{ summer 2015 } VINTAGE STYLE
Transcription
{ summer 2015 } VINTAGE STYLE
{ summer 2015 } VINTAGE STYLE REINTERPRETED *FC_BC_CJ_Summer2015_drop1.indd 3 4/7/15 3:23 PM 04082015090153 { summer 2015 } TIME-HONORED TECHNIQUES The old Kingsbury and Peck Industrial House continues to serve as our "silent muse" for GHYHORSLQJXQLTXHZHDYHVG\HFRORUVDQG¿QLVKHV From the sewing room with its rows of time worn machines to the mahogany shelves stacked with dye recipes, color samples and fabric swatches, all are a source for vintage inspiration. Honoring those traditions, we spend an exceptional amount of time on techniques and processes to give a soft, lived-in feel to each garment, evoking a relaxed DQG FRQ¿GHQW SUHVHQFH $OO RI XV DW &RRSHU -RQHV hope you enjoy our new Summer 2015 line of men's sportswear as much as we enjoyed creating it. echo park henley &223(5-21(6&20 02_03_CJ_Summer2015.indd 2 An urbanized, modernized and stylized take on the short-sleeve henley, this one features slub jersey with printed stripes and a watercolor wash. Three-button placket bolstered with herringbone tape. Other enduring details include coverstitched seams and metal buttons. 100% cotton. Machine wash. Imported. Colors: Dry Sage, Navy. Sizes: M-XXL. No. 22500 $89.50 4/7/15 3:35 PM s h. PAGE 03 02_03_CJ_Summer2015.indd 3 4/7/15 3:35 PM SUMMER'S FAVORITE UNIFORM watercolor slub vee Above & Facing Page: Grab a few new slub jersey tees, each with its own personality thanks to our exclusive watercolor wash. With short sleeves, coverstitched seams, rib v-neck and curved bottom hem. 100% cotton. Machine wash. Imported. Colors left to right: Vintage Denim, Canary, Calypso, Gravel, Navy. Sizes: S-XXL. No. 22496 $69.50 COOPERJONES.COM 04_05_CJ_Summer2015.indd 2 888.706.6767 4/7/15 3:45 PM ÀDWIURQWFRWWRQEDPERRVWUHWFKVKRUWV /HIW$VXUSULVLQJFRPELQDWLRQRIQDWXUDOEDPERRDQGFRWWRQFUHDWHVDZRYHQ IDEULFVRFRRODQGVRIW\HWGXUDEOHDQGDQWLPLFURELDO\RX¶OOZRQGHUZK\\RX KDYHQ¶WVHHQWKHVHVKRUWVEHIRUH%HVWRIDOOWKH³,VODQG%DPERR&DQYDV´ RIIHUVWKHDWWULEXWHVRISXUHOLQHQZLWKRXWWKHZULQNOHVFRWWRQUD\RQ EDPERRVSDQGH[0DFKLQHZDVK,PSRUWHG&RORUV%OXH:KLWH.KDNL 6DQG:DLVWVL]HVLQVHDP 1R SDWWHUQHGVZLPVKRUWV $ERYH6XUI VXSGUHVVDFFRUGLQJO\7KHVHOLJKWO\SHDFKHGWUXQNVIHDWXUH FDUJRSRFNHWVDIXOOHODVWLFZDLVWLQVLGHGUDZFRUGDQGPHVKEULHIOLQHUZLWK NH\SRFNHWSRO\HVWHUFRWWRQSRO\HVWHUOLQHU0DFKLQHZDVK ,PSRUWHG6L]HV6;;/LQVHDP 1R5HHI:DONV:DYH 1R5LSSOHV1DY\ 3$*( 04_05_CJ_Summer2015.indd 3 4/7/15 3:45 PM VWWKRPDV\DUQG\HGSODLGVKRUWV Treat yourself to shorts elevated in look and feel, thanks to skillful techniques. The plaid fabric is yarn dyed to hold color intensity, then specially peached IRUDUHPDUNDEO\VRIWWRXFK6KRUWVDUHDOVRSUHODXQGHUHGWRJLYH\RXWKH VDPHSHUIHFW¿WZDVKDIWHUZDVKOLQHQ0DFKLQHZDVK,PSRUWHG &RORUV/LJKW%OXH6DQG:DLVWVL]HVƎLQVHDP 1R vintage washed linen shorts Cross dyeing creates a unique color that can change based on angle and lighting. Vintage washing softens the linen look and feel. Contrast fabric inside waistband and pocket bags. Quarter-top front pockets, coin pocket and buttonWKURXJKEDFNSRFNHWV5HOD[HG¿WOLQHQ0DFKLQHZDVK,PSRUWHG &RORUV.KDNL/LQHQ%OXH:DLVWVL]HVLQVHDP»2 1R FROHKDDQPRWRJUDQGFDPSPRF Colorful appeal right at your feet! Versatile slip-on shoes with classic PRFFDVLQFORVHGWRHDQGOHDWKHUWLHDFFHQW&UDIWHGIRUVXUHIRRWHGFRPIRUW ZLWKDÀH[LEOHRXWVROHDQGJULGWUHDGLQJ/HDWKHUXSSHU,PSRUWHG &RORUV,QN'HHS)RUHVW6L]HVPHGLXP 1R &223(5-21(6&20 06_07_CJ_Summer2015.indd 2 4/17/15 12:04 PM 9,17$*(,163,5$7,21 marina piqué polo :LWKLWVLQQRYDWLYHZDWHUFRORUZDVKWKLVVKRUWVOHHYHSRORHPHUJHVZLWKEHWWHUWKDQEDVLFFKDUDFWHU7KUHHEXWWRQ SODFNHWZLWKWZLOOWDSHGHWDLO5LENQLWFROODURSHQVOHHYHVDQGVLGHYHQWVDWERWWRPFRWWRQ0DFKLQHZDVK ,PSRUWHG&RORUV0DULQH/LJKW*UH\'U\6DJH%ODFN&RUDO6L]HV6;;/ 1R 3$*( 06_07_CJ_Summer2015.indd 3 4/7/15 3:52 PM UNCONVENTIONAL CARGOS PRGL¿HGFDUJRVKRUWV *HWWKHFOHDQORRNRIDÀDWIURQWWZLOOVKRUWDQGNHHSWKHKDQG\FDUJRSRFNHW7KLVRQHLVEHKLQGWKHOHIW VLGHVHDP$OVR¿QGDFRQFHDOHG]LSSHUHGSRFNHWDWORZHUULJKWIURQWWZRIURQWVODVKSRFNHWVDQGWZR EDFNSDWFKSRFNHWV9LQWDJHZDVKHGFRWWRQ0DFKLQHZDVK,PSRUWHG&RORUVOHIWWRULJKW 6WRQH*UHHQ'XVW\.KDNL%OXH1DQWXFNHW5HG:DLVWVL]HVLQVHDP 1R COOPERJONES.COM 08_09_CJ_Summer2015.indd 2 888.706.6767 4/7/15 3:50 PM brentwood stripe poplin shirt Drawing outside the lines reveals unmatched creativity in lightweight poplin. 6WDPSOLNHOHDYHVÀRDWIUHHO\RQGXDOWRQHVWULSHVZKLOHDOORYHUPLFURVWULSHV elevate the vintage sheen. Twill taped placket. Chest pocket. Long sleeves. 100% cotton. Machine wash. Imported. Color: Khaki/Lilac. Sizes: S-XXL. No. 23487 $165.00 vintage sahara twill pants 6XSHUVRIWDQGFRPIRUWDEOHIURPGD\RQH&RQWUDVWGHWDLOHGLQWHULRU ([WUDVWXUG\IURQWSRFNHWVDQGEXWWRQWKURXJKEDFNSRFNHWVFRWWRQ Machine wash. Imported. Colors: Blue, Green, Dusty Khaki, Nantucket Red. Waist sizes: 32-34, 36, 38, 40, 42"; inseam 30, 32, 34". No. 75072 $110.00 PAGE 09 08_09_CJ_Summer2015.indd 3 4/7/15 3:50 PM cole haan vaughn sneakers Finally there are low-top sneakers you can wear just about anywhere. Lace-up style with two-tone canvas upper, full lining and vulcanized rubber outsole. Colors: Chestnut, Black. Sizes: 8-12, 13. No. 78034 $98.00 overdyed textured shorts On the way to being your warm-weather fave, these linen and cotton shorts are enzyme stone washed for exceptional softness and no shrinkage. The intricate horizontal pattern adds visual interest while the internal drawcord lets you comfortably wear these shorts without a belt. 55% linen, 45% cotton. Machine wash. Imported. Colors: Khaki, Black, Sand, Light Blue. Waist sizes: 32-36, 38, 40, 42"; inseam 10". No. 75081 $98.00 COOPERJONES.COM 10_11_CJ_Summer2015.indd 2 astoria slub stripe crew Contrary to the fast-paced world we live in today, we took our time creating this short-sleeve tee. You can see it in the unique feeder stripe slub weave. You can feel it in the broken-in softness achieved by a special garment wash. Subtle pickstitch detail across shoulders. Self-bound neckline. 100% cotton. Machine wash. Imported. Colors: Army, Grey Marl, Salmon. Sizes: S-XXL. No. 22402 $59.50 888.706.6767 4/17/15 12:05 PM OUR SEASONAL CLASSIC williamsburg cavalry twill shirt The advantage is in the mix of Tencel® and cotton with an equestrian-inspired weave and a luxe touch. Adding a vintage-dye process gives each one its own unique look. Short sleeves. Chest pocket. Straight collar. 62% Tencel®, 38% cotton. Machine wash. Imported. Colors left to right: Black, Garnet, Denim, Balsam, Off White, Coral, Iceberg. Sizes: S-XXL. No. 23415 $99.50 PAGE 11 10_11_CJ_Summer2015.indd 3 4/7/15 3:59 PM BASIC, YES. ORDINARY, NO. vintage slub vee What’s most interesting about slub cotton jersey is how the slightly twisted yarns create a subtle yet creative pattern. Durably crafted with a split ribbed v-neck and coverstitched seams. Short sleeves. 100% cotton. Machine wash. Imported. Colors top to bottom: Dark Plum, Salmon, Azure, Black, Army, White. Sizes: S-XXL. No. 22397 $49.50 COOPERJONES.COM 12_13_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:02 PM del mar stripe linen-cotton shirt Our exclusive watercolor wash gives new-found freedom to classic stripes, playing effortlessly against the natural folds of linen and cotton. Contrast color under the spread collar. Shell buttons. Chest pocket. Short sleeves. 55% linen, 45% cotton. Machine wash. Imported. Colors: Caspian, Bright Plum, Dark Navy. Sizes: S-XXL. No. 23418 $69.50 marco indigo piqué polo $W¿UVWWRXFK\RX¶OOPDUYHODWWKHOLJKWQHVVDQGVRIWQHVV<HWLW¶VWKHVNLOOIXO ZD\WKHLQGLJRG\HLQWHQWLRQDOO\IDGHVXQHYHQO\WKDW¶VPRVWFRPSHOOLQJ6LPSO\ VW\OHGZLWKDÀDWNQLWFROODUWZREXWWRQSODFNHWFRYHUVWLWFKHGVHDPVDQG straight bottom with side vents. 100% cotton. Machine wash. Imported. Colors: Light Indigo, Dark Indigo. Sizes: S-XXL. No. 22408 $69.50 PAGE 13 12_13_CJ_Summer2015.indd 3 4/17/15 12:07 PM patchwork shorts Top: Skillfully stitched and garment washed for some serious fun. Slash front pockets, coin pocket and button-through back pockets. 100% cotton. Machine wash. Imported. Color: Khaki. Waist sizes: 32-36, 38, 40, 42"; inseam 9½". No. 76098 $95.00 stars & plaid shorts Middle: Show your American spirit and have a great time along the way. Slash front pockets, coin pocket and button-through back pockets. 100% cotton. Machine wash. Imported. Color: Navy. Waist sizes: 32-36, 38, 40, 42"; inseam 9½". No. 76097 $95.00 COOPERJONES.COM 14_15_CJ_Summer2015.indd 2 jacquard shorts Bottom: Cleverly designed, paying homage to the past with a thoroughly modern edge. Slash front pockets, coin pocket and button-through back pockets. 100% cotton. Machine wash. Imported. Color: Blue. Waist sizes: 32-36, 38, 40, 42"; inseam 9½". No. 76099 $95.00 888.706.6767 4/7/15 4:04 PM e t . ½". soft linen polo There's no settling for an ordinary polo, thanks to the unique slub weave and lightweight feel. Contrast detail inside three-button placket. Self-collar, open short sleeves and straight bottom with side vents. 100% linen jersey. Machine wash. Colors: Indigo, Charcoal Heather. Sizes: S-XXL. No. 22574 $79.50 soft linen tee This could very well be the lightest, most interesting looking short-sleeve tee you'll wear this year. It's all possible in a 100% linen jersey with an all-over slub weave. Sleeves with contrast trim. Crewneck. Straight bottom. Machine wash. Colors: Grey Heather, Indigo. Sizes: S-XXL. No. 22573 $69.50 PAGE 15 14_15_CJ_Summer2015.indd 3 4/7/15 4:05 PM slub baby french terry sweatshirt Life's always more comfortable when there's a short-sleeve French terry crew like this one nearby. Looped softness next to your skin and slub weave outside. Contrast coverstitched at seams. Open sleeves and bottom. 100% cotton. Machine wash. Imported. Colors: Navy, Gravel. Sizes: M-XXL. No. 22493 $75.00 SDFL¿FDMDFNHW With a surplus of comfort and our own cool details, we've revamped the full-zip NQLWMDFNHW/RZHUZHOWSRFNHWVZLWKFKDPEUD\WULP)HHGHUVWULSHULEELQJDW cuffs, bottom and inside collar. Slub interlock of 53% pima cotton, 47% Tencel®. Machine wash. Imported. Color: Navy. Sizes: S-XXL. No. 27510 $165.00 COOPERJONES.COM 16_17_CJ_Summer2015.indd 2 slub baby french terry shorts *UHDWIRUZRUNLQJRXWRUKDQJLQJRXWRXU)UHQFKWHUU\VKRUWVKROGXSWR\RXU demands. A slub weave elevates the look. Contrast waistband with exterior GUDZFRUGDQGIDX[À\6LGHSRFNHWVDQGRQHEDFNSDWFKSRFNHWFRWWRQ Machine wash. Imported. Colors: Gravel, Navy. Sizes: S-XXL; inseam 10". No. 26492 $69.50 888.706.6767 4/7/15 4:05 PM LEGENDARY BIG LEAGUE FAVES retro major league baseball tee Don’t blend in with the masses. Vintage-washed tee with a screen print on front and logo appliqué on left sleeve. Contrast double stripe detail. Short sleeves. 100% cotton. Machine wash. Imported. Sizes: S-XXL. No. 72105 Green (Oakland A's); Black (San Francisco Giants) No. 72104 Navy (Los Angeles Angels) No. 72106 Orange (Baltimore Orioles) No. 72018 Blue (Brooklyn Dodgers) $45.00 PAGE 17 16_17_CJ_Summer2015.indd 3 4/17/15 12:25 PM vintage slub baseball tee Super cool, super soft short-sleeve tees made from vintage-washed slub jersey with a distressed screen print on front and left sleeve. Complete with contrast coverstitching. 55% cotton, 45% polyester. Machine wash. Imported. Sizes: S-XXL No. 72111 Navy (New York Yankees) No. 72113 Blue (Chicago Cubs) No. 72112 Navy (Boston Red Sox) $45.00 vintage-washed soccer tee Super cool, super soft crewneck tees made from vintage-washed jersey with a distressed screen print on front. Short sleeves. 100% cotton. Machine wash. Imported. Sizes: S-XXL Blue (California Surf) White (Los Angeles Aztecs) No. 72117 $38.00 COOPERJONES.COM 18_19_CJ_Summer2015.indd 2 888.706.6767 4/17/15 12:27 PM vintage slub major league baseball vee Contrary to the average baseball tee, ours breaks the mold in a vintage washed slub weave with a distressed MLB team logo at left chest. V-neck, short sleeves and straight bottom. 60% cotton, 40% polyester Machine wash. Imported. Sizes: S-XXL. No. 72125 Midnight (Los Angeles Angels), No. 72124 Mid Blue (Los Angeles Dodgers), No. 72123 Navy (New York Yankees) $45.00 vintage-washed major league baseball crew Support your favorite team with original style. Each short-sleeve crewneck tee is vintage washed for lived-in character and softness. Distressed MLB team logo prominently displayed front and center. 100% cotton. Imported. Sizes: S-XXL. Black (Detroit Tigers), Mid Blue (Chicago Cubs) Navy (Boston Red Sox) No. 72126 $45.00 PAGE 19 18_19_CJ_Summer2015.indd 3 4/7/15 4:08 PM 34 heritage cashmere wash stretch jeans Jeans can feel like a luxury when they're aggressively washed to be as soft as cashmere. And these are strategically crafted to stand up to life's adventures. 7ULPLQWKHVHDWDQGWKLJKIRUDEHWWHU¿WZDVKHGFRWWRQHODVWDQH Machine wash. Imported. Colors: Mid Wash Denim, Dark Wash Denim. Waist sizes: 32-36, 38, 40, 42"; inseam 30, 32, 34". No. 8002 $185.00 COOPERJONES.COM 20_21_CJ_Summer2015.indd 2 venice slub stripe vee This short-sleeve tee features slub jersey that was meticulously G\HGDQGKDQG¿QLVKHGIRUVWDQGRXWFKDUDFWHU6HOIIDEULFERXQG v-neckline. Subtle contrast pickstitching at sleeve and bottom hems. 80% cotton, 20% polyester. Machine wash. Imported. Colors: Indigo, Salmon, Zinc, Bright Plum. Sizes: S-XXL. No. 22404 $59.50 888.706.6767 4/7/15 4:11 PM WATERCOLOR DREAM sea ranch poplin shirt It's our exclusive watercolor wash that gives this light poplin shirt its dressed down personality. Long sleeves work rolled up or not. Twill taped placket. Chest pocket. 100% cotton. Machine wash. Imported. Colors: Dry Sage, Iceberg, Army, Coral, Denim. Sizes: S-XXL. No. 23501 $115.00 PAGE 21 20_21_CJ_Summer2015.indd 3 4/7/15 4:11 PM OPEN-AIR REFRESHMENT malibu twist linen chambray shirt Noticeable thought went into achieving this naturally carefree and perfectly imperfect texture. Strengthened with contrast triple needle stitching. Spread Collar. Shirttail bottom. Short sleeves. 100% linen. Machine wash. Imported. Colors left to right: Bright Plum, Caspian, Zinc, Garnet, Dark Navy. Sizes: S-XXL. No. 23337 $79.50 COOPERJONES.COM 22_23_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:33 PM redondo dobby-stripe shorts Top Left: All-over dobby stitching mimics a stripe effect, yet it's such a ¿QHOLQHWKDWWKHVHVKRUWVORRNJUHDWZLWKERWKSULQWDQGVROLGVKLUWV :LWKTXDUWHUWRSIURQWSRFNHWVDQGEXWWRQWKURXJKEDFNSRFNHWVFRWWRQ 0DFKLQHZDVK,PSRUWHG&RORUV1DY\3HZWHU :DLVWVL]HVLQVHDP 1R Navy 3HZWHU belmar plaid linen-cotton shirt 7RS5LJKW6XEWOHYDULDWLRQVLQWKHYLQWDJHZDVKHG\DUQVHQKDQFHWKHFRRO ZHDULQJDXWKHQWLFLW\7ULSOHQHHGOHVWLWFKLQJUHLQIRUFHVGXUDELOLW\:LWKVKRUW VOHHYHVVSUHDGFROODUDQGVKLUWWDLOERWWRPOLQHQFRWWRQ0DFKLQH ZDVK,PSRUWHG&RORUVIURQWWREDFN&DVSLDQ'DUN3OXP6L]HV6;;/ 1R italian cotton stretch belt :DUPZHDWKHUFDOOVIRUFRWWRQEHOWVZLWKVWUHWFKDSSHDO:LWKOHDWKHU FORVXUHVDQGNHHSHUVDQGEUDVVEXFNOHLQVDWLQQLFNHO¿QLVK 0DGHLQ86$óZLGH(YHQVL]HV 1R72&UHDP1R725R\DO 1R721DY\1R72.KDNL1R72%ODFN PAGE 23 22_23_CJ_Summer2015.indd 3 4/7/15 4:33 PM stuart indigo polo Top Left: The mix of indigo-dyed piqué and jersey creates a unique stripe effect that not only looks cool, it feels cool on hot, humid days. Self-fabric collar, four-button placket and coverstitched seams. 100% cotton. Machine wash. Imported. Colors: Dark Indigo, Light Indigo. Sizes: S-XXL. No. 22409 $69.50 slub sateen camo short Top Right: Aim your discerning eye on a camo print that refuses to follow the usual path. Garment dyed to intensify the sheen. 100% cotton. Machine wash. Imported. Color: Navy. Waist sizes: 32-34, 36, 38, 40, 42"; inseam 10". No. 26516 $125.00 cole haan thong sandals Right: Treat your feet to warm weather. Soft leather upper. Vibram® outsole in camo print. Colors: Black, Fatigue. Sizes: 8½ -11½. No. 78028 $69.00 COOPERJONES.COM 24_25_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:36 PM livingston laced leather belt atelier gardeur stretch denim jeans Luxury denim is composed of buttery soft cotton and a tad of spandex with a VDQGHG¿QLVKIRUDFRPIRUWDEOHUHOD[HG¿WIURPWKHVWDUWSRFNHWVW\OLQJZLWK FRQWUDVWVWLWFKLQJFRWWRQHODVWDQH0DFKLQHZDVK,PSRUWHG &RORUV%ODFN'DUN'HQLP:DLVWVL]HVLQVHDP :HUHFRPPHQGRUGHULQJEDVHGRQ\RXUH[DFWZDLVWPHDVXUHPHQW 1R +DQGFUDIWHGLQ$PHULFDWKLVRQHRIDNLQGEHOWLVPDGHIURPKDQGODFHG VDGGOHOHDWKHUFRORUIXOO\DFFHQWXDWHGZLWKZD[HGFRWWRQFRUGLQJ 3ROLVKHGVLOYHUKDUGZDUH⅜ZLGH0DGHLQ86$&RORUVOHIWWRULJKW %ODFN%URZQ(YHQVL]HV 1R 3$*( 24_25_CJ_Summer2015.indd 3 4/7/15 4:36 PM REDEFINE ULTIMATE driving jacket 6KRZWKHZRUOG\RX UHUHDG\IRUDGYHQWXUH$XQLTXH-DSDQHVHJDUPHQWG\HSURFHVVHOHYDWHVWKH¿QLVK3DFNHGZLWKIRXUURRP\ exterior patch pockets along with a few other secret compartments. 27" length. 65% micro polyester, 35% nylon; 100% polyester taffeta lining Machine wash. Imported. Colors: Orange, Blue. Sizes: S-XXL. No. 77092 $295.00 &223(5-21(6&20 26_27_CJ_Summer2015.indd 2 4/17/15 12:28 PM bradley check shirt Our intricately woven micro check shirt looks simply effortless. In fact, it could pass as a solid when you need one. A linen-cotton blend amps up the cooling effect while gold stitching elevates the style factor. Contrast color under the collar. Chest pocket. Short sleeves. 55% linen, 45% cotton. Machine wash. Imported. Colors left to right: Bright Plum, Zinc, Azure. Sizes: S-XXL. No. 23417 $79.50 big sur plaid shirt Inspired by the jagged cliffs and surf line of California's Big Sur, our namesake short-sleeve shirt is similarly exceptional. Dobby stitches intersect at varying widths to forge an original plaid with timeless appeal. Enhanced with a vintage wash and contrast stitching. Single chest pocket. 100% cotton. Machine wash. Imported. Colors: Marigold, Navy. Sizes: S-XXL. No. 23482 $110.00 double-faced half-zip Different in every way from the usual half-zip knit pullover. Double-faced cotton interlock makes the perfect fabric for heather stripes to work their understated magic. Contrast side panels and woven collar trim add more interest. Even the zip placket and eyelets pop with contrast. Open sleeves and bottom. 100% cotton. Machine wash. Imported. Color: Gravel. Sizes: S-XXL. No. 22511 $125.00 PAGE 27 26_27_CJ_Summer2015.indd 3 4/17/15 12:28 PM tinted stripe polo dover plaid linen-cotton shirt 2XUXQLTXHWLQWHGZDVKUHGH¿QHVVWULSHVWUXFWXUH&KDUFRDOFKDPEUD\XQGHU collar and inside three-button placket. Distressed metal buttons. Short sleeves. 100% cotton. Machine wash. Imported. Color: Black Indigo. Sizes: S-XXL. No. 22494 $89.50 When a dark color palette calls to your casual side, answer with this easy, breezy version. Softened with a vintage wash. Triple needle stitching. Bias yoke. Shell buttons. Short sleeves. 55% linen, 45% cotton. Machine wash. Imported. Colors: Black, Dark Navy. Sizes: S-XXL. No. 23416 $69.50 tubular braided belt Above: Woven Leather Belt. Skillfully detailed for distinction and endurance. ,WDOLDQNLSVNLQOHDWKHUWDEHQGVZLWKDVDWLQQLFNHOEXFNOHǩZLGH Colors: Cognac/Black, Natural/Cognac. Even sizes: 34-42. No. 79093 $110.00 panama check linen-cotton shirt Right: All the qualities of a warm-weather essential, enhanced with a vintage wash and triple needle stitching. Styled with short sleeves, shirttail bottom and shell buttons. 55% linen, 45% cotton. Machine wash. Imported. Colors left to right: Multi, Azure. Sizes: S-XXL. No. 23423 $69.50 COOPERJONES.COM 28_29_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:41 PM borrego plaid shirt Not just a plaid, this linen-cotton version moves centuries-old craft forward. Vintage washed, micro slub texture with intersecting multi-dobby stripes create the unique qualities. Short sleeves. Chest pocket. 55% linen, 45% cotton. Machine wash. Imported. Colors: Navy, Antique Red. Sizes: S-XXL. No. 23477 $110.00 washed 4-pocket jacket Here's a fresh look at the linen-cotton travel jacket. Equipped for some serious IXQZLWKWZRORZHUÀDSEHOORZSRFNHWVDQGWZRÀDSFKHVWSRFNHWVDOOZLWK hidden button closures. Also has button and zip front, two-way collar (stands up or folds down) and interior drawcord waist. 60% linen, 40% cotton. Dry clean. Imported. Color: Brick. Sizes: 40-48. No. 77088 $325.00 PAGE 29 28_29_CJ_Summer2015.indd 3 4/7/15 4:41 PM ESSENTIAL ELEMENT stretch sport coat 7KLV¿QHO\WH[WXUHGVHPLVWUXFWXUHGVSRUWFRDWLVVWUHDPOLQHGIRUFRROUH¿QHPHQWDQGJUHDWHUYHUVDWLOLW\ 7ZREXWWRQIURQW+DOIOLQHGLQWHULRUZLWKKDQG\SRFNHWV6LGHYHQWVFRWWRQHODVWDQH'U\FOHDQ ,PSRUWHG&RORUV6WRQH1DY\1DQWXFNHW5HG6L]HVUHJXODUORQJ 1R COOPERJONES.COM 30_31_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:42 PM PAGE 31 30_31_CJ_Summer2015.indd 3 4/7/15 4:43 PM cole haan canvas weekender Above Left: Feather-light sneaker meets loafer. Easy slipon style with pebble textured canvas upper, contrast trim, textile printed lining and full vulcanized rubber outsole. Color: Blue. Sizes: 8-12, 13. No. 78107 $88.00 WRSDQJD¿QHVWULSHYHH Above Right: Read between the lines and see how slub jersey reinvents stripe appeal. Soft, light yet substantial cotton tee with just the right drop in the V. Subtle contrast coverstitched seams update the look and reinforce durability. Self-fabric v-neckline, short sleeves and hem. 100% cotton. Machine wash. Imported. Colors: Marine, Light Grey. Sizes: M-XXL. No. 22504 $65.00 34 heritage charisma comfort jeans 5LJKW0DGHIRUWKHPDQZKRDSSUHFLDWHVUH¿QHGVW\OHDQG undisputed quality. Classic waist, falling just below the belly and higher on the back for added comfort. Trim in the seat and thigh. Five pockets. Straight leg. 76% cotton, 22% polyester, 2% elastane. Machine wash. Imported. Colors left to right: Charcoal, Denim, Indigo. Recommend ordering one size down due to stretch fabric. Waist sizes: 32-36, 38, 40, 42"; inseam 30, 32, 34". No. 8001 $165.00 COOPERJONES.COM 32_33_CJ_Summer2015.indd 2 888.706.6767 4/17/15 12:50 PM WELCOME CHANGE textured knit sport coat :KHQ\RX¿UVWWRXFKWKLVVSRUWFRDW\RX OONQRZLW VGLIIHUHQW*RRGGLIIHUHQWZLWKVWUHWFKFRPIRUWEXLOWLQWKHVOXEWH[WXUH :HOWFKHVWSRFNHWDQGWZRORZHUÀDSSRFNHWV4XDUWHUOLQHGLQWHULRUZLWKWKUHHSRFNHWVLQFOXGLQJDEXWWRQWKURXJKSKRQH VOHHYH'RXEOHYHQWVOLQHQFRWWRQ'U\FOHDQ,PSRUWHG&RORU%OXH6L]HVUHJXODUORQJ 1R 3$*( 32_33_CJ_Summer2015.indd 3 4/7/15 4:46 PM silk hopsack blazer One touch will convince you. Woven from pure Italian silk, the texture hopsack breathes to keep you cool when temperatures climb. Punctuated with pick stitching. Four print-lined exterior pockets, including a phone sleeve. Interior with French seams, quarter lining and two pockets. Side vents. 100% silk. Dry clean. Imported. Colors: Cream, Light Blue. Sizes: 40-48 regular; 42-48 long. No. 77084 $495.00 COOPERJONES.COM 34_35_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:48 PM pocketed linen twill shirt presidio plaid shirt The drape of vintage-washed linen and cotton makes it an especially ZRUWK\FDQGLGDWHIRUDVKRUWVOHHYHVKLUW$GGDEXWWRQWKURXJKÀDS chest pocket and you have a warm-weather go-to. Twill taped placket. 55% linen, 45% cotton. Machine wash. Imported. Colors: Coral, Navy, White, Calypso. Sizes: M-XXL. No. 23479 $110.00 A special vintage wash elevates the lived-in nature of this linen and cotton plaid with promises to keep you cool and colorful. Triple needle stitching adds longevity. Short sleeves. Spread collar. 55% linen, 45% cotton. Machine wash. Imported. Colors front to back: Iceberg, Dry Sage. Sizes: M-XXL. No. 23478 $125.00 PAGE 35 34_35_CJ_Summer2015.indd 3 4/17/15 12:50 PM del mar polo atelier gardeur cashmere touch cotton stretch 5-pocket pants $ERYH6OXEMHUVH\LVVXEVWDQWLDO\HWDLU\GLVWLQFWLYH\HW XQGHUVWDWHG&KDPEUD\IDEULFLQVLGHDQGXQGHUFROODUDVZHOODV LQVLGHSODFNHW'RXEOHQHHGOHVWLWFKLQJ2SHQVKRUWVOHHYHVDQG ERWWRPFRWWRQUD\RQ0DFKLQHZDVK,PSRUWHG &RORUVOHIWWRULJKW1DY\*UDYHO,FHEHUJ&RUDO6L]HV6;;/ 1R Bottom: As soft as cashmere and ideal for warm weather, make your mark in amazingly OLJKWDQGVRIWFRWWRQSDQWVZLWKVWUHWFKFRPIRUW7RQDOVWLWFKLQJ5HJXODU¿W6WUDLJKW leg. Garment-washed 98% cotton, 2% elastane. Machine wash. Imported. Colors: 6WRQH.KDNL&KDUFRDO&KDPEUD\:DLVWVL]HVLQVHDP QRWDYDLODEOHLQLQVHDP:HUHFRPPHQGRUGHULQJVL]HEDVHGRQH[DFWZDLVW measurement. 1R &223(5-21(6&20 36_37_CJ_Summer2015.indd 2 4/17/15 12:51 PM SEERSUCKER REINVENTED slub puckered stripe sport coat Unstructured, unconventional and totally cool. Styled with two-button front, notch lapel, lower open patch pockets, welt chest pocket and double vents. Contrasting undercollar and trim. Removable throat latch. Italian 98% cotton, 2% elastane; 100% polyester half lining. Dry clean. Imported. Color: Navy/White. Sizes: 40-48 regular; 42-48 long. No. 77086 $385.00 PAGE 37 36_37_CJ_Summer2015.indd 3 4/7/15 4:50 PM COOL CHARACTER washed cotton sport coat Your new favorite unstructured sport coat comes in a washed-down cotton that works with jeans or trousers, a t-shirt or a sport shirt, whether it's casual Friday or date night Saturday. Nicely accented with tonal pickstitching. Plenty of pockets inside and out. Double vents. Quarter-lined for lightweight comfort. 100% cotton. Dry clean. Imported. Color: Black. Sizes: 40-48 regular; 42-48 long. No. 77087 $295.00 COOPERJONES.COM 38_39_CJ_Summer2015.indd 2 888.706.6767 4/7/15 4:51 PM burlingame stripe shirt Horizontal micro stripes play effortlessly against the natural folds of linen and cotton. Durably constructed with triple needle stitching, bound placket edge and metal buttons. Short sleeves. Single chest pocket. 55% linen, 45% cotton. Machine wash. Imported. Colors: Calypso, Navy, Coral. Sizes: S-XXL. No. 23485 $110.00 pebbled heather crew Two-tone cotton yarns create a subtle marled effect sure to step up your tee drawer. The reverse fabric chest pocket updates the look even more. Holds up wash after wash with triple needle stitching. 100% cotton. Machine wash. Imported. Colors: Blue Marl, Tan Marl, Black Marl, Rose Marl. Sizes: S-XXL. No. 22506 $65.00 PAGE 39 38_39_CJ_Summer2015.indd 3 4/7/15 4:51 PM atelier gardeur crosshatch jeans Buttery-soft and light stretch denim features a crosshatch weave with a GLVWUHVVHG¿QLVKIRULQVWDQWFRPIRUWSRFNHWVW\OHLQDUHJXODU¿WZLWKDVWUDLJKW OHJFRWWRQHODVWDQH0DFKLQHZDVK,PSRUWHG&RORUV'DUN'HQLP 'HQLP6L]HVLQVHDPLQVHDP :HUHFRPPHQGRUGHULQJVL]HEDVHGRQ\RXUH[DFWZDLVWPHDVXUHPHQW 1R COOPERJONES.COM 40_41_CJ_Summer2015.indd 2 GLVWUHVVHGFRZKLGHEHOW 6WXUG\VWURQJDQGFRPIRUWDEOHDVLWLVPHDQWWREH)XOOJUDLQFRZKLGHJHWV DGLVWUHVVHG¿QLVKIRUDRQHRIDNLQGORRNDQGEURNHQLQIHHO'URSSHGHGJH FRQVWUXFWLRQZLWKDQLOLQHOHDWKHUOLQLQJDQGGLVWUHVVHGQLFNHO¿QLVKEXFNOH Made in USA. 11»2ZLGH&RORUV%ODFN7DQ(YHQVL]HV 1R 888.706.6767 4/17/15 12:52 PM délavé linen sport coat This particular Italian linen goes through a special dye-and-wash process to reveal a slighly faded look and fully unique character called délavé. Semi-structured with chest pocket, lower patch pockets (including phone sleeve) and double vents. Interior is quarter lined with two pockets and French faced with contrast fabric. 100% linen. Dry clean. Imported. Color: Blue. Sizes: 40-48 regular, 42-46 long. No. 77085 $495.00 PAGE 41 40_41_CJ_Summer2015.indd 3 4/7/15 4:53 PM melrose utility jacket $ERYH)DFLQJ3DJH&RROFDVXDODQGFRQ¿GHQW\RXFDQZHDUWKLVXQVWUXFWXUHGVRIWZDVKHGKRSVDFNMDFNHWWZRZD\V fold the collar down like a sport coat and show contrast color, or leave the collar up with button closure tab back or forward. Welt chest pocket and two lined patch pockets. Double vents. Interior is fully lined and equipped with phone pocket. 55% linen, 45% cotton. Dry clean. Imported. Colors shown on opposite page: Café, Navy. Sizes: S-XXL. No. 27509 $325.00 COOPERJONES.COM 42_43_CJ_Summer2015.indd 2 888.706.6767 4/7/15 5:02 PM crinkled check shirt atelier gardeur side-pocket cotton cashmere pants This carefree essential has life, lift, depth and dimension – the result of weaving yarns at varying tensions to create a pleasantly crinkled effect. Vintage washed. Roll up the sleeves or not. Chambray trim. Chest pocket. 65% cotton, 45% nylon. Machine wash. Imported. Colors: Coral, Calypso, Iceberg. Sizes: S-XXL. No. 23484 $125.00 6LGHSRFNHWVJLYHWKHDSSHDUDQFHRIDÀDWIURQWWURXVHUZKLOHWKH¿WLVOLNHD ¿YHSRFNHW&RQWUDVWWULPRQFRLQSRFNHWDQGEDFNSRFNHWVDOVRVHWVWKLVSDQW apart from the ordinary. 98% cotton, 2% elastane. Machine wash. Imported. Colors: Khaki, Dark Navy. Waist sizes: 32, 34, 36, 38, 40, 42"; inseam 32". Waist sizes: 33, 38, 40, 42"; inseam 34". We recommend ordering size based on your exact waist measurement. No. 75131 $225.00 PAGE 43 42_43_CJ_Summer2015.indd 3 4/7/15 5:02 PM ÀDJVWDIISODLGVKLUW 8SGDWLQJDVKRUWVOHHYHSODLGVKLUWWDNHV¿QHVVHDQGVNLOO:HWRRNDOLQHQ FRWWRQEOHQGDQGZRYHLWLQWRDPXWHGSODLGGHVLJQ9LQWDJHZDVKHGWRPHOORZ WKHHQWLUHVKLUW5HLQIRUFHGZLWKWULSOHQHHGOHVWLWFKLQJ6SUHDGFROODU6KLUWWDLO ERWWRPOLQHQFRWWRQ0DFKLQHZDVK,PSRUWHG&RORUV$QWLTXH5HG 1DY\6L]HV6;;/ 1R G\ODQJHWDZD\FRDW YLQWDJHKRQH\FRPEVZHDWHU 5DLQRUVKLQHWKLVVKRUWFRDWFDQ WEHEHDW'RXEOHIDFHGPLFURWZLOOIHDWXUHV DPHPRU\¿QLVKWRUHWDLQVKDSHDQGDSSHDUDQFH'RXEOHFROODUZLWKFRQWUDVW FRORUIRUYHUVDWLOHZHDU3KRQHSRFNHWDWFKHVW$FWLRQSOHDWDWEDFN OHQJWK:DWHUUHSHOOHQWSRO\HVWHUFRWWRQSRO\HVWHUOLQLQJ 'U\FOHDQ,PSRUWHG&RORU0LGQLJKW6L]HV6;;/ 1R 7KLVUHPDUNDEO\OLJKWZHLJKWFRWWRQVZHDWHUVKRZVLWVLQJHQXLW\LQWKH KRQH\FRPEWH[WXUHDQGYLQWDJHZDVK'HWDLOHGZLWK;VWLWFKXQGHUQHFNOLQH 5LENQLWFUHZQHFNFXIIVDQGERWWRPFRWWRQ0DFKLQHZDVK &RORUV%DMD%OXH'U\6DJH3HZWHU,QGLJR6L]HV6;;/ 1R &223(5-21(6&20 44_45_CJ_Summer2015.indd 2 4/7/15 4:58 PM DECIDEDLY UNCOMPLICATED edge melange softcoat Ethereal qualities of Italian melange yarns give this unstructured linen-cotton sport coat its edge. Two-button front with notch lapel, suede undercollar and trim, welt chest pocket, two lower open pockets and suede patch for phone. Double vents. 66% linen, 34% cotton; 100% polyester half lining. Dry clean. Imported. Color: Brown. Sizes: 40-48 regular; 42-48 long. No. 77089 $475.00 PAGE 45 44_45_CJ_Summer2015.indd 3 4/17/15 11:23 AM distressed leather blazer You’ve probably seen a million blazers. Well not like this one. With a vintage vibe, rugged edge and sumptuous feel, this washed leather blazer is built for a lifetime of pleasure. Raw edges and rivet details. Two lower pockets; three interior pockets. Paisley lined body; satin lined sleeves. 100% leather; 100% polyester lining. Dry clean. Imported. Colors: Taupe, Red, Charcoal, Camel. Sizes: S-XXL. If in between sizes, we recommend ordering one size up. No. 77001 $495.00 COOPERJONES.COM 46_47_CJ_Summer2015.indd 2 888.706.6767 4/15/15 3:31 PM IDX[RVWULFKFDOIVNLQEHOW 'LVWLQJXLVKHGLQDQRVWULFKIHDWKHUHGSDWWHUQRQSOLDEOHFDQIVNLQZLWK FRQWUDVWVWLWFKLQJ$QWLTXH¿QLVKHGEXFNOH&RORUV%URZQ&RJQDF 11»2" wide. Even sizes: 32-42. No. 79007 $95.00 atherton linen-cotton plaid shirt 5LJKW1RWLFHDEOHWKRXJKWZHQWLQWRFUHDWLQJWKLVSHUIHFWO\LPSHUIHFWSODLGVKLUW Seams reinforced with triple needle stitching. Open short sleeves; shirttail ERWWRPOLQHQFRWWRQ0DFKLQHZDVK,PSRUWHG&RORU&DO\SVR Sizes: S-XXL. No. 23476 $110.00 alberto houndstooth stretch jeans alberto pinstripe stretch jeans ,QWULJXLQJKRXQGVWRRWKSDWWHUQHGVWUHWFKGHQLPLV¿QLVKHGE\KDQGWR create new interest in jeans. Vintage washed for even more comfort. 61»2-oz. 98% cotton, 2% elastane. Color: Light Blue. Waist sizes: 32-36, 38, 40, 42"; inseam 32, 34". No. 75078 $245.00 How can jeans be so soft, lightweight and distinguished? It starts with 71»2-oz. Italian cotton denim with stretch comfort. Pinstripes are hand sanded for OLYHGLQFKDUDFWHUIURPGD\RQH)LYHSRFNHWVFRWWRQHODVWDQH Color: Light Blue. Waist sizes: 32-36, 38, 40, 42"; inseam 32, 34". No. 75077 $245.00 PAGE 47 46_47_CJ_Summer2015.indd 3 4/7/15 5:05 PM ringer crew Top Left: Giving new life to a classic starts with heather rib texture. Add a charcoal grey ringer neck. Jazz up with denim gold pick stitch detail at seams. It all equates to a far-from-ordinary shortsleeve tee to go with just about anything you own. 100% cotton. Machine wash. Imported. Colors top to bottom: Gravel, Marine, Pewter. Sizes: M-XXL. No. 22505 $69.50 coronado madras shirt Top Right: There are few things as appealing for warm weather as a madras shirt. Ours, in a nature-inspired color palette, is made from a coolwearing linen and cotton softened with a vintage wash. Triple needle stitching. Short sleeves. Shell buttons. 55% linen, 45% cotton. Machine wash. Imported. Colors: Apricot, Warm Olive. Sizes: S-XXL. No. 23420 $79.50 COOPERJONES.COM 48_49_CJ_Summer2015.indd 2 catalina henley Above: Color artistically fades from dark to light, WKDQNVWRDPLQHUDOG\HGKDQG¿QLVKHGHIIHFW Ribbed neck with raw-edge rolled trim. Threebutton placket reinforced with lightweight twill. Complete with contrast stitching. Short sleeves. 100% cotton jersey. Machine wash. Imported. Colors left to right: Army, Fig, Blue Ice. Sizes: M-XXL. No. 22400 $69.50 888.706.6767 4/7/15 5:07 PM INDEPENDENT INSPIRATION distressed moto jacket ,W VKDUGWR¿QGWKLVDPRXQWRIGHWDLOLQDQ\WKLQJOHWDORQHDOHDWKHUMDFNHW5DZHGJHVOHDYHDQLQGHOLEOHSUHVHQFHLQFOXGLQJ GRZQWKHFHQWHUEDFNDQGDURXQGWKHRSHQERWWRPDQGFXIIV/RZHUIURQWSRFNHWVZLWKVQDSFORVXUHV2QHVQDSFROODU OHDWKHUSRO\HVWHUOLQLQJ'U\FOHDQ,PSRUWHG&RORUV&KDUFRDO7DXSH6L]HV6;;/ 1R 3$*( 48_49_CJ_Summer2015.indd 3 4/7/15 5:07 PM Sizing Charts and Fit Information If you are unsure of your sizing, please take your measurements. Doing so will greatly reduce the guesswork - and the need to return something WKDWGRHVQ¶W¿W,I\RXKDYHDQ\TXHVWLRQV UHJDUGLQJ¿WVL]HVRUWDNLQJ\RXUPHDVXUHPHQWV please call us toll-free at 888-706-6767. Small Medium Large X-Large XX-Large Neck 14-14½ 15-15½ 16-16½ 17-17½ Chest 36-38 39-40 42-44 46-48 50-52 Sleeve 32-33 33-34 34-35 35-36 36-37 28-30 32-34 36-38 40-42 44-46 Waist 18-18½ Sizing Tips Fit:0RVWRIRXULWHPVDUHPDGHZLWKDVOLPPLQJ FRQWHPSRUDU\¿W Belts: We recommend that you order the next even size up from your waist size. Measuring Neck:0HDVXUHDURXQGWKHPLGGOHRI\RXUQHFNDW\RXU $GDP¶VDSSOH$OORZURRPIRU\RXULQGH[¿QJHUWR¿W EHWZHHQWKHWDSHDQG\RXUQHFNIRUDFRPIRUWDEOH¿W Chest: With your arms at your side measure around \RXUXSSHUERG\0HDVXUHXQGHU\RXUDUPSLWVDQGRYHU the fullest part of your chest and shoulder blades. Sleeve:0HDVXUHIURPWKHFHQWHURIWKHEDFNRI\RXU neck to your wrist. Waist:0HDVXUHDURXQG\RXUQDWXUDOZDLVWOLQHDWWKH height you normally wear your pants. cole haan suede loafer Tri-colored suede upper steps up your casual style while the removable cushioned insole ensures comfort. Full vulcanized rubber outsole. Color: Stone. Sizes: 8-12, 13. No. 78110 $88.00 cole haan suede chukka Dressed up or down, the lace-up chukka boot is a versatile staple for any wardrobe. EVA midsole for cushioned comfort. Rubber IRUHSDUWIRUÀH[LELOLW\&RORUV0LONVKDNH%ODFN Sizes: 8-12, 13. No. 78037 $178.00 6RPHSDQWVDUHVKLSSHGZLWKDQRSHQXQ¿QLVKHG bottom. We will be happy to hem them for an additional $10. Straight hem and cuffs available. Altered pants cannot be returned. Delivery Services All orders ship via UPS from our warehouse in Alpharetta, Georgia. Expedited orders placed E\30(67ZLOOVKLSWKHVDPHEXVLQHVV day. Please allow an additional 72 hours for ¿QLVKHGLQVHDPRUGHUV Delivery Charges if your order is: this is your charge Ground $8.95 Rush Delivery Orders 2 Day Air add $15.00 Overnight add $25.00 Returns and Exchanges Returns policy - Items that are unworn and unaltered can be returned within 60 days for credit or exchange. A prepaid return label will be enclosed with the order for an easy return. A small fee of $8.95 will be deducted from WKHUHIXQGQRFRVWIRUH[FKDQJHV6LPSO\¿OORXWWKH return form and using the prepaid label, take to the post RI¿FHRUJLYHWR\RXUOHWWHUFDUULHU,I\RXFKRRVHWRVKLSD different method, please send to the address below. cole haan sport oxford Casual oxford or sneaker? It's the best of both. Perforated leather upper reinforced with suede trim at toe and heel. Vulcanized rubber outsole. Colors: Berkley Blue, Woodbury. Sizes: 8-12, 13. No.78095 $148.00 cole haan high-top sneaker Smooth leather upper with strategically placed perforations for breathability. Reinforced with suede trim. Durable vulcanized rubber outsole. Padded collar. Color: Black. Sizes: 8-12, 13. No. 78094 $168.00 Cooper Jones Attention: Returns 1034 Windward Ridge Parkway Alpharetta, GA 30005-3992 &223(5-21(6&20 50_51_CJ_Summer2015.indd 2 4/7/15 5:08 PM ka obe. bber %ODFN r laced with tsole. carbon crew tee Top: Our goal was to create the softest cotton tee you'll ever wear. The GLIIHUHQFHLVDFDUERQL]HGEUXVKHGWHFKQLTXH¿QLVKHGZLWKDYLQWDJHZDVK Rib neckline with heather tape detail. Triple needle contrast stitching. 100% cotton. Machine wash. Imported. Colors left to right: Guava, White, Canary, Calypso, Black. Sizes: S-XXL. No. 22514 $49.50 VD[[®OLIHVW\OHER[HUEULHIV $ERYH/HIWDQG5LJKW0DGHRIOX[XULRXVVWUHWFKYLVFRVHZLWKSDWHQWHGPHVK panels to ensure breathability, moisture wicking and an incredibly soft feel. YLVFRVHVSDQGH[0DFKLQHZDVK,PSRUWHG6L]HV6;;/ 1R9LEH3ULQW%R[HU%ULHI Colors front to back: Miami Sunset, Grey Anchor, Navy Anchor. 1R*UDGLHQW6WULSH%R[HU%ULHI&RORU%ODFN 1R8OWUD%R[HU%ULHI Colors front to back: Miami Heather, Grape, Light Heather, Zest Heather, Cobalt, Black. PAGE 51 50_51_CJ_Summer2015.indd 3 4/7/15 5:08 PM PRSRT STD US POSTAGE PAID 1034 Windward Ridge Pkwy Alpharetta, GA 30005 COOPER JONES CUSTOMER NUMBER COOPERJONES.COM SOURCE CODE 888.706.6767 watercolor slub vee SU151 Grab a few new slub jersey tees, each with its own personality thanks to our exclusive watercolor wash. With short sleeves, coverstitched seams, rib v-neck and curved bottom hem. 100% cotton. Machine wash. Imported. Colors left to right: Vintage Denim, Canary, Calypso, Gravel, Navy. Sizes: S-XXL. No. 22496 $69.50 *FC_BC_CJ_Summer2015_drop1.indd 2 4/7/15 3:22 PM 04082015090137