended, to
consider in particular:
• fewer passport descriptors
• restructuring of the characterization and evaluation data
• a more user-friendly method of describing the seed colour and pattern,
including testa and eye, and pigmentation around eye
• the inclusion of some molecular data.
126
&%1&%6% GROUNDNUT
Along these lines, a revised descriptor list has been drafted and circulated among
selected experts of the crop.
1EMRXIRERGI HIZIPSTQIRX ERH HMWXVMFYXMSR SJ XLI -RXIVREXMSREP &EQFEVE
+VSYRHRYX(EXEFEWI
As the information contained in the International Bambara Groundnut Database is
highly relevant to any improvement programme for this crop, it is recommended that
the database be maintained, further developed and freely distributed. ZADI is
currently offering to develop the database, with the support of all members of the
IBGN, and to maintain and distribute it on-line via Internet, and on diskette (Foxpro
with distribution kit, or other software). Recently, ZADI has also established the
Bambara Groundnut Online Database, which provides for qualified and flexible
online searches directly.
%ZEMPEFMPMX]SJYTHEXIHFMFPMSKVETLMGMRJSVQEXMSR
In order to increase the efficiency of future research activities, it is recommended that
up-to-date information on projects and literature be provided. These activities should
be seen to be connected to the future development of the International Bambara
Groundnut Database. New developments on Internet, which may provide tools for
this undertaking, should be investigated.
Fig. 1. International Bambara Groundnut Database on the Internet.
GENETIC RESOURCES/BREEDING/PROMOTION
Fig. 2. Bambara Groundnut Online Database on the Internet.
127
128
&%1&%6% GROUNDNUT
&VIIHMRKFEQFEVEKVSYRHRYXZEVMIXMIWWYMXEFPIJSV>MQFEF[IER
GSRHMXMSRW
R. Madamba
Department of Research and Specialist Services, Harare, Zimbabwe
Introduction
In the communal and resettlement areas of Zimbabwe, bambara groundnut (Vigna
subterranea (L.) Verdc.) is the third most important grain legume after peanut (Arachis
hypogaea L.) and cowpea (Vigna unguiculata (L.) Walp). The crop is grown in diverse
agro-ecological regions. The regions vary in temperature, rainfall and soil types
(Vincent and Thomas 1961). It is principally grown by the communal farmers located
in the country’s dry natural regions – IV, V and part of region III. These regions are
characterized by very low rainfall (less than 400 mm/year), which is unreliable and
poorly distributed. The growing seasons are short, usually less than 4 months.
Communal farmers grow bambara groundnut mainly for subsistence purposes, and
use little or no fertilizer, pesticides or irrigation. Commercial farmers have recently
begun to show interest in bambara groundnut and, unlike communal farmers, they
grow the crop using these inputs.
Bambara groundnut is grown in both pure and mixed stands. Current production
figures of bambara groundnut in the country are quite low. For example, in 1993, a
total of 1491 tonnes of unshelled nuts were produced by the large and small-scale
commercial farmers, and the resettlement area farmers, with a national average yield
of 530 kg/ha. Production figures for the communal area farmers are not yet available,
but are likely to be higher than this (CSO 1994).
Bambara groundnut production is limited by shortage of seed and the use of
unimproved local races, which are inherently low yielding. Droughts, improper crop
management (including delayed planting, low plant populations and poor earthing
practices) and pests such as wild animals and aphids also limit production.
Apart from some exploratory work done on bambara groundnut in the early
1920s, the crop was neglected by researchers, as it was considered a ‘poor man's crop’,
of little economic importance (Smartt 1959). Mundy (1932) described bambara
groundnut as a pulse of the African native, which despite being a good drought
resister, had low yields and hence was uninteresting to European farmers.
In the early 1980s, the Zimbabwean government acknowledged the role played by
indigenous crops, especially in the improvement of human nutrition in the marginal
areas of the country. Some agronomic research on bambara groundnut was begun in
the mid-1980s and a bambara groundnut breeding programme was launched in 1989.
Its major objectives are to collect germplasm and to develop high-yielding and welladapted bambara groundnut varieties for Zimbabwean farmers.
Germplasm collecting and conservation
A germplasm collecting mission was launched in 1990, aimed at local germplasm in
the rural areas of Zimbabwe, through agricultural extension workers located in all of
the country’s eight provinces. To date, a total of 129 active bambara groundnut
germplasm accessions have been gathered. This year, more germplasm was collected
from Mbare Musika, a fruit and vegetable market in Harare. Foreign germplasm has
GENETIC RESOURCES/BREEDING/PROMOTION
129
been provided by the International Institute of Tropical Agriculture (IITA), Zambia,
South Africa, Tanzania and Wageningen Agricultural University. About 80% of the
germplasm held is from local collections. Germplasm for medium-term storage is
stored in folding envelopes in a cold room at temperatures below 10ºC, while the
active germplasm is stored at room temperature. Lack of proper long-term storage
facilities has hindered progress in germplasm conservation. However, construction of
a plant genetic resources unit at Harare Research Station is currently underway,
which should solve this problem.
Germplasm characterization
Characterization of the collected bambara groundnut germplasm for different traits
has been done, to assess the range of genetic variation. Accessions or lines with
desirable traits are also used in the hybridization programme. Lines have been found
to differ in growth habit, flower colour, seed shape, seed colour, eye colour and
pattern, seed weight, days to 50% flowering and days to 95% physiological maturity
(an example is given in Table 1).
Variety development
Varieties are developed through a modified pure-line breeding method, and through
hybridization. Introductions from other countries also add to the germplasm. A
schematic diagram showing bambara groundnut germplasm flow is shown in Fig. 1.
:EVMIX]L]FVMHM^EXMSR
Individual parental lines for crossing are planted in such a way that their flowering
periods coincide. These are grown in asbestos pots at the greenhouse site. As
bambara groundnut is a self-pollinating plant, the female parent is made by
emasculation. A flower bud is selected and all the neighbouring buds are removed.
The selected bud should be big enough to be handled by a pair of forceps, but should
not be well developed, because bambara groundnut is cleistogamous (i.e. pollen is
shed before the flower opens). A pair of forceps is used to open the bud carefully, and
the anthers bearing undeveloped pollen grains are then removed. Maximum care
should be taken not to damage the stigma. A fully bloomed flower is used as a source
of pollen.
On opening of the fully bloomed flower, a white substance, which is the pollen,
can be seen with the naked eye. The style of the flower bearing the pollen grains is
carefully removed by a pair of forceps, and the pollen grains are squeezed onto the
emasculated female flower. Attempted cross-pollinated buds are identified by a thin
copper wire, which is folded around the peg. Earthing is done at 2 days after
pollination.
Segregating populations are advanced from F1 to F5 through a modified singleseed descent method. Single plant selection is done at F 5 generation, when a high
degree of homogeneity is believed to have been achieved. Selection of plants is based
on maturity, yield (pods per plant), seed colour and seed size.
130
&%1&%6% GROUNDNUT
GENETIC RESOURCES/BREEDING/PROMOTION
131
Fig. 1. Flow chart of bambara groundnut improvement programme.
,ERHPMRKPSGEPKIVQTPEWQ
The local landraces are so heterogeneous that more than 10 different types of bambara
groundnut can be found in a single crop. True breeding varieties are developed from
the local landraces, through a modified pure-line breeding method. The locally
collected seed is initially sorted by seed colour and is then grown in different plots in
the field. Within a plot, plants with similar morphological features are selected and
grouped to form progenies. These progenies are then grown at Harare Research
Station for multiplication purposes. Although diseases are not a major constraint to
bambara groundnut production, progenies showing disease symptoms are instantly
discarded. Introduced exotic lines and those developed through hybridization are
initially evaluated in the same way, in progeny-row plots in the field.
132
&%1&%6% GROUNDNUT
Germplasm evaluation
Agronomically superior lines from the progenies enter into several stages of testing,
conducted at sites located in all the agro-ecological regions of Zimbabwe. These trials
are conducted to assess the range of adaptation of the developed varieties. The
selected lines from the progenies are first evaluated for yield and other agronomic
characteristics, in unreplicated double-row observation plots. They are tested at a
high-potential site (Harare Research Station), and a marginal dryland area (Matopos
Research Station). Varieties with good agronomic performance in at least one of the
two environments progress into the Preliminary Variety Trials (PVT). The PVTs are
conducted in 4-row plots, 3 m long. The intra-row spacing is 15 cm; inter-row spacing is
45 cm. The design is a Randomized Complete Block Design (RCBD), replicated twice.
The PVTs are conducted on at least two sites. At this stage, selection is based both on
reaction to disease, and on the yield potential of the varieties at the two different sites.
The selected lines from PVTs progress to Intermediate Variety Trials (IVT). These
are conducted at 4-5 sites, using a RCBD replicated three times. This trial consists of
4 rows per plot, 4.5 m long. Agronomically superior varieties in the IVTs progress
into the Advanced Variety Trials (AVT), which are conducted at 5-8 sites. The sites
used are chosen to represent all the agro-ecological regions of Zimbabwe. The plots
contain 6 rows, with each row being 4.5 m long in a RCBD, with four replications. A
few selected varieties (3-5) from the AVTs are tested on-farm. At all testing sites,
except Gwebi Variety Testing Centre (GVTC), the trials are conducted under strictly
rain-fed conditions. Supplementary irrigation is applied at GVTC, to assess the
varieties’ full genetic potential. This information is also important to the large-scale
commercial farmers, who produce bambara groundnut with many inputs.
Research activities: 1993/94
In the 1993/94 summer season, a total of 100 progenies made from the local
germplasm were evaluated for yield, and some of them were quite promising. A
hybridization programme was initiated in the 1994 summer season, and five different
crosses were made among six promising bambara groundnut varieties with different
seed colour: SA 37 and ZVS-564; BGM 1B and ZVS-564; Variety 10 and ANKPA 4;
ZVS-564 and SA 37, and Variety 5 and ANKPA 4.
The crosses yielded poorly, probably owing to the use of clay soil, which
compacted and hindered pod development when irrigated. In future, sandy soils will
be tried. Ten bambara groundnut lines, including a local variety, were tested in the
preliminary variety trial. Two lines, ANKPA 4 and TALI LOCAL, significantly
(P<0.05) outyielded the local Variety 10, while the varieties ZVS-580 and CHIPATA 1
compared very favourably with it.
Also in the 1993/94 summer season, 18 experimental varieties, including both
foreign and locally developed ones, were evaluated for their yield performance under
various environmental conditions in the AVTs. The two sites – Makoholi and Mlezu –
are located in low-potential areas, whereas Kadoma, Harare and GVTC are highpotential sites.
In the AVTs, significant differences (P<0.05) were found in the grain yields of the
varieties at four sites (Table 2). At Makoholi and Mlezu testing sites, which are
marginal rainfall areas, lower mean site yields (<400 kg/ha) were recorded. In these
areas, some of the varieties yielded only <200 kg/ha. However, some varieties
attained reasonable yields at these sites. For example, the variety ZVS-564 yielded
GENETIC RESOURCES/BREEDING/PROMOTION
133
538 kg/ha at Makoholi experimental station, and the variety 3806/90 yielded
811 kg/ha at Mlezu. These results are very good, since the current average yield for
the marginal rainfall areas is 80-400 kg/ha.
Table 2. Bambara groundnut yields (kg/ha) at different sites (advanced variety trial,
summer 1993/94).
Variety
ZVS-503
ZVS-524
ZVS-530
SA 16
ZVS-509
ZVS-391
ZVS-537
ZVS-531
ZVS-561
ZVS-534
ZVS-339
SA-37
ZVS-564
SA-28
SA-12
3806/90
3804/90
Variety 10
Mean
SE
CV
LSD 5%
Makoholi
327
313
375
353
308
199
399
207
274
370
261
255
538
433
376
250
188
286
317
–
46
–
Mlezu
272
397
133
611
347
255
391
294
347
161
321
403
485
480
281
811
413
103
364
93
44
267
Kadoma
1332
1475
1114
1324
718
996
1157
897
2139
1012
1262
1905
1809
2214
1408
1558
1119
1499
1385
229
29
659
Gwebi
3273
2078
3292
4200
2009
2818
3522
2792
2933
3180
2664
3536
3673
3025
3945
3323
3257
3326
3158
386
21
1109
Harare
1302
1740
1448
1419
1119
1295
1938
1231
1732
2228
1126
2543
1908
1728
1291
1600
1565
934
1564
135
15
389
Mean
1301
1271
1283
1683
900
1112
1590
1162
1439
1417
1127
1728
1682
1667
1635
1509
1308
1381
1400
–
–
–
Rank
12
14
13
2
18
17
6
15
8
9
16
1
3
4
5
7
11
10
–
–
–
–
The testing sites in wetter agro-ecological zones had good mean yields:
1385 kg/ha and 1564 kg/ha at Kadoma and Harare Research Stations, respectively.
The variety SA 28 attained the highest yield at Kadoma (2214 kg/ha), but SA 37 was
highest at Harare Research Station (2543 kg/ha). GVTC, also situated in wetter zones,
received supplementary irrigation, and had a very high site mean yield (3158 kg/ha).
Yields recorded at this site ranged from 2009 kg/ha (ZVS-509) to 4200 kg/ha (SA 16).
In the high-potential areas, in both dryland and irrigated blocks, yields were
impressive, given that the average yield for the commercial farmers located in these
regions is less than 1000 kg/ha (CSO 1994). The highest yield (4200 kg/ha), obtained
at GVTC, compares very favourably with the highest yields obtained from other grain
legumes such as soybean (4500 kg/ha) and groundnuts (4300 kg/ha). The current
market price of bambara groundnut is three times that of soybean and peanuts, which
makes it a potentially more profitable crop, in both the commercial and communal
farming sectors.
From the results in Table 2, it can be concluded that bambara groundnut is a crop
with the potential to produce reasonable yields, averaging 300 kg/ha under marginal
conditions and 4000 kg/ha under good environmental conditions. Bambara
groundnut can therefore be grown successfully in all agro-ecological regions of
Zimbabwe, by both the commercial and the communal farming communities. Table 3
shows some of the agronomic characteristics of the bambara groundnut varieties
tested in the AVTs during the 1993/94 summer season.
134
&%1&%6% GROUNDNUT
Compared with peanuts, bambara groundnut had a higher shelling percentage;
on average it is about 78%, whereas that of peanuts is 60% (Crop Breeding Institute
Annual Reports 1993-94, unpublished data). However, the bambara groundnut crop
requires a long period to reach flowering and physiological maturity. On average, it
takes 62 days to attain 50% flowering (i.e. when half of the plants in a plot are at full
bloom) and 140 days to reach physiological maturity. This is not a desirable
characteristic, because of the shorter growing seasons characterizing most of the
bambara groundnut growing regions in Zimbabwe.
Table 3. Agronomic characteristics of bambara groundnut (advanced variety trial,
summer 1993/94).
Percentage
Days to
Days to
Shelling
Variety
stand
50% flower
95% maturity
percentage
ZVS-503
89
62
141
78
ZVS-524
80
61
141
82
AVS-530
86
62
139
78
SA-16
87
61
141
78
ZVS-509
75
61
140
76
ZVS-391
83
62
141
76
ZVS-537
84
63
140
82
ZVS-531
86
62
141
76
ZVS-61
82
62
140
76
ZVS-534
85
61
140
78
ZVS-339
82
62
141
80
SA-37
88
62
138
82
ZVS-564
83
60
139
78
SA-28
82
62
139
76
SA-12
84
62
142
82
3806/90
80
62
139
74
3804/90
84
61
139
78
Variety 10
82
61
141
78
Mean
84
62
140
79
Conclusions
Four high-yielding varieties, capable of producing about 300 kg/ha under marginal
rainfall conditions and over 4000 kg/ha in high-rainfall areas, have been identified:
SA 16, SA 37, ZVS-564 and 3806/90. These are being tested extensively on-farm
before they can be recommended for production by the farmers. Short-duration
varieties (TVSU 354, TVSU 1130, TVSU 228, TVSU 158 and TVSU 949) taking less than
100 days to physiological maturity have been identified, and would thus suit
Zimbabwe’s short growing seasons. Although inherently low yielding, their
performance will be improved through a hybridization programme. In the 1995/96
hybridization programme, 10 planned crosses will be made between high-yielding,
long-duration and short-duration varieties. While progress has been made in
germplasm collecting, germplasm conservation is currently constrained by a lack of
proper long-term storage facilities.
GENETIC RESOURCES/BREEDING/PROMOTION
135
%RI\TIVMQIRXXSGVSWWFEQFEVEKVSYRHRYXERHGS[TIE
F. Begemann
Information Centre for Genetic Resources (IGR), Centre for Agricultural
Documentation and Information (ZADI), Bonn, Germany
Introduction
Bambara groundnut (Vigna subterranea (L.) Verdc.) belongs to the family
Leguminosae, subfamily Papilionoideae. Recent electrophoretic studies by Howell
(1990) confirmed the close relationship between bambara groundnut and several
species of the genus Vigna. According to Linnemann (1992), the nature and extent of
the genepools in cultigens of the genera Phaseolus and Vigna were reviewed by Smartt
(1981), as indicated by studies of experimental interspecific hybridization. In all cases, a
primary genepool exists which has evolved distinct wild and cultivated subgenepools.
For bambara groundnut, no secondary or tertiary genepools had been identified.
Many authors (Begemann 1988a; Goli et al. 1991; IITA 1978; Linnemann 1992)
have reported bambara groundnut to be adapted to poor and sandy soils and low
precipitation. Hence, bambara groundnut is a crop well suited for the semi-arid
areas, such as the savanna regions. Generally, cowpea (Vigna unguiculata) seems to
require a more humid environment and richer soils than bambara groundnut.
Besides, bambara groundnut has been reported to be less susceptible to pest and
diseases than cowpea (IITA 1978).
Cowpea is the most widely grown legume in Sub-Saharan Africa. However,
bambara groundnut, despite having been marginalized by farmers in recent years,
is still of great value to local farming communities. It therefore seems worthwhile
to investigate whether or not some valuable characters, i.e. resistance to biotic and
abiotic stresses of both crops, could be exchanged. To do so, it was necessary to
perform a crossing experiment to determine whether bambara groundnut and
cowpea partly belong to the same genepool and could be crossed easily.
Materials and methods
Between 1985 and 1987, an experiment was carried out at the International Institute
of Tropical Agriculture (IITA), in the glasshouse at the Ibadan campus, to attempt to
cross bambara groundnut and cowpea. The accessions used in the experiment were
TVU-13677 (cowpea) and TVSU-501 (bambara groundnut); TVU-13677 served as
the female plant, and pollen was taken from TVSU-501. The pollination was carried
out by hand, without additional inputs.
Results and discussion
The experiment showed that the pollinated flower of the TVU-13677 plant
produced an abnormally short pod (approx. 1 cm), with only one seed per pod,
while all other flowers of the same plant which had not been pollinated with
bambara groundnut pollen produced pods of normal length (approx. 10 cm) (see
Fig. 1). Figure 2 shows the pod and harvested seed of the TVU-13677 x TVSU-501
experiment, as well as a long pod with 14 seeds, as produced by the TVU-13677
136
&%1&%6% GROUNDNUT
plant with no bambara groundnut pollination. The seed of the supposed cross
shows similar seed colour and pattern as the normal TVU-13677 seeds.
Fig. 1. Short pod resulting from crosspollination.
Fig. 2. Pod and seeds of TVU13677 (left) and F1 crossing (TVU-13677
x TVSU-501, right).
After harvest, the F1 seed (TVU-13677 x TVSU-501) was planted to test its
fertility. It developed a fertile plant which looked very similar to the original TVU13677. The only agromorphological difference noted was its time to maturity.
While TVU-13677 is a 60-day variety, the supposed F1 cross did not reach maturity
at 80 days. Figure 3 shows the still immature plant on the 81st day. The pods and
seeds which were later harvested from this attempted F1 cross looked very similar
to those of the TVU-13677, as indicated in Figure 4.
Fig. 3. F1 plant.
Fig.4. Pods and seeds harvested from F1 cross
(left), compared with TVU-13677.
GENETIC RESOURCES/BREEDING/PROMOTION
137
The experiment had to be interrupted at this point because of time and financial
constraints, although the trial indicated that crossing of bambara groundnut and
cowpea may be feasible, provided that cowpea is used as the female partner and the
pollen is taken from bambara groundnut. It was not possible to establish from this
experiment whether the cross was successful, however, although the shape and size
of the F1 pod and F1 seed, as well as the extended time to maturity of the resulting
plant, strongly indicated this was the case.
However, using bambara groundnut as the female plant to be pollinated with
cowpea pollen, as was attempted by A. Goli in 1986 (pers. comm.), seems to be
much more problematic. Part of the difficulty arises from the physical conditions of
such an experiment, as the flowers of bambara groundnut are very difficult to trace
underground, and are hard to earmark because of their very short internodes, with
even more than one flower per node. The results of the trial were in agreement
with earlier reports, which had stated a very close relationship between bambara
groundnut and other species of the genus Vigna. It is nonetheless very surprising
that the two crops belong to the same genepool.
Conclusions and recommendations
If the findings of this trial could be confirmed by other experiments, this would be
extremely useful for improvement programmes of the bambara groundnut and the
cowpea crops. It is therefore strongly recommended that such an experiment be
repeated. The F2 seeds also could be tested for their viability and used for molecular
studies. As the electrophoretic study findings published so far seem insufficient to
reveal the genetic diversity of the entire bambara groundnut genepool, some
molecular investigations should be undertaken to identify the diversity required for
further crosses of the species with cowpea.
If these future crosses are successful, the new possibilities they imply for the
improvement programmes of both crops should then be exploited. Doing so would
require an analysis of the specific characters of one crop which would be beneficial
for the other, e.g. resistances to biotic and abiotic stresses. Furthermore, the
possibility of using bambara groundnut as the female plant to be pollinated with
cowpea pollen should be further investigated.
138
&%1&%6% GROUNDNUT
8LITSXIRXMEPVSPISJ2+3WMRTVSQSXMRKGSRWIVZEXMSRERHYWISJ
FEQFEVEKVSYRHRYX
D. Shumba
ENDA, Harare, Zimbabwe
Introduction
Since the late 1960s, the countries of Sub-Saharan Africa have been struggling against
severe food shortages and the crisis appears to be worsening. A number of factors
account for the continent’s growing inability to feed its rapidly expanding population.
One of these is the erosion of the genetic resources of indigenous African crops,
including bambara groundnut. Owing to the recurring droughts in Africa, food
insecurity and starvation are constant threats. Researchers have discovered that
hunger, malnutrition and household food insecurity are to a large extent caused by
poverty, which results from scarce agricultural resources, including agricultural
knowledge and its application. This paper discusses the part that non-governmental
organizations (NGOs) can play to make these resources available to needy farmers in
general.
The paper will specifically discuss the role of NGOs in promoting the
conservation and use of crops such as cowpea and bambara groundnut, which are
widely grown but largely ignored by most extensionists, researchers, national seed
programmes and seed companies. It has been suggested (Diana Callear, pers. comm.)
that the best strategy to combat famine is to assist the great majority of the farmers to
increase their levels of production and their incomes, as this would increase
household food security. It may be easier, and perhaps more lucrative, to identify a
famine and provide relief than to address the underlying cause of famine and
poverty.
Famine relief also has immediate short-term effects: lives are saved for today, at
least (what happens tomorrow is another issue). In most cases, countries that are said
to be food sufficient, e.g. India, have high levels of malnutrition. The reasons are that
national food availability does not necessarily lead to household food security. The
lack of crop diversity in a household might lead to food availability, but an
unbalanced diet for the family. The incorporation of grain legumes in the cropping
programme of the rural farmers will diversify their protein source.
Problems encountered in a bid to achieve food security
One of the most crucial factors in crop production is the availability of the appropriate
crops and seed when needed. Many reports on individual seed projects and
programmes have pointed out the enormous difficulties faced in getting a formal
national seed system to provide an effective service to small farmers in marginal,
variable environments. Recent studies by Cromwell et al. (1992) have confirmed this
picture on a wide scale, in developing countries.
The formal sector finds it most profitable to produce hybrid seed, especially
vegetable crops. It also concentrates on the seed of crops with high sowing rates
(meaning that large quantities will be bought) and high multiplication rate (i.e. more
can be produced quickly). The sector, therefore, tends to ignore certain crops that are
important to small farmers, such as self-pollinated varieties of cereals and legumes.
GENETIC RESOURCES/BREEDING/PROMOTION
139
These tend to be less profitable for seed companies and face stiff competition from
farm-saved seed. This situation is aggravated by the methods and orientation of plant
breeding and researchers within the formal agricultural research system. Thus, with
regard to both the product required and the distribution system, the formal sector
often cannot provide an effective seed service in the marginal, variable environments
of developing countries, except for certain ‘niche’ markets.
The formal seed supply systems, the formal research organizations and the
extensionists have all contributed, through the Green Revolution, to the extinction of
the more adaptable, drought-tolerant crops, a group which includes millet, sorghum,
cowpea, bambara groundnut, chickpea and pigeon pea.
Because of the very limited and erratic nature of rainfall in the semi-arid regions,
the high costs of external crop inputs, the unreliability of the agribusiness and the
unsustaining nature of alien farming systems in these areas, it is imperative for
farmers to develop a low-input-cost farming system that is sustainable. Bambara
groundnut is a ubiquitous grain legume, indigenous to Africa. It is primarily grown
by peasant farmers, for consumption of the grain. It has an enviable reputation as a
hardy crop, owing to its drought tolerance and reasonable yields when grown on
poor soil, and therefore has good potential in the semi-arid regions. Both improved
and indigenous varieties of bambara groundnut will be adopted and cultivated by
smallholders, if the crop is well promoted to them.
Farmers in our country easily adapt to new technologies if they perceive their
advantages.
Good cases in point are provided by the hybrid maize and
‘Moneymaker’ tomatoes, planting in rows, planting Eucalyptus and the cultivation of
burley tobacco, all of which have been introduced in Zimbabwe. If improved
varieties of bambara groundnut are advantageous, famers usually grow them. If, on
the other hand, the traditional farmer-managed bambara groundnut varieties are
good enough, cultivation of the crop benefits from a viable seed-exchange
programme.
Despite existing knowledge of the crop, prudence is called for in its cultivation. If
small farmers produce more bambara groundnut than they can consume, and if there
is no viable market for this surplus, farmers will be discouraged from cultivating the
crop in the future. Such a situation currently exists regarding the adoption of
drought-tolerant small grains in Zimbabwe. Any strategy for promoting bambara
groundnut needs to address the issue of diverse utilization of the crop.
NGOs in rural development
The number of development NGOs has increased dramatically during the last decade,
and now there are many based in developing countries. An NGO is defined as "any
organization that is operationally distinct from government" (ODI 1988). They vary in
their historical origins and in their size and significance, compared with other
agencies, and the strength of the link with these other agencies. Farrington and Biggs
(1990) grouped NGOs in the following categories:
• Service provision, ranging from short-term relief to long-term development.
• Organization-building and local empowerment, working with communities to
identify their problems and solve them locally.
• Support and advocacy, including lobbying national and international policymakers, and providing back-up services, such as research and policy analysis,
and information exchange for smaller organizations.
&%1&%6% GROUNDNUT
140
•
Volunteer agencies, which are primarily geared to providing volunteer
technical assistance to other projects and programmes.
Most NGOs specialized in agriculture base their activities on three premises:
(i) The existing indigenous knowledge systems of farmers are critical for the
success of any initiative.
(ii) Farmers have the right to be part of the decision-making process in all matters
which affect them.
(iii) Agriculture is but one aspect of development, and it is a means to the end of
individuals’ development.
ENDA’s experience
ENDA-ZW (Environment and Development Activities in Zimbabwe), as a member of
rural development NGOs that specialize in agriculture, adopted an integrated
approach to the development of the organizational and individual capacities of the
rural people it serves. Its mission statement reads as follows: "ENDA strives to
promote and develop opportunities for wealth creation for the rural and urban poor,
through sustainable natural resource utilization and the capacity development of
Zimbabwean human and institutional resources" (ENDA-ZW 1994). The three most
critical issues are sustainability, wealth creation and community participation.
The two agricultural projects which have shown that NGOs can promote the
adoption of a technology are ENDA’s Seeds Action Project and its Sustainable
Agriculture Project. The Seeds Action Project promotes germplasm conservation,
both in situ and ex situ, and seed production by small-scale farmers. The project was
started 10 years ago, and its achievements to date are as follows:
• Increased production of local and improved varieties of millets and sorghums
in the project areas.
• Small-scale farmers have proved beyond reasonable doubt that they can
produce good-quality seed, despite their shared arable areas.
• Farmers can effectively participate and contribute to on-farm characterization.
• Farmers have a defined selection method, which they use when harvesting
farm-saved seed.
• Prototype dehullers have been introduced to small-scale farmers, making it
easy to process sorghum and millets. This has led to increased use of
sorghum and millet products.
• Value-added diverse products of small grains after processing.
The Sustainable Agriculture Project, which is in its third year, promotes soil and
moisture conservation techniques and sustainable low-input agricultural practices.
On-farm trials are carried out and demonstration plots are established annually. The
strength of both projects lies in farmer training, and result and method
demonstrations.
Methods used to promote cultivation and utilization of any crop
ENDA programmes emphasize farmer participation, and stress is therefore placed on
a dialogue with farmers. Information is exchanged and assessed, attitudes concerning
the introduced or modified technology are noted and misunderstandings that occur
during the exchange are quickly identified and rectified. Thus relationships of mutual
GENETIC RESOURCES/BREEDING/PROMOTION
141
respect are built up between farmers and extension agents. ENDA bases its activities
on good channels of communication between farmers and its officers, and
disseminates information to farmers through:
• Group meetings. These may be divided into
(i) information meetings to communicate a specific piece of new information
(ii) planning meetings to review a particular problem, suggest a number of
solutions, and decide upon a course of action
(iii) special-interest meetings to present topics of specific interest to a
particular group of people
(iv) general meetings, where all general topics affecting the community are
discussed.
• Individual visits, usually made as follow-up to group meetings or training
sessions to assess the acceptability of issues discussed, and the adoption rate.
• Demonstrations: farmers like to see how a new idea works, and also what
effects it can have on increasing their crop production. Both result and
method demonstrations are carried out by ENDA officers.
• Field days, to introduce a new idea and/or a new crop, and to stimulate the
maximum interest among farmers. These are usually opportunities to hold
result and/or method demonstrations.
• Tours: farmers visit farms in other areas to see how the introduced technology
works, or to learn of that community’s experience of a newly introduced crop.
What effective communication can do in promotion of bambara nut
In the author’s opinion, with effective communication between researchers and
extensionists, quite a number of agriculturally oriented or food-security-conscious
NGOs would be glad to include any local cultivars or improved varieties of bambara
groundnut in their programmes. If a commercial use of bambara can be developed,
this would create a reliable and perhaps a viable market for the crop.
Similarities in the uses made of bambara groundnut and cowpea in Africa are
well known. Results from a survey on production and utilization of cowpea,
conducted in Zimbabwe, suggest that it has the brighter future of the two crops. The
survey revealed that, from a total of 145 farming families from 13 districts of six
provinces, almost 90% grew and used cowpea.
Bambara groundnut was ranked among the top four most important legumes in
SADCC by the grain legume feasibility study (SADCC 1984). However, utilization of
grain legumes may be constrained by their limited supply.
Strengths and weaknesses of NGOs
Compared with formal sector agricultural research and extension institutions, NGOs
possess advantages in working together for rural development with small farmers in
marginal areas. They are able to respond quickly to local needs, work mainly with the
most disadvantaged groups, and are often more participatory than the formal sector.
They are independent, and can be flexible in their choice of project, information
sources, communication methods, clientele and organizational structure.
Furthermore, they can adopt an integrated approach to programmes, which includes
attention to the institutional and economic context, as well as to technical factors. In
142
&%1&%6% GROUNDNUT
this respect, NGOs play an important role as bridging organizations, bringing
together diverse agents in the development process.
Nonetheless, a number of problems are beginning to emerge. It is becoming clear
that the diverse demands placed on NGOs by different clients present almost
impossible managerial challenges. It is also unclear whether all NGOs have the time
and resources to develop the necessary technical capabilities and links with the
sources of innovation. Cooperation with other NGOs and with the formal sector is
often weak.
Conclusions
The evaluation of improved varieties of bambara groundnut, the dissemination of
local cultivars, and the promotion of released varieties can be done with the help of
NGOs, which provide an outlet through which the government and other sources of
innovation can sell their newly developed technologies. Conservation and utilization
of bambara groundnut can also be promoted through the collection of local varieties,
and the facilitation of an exchange programme of these materials between rural
communities, operating through the different NGOs working with them. It is
recommended that all the interested parties form a network, share innovations and
jointly develop a strategy for bambara groundnut. This will avoid duplication of
efforts, and ensure conservation, production and utilization of this protein-rich
legume.
GENETIC RESOURCES/BREEDING/PROMOTION
143
6IJIVIRGIW
Ahmad, M.H., A.R.J. Eaglesham, S. Hassouna, B. Seaman, A. Ayanaba, K. Mulongoy and E.L.
Pulver. 1981. Examining the potential for inoculant use with cowpeas in West African
soils. Trop. Agric. 58:325-335.
Akonaay, H.B. and V. Mazige. 1982. Grain Legumes and Oil Seeds. Ukiriguru: 50 Years of
Research. Tanzania Agricultural Research Organization, Ukiriguru Research Institute,
Mwanza, Tanzania.
Andrews, M.J., M. Sutherland, R.J. Thomas and J.I. Sprent. 1990. Distribution of nitrate
reductase activity in six legumes: the importance of the stem. New Phytol. 98:301-310.
Atkins, C.A., J.S. Pate, G.J. Griffiths and S.T. White. 1980. Economy of carbon and nitrogen in
nodulated and non-nodulated (NO3-grown) cowpea (Vigna unguiculata (L.) Walp.). Plant
Physiol. 66:978-983.
Begemann, F. 1986a. Bambara Groundnut: Background Information. International Institute of
Tropical Agriculture (IITA), Genetic Resources Unit, Ibadan, Nigeria. 17 pp.
Begemann, F. 1986b. Bambara Groundnut (Vigna subterranea, (L.) Verdc.): Pests and Diseases.
International Institute of Tropical Agriculture (IITA), Genetic Resources Unit, Ibadan,
Nigeria. 18 pp.
Begemann, F. 1988a. Ecogeographic Differentiation of Bambara Groundnut (Vigna subterranea)
in the Collection of the International Institute of Tropical Agriculture (IITA).
Wissenschaftlicher Fachverlag Dr Fleck, Niederkleen, Germany. 153 pp.
Begemann, F. 1988b. Bambara Erderbse (Vigna subterranea), Vernachlässigte Frucht mit großem
Potential für die kleinbäuerliche Landwirtschaft. Entwicklung und ländlicher Raum
2/88.
Begemann, F. 1990. Future research priorities of bambara groundnut improvement in Zambia.
Pp. 12-13 in Proc. First National Workshop on Bambara Groundnut Improvement in
Zambia, UNZA, 5 July 1990, Lusaka, Zambia.
Begemann, F. 1991. Diversity in underutilized plant species: field Crops. Pp. 38-47 in
Conserving the Plant Genetic Resources of Zambia, Proc. First National Workshop on
Plant Genetic Resources (I. Kalingile, S. W. Muliokela, G. P. Mwila and E. N. Nkhoma,
eds.), 8-12 October 1990, Siavonga, Zambia.
Billington, R.V. 1970. The effect of planting dates on disease incidence on legumes and its
effect on final yields. Ukiriguru Research Notes 44:5-7.
Bouriquet, G. 1946. The diseases of cultivated plants in Madagascar. Diseases of V. subterranea.
Encycl. Mycol. 12:352-359.
Brook, C.J. Bray, J. Cumberland, R. Clark, K. Shepherd, J. Watson and A. Whirtmarsh. 1977.
Field Crop, Horticultural and Pasture Recommendations for Swaziland: Njugo Beans
(Bambara Groundnuts, Tindlubu). Res. Div. UCS Faculty of Agriculture Advisory Bull.
1:74-75.
Brough, S.H., S.N. Azam-Ali and A.J. Taylor. 1993. The potential of bambara groundnut
(Vigna subterranea) in vegetable milk production and basic protein functionality
systems. Food Chem. 47:277-283.
Chaba, O. 1994. Intercropping studies in bambara groundnut. B.Sc (Agriculture) Special Project.
BCA/University of Botswana. 29 pp.
Cook, A.A. 1978. Bambara groundnut: Voandzeia subterranea. P. 15 in Diseases of tropical and
subtropical vegetables and other plants. Hafner Press, New York, USA.
Coudert, M.J. 1982. Niebe et voandzou; une perspective pour développement du commerce
régional en Afrique de l’ouest [Cowpea and bambara groundnut; prospects for regional
trade development in West Africa]. FAO microfiche XF 83322635. International Trade
Centre UNCTAD/GATT, Geneva, Switzerland, 125 pp.
Cromwell, E., F. Hansen and M. Turner. 1992. The Seed Sector in Developing Countries; a
Framework for Performance Analysis. Working Paper No. 65. Overseas Development
Institute, London.
CSO. 1994. Central Statistical Office, Causeway, Harare, Zimbabwe.
144
&%1&%6% GROUNDNUT
Dadson, R.B., C.B. Brooks and J.G. Wutoh. 1988. Evaluation of selected rhizobial strains grown
in association with bambara groundnut (Voandzeia subterranea (L.) Thouars.). Trop. Agric.
65(3):254-256.
Dakora, F.D., C.A. Atkins and J.S. Pate. 1992. Effect of NO3 on N2 fixation and nitrogenous
solutes of xylem in two nodulated West African geocarpic legumes, Kersting’s bean
(Macrotyloma geocarpum L.), and bambara groundnut (Vigna subterranea (L.)). Plant and
Soil 140:255-262.
Dalziel, J.M. 1937. Voandzeia Thou. Pp. 269-271 in The Useful Plants of West Tropical Africa.
Crown Agents, London.
Doku, E.V. 1967. Are there any alternatives to the traditional bush fallow system of maintaining
fertility? Ghana Farmer 11(1):27-30;38.
Doku, E.V. 1969a. Growth habit and pod production in Bambara groundnut (Voandzeia
subterranea ). Ghana J. Agric. Sci. 2: 91-95.
Doku, E.V. 1969b. Host specificity among five species in the cowpea cross-inoculation group.
Plant and Soil 30:126-128.
Doku, E.V. and S.K Karikari. 1970. Flowering and pod production of bambara groundnut
(Voandzeia subterranea Thou.) in Ghana. Ghana J. Agric. Sci. 3:17-26.
Doku, E.V. and S.K. Karikari. 1971a. Bambara groundnut. Econ. Bot. 25(3):225-262.
Doku, E.V. and S.K. Karikari. 1971b. Operational selection in wild bambara groundnuts.
Ghana J. Sci. 11(1):47-56.
Doku, E.V. and S.K. Karikari. 1971c. The role of ants in pollination and pod production of
bambara groundnut. Econ. Bot. 25(4):357-362.
Drabo, I. 1987. Rapport de synthèse 1985/1986 et 1986/1987 du projet légumineuses
alimentaires. Ouagadougou, Burkina Faso.
Du Petit-Thouars, L.M.A. 1806. Genera nova Madagascariensis, p. 23. Paris.
Duke, J.A., B.N. Okigbo, C.F. Reed and J.K.P. Werder. 1977. Voandzeia subterranea (L.) Thou.
Trop. Grain Legume Bull. 10:8-11.
Ebbels, D.L. and R.V. Billington. 1972. Fusarium wilt of Voandzeia subterranea in Tanzania. Trans.
Br. Mycol. Soc. 58(2):336-338.
Ehret, C. 1985. East African words and things: agricultural aspects of economic
transformation in the nineteenth century. Pp. 152-172 in Kenya in the Nineteenth
Century (A. O. Bethwell, ed.). Bookwise Ltd and Anyange Press Ltd, Kenya.
ENDA-ZW. 1994. Mission Statement. ENDA, Zimbabwe.
Ezueh, M.I. 1977. Cultivation and utilization of minor food legumes in Nigeria. Trop. Grain
Legume Bull. 10:28-32.
FAO. 1982. Legumes in human nutrition. FAO Food and Nutrition Paper No. 20. FAO, Rome.
Farrington, J. and S. Biggs. 1990. NGOs, agricultural technology and the rural poor. Food Policy
15(6):479-491.
Gibbons, M. 1994. Chemical composition of Botswana landraces of bambara groundnut. Special
Project Report, University of Nottingham, UK.
Goldsworthy, P.R. and R.G. Heathcote. 1963. Fertilizer trials with groundnuts in northern
Nigeria. Empire J. Expl. Agric. 31:351-366.
Goli, A.E. and N.Q. Ng. 1988. Bambara groundnut multi-location yield trial. Pp. 11-12 in
Annual Report, Genetic Resources Unit, IITA. 1987.
Goli, A.E., F. Begemann and N.Q. Ng. 1991. Germplasm diversity in bambara groundnut and
prospects for crop improvement. Pp. 195-202 in Crop Genetic Resources of Africa Vol.
2. (N.Q. Ng, P. Perrino, F. Attere and H. Zedan, eds.). IITA, IBPGR, UNEP, CNR.
Grant, P.M. 1988. Restoration of productivity of depleted sands. Rhod. J. Agric. Res. 67(5):134137.
Gueye, M. 1990. Effet de l’inoculation avec des souches de Rhizobium et de la fertilisation azotée
sur le rendement en grains du Voandzou (Vigna subterranea (L.) Thou.) au Sénégal. Pp.
34-38 in Maximiser la Fixation Biologique de l’Azote pour la Production Agricole et
Forestière en Afrique (M. Gueye, K. Mulongoy and Y. Dommergues, eds). Collection
Actes de l’ISRA, Vol. 2.
Gueye, M. and L.M. Bordeleau. 1988. Nitrogen fixation in bambara groundnut (Voandzeia
subterranea (L.) Thou.). MIRCEN J. 4:365-375.
GENETIC RESOURCES/BREEDING/PROMOTION
145
Guillemin, J.A., G.S. Perrottet and A. Richard. 1832. Florae Senegambiae Tentamen. Paris.
Haque, I. 1980. Present status of grain legume research in Swaziland 3. Jugo Beans. Trop. Grain
Legume Bull. 17/18:38-40.
Harper, J.E. and A.H. Gibson. 1984. Differential nodulation tolerance to nitrate among legume
species. Crop Sci. 24(4):797-801.
Hazekamp, T. 1995. IPGRI’s role in the standardization of plant genetic resources
documentation. Pp. 115-118 in Standardization in Plant Genetic Resources
Documentation. Report of the Second Technical Meeting of Focal Points for
Documentation in East European Genebanks (Th.J.L. van Hintum, M.W.M. Jongen and T.
Hazekamp, eds.). Centre for Genetic Resources (CGN), Wageningen, The Netherlands.
Hepper, F.N. 1963. The bambara groundnut (Voandzeia subterranea) and Kersting’s groundnut
(Kerstingiella geocarpa) wild in West Africa. Kew Bull. 16:395-407.
Hepper, F.N. 1970. Bambara groundnut (Voandzeia subterranea). Review article. Field Crop
Abstr. 23 (1):1-6.
Holm, J.M. and B.W. Marloth. 1940. The bambara groundnut or njugo bean. Farming in
South Africa 15:195-198; 200.
Howell, J.A. 1990. Variation and evolution of bambara groundnut (Vigna subterranea (L.)
Verdc.; Fabaceae). PhD Dissertation, Miami University, Oxford, Ohio, USA. 237 pp.
IBPGR, IITA and GTZ. 1987. Descriptors for Bambara Groundnut (F. Begemann and N.Q. Ng,
eds.). International Board for Plant Genetic Resources, Rome. 23 pp.
IITA. 1978. Bambara Groundnut (Voandzeia subterranea Thou. ex DC). Abstracts of World
Literature 1900-1978 (B.O. Adenaike, ed.). IITA, Ibadan, Nigeria. 55 pp.
Jacques-Félix, H. 1946. Remarques sur l’origine et la geocarpie du Voandzeia subterranea Thou.
Bull, Soc. Bot. France 93(9):260-362.
Jiménez Krause, D. 1995. Genetische Ressourcen im Internet. Pp. 49-53 in Das Deutsche
Agrarinformationsnetz (DAINET) Symposium, Juni 1995, Bonn (J.M. Pohlmann and C.U.
Koehler, eds.). Informationsmanagement in den Agrarwissenschaften 5, ZADI, Bonn,
Germany.
Johnson, D.T. 1968. The bambara groundnut: a review. Rhodesia Agric. J. 65:1-4.
Jones, M.M. 1971. The maintenance of soil organic matter under continuous cultivation at
Samaru, Nigeria. J. Agric. Sci. Camb. 24:42-53.
Kanayama, Y. and Y. Yamamoto. 1990. Inhibition of nitrogen fixation in soybean plants
supplied with nitrate III. Kinetics of the formation of nitrosylleghemoglobin and of the
inhibition of oxyleghemoglobin. Plant Cell Physiol. 31:603-608.
Karikari, S.K. 1969. Flowering, Pollination and Pod Formation in Bambara Groundnut
(Voandzeia subterranea Thou.) in Ghana. MSc Thesis, University of Ghana, Legon.
Karikari, S.K. 1971. Economic importance of bambara groundnut. World Crops 23(4):195-196.
Kebadumetse, G.B. 1994. Classification of Botswana landraces of bambara groundnut. Diploma
in Agriculture Special Project, BCA/University of Botswana, unpublished.
Kinyawa, P.L. 1969. Bambara groundnut: a well-balanced food. Ukiriguru Res. Notes 27.
Ministry of Agriculture, Ukiriguru, Mwanza, Tanzania.
Kiwallo, L. 1991. Inventaire des maladies cryptogamiques du voandzou (Vigna subterranea (L.)
Verdc.) au Burkina Faso. Mémoire de fin d’études en agronomie, Institut du
Développement Rural, Université de Ouagadougou, Burkina Faso. 54 pp.
Knüpffer, H. 1995. Central Crop Databases. Pp. 51-62 in Standardization in Plant Genetic
Resources Documentation. Report of the Second Technical Meeting of Focal Points for
Documentation in East European Genebanks (Th.J.L. Van Hintum, M.W.M. Jongen and
T. Hazekamp, eds.). Centre for Genetic Resources (CGN), Wageningen, The Netherlands.
Kumaga, F., S.K. Danso and F. Zapata. 1994. Time-course of nitrogen fixation in two bambara
groundnut (Vigna subterranea) cultivars. Biol. Fertil. Soils 18:231-236.
Letouzey, R. 1968. Etude phytogéographique du Cameroun. Editions Lechevalier, Paris.
Lewitt, T.D. 1990. Crop Water Use and the Root System of Bambara Nut (Vigna subterranea (L.)
Under Different Soil Moisture Regimes. BSc Thesis, University of Nottingham, UK.
Linnaeus, C. 1763. Species Plantarum, Vol. 2, 2nd ed. Impensis Laurentii Salvii, Stockholm.
Linnemann, A.R. 1987. Bambara groundnut (Vigna subterranea (L.) Verdc.): a review. Abstr. on
Tropical Agriculture 12(7).
146
&%1&%6% GROUNDNUT
Linnemann, A.R. 1988. Cultivation of bambara groundnut in northern Nigeria. Trop. Crops.
Comm. 15:1-14.
Linnemann, A. R. 1990. Cultivation of Bambara groundnut (Vigna subterranea (L.) Verdc.)) in
Western Province, Zambia. Report of a Field Study. Trop. Crops Commun.No. 16.
Wageningen Agricultural University.
Linnemann, A. R. 1992. Bambara groundnut (Vigna subterranea) literature: a revised and
updated bibliography. Trop. Crops Commun. 17. Dept. Tropical Crop Science,
Wageningen Agricultural University, The Netherlands. 124 pp.
Linnemann, A. R. 1994. Photothermal regulation of phenological development and growth in
bambara groundnut (Vigna subterranea (L.) Verdc.). PhD Thesis, Wageningen
Agricultural University, The Netherlands. 123 pp.
Linnemann, A.R. and S. Azam-Ali. 1993. Bambara groundnut (Vigna subterranea (L.) Verdc.) Pp.
13-58 in Underutilized Crops Series 2. Vegetables and Pulses (J.T. Williams, ed.).
Chapman & Hall, London. UK.
Mabika, V.C. 1991. The Influence of Temperature on Germination of Bambara Nut (Vigna
subterranea (L.). MSc Thesis, University of Nottingham, UK.
Mafongoya, P.L. 1988. Symbiotic nitrogen fixation of bambara groundnut (Vigna subterranea).
MSc Thesis, Dept. Biochemistry and Biological Sciences, Wye College, University of
London, UK. 3pp.
Marandu, W.Y.F. and W.H. Ntundu. 1995. The Status of Underutilized Crops in Tanzania. A
Country Report Presented to the Symposium on Genetic Resources and Utilization of
Indigenous Underutilized Crops in Southern and Eastern Africa, 22-23 August 1995,
Nelspruit, South Africa. (In press).
Marcgrav de Liebstad, G. 1648. Historiae Rerum Naturalium Brasiliae. Libri Octo. Jeticulu
seu Radix Mechoacan, Mandubi, Innominata 1(29):43-44.
Maréchal, R., J.M. Mascherpa, and F. Stainier. 1978. Etude taxonomique d’un groupe
complexe d’espèces des genres Phaseolus et Vigna (Papilionaceae) sur la base de
données morphologiques et polliniques, traitées par l’analyse informatique. Boissiera
28:177-178.
Martin, G.C. 1959. Plants attacked by root-knot nematodes in the Federation of Rhodesia and
Nyasaland. Rhod. Agric. J. 56:162-175.
Mazhani, L.M. and S. Appa-Rao. 1985. Groundnut, bambara groundnut and finger millet
germplasm collection in Botswana. Crops Res. Bull. No. 3. 6pp.
Mbewe, D.N. and F. Begemann. 1990. Recommendations for bambara groundnut improvement
in Zambia. P. 13 in Proc. First National Workshop on Bambara Groundnut Improvement
in Zambia, UNZA (F. Begemann, ed.), 5 July 1990, Lusaka, Zambia.
Minchin, F.R., M.I. Minguez, J.E. Sheehy, J.F. Witty and L.L. Scot. 1986. Relationships between
nitrate and oxygen supply in symbiotic nitrogen fixation by white clover. J. Exp. Bot.
37:1103-1113.
Ministry of Agriculture (MoA). 1947. Jugo Beans. Pp. 127-128 in Review of Crop Experiments;
Bechuanaland Protectorate. Dept. Agric. Res., Botswana.
Ministry of Agriculture (MoA). 1993. Agriculture Crop Statistics. Botswana Agric. Stats. Central
Statistics Office, MFDP, Gaborone, Botswana.
Ministry of Environment and Natural Resources. 1994. Kenya soil survey. P. 8 in Kenya
National Environment Action Plan (NEAP). Nairobi, Kenya.
Mittelholzer, A.S. 1969. Section 3, experiment 16: an evaluation of the yield of ten groundbean
(Voandzeia subterranea) selections. P. 3 in Annual Report on Grain Legume Research of the
Agricultural Research Council of Malawi, October 1968-September 1969.
Mudimu, G. and R.H. Bernsten. 1989. Household and National Food Security in Southern
Africa. UZ/MSU Food Security Research in Southern Africa Project, Dept. Agricultural
Economics and Extension, Univ. Zambia. 401 pp.
Mukurumbira, L.M. 1985. Effects of the rate of fertilizer nitrogen and previous grain legume
crop on maize yields. Zimbabwe Agric. J. 82(6):177-179.
Mulongoy, K. and A.E. Goli. 1990 Nodulation and growth of bambara groundnut (Vigna
subterranea) in three soils. Pp. 27-33 in Maximiser la Fixation Biologique de l’Azote pour la
GENETIC RESOURCES/BREEDING/PROMOTION
147
Production Agricole et Forestière en Afrique (M. Gueye, K. Mulongoy and Y.
Dommergues, eds.). Collection Actes de l’ITSRA, Vol 2.
Mundy, H.C. 1932. Twenty-one Years of Plant Introduction and Trial in Southern Rhodesia.
Rhod. Agric. J. 29:507.
Nape, B.N. 1995. Evaluation of three seeded metering mechanisms of the Sebele standard
planter for planting bambara groundnuts. Diploma in Agricultural Engineering Special
Project, BCA/University of Botswana. 20 pp.
National Academy of Sciences. 1979. Tropical Legumes: Resources for the Future. National
Academy of Sciences, Washington DC, USA.
Ng, N.Q., A.A. Osunmakinwa, F. Begemann and A.E. Goli. 1985. Germplasm
maintenance/preservation, characterization and documentation. GRU Annual Report,
International Institute of Tropical Agriculture (IITA), Genetic Resources Unit, Ibadan,
Nigeria. 11 pp.
Nishitani, T., K. Muraki and J. Inouye. 1988. Effects of daylength on flowering and fruiting in
bambara groundnut (Vigna subterranea (L.) Verdc.). Jpn. J. Trop. Agric. 32:80-4.
Nkumba, E.N. 1993. Genetic Attributes of Bambara Groundnuts. MSc Thesis, University of
Zambia, Lusaka, Zambia.
Nnadi, L.A., L. Singh and V. Balasubramanian. 1981. Effect of grain legumes and sorghum on
soil nitrogen status and the yield of subsequent maize crops. Samaru J. Agric. Res.
1:183-90.
Nyamudedza, P. 1989. Crop Water Use and the Root System of Bambara Nut (Vigna subterranea
(L.)) and Groundnut (Arachis hypogaea (L.)). MSc Thesis, University of Nottingham, UK.
Obizoba, I.C. 1983. Nutritive value of cowpea-bambara groundnut-rice mixtures in adult
rats. Nutr. Rep. Int. 27:709-12.
ODI. 1988. NGOs in Development. ODI Briefing Paper. Overseas Development Institute,
London.
Oghoghorie, C.G.O. and J.S. Pate. 1971. The nitrate stress syndrome of the nodulated pea (Pisum
arvense (L.)). Techniques for measurement and evaluation in physiological terms. Pp. 185202 in Proc. Tech. Mtg. on Biological Nitrogen Fixation Programme (T.A. Lie and E.G.
Mulder, eds.). Plant and Soil (Special Volume).
Oliveira, J.S. 1976. Grain legumes of Mozambique. Trop. Grain Legume Bull. 3:13-15.
Oluyemi, J.A., B.L. Fetuga and H.N.L. Endeley. 1976. The metabolizable energy value of
some feed ingredients for young chicks. Poultry Sci. 55:611-618.
Owonubi, J.J. and J.Y. Yayock. 1987. Climatic limitations to crop production in the savanna
regions of Nigeria. Paper presented at the National Seminar on the Green Revolution in
Nigeria, Ahmadu Bello University, Zaria, Nigeria, 21 September, 1990.
Owusu-Domfeh, K., D.A. Christensen and B.D. Owen. 1970. Nutritive value of some Ghanian
feed-stuffs. Can. J. Anim. Sci. 50:1-14.
Pasquet, R.S. and M. Fotso. 1991. Les légumineuses alimentaires du Cameroun, premiers
résultats. Pp. 317-360 in Du politique à l’économique, études historiques dans le bassin
du lac Tchad (J. Boutrais, ed.). ORSTOM, Paris.
Pasquet, R.S. and M. Fotso. 1994. Répartition des cultivars de niébé (Vigna unguiculata (L.)
Walp.) du Cameroun: influence du milieu et des facteurs humains. J. Agric. Trad. Bot.
Appl. 36(2):93-143.
Pate, J.S. and C.A. Atkins. 1983. Nitrogen uptake, transport and utilization. Pp. 245-298 in
Nitrogen Fixation. Volume 3. Legumes (W.J. Broughton, ed.). Oxford Univ. Press, New
York.
Perry, D.A. 1981. Methodology and Application of Vigour Tests. Pp. 8-10 in Handbook of
Vigour Test Methods (D.A. Perry, ed.). International Seed Testing Association, Zurich.
Platt, B.S. 1965. Tables of representative values of foods commonly used in tropical countries.
Medical Research Council Special Report Series No. 302. HMSO, London, UK.
Poulter, N.H. and J.C. Caygill. 1980. Vegetable milk processing and rehydration characteristics
of bambara groundnut (Voandzeia subterranea (L.) Thou.) J. Sci. Food Agric. 31(11):11581163.
Purseglove, J.W. 1968. Tropical Crops.Dicotyledons. Longman, London, UK.
148
&%1&%6% GROUNDNUT
Rachie, K.O. and L.M. Roberts. 1974. Grain legumes of the lowland tropics. Advances in
Agronomy 26:355.
Rachie, K.O. and P. Silvestre. 1977. Grain legumes. Pp. 41-74 in Food crops of the lowland
tropics (C.L. Leakey and J.B. Wills, eds.). Oxford University Press, London.
Rassel, A. 1960. Le voandzou Voandzeia subterranea Thou. et sa culture au Kwango. Bull.
agric. du Congo Belge et du Ruanda-Urundi 51:1-26.
Rigaud, J. and A. Puppo. 1977. Effect of nitrite upon leghemoglobin and interaction with
nitrogen fixation. Biochim. Biophys. Acta 497:702-706.
SADCC. 1984. Food Security Newsletter, Third Quarter.
Samasegaram, P., R.C. Abaidoo and F. Kumaga. 1993. Host-Bradyrhizobium relationships and
nitrogen fixation in the bambara groundnut (Voandzeia subterranea). Trop. Agric. (Trin.)
67: 137-142.
Sands, W. N. 1931. The bambara groundnut in Kedah. Malayan Agric. J. 19(7):339-40.
Sérémé, P. 1989. Seed-borne pathogens of bambara groundnut (Vigna subterranea (L.) Verdc.) in
Burkina Faso and their significance. A report of research conducted from SeptemberDecember, 1982 at the Danish Government Institute of Seed Pathology for Developing
Countries, Copenhagen, Denmark. 49 pp.
Sérémé, P. 1992. Les contraintes pathologiques à l’amélioration de la culture du voandzou au
Burkina Faso: cas des maladies transmises par les semences. Pp. 320-324 in Proc. Lutte
intégrée contre les ennemis des cultures dans le Sahel. Deuxième séminaire sur la lutte
intégrée contre les ennemis des cultures vivrières dans le Sahel (John Libbey, ed.),
Bamako, Mali, 4-9 Janvier 1990. Institut du Sahel (INSAH) Séminaires Colloques 1.
Sérémé, P. 1993. Rapport d’avancement du projet FIS sur "L’Amélioration de la culture du
voandzou au Burkina Faso par la lutte contre ses principaux pathogènes". 8 pp.
Sérémé, P., L. Kiwallo and E. Zida. 1991. Amélioration de la culture du vouandzou (Vigna
subterranea (L.) Verdc.) au Burkina Faso par la lutte contre les principaux pathogènes.
Seminaire International sur l’influence du climat sur les productions des cultures
tropicales, organizé par la FIS e le CTA à Ouagadougou, Burkina Faso, 23-28 September
1991.
Sibuga, K.P., A.F. Lana, A.J. Tarimo and H. Temu. 1994. Evaluating Potential for Bambara
Groundnut as a Food Crop in Semi-Arid Africa. An Approach for Assessing the Yield
Potential and Ecological Requirements of an Underutilized Crop. Report 2. Sokoine
University of Agriculture, Morogoro, Tanzania.
Smartt, J. 1959. Some factors limiting the production of edible legumes in Northern Rhodesia. P.
13 in Proc. 4th Annual Conference of Professional Officers, DR & SS. Govt. Printer,
Salisbury.
Smartt, J. 1981. Gene pools in Phaseolus and Vigna cultigens. Euphytica 30(2):445-449.
Smartt, J. 1985. Evolution of grain legumes. III. Pulses in the genus Vigna. Exp. Agric. 21:87100.
Smyth, K.J.F. 1968. Bambara Groundnut or ‘Njugu Mawe’ (Voandzeia subterranea). Ukiriguru
Res. Notes 12. Ministry of Agriculture, Ukirigiru, Mwanza, Tanzania.
Somasegaran, P., R.C. Abaidao and F. Kumaga. 1990. Host-Bradyrhizobium relationships and
nitrogen fixation in the bambara groundnut (Voandzeia subterranea (L.) Thou.). Trop.
Agric. 67:137-142.
Sreeramula, N. 1983. Germination and food reserves in bambara nut seeds (Voandzeia
subterranea (L.) Thou.) after different periods of storage. Ann. Bot. 34(138):27-33.
Stanton, W.R., J. Doughty, R. Orraca-Tetteh and W. Steele. 1966. Voandzeia subterranea
(Thouars). Pp. 128-133 in Grain Legumes in Africa. FAO, Rome.
Tanimu, B.S., G. Ado and L. Aliyu. 1990. Genotypic variability in Bambara groundnut cultivars
at Samaru. Pp. 54-66 in Proc. 17th Annual Conference of the Genetic Society of Nigeria
(I.O. Obigbesban, ed.), Institute for Agricultural Research and Training, Obafemi
Awolowo University, Nigeria, 11-16 March, 1990.
Thompson, E.J. and E.A. Dennis. 1977. Studies on nodulation and nitrogen fixation by selected
legumes. Pp 85-102 in Proc. Joint University of Ghana Council for Scientific and
Industrial Research Symposium on Grain Legumes in Ghana. Crop Science Department,
University of Ghana, Legion, Ghana.
GENETIC RESOURCES/BREEDING/PROMOTION
149
Verdcourt, B. 1978. The demise of two geocarpic legume genera. Taxon 27:219-222.
Verdcourt, B. 1980. The correct name for the bambara groundnut. Kew Bull. 35(3):474.
Vessey, J.K., K.B. Walsh and D.B. Layzell. 1988a. Oxygen limitation of nitrogen fixation in
nodules of stem-girdled or nitrate-treated soybean. Plant Physiol. 73:113-121.
Vessey, J.K., K.B. Walsh and D.B. Layzell. 1988b. Can a limitation in phloem supply to nodules
account for the inhibitory effect of nitrate on nitrogenase activity in soybeans? Physiol.
Plantarum 74:136-146.
Vincent, V. and R.G. Thomas. 1961. An Agricultural Survey of Southern Rhodesia. Part 1: Agroecological Survey. Government Printer, Salisbury.
von Rudloff. 1993. A survey of bambara groundnut cultivation in Botswana. Diploma in
Agriculture Special Project. BCA/University of Botswana. 18 pp.
Walsh, K.B., M.J. Canny and D.B. Layzell. 1989. Vascular transport and soybean nodule
function: II. A role for phloem supply in product export. Plant Cell Environ. 12:713-723.
Wasfi, M. and J.L. Prioul. 1986. A comparison of inhibition of French bean and soybean nitrogen
fixation by nitrate, 1% oxygen or direct assimilate deprivation. Physiol. Plant. 66:481-490.
Zulu, E.D. 1989. Germination and Establishment of Bambara Groundnut (Vigna subterranea (L.)
Verdc.) in Response to Temperature, Sowing Depth and Seed Size. MSc Thesis.
University of Nottingham, UK.
150
&%1&%6% GROUNDNUT
6IGSQQIRHEXMSRWSJ;SVOMRK+VSYTW
Recommendations of the workshop were made through group discussions, and
were presented in a plenary session.
%KVSRSQ]IGSTL]WMSPSK]
4VIEQFPI
The following areas deserve more attention for future research on bambara
groundnut:
• collection of indigenous knowledge on production practices
• on-farm testing
• economic analysis of production packages
• gender issues.
4VMSVMX]EVIEWJSVVIWIEVGL
Research should be targeted on the following priority areas:
1.2.1 Cropping systems
• sole cropping
• multiple cropping
• intercropping
• relay cropping
• mixed cropping
• rotation cropping
• water conservation.
1.2.2 Cultivar characterization and evaluation
• identification of early, medium and late maturing cultivars
• growth habit
• population (spacing)
• maturity determination
• photosensitivity.
1.2.3 Nutritional requirements
• cultivar x strain association
• critical nutrient levels.
1.2.4 Earthing-up
• reasons for earthing-up
• method
• timing.
1.2.5 Crop loss assessment and IPM
• cultural
• biological
• chemical.
GENETIC RESOURCES/BREEDING/PROMOTION
151
1.2.6 Crop management
• weeding
• planting period
• planting method
• harvesting period.
'SRWIVZEXMSRERHFVIIHMRK
'SPPIGXMSRW
•
•
•
•
•
National Programmes (NP) to make an inventory of their collections.
NP to liaise with IITA to fill gaps.
NP to identify national gaps and fill gaps.
IITA to become the world base collection with a safety-duplicate at a
German genebank for that material which is not duplicated under longterm conditions at suitable Regional genebanks.
ORSTOM to be contacted, to send a duplicate to IITA’s world base
collection.
'SRWIVZEXMSR
•
•
•
accessions to be separated according to different seed patterns/colours
ex situ conservation should be done according to international standards
(i.e. IPGRI), as is hoped will be ensured by the NP
on-farm conservation: NP to be encouraged to make use of on-farm
conservation as appropriate.
'LEVEGXIVM^EXMSR
2.3.1 Revision of the descriptor list
• establishment of a ‘Committee to revise the descriptor list’
• above Committee to draft a revised descriptor list, by consulting experts
as appropriate
• list be finalized and sent to IPGRI
• publication.
2.3.2 NP to follow the standard descriptor list
2.3.3 Characterization to be completed for all national collections
)ZEPYEXMSR
•
•
•
For further efficient use of the accessions, it is recommended that the
National Agricultural Research Systems (NARS) evaluate the collections,
according to the guidelines (provided in the descriptor lists), as appropriate
in the specific country.
NPs are encouraged to exchange germplasm, in light of the evaluation done
other countries.
The use of new techniques, e.g. molecular: RAPDs are encouraged to be
included in evaluation.
(SGYQIRXEXMSRERHMRJSVQEXMSR
•
NPs should collect all information within their country
&%1&%6% GROUNDNUT
152
•
•
•
NPs to share this information with the International Bambara Groundnut
Database (IBGDB)
The IBGDB to be disseminated to the NP (to all users, in particular), by
making use of all available means, i.e. diskettes, Internet, etc.
In the initial stages, it is recommended that the IBGDB be located, updated
and disseminated at the Centre for Agricultural Documentation and
Information (ZADI), Bonn, Germany.
4VIFVIIHMRKERHFVIIHMRK
•
•
•
•
Genetic studies are to be encouraged, to understand the genetic basis of
important characters.
Crossing techniques are to be developed.
NPs to be encouraged to initiate comprehensive breeding programmes.
Participatory breeding approach, i.e. within the FSR context, to be
encouraged.
7IIHWYTTP]
•
NARS are encouraged to ensure sufficient seed supply.
4VSQSXMSRSJYWIQEVOIXMRKERHTVSGIWWMRK
Strategies for promotion of use, marketing and processing include:
4VSQSXMRKTVSHYGXMSR
The following problems limit the present production:
• lack of high-yielding varieties
• lack of bambara groundnut seed.
Suggested solutions:
Short term
• availability of seed to farmers through multiplication of the available
landraces
• extension to consent farmers to set aside portions of their arable area to
bambara groundnut seed.
Long term
• improve the available landraces
• breeders to breed for high yields.
(MWXVMFYXMSRSJWIIH
•
•
•
NGOs, other organizations and extension services to assist in distributing
seed
farmer-to-farmer exchange programmes will be the best solution
countries to identify the optimum strategies for their situation.
8VEMRMRK
•
•
•
training of trainers
use of the media (radio, programmes, pamphlets, TV)
inclusion of agronomic information in extension handbooks.
GENETIC RESOURCES/BREEDING/PROMOTION
153
9XMPM^EXMSR
•
•
•
•
•
•
•
identify uses
compile recipe books in various countries
establish a newsletter on bambara groundnut
involve a food technologist to assess digestibility problems
breeders to include cooking quality in their breeding programmes
use as a forage or a cover crop
use in the food industry, e.g. canning, flour making, and other appropriate
technologies be developed.
1EVOIXMRK
•
•
•
urban centres (both formal and informal markets)
rural centres (to local farmers, middlemen from urban centres in local shops)
marketed as grain (both fresh and dry), finished products.
4VSGIWWMRK
•
•
shelling problem (sheller developed in South Africa being investigated)
mechanical harvesting.
;E]JSV[EVH
•
•
find out prices of bambara groundnut in all levels of marketing and the
margin for each country.
market survey, both regional and international.
154
&%1&%6% GROUNDNUT
)WXEFPMWLQIRX SJ XLI -RXIVREXMSREP &EQFEVE +VSYRHRYX
2IX[SVO-&+2ERHTPERRIHEGXMZMXMIW
Participants unanimously agreed to establish the IBGN, and a Technical Advisory
Committee (TAC) was created to guide it. The following persons were elected
members of the TAC for the first phase:
F. Dakora
Agronomy
M. Mwala
Germplasm conservation and management
E. Doku
Breeding
J. Mulila-Mitti
Sociology
F. Begemann
Information and documentation
D. Shumba
Utilization and processing
IPGRI
Standing invitation.
Dr. F. Begemann was elected as coordinator of the TAC.
If funds allow, the TAC should meet annually; otherwise, biennially. Members
of TAC should attend the meeting of the EC bambara groundnut project, scheduled
for 23–25 July 1996, in Nottingham, UK.
%GXMZMXMIWSJXLI-RXIVREXMSREP&EQFEVE+VSYRHRYX2IX[SVO-&+2
The following concrete activities will be pursued by the IBGN.
-RJSVQEXMSRJVSQSXLIVGSYRXVMIW
Country status reports, to be requested from countries which were not present at
the Harare meeting.
4VITEVEXMSRSJEPMWXSJI\TIVXW
Letters (questionnaires) will be send to experts, to identify their area of expertise
and the projects they are working on, in order to prepare a directory of bambara
groundnut experts.
-RXIVREXMSREP&EQFEVE+VSYRHRYX(EXEFEWI
Passport data of collections should be sent to F. Begemann, for incorporation in the
International Bambara Groundnut Database (IBGDB). The IBGDB is available upon
request on diskettes or online on Internet at the following web site:
http://www.dainet.de/genres/bambara/bambara.htm. Participants should send
references (especially the so-called ‘grey literature’, e.g. diploma theses from their
institutes) to F. Begemann, to update the two bambara groundnut bibliographies
published by IITA in 1978, and by the Department of Tropical Crop Science
Wageningen Agricultural University (compiled by A. Linnemann), in 1992.
'SPPIGXMSRW
Participants should check their collections with IITA’s collection, and ask IITA to
repatriate the material not available in the national collections, to build up national
collections. On the other hand, national collections should be duplicated at IITA.
6IZMWMSRSJFEQFEVEKVSYRHRYXHIWGVMTXSVW
GENETIC RESOURCES/BREEDING/PROMOTION
155
There is a need to revise the ‘Bambara groundnut descriptors’, published in 1987.
An ad hoc ‘Committee to revise the descriptor list’ was formed, consisting of
F. Begemann, E. Doku, N. Ng (to be invited) and C. Swanevelder, which is to
produce a first draft.
2I[WPIXXIV
A bambara groundnut newsletter will be published once per year. The first issue
will be produced by IPGRI, as soon as possible.
4YFPMGE[EVIRIWW
To create public awareness on bambara groundnut, announcements of the
establishment of the IBGN will be published in IPGRI’s SSA Newsletter, and in
Spore and Monitor, etc.
*YRHVEMWMRK
Preparation of projects and/or assistance for institutions to draft project proposals.
156
&%1&%6% GROUNDNUT
%TTIRHM\%;SVOWLST4VSKVEQQI
8YIWHE]2SZIQFIV
08:30 - 09:20
Opening session
Opening address
Introduction
Workshop organization
(Mungate)
(Goli)
(Heller)
09:20 - 09:40
09:40 - 10:00
10:00 - 10:30
Country presentations (Session 1)
Burkina Faso
(Drabo, Sérémé and Dabire)
Botswana
(Karikari, presented by Collinson)
Coffee break
10:30 - 10:50
10:50 - 11:10
11:10 - 11:30
11:30 - 11:50
11:50 - 12:10
12:10 - 12:30
12:30 - 14:00
Country presentations (Session 2)
Cameroon
Ghana
Kenya
Mali
South Africa
Tanzania
Lunch
14:00 - 14:20
14:20 - 14:40
14:40 - 15:00
15:00 - 15:20
15:20 - 15:40
15:40 - 16:10
16:10 - 18:00
Country presentations (Session 3)
Togo
(Nambou)
Zambia
(Mbewe, Mwala and Mwila)
Zimbabwe
(Mabika and Mafongoya)
Discussion
Summary of country presentations
(Mulila-Mitti)
Coffee break
Visit DR & SS campus and presentation of research activities
(Nguy-Ntamag)
(Doku)
(Ngugi)
(Kodio)
(Swanevelder)
(Ntundu)
;IHRIWHE]2SZIQFIV
08:30 - 08:50
08:50 - 09:10
09:10 - 09:30
09:30 - 09:50
09:50 - 10:10
10:10 - 10:40
Agronomy (Session 4)
Agronomical research on bambara groundnut at
the Agronomy Institute
(Mabika)
Nitrogen fixation and nitrogen nutrition in symbiotic
bambara groundnut (Vigna subterranea (L.) Verdc.)
and Kersting’s bean (Macrotyloma geocarpum
(Harms) Maréch. et Baud.)
(Dakora and Muofhe)
Pests and diseases of bambara groundnut
(Gwekwerere)
Evaluating the potential for bambara groundnut
as a food crop in semi-arid Africa: an approach for
assessing the yield potential and ecological
requirements of an underutilized crop
(Collinson)
Toward increased food legume production
(Mulila-Mitti)
Coffee break
Genetic resources/breeding/promotion (Session 5)
GENETIC RESOURCES/BREEDING/PROMOTION
10:40 - 11:00
157
12:40 - 14:00
Preliminary studies on the germinability and
vigour of Zimbabwean bambara groundnut
(Vigna subterranea) genotypes
(Zengeni and Mupamba)
Characterization/evaluation of IITA’s bambara
groundnut collection
(Goli, Begemann and Ng)
Development of The International Bambara
Groundnut Database
(Begemann)
The potential role of NGOs in promoting conservation
and use of bambara groundnut (Vigna subterranea)
(Shumba)
Breeding bambara groundnut suitable for Zimbabwean
conditions
(Madamba)
Overview of bambara nut production and research by
the Farming Systems Research Unit: a case study
of Chivi Communal area in Zimbabwe
(Chibudu)
Lunch
14:00 - 14:10
14:10 - 16:00
16:00 - 16:30
16:30 - 18:30
Working groups
Introduction to working group sessions
Working group 1 (Agronomy/ecophysiology)
Coffee break
Working group 2 (Conservation and breeding)
11:00 - 11:20
11:20 - 11:40
11:40 - 12:00
12:00 - 12:20
12:20 - 12:40
(Heller)
8LYVWHE]2SZIQFIV
08:30 - 10:00
10:00 - 10:30
10:30 - 12:30
12:30 - 13:30
Working groups (cont.)
Working group 3 (Promotion of use, marketing, processing)
Coffee break
Network discussion
Lunch
158
&%1&%6% GROUNDNUT
%TTIRHM\&0MWXSJ4EVXMGMTERXW
Dr F. Begemann
Centre for Agricultural
Documentation and Information
(ZADI)
Information Centre for Genetic
Resources (IGR)
Villichgasse 17
53177 Bonn
GERMANY
Tel: +49-228-9548-212
Fax: +49-228-9548-149
email: [email protected]
Ms Chinaniso Chibudu
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Dr Sarah Collinson
Tropical Crops Research Unit
Dept. Agriculture and Horticulture
Univ. Nottingham
Sutton Bonington Campus
Loughborough LE12 5RD
UK
Tel: +44-(0115)-9516081
Fax: +44-(0115)-9516060
email: sarah.collinson@
nottingham.ac.uk
Dr Felix D. Dakora
Botany Dept.
Univ. Cape Town
P/B Rondebosch 7700
Cape Town
SOUTH AFRICA
Tel: +27-21-650-2964
Fax: +27-21-650-3726/3918
email: [email protected]
Prof. Emmanuel V. Doku
Dept. Crop Science
Univ. Ghana
PO Box 25
Legon, Accra
GHANA
email: [email protected]
Dr Issa Drabo
INERA - Kamboinse
BP 476
Ouagadougou
BURKINA FASO
Fax: +226-340271/319206
Dr Ankon E. Goli
IPGRI Coordinator - West Africa
c/o IITA/Benin Research Station
BP 08-0932
Cotonou
REPUBLIQUE DU BENIN
Tel: +229-350553/350189/360600
Fax: +229-350556
email: [email protected]
Ms Yovita Gwekwerere
Univ. Zimbabwe
Dept. Science and Maths Education
PO Box MP 167
Mt. Pleasant
Harare
ZIMBABWE
Tel: +263-4-303211
Fax: +263-4-333407/335249
Dr Joachim Heller
Visiting Scientist - Neglected Crops
IPGRI
Via delle Sette Chiese 142
00145 Rome
ITALY
Tel: +39-6-51892226
Fax: +39-6-5750309
email: [email protected]
GENETIC RESOURCES/BREEDING/PROMOTION
Mr Victor Mabika
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Ms Rosalia Madamba
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Dr Paramu Mafongoya
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Dr Irvine Mariga
Univ. Zimbabwe
Dept. Crop Science
PO Box MP 167
Mt. Pleasant, Harare
ZIMBABWE
Tel: +263-4-303211
Fax: +263-4-333407
Dr Antony Mashiringwani
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Mr Linus Mukurumbira
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
159
Dr Joyce Mulila-Mitti
Integrated Crop Management/Food
Legume Project
PO Box 30563
Lusaka
ZAMBIA
Tel: +260-1-225522/227803/4
Fax: +260-1-225879/221426/254173
Email: [email protected]
Ms Juliet Mupamba
National Tested Seeds
Bentley House
Cnr Wynne St/Forbes Ave
Harare
ZIMBABWE
Tel: +263-4-796411
Fax: +263-4-706148
Dr Joseph Mushonga
Dept. Research and Specialist Services
PO Box CY 550
Causeway, Harare
ZIMBABWE
Tel: +263-4-704531
Fax: +263-4-728317
Dr Mick S. Mwala
Crop Science Dept.
School of Agric. Sci.
Univ. Zambia
PO Box 32379
Lusaka
ZAMBIA
Tel: +260-1-213221
Fax: +260-1-250587/222875/292681
Mr Bitignime Nambou
INCV
BP 2318
Lomé
TOGO
Fax: +228-218792
160
&%1&%6% GROUNDNUT
Mr Ortwin Neuendorf
Project Promotion of Small Scale Seed
Production by Self Help Groups
SADC/GTZ
PO Box 4046
Harare
ZIMBABWE
Fax: +263-4-795345
email: [email protected]
Ms Grace Wambui Ngugi
National Museums of Kenya
PO Box 40658
Nairobi
KENYA
Tel: +254-2-743513
Fax: +254-2-741424
email: [email protected]
Ms Françoise C. Nguy-Ntamag
Univ. Dschang
Faculty of Agronomy
Crop Science Dept.
Box 222
Dschang
CAMEROON
Tel: +237-451032
Fax: +237-451202
Mr Phibion Nyamudedza
Dept. Research and Specialist Services
Save Valley Experimental Station
Private Bag 2037
Chipinge
ZIMBABWE
Tel: +263-27-239129
Fax: +263-4-728317
Mr Ishmael Pompi
Agricultural Extension Service
(Agritex)
Box CY 639
Harare
ZIMBABWE
Tel: +263-4-794601/6, 794701, 707311
Fax: +263-4-730525
Mr Zondai Shamudzarira
Dept. Agriculture and Horticulture
Univ. Nottingham
Sutton Bonington Campus
Loughborough LE12 5RD
UK
Fax: +44-(0115)-9516060
email: [email protected]
Ms Doreen Shumba
ENDA - Zimbabwe
Box 3492
Harare
ZIMBABWE
Tel: +263-4-301162
Fax: +263-4-301156
email: [email protected]
Dr Carel J. Swanevelder
Agricultural Research Council
Oil and Protein Seed Centre
Private Bag X1251
Potchefstroom 2520
SOUTH AFRICA
Tel: +27-148-2996333
Fax: +27-148-297-6572
Email: [email protected]
Mr Simba Zengeni
National Tested Seeds
Bentley House
Cnr Wynne St/Forbes Ave
Harare
ZIMBABWE
Tel: +263-4-796411
Fax: +263-4-706148
GENETIC RESOURCES/BREEDING/PROMOTION
Unable to attend:
Mr Mounkaila Adamou
INRAN
BP 429 Niamey
NIGER
Fax: +227-722144
Dr Murthi Anishetty
FAO
Viale delle Terme di Caracalla
00100 Rome
ITALY
Tel: +39-6-522-54652
Fax: +39-6-52253152
Dr Sayed Azam-Ali
Tropical Crops Research Unit
Dept. Agriculture and Horticulture
Univ. Nottingham
Sutton Bonington Campus
Loughborough LE12 5RD
UK
Tel: +44-(0115)-9516049
Fax: +44-(0115)-9516060
email: [email protected]
Dr A. Darthenucq
DG XII
European Union Commission
Rue de la Loi 200
1049 Brussels
BELGIUM
Fax: +32-2-29-66252
email: [email protected]
Prof. F.O.C. Ezedinma
FAMALL (Agriculture & Renewable
Resources Systems)
PLOT X, OLD. G.R.A.
PO Box 586
Nsukka
NIGERIA
Tel: +2342-42771659
161
Dr Nazmul Haq
International Centre for Underutilized
Crops (ICUC)
c/o Inst. Irrigation and Development
Studies
Univ. Southampton
Bassett Crescent East
Southampton SO16 7PX
UK
Tel: +44-1703-594229
Fax: +44-1703-677519
email: [email protected]
Prof. S. K. Karikari
Dept. Crop Science and Production
Botswana College of Agriculture
Private Bag 0027
Gaborone
BOTSWANA
Tel: +267-352381
Fax: +267-314253
Ms Ondie Kodio
Institut d’Economie Rurale/Kayes
BP 258
Bamako
MALI
Tel: +223-23-1905
Fax: +223-22-3775
Dr Anita Linnemann
Dept. Food Science
Laboratory of Dairying and Food
Physics
PO Box 8129
6700 EV Wageningen
THE NETHERLANDS
Dr David N. Mbewe
Crop Science Dept.
School of Agricultural Science
Univ. Zambia
PO Box 32379
Lusaka
ZAMBIA
Tel: +260-1-213221
Fax: +260-1-250587/222875/292681
162
&%1&%6% GROUNDNUT
B.J. Ndunguru
Southern African Centre for Cooperation in Agricultural & Natural
Resources (SACCAR)
Private Bag 00108
Gaborone
BOTSWANA
Tel: +267-328847/328848/328758
Fax: +267-328806
email: 100075,[email protected]
Dr N.Q. Ng
IITA
PMB 5320
Ibadan
NIGERIA
email: IITA@cgnetcom/
[email protected]
Mr Wazael Hillary Ntundu
National Plant Genetic Resources
Centre
Tropical Pesticides Research Inst.
PO Box 3024
Arusha
TANZANIA
Tel: +255-57-8813-15
Fax: +255-57-8217/8242
email: [email protected]
Dr Rémy Pasquet
ORSTOM and
Dept. Agronomy and Range Science
Univ. California
Davis CA 95616-8515
USA
Fax: +1-9167524361
email: [email protected]
Mr Balarabe Tanimu
Dept. Agronomy
Ahmadou Bello University
PMB 1044
Zaria
NIGERIA
Tel: +2342-69-50571-4 PBX (32581/5)
GENETIC RESOURCES/BREEDING/PROMOTION
163
%TTIRHM\'&EQFEVE+VSYRHRYX6IWIEVGL
7GMIRXMWXWERHXLIMV%JJMPMEXMSRW
Ir. Martin Brink
Dept. Tropical Crop Science
Wageningen Agricultural Univ.
Haarweg 333
Wageningen
THE NETHERLANDS
(responsible for the input of Wageningen
in the EU project)
Tel: +31-8370-83072
Fax: +31-8370-84575
Prof. A. Femi Lana
Dept. Crop Science and Production
Sokoine Univ. Agriculture
PO Box 3005
Morogoro
TANZANIA
Fax: +255-563599/564988
Tel: +255-563661/564079
Ms Erica van den Heever/
Ms Sonja Venter
Vegetable and Ornamental Plant Inst.
Agricultural Research Council
Private Bag X293
Pretoria 0001
SOUTH AFRICA
(Small farm project where bambara is one
of the crops being evaluated in the
“vegetable garden” context. Also
participates in Swanevelder’s cultivar
evaluation programme.)
Dr James A. Howell
Dept. Biological Sciences
Allegany Community College
Cumberland, MD 21502
USA
Mr Kennedy Kanenga
Msekera Research Station
PO Box 510089
Chipata
ZAMBIA
Tel: +260-62-21275/21153
Fax: +260-62-21275
KENGO
Kenya Energy and Environment
Organizations
Mwanzi Road Westlands
PO Box 48197
Nairobi
KENYA
Tel: +254-2-749747/748281
Mr C. Mathews
Dept. Agriculture
PO Box 727
White River 1240
SOUTH AFRICA
Tel: +27-1311-33287
Fax: +27-1311-33287
Dr Sérémé Paco
Director
INERA
BP 476
Ouagadougou
BURKINA FASO
Fax: +226-340271/319206
Mr G.O. Rachier
Kakamega Regional Research Centre,
KARI
PO Box 169
Kakamega
KENYA
Tel: +254-331-30031
Fax: +254-331-20893
Dr A. Sesay
Dept. Agriculture and Horticulture
Univ. Nottingham
Sutton Bonington Campus
Loughborough, LE12 5RD
UK
Tel: +44 (0)115 951 6080
Fax: +44-(0115)-9516060
164
&%1&%6% GROUNDNUT
Dr K.P. Sibuga
Dept. Crop Science and Production
Sokoine Univ. Agriculture
PO Box 3005
Morogoro
TANZANIA
Fax: +255-563599/564988
Tel: +255-563661/564079
Mr Mem Temu
Dept. Crop Science and Production
Sokoine Univ. Agriculture
PO Box 3005
Morogoro
TANZANIA
Fax: +255-563599/564988
GENETIC RESOURCES/BREEDING/PROMOTION
%TTIRHM\(-RWXMXYXMSRW1EMRXEMRMRK'SPPIGXMSRW
BENIN
Station de Recherche sur les Cultures
Vivrières d’INA
Bemebereke
BP 03
N’Dali
BOTSWANA
Botswana College of Agriculture
Faculty of Agriculture
University of Botswana
Private Bag 0027
Gaborone
Dept. Agricultural Research
Ministry of Agriculture
Private Bag 0033
Gaborone
Genetic Resources Office
Sebele Agricultural Research Station
Private Bag 0033
Gaborone
FRANCE
Genetic Resources and Biotechnolgy
for Plant Breeding (ORSTOM)
BP 5045
911 Av. d’Agropolis
34032 Montpellier
Tel: +33-67617400
Fax: +33-67547800
GHANA
Crops Research Inst.
Plant Genetic Resources Unit (PGRC)
(Officer-in-Charge: Dr S.O. BennetLartey)
PO Box 7
Bunso
Dept. Crop Science
Univ. Ghana
PO Box 44
Legon, Accra
Savanna Agricultural Res. Inst. (SARI)
c/o Crops Research Inst.
PO Box 3785
Kwadaso, Kumasi
GUINEA
Bureau des Ressources
Phytogénétiques
BP 576
Conakry
MALI
Institut d’Economie Rurale
BP 258
Bamako
MOZAMBIQUE
Instituto Nacional de Investigaçao
Agronómica
PO Box 3658
Maputo
NAMIBIA
National Plant Genetics Resources
Centre
National Botanical Resources Inst.
Private Bag 13184
Windhoek
NIGERIA
International Institute of Tropical
Agriculture (IITA)
Genetic Resources Unit
(Head: Dr. N.Q. Ng)
PMB 5320
Ibadan
Tel: +2342-2410848/2411430
Fax:+2342-2412221
email: [email protected]/
[email protected]
International mailing address:
IITA, Ibadan, Nigeria
c/o Ms Maureen Larkin
L.W. Lambourn & Co.
Carolyn House
26 Dingwall Road
Croydon CR9 3EE, UK
Tel: +44-81-686-9031
Fax: +44-81-681-8583
165
166
&%1&%6% GROUNDNUT
SOUTH AFRICA
Dept. Agriculture
PO Box 727
White River 1240
Grain Crops Institute
(Oil and Protein Seed Centre)
Private Bag X1251
Potchefstroom 2520
Inst. for Veld and Forage Utilization
Private Bag X
Roodeplaat
Plant Genetic Resources Unit
(Coord.: Dr. R.P. Ellis)
Agricultural Research Council
Private Bag X05
Lynn-East 0039
Pretoria
Tel: 27-12-8419717/8
Fax: 27-12-8081001
ZAMBIA
Crop Science Dept.
School of Agricultural Science
Univ. Zambia
Lusaka
PO Box 32379
Zambia
ZIMBABWE
Dept. of Research and Specialist
Services
PO Box CY 550
Causeway, Harare