INSTRUMENTOS PARA ENSAYOS DE MATERIALES

Comments

Transcription

INSTRUMENTOS PARA ENSAYOS DE MATERIALES
Corimex Ltda. Desde su
fundación en 1965 se
caracteriza por importar
productos de primera
calidad, provenientes de
empresas
muy
bien
reconocidas
a
nivel
mundial.
INSTRUMENTOS PARA ENSAYOS
S DE MATERIALES
Una realidad industrial al servicio de la Ingeniería en más de 100 países
del mundo. Líder en la producción de maquinas e instrumentos de
laboratorio para ensayos y controles de:
Una gama de más de 5000 productos. MATEST S.p.A. – Italia.
www.corimex.com
Oficina Central La Paz
Calle Montevideo 130
Tel. +591 2 2440330
Fax +591 2 2440230
Casilla 359 - 4788
[email protected]
Oficina Santa Cruz
Av. Sta. Cruz 1143(2do. Anillo)
Tel. +591 3 3333533
Fax +591 3 3331193
Casilla 3975
[email protected]
Oficina Cochabamba
Calle Ismael Céspedes 1138
Tel. +591 4 4422201
Fax +591 4 4422207
[email protected]
1%()-21%8)781%()-2-8%0=
'%8Å03+3)(-'-Ì2
1EXIWXŒ'ST]VMKLX
)WXjTVSLMFMHEPEVITVSHYGGMzRXSXEPSTEVGMEPHIIWXIGEXjPSKSWMRPEI\TVIWE
EYXSVM^EGMzRTSVIWGVMXSHI1EXIWX
1EXIWXMRZIWXMKEGMzR]HIWEVVSPPSTYIHILEFIVGSRGIFMHSRYIZSWTVSHYGXSW
UYIRSWILERTSHMHSMRGPYMVIRIWXIGEXjPSKS%PKYRSWRYIZSWTVSHYGXSWTYIHIR
IWXEVHMWTSRMFPIWSXVSWTYIHIRHINEVWIHIJEFVMGEV0EWMQjKIRIW]HIWGVMTGMSRIWRS
WSRZMRGYPERXIWEPEIQTVIWE1EXIWXTSVPSXERXSWIVIWIVZEIPHIVIGLSEQSHM½GEV
PEWIWTIGM½GEGMSRIWHITVSHYGXSWIRGYEPUYMIVQSQIRXSWMRTVIZMSEZMWS
-278691)28374%6%)27%=37()1%8)6-%0)7
0SWSFNIXMZSWUYILIQSWPSKVEHSIW
TSHIVHIGMVHIHSRHITEVXMQSW]LEGME
HzRHIZEQSW
8IRKS IP TPEGIV HI TVIWIRXEV PE SGXEZE IHMGMzR HI RYIWXVS GEXjPSKS KIRIVEP IP
PXMQSIRPELMWXSVMEHIq\MXSWHI1EXIWX 2YIWXVEHIHMGEGMzREPEMRZIWXMKEGMzR]
HIWEVVSPPS NYRXSGSRYREQjWEQTPMEKEQEHIRYIZSWTVSHYGXSW WIIRGYIRXVER
IRIWXEKYuE 4SRMIRHSHIQERM½IWXSSXVSTEWSEHIPERXIIRIPTVSGIWSIZSPYXMZS
HITVSHYGGMzRHITVSHYGXSW1EXIWXETS]EHSWTSVYREJYIV^ETVSHYGXMZEHMRjQMGE
HIIWXEWSGMIHEHKPSFEP
(IRXVSHIRYIWXVSGEXjPSKSHI WITYIHIZIVIPTVSKVIWSUYI1EXIWXLE
LIGLSIRPSWPXMQSWXVIWEySWGSRTVSHYGXSWHIEPXEXIGRSPSKuETSRMIRHSIWTI
GMEPEXIRGMzRIRIPGEQTSHIPEWJEPXS ]HIWXEGERHS EPEQjWEZER^EHEYRMHEHHI
GSRXVSPHMKMXEPGSRTERXEPPEXjGXMP MRXIKVEHETSVTVMQIVEZI^IRPEJEFVMGEGMzRHI
IUYMTSWHIIRWE]SHIQEXIVMEPIW
)WXEQSWSVKYPPSWSWHIHIGMV 1EXIWXIWYREQEVGE±,IGLEIR-XEPME²HIWHIIPHM
WIySHIPTVS]IGXSEXVEZqWHIGEHEYRSHIPSWTEWSWHIPTVSGIWSHITVSHYGGMzR
HIWHIIPQSRXENIEPGSRXVSPHIGEPMHEH]IPWIVZMGMSTSWXZIRXEEPGPMIRXIGSRXERHS
GSRIPETS]SHIQjWHIIQTPIEHSWHI1EXIWX)RPEEGXYEPMHEHPETPERXEHIJE
FVMGEGMzRHI1EXIWXGYFVIQIXVSWGYEHVEHSWVIYRMIRHSPEWuRXIWMWTIVJIGXE
HIPEWWMRIVKMEWHIJEFVMGEGMzRIPEPQEGIREQMIRXS]PEHMWTSRMFMPMHEHHIYRQE]SV
RQIVSHITVSHYGXSW
1. nuove foto
1EXIWXVITVIWIRXEPEWIKYRHEKIRIVEGMzRHIYREIQTVIWEJEQMPMEV )PQMWQSIW
TuVMXY IQTVIWEVMEP HI PSW MRMGMSW HI HEV YRE EXIRGMzR TIVWSREPM^EHE IWXj HIXVjW
HIRYIWXVSXVEFENS]RYIWXVSSFNIXMZSHI IWXEVWMIQTVIIRFYIREWQERSW 9RE
IQTVIWEWzPMHE½RERGMIVEQIRXIJYIVXI1EXIWXWILEGSRZIVXMHSVIGMIRXIQIRXIIR
1EXIWX7T%GSR½VQERHSYREQFMGMSWSTVSKVEQEHIJYXYVS
,S]HIWTYqWHIGEWMEySW]SXSHEZuEZISYREIQTVIWEUYILEWMHSGETE^HI
IWXEVIRPEZERKYEVHMEHIPEQEWQSHIVREXIGRSPSKuE]WIKYMVQERXIRMIRHSPETE
WMzRTSVWY½PSWSJuESVMKMREPIWXSLEGIHI1EXIWXPEQINSVSTGMzRIRIPWYQMRMWXVS
HITVSHYGXSWHIGEPMHEH
)046)7-()28)
1EXIWX7T%PERYIZETPERXEHITVSHYGGMzR
(IPHIWEVVSPPSSVMKMREPHI WIEQTPMzIR]ELSVEGYFVI
QjW HI QIXVSW GYEHVEHSW 0E EQTPMEGMzR HI RYIWXVE TPERXE
TVSTSVGMSREVjQE]SVIWZSPQIRIWHITVSHYGGMzR]EQTPuEVjRYIW
XVSWXSGOTEVEVIEPM^EVYREIRXVIKEQYGLSQjWVjTMHE
29)78637'0-)28)7
8VEFENEQSW GSR IP GSRXVSP HI GE
PMHEH ] PEFSVEXSVMSW KISXqGRMGSW
IQTVIWEW HI GSRWXVYGGMzR HI
GEVVIXIVEW JEFVMGERXIW HI QEXI
VMEPIWHIEWJEPXS]QEXIVMEPIWHIPE
GSRWXVYGGMzR JEFVMGERXIWHITVIJE
FVMGEHSW HI LSVQMKzR ] GIQIRXS
MRKIRMIVSW GSRWYPXSVIW EYXSVMHE
HIWKYFIVREQIRXEPIWGSRPSWTVMR
GMTEPIW GIRXVSW HI MRZIWXMKEGMzR ]
PEWYRMZIVWMHEHIWQjWMQTSVXERXIW
HIPQYRHS
1EXIWXIWXjIRIPQYRHS
0ETVIWIRGMEHIPEQEVGE1EXIWXIRXSHSIPQYRHSIWXjKEVERXM^EHE
TSVYREEQTPMEVIHHIHMWXVMFYGMzRGSREKIRXIWGYEPM½GEHSW]GSQ
TIXIRXIWHMWXVMFYMHSVIW]QMRSVMWXEW1EXIWXWEXMWJEGIPEWRIGIWMHEHIW
HIRYIWXVSWGPMIRXIWIRXSHSIPQYRHSGSRPSWWIVZMGMSWXqGRMGSW]
GSQIVGMEPIWHITVI]TSWXZIRXE
-278691)28374%6%)27%=37()1%8)6-%0)7
'
SRQjWHIEySWHII\TIVMIRGMEIRIPWIGXSV1EXIWXIWYRPuHIVQYRHMEPIRPEJEFVMGEGMzR
HIIUYMTSWHIIRWE]SWTEVEPEMRHYWXVMEHIPEGSRWXVYGGMzR
29)78637:%036)7*9)68)7
ˆ %PXEGETEGMHEH]I½GMIRGMEHIPETVSHYGGMzR
ˆ 4VIGMSWHIJEFVMGERXI
ˆ 'SVXSTPE^SHIIRXVIKE
ˆ +EQEGSQTPIXEHITVSHYGXSW
ˆ 'EPMHEH]½EFMPMHEHHIPSWTVSHYGXSW
ˆ %WMWXIRGMEXqGRMGEGYEPM½GEHE
037291)637()1%8)78
ˆ TVIRWEWTEVEIRWE]SWHIGSQTVIWMzR]¾I\MzRIRLSVQMKzR]GIQIRXS
ˆ QEVXMPPSWTEVEIRWE]SWHILSVQMKzR
ˆ XEQM^EHSVEW
ˆ IUYMTSWEYXSQjXMGSWHI:MGEX
ˆ JEFVMGEHSWTSV1EXIWXWIYXMPM^ERLS]IRXSHSIPQYRHS
1%()-21%8)781%()-2-8%0=
-278691)28374%6%)27%=37()1%8)6-%0)7
0EMRRSZEGMzRTEWETSVEUYu
-RZIWXMKEGMzR]HIWEVVSPPSVIEPM^EQSWMRRSZEGMzR
0EWMRRSZEGMSRIWIPIGXVzRMGEW]XIGRSPzKMGEWWSRJEGXSVIWGPEZITEVE
IPGVIGMQMIRXSIQTVIWEVMEP IWTIGMEPQIRXIIRYRGEQTSIRGSRW
XERXIIZSPYGMzRGSQSIPIRWE]SHIQEXIVMEPIW
4EVEWEXMWJEGIVPSWGVIGMIRXIW]GEHEZI^QjWI\MKIRXIWQIVGEHSW
1EXIWXLETYIWXSIRQEVGLEYRGYEPM½GEHSIUYMTSHIMRKIRMIVSW
4%28%00%)2'3036
-28)6*%>*%'-0
()97%6
HIHMGEHSW E PE MRZIWXMKEGMzR ] EP HIWEVVSPPS HI RYIZSW TVSHYGXSW
EWuGSQSEPEEGXYEPM^EGMzRHIPSW]EI\MWXIRXIWHMWIyEHSW]JEFVMGE
HSWHIEGYIVHSEPEWQjWMQTSVXERXIWRSVQEWMRXIVREGMSREPIW)2
%781%%7,83&7%*236(-292)92--73
']FIV4PYW)ZSPYGMzR
PEIZSPYGMzR
HIYRTVSHYGXSHIq\MXS
)\GPYWMZSTSVWYGEPMHEH]PEMRRSZEGMzRMRMQMXEFPI PERYIZEYRMHEH
HIGSRXVSP±4'FEWIH²GSRTERXEPPEXjGXMP]ELEWMHSVIGSRSGMHETSV
PEW TIVWSREW QjW I\TIVMQIRXEHEW ] VIWTIXEHEW IR PE MRHYWXVME HIP
IRWE]SHIQEXIVMEPIW
(IXEPPIWXqGRMGSWIRPETjKMRE
1)136-%-0-1-8%(%
'32)<-Ì2(-6)'8%%-28)62)8
4%6%)0734368)8f'2-'36)1383
-278691)28374%6%)27%=37()1%8)6-%0)7
)WXEQSWWMIQTVIIRQSZMQMIRXS
9RJYIVXIGSQTVSQMWSGSRPSWIUYMTSW
HIIRWE]SWHIEWJEPXSW
&'SQTEGXEHSVHI
VSHMPPS
GSQTEGXETVSFIXEWHIQEXIVMEP
EWJjPXMGSIRIPPEFSVEXSVMSFENS
GSRHMGMSRIWUYIWMQYPERPE
GSQTEGXEGMzRMRWMXY
&)RWE]SHITMWXE
HMWIyEHSTEVEQIHMVPE
HIJSVQEGMzRHIPEWQYIWXVEW
FMXYQMRSWEWIRGSRHMGMSRIW
UYIWMQYPERHIGIVGEIPIJIGXS
HIPQSZMQMIRXSHIYRXVj½GS
PIRXS
%21EUYMREHITYPMQIRXS
EGIPIVEHSHIPSWjVMHSW
WIYXMPM^ETEVEQIHMVPE
VIWMWXIRGMEHIPSWjVMHSWEHS
UYMRIW]FPSUYIWEPEEGGMzR
HITYPMHSHIPEWVYIHEWHIPSW
ZILuGYPSWIRPEWYTIV½GMIHIPEW
GEVVIXIVEW
&2)UYMTSEYXSQjXMGSHI
ERMPPS]FSPE
HIXIVQMREEYXSQjXMGEQIRXIIP
TYRXSHIVIFPERHIGMQMIRXSHI
TVSHYGXSWFMXYQMRSWSW
-278691)28374%6%)27%=37()1%8)6-%0)7
[[[QEXIWXGSQ
YRE REZIKEGMzR MRXIVEGXMZE TSV PE VIH E XVEZqW HI
QjW HI TVSHYGXSW GSQTPIXSW GSR PEW 2SV
QEWMRXIVREGMSREPIW]PSWHIXEPPIWXqGRMGSW
2YIZETjKMRE[IFHI1EXIWX
WSQSWHMRjQMGSWXEQFMqRIRPEVIH
2YIWXVS WMXMS [IF XMIRI YR RYIZS HMWIyS KVj½GS ] GSRXI
RMHSW RYIZSW YR GEXjPSKS MRXIVEGXMZS QY] GSQTPIXS TEVE
XSHSWPSWTVSHYGXSWEGGIWSVMSW]RSVQEWPSWGYEPIWTYIHIR
PSGEPM^EVWI E XVEZqW HIP QSXSV HI FWUYIHE QMIRXVEW UYI
PE ETPMGEGMzR HI GSQIVGMS IPIGXVzRMGS PI TIVQMXI EP GPMIRXI
IRZMEVYREWSPMGMXYHHITVIWYTYIWXSERYIWXVSHITEVXEQIRXS
HIZIRXEW
0E TjKMRE [IF HI 1EXIWX WI EGXYEPM^E HMEVMEQIRXI GSR PEW
PXMQEWRSZIHEHIWHIPEIQTVIWERYIZSWTVSHYGXSWTYFPMGE
GMSRIW]PEVITVIWIRXEGMzRIRJIVMEWGSQIVGMEPIWHIPQYRHS
%WMWXIRGMEXqGRMGE]WIVZMGMSW
PEEXIRGMzREPEWTIVWSREWIWRYIWXVSTVMRGMTMS
4VSTSVGMSREV ETS]S ] EWMWXIRGME XqGRMGE IR XSHEW PEW JEWIW
HI PE VIPEGMzR GSR PSW GPMIRXIW IW RYIWXVE ZIRXENE GSQTIXM
XMZE 2YIWXVSGYEPM½GEHSIUYMTSHIXqGRMGSWHI1EXIWXWSR
GSRWXERXIQIRXIEGXYEPM^EHSWWSFVIPEWPXMQEWRSXMGMEWIRIP
GEQTSHIIRWE]SHIQEXIVMEPIWTEVETSHIVSJVIGIV
ˆJSVQEGMzRXqGRMGETEVEPSWGPMIRXIW]EKIRXIW
ˆ ETS]S GYEPM½GEHS ] EWMWXIRGME VjTMHE TEVE PE MRWXEPEGMzR
TVYIFEW IWXVMGXEW HI QERXIRMQMIRXS TVIZIRXMZS VITEVE
GMzR]GIVXM½GEHSWHIGEPMFVEGMzR
ˆYRZEPMSWSETS]STEVEIPHIWEVVSPPSHITVSHYGXSWIRWMRIV
KMEGSRRYIWXVSWGPMIRXIW
1EXIWXWIHIWXEGETSVIPWIVZMGMSEPGPMIRXI%WMWXIRGMETVI]
TSWXZIRXEWSR
ˆWYQMRMWXVSNYWXSEXMIQTSGSRYRWXSGOGSQTPIXS]WMIQ
TVIHMWTSRMFPI
ˆVjTMHEVIRSZEGMzRHITMI^EWHIVITYIWXSEXVEZqWHIRYIW
XVSEPQEGqR
QIWIWHIKEVERXuEIWXjRHEVTEVEPEWTVIRWEW1EXIWXHIGSQTVIWMzR]¾I\MzRTEVELSVQMKzR]GIQIRXSWMRVMZEPIRPE
MRHYWXVME
-278691)28374%6%)27%=37()1%8)6-%0)7
0%82
7MKREXSV]SJ)%-%*ERH-0%'1YXYEP
6IGSKRMXMSR%KVIIQIRXW
Centro SIT n° 214
www.sit-italia.it
7IVZMGMSHIGEPMFVEGMzR
IP'IRXVS0%8R„1EXIWX
)PPEFSVEXSVMSHI1EXIWXLEWMHSEGVIHMXEHSGSQS'IRXVS0%8R„TEVE
PEGEPMFVEGMzRHIQjUYMREWHIGSQTVIWMzRHIQEXIVMEPIWHIEGYIVHSEPEW
2SVQEW92-)292-)2-73]&7
-73
JEFVMGERXIGEPM½GEHS
1EXIWXIWXjS½GMEPQIRXIEGVIHMXEHSTSVPERSVQE-73 TEVEIP
±HMWIyS JEFVMGEGMzR EWMWXIRGMEXqGRMGE]ZIRXEHIQjUYMREW IUYMTSWIMRW
XVYQIRXSWHIQIHMGMzRTEVEIRWE]SWHIQEXIVMEPIWHIPEGSRWXVYGGMzR]WY
MRWTIGGMzR²
'EHE TEWS HIP TVSGIWS HI JEFVMGEGMzR IW VMKYVSWEQIRXI GSRXVSPEHS TEVE
EPGER^EV]KEVERXM^EVPEQj\MQETVIGMWMzRIRXSHSWPSWIUYMTSWHIIRWE]SYR
VIUYMWMXSTEVEPEW2SVQEWMRXIVREGMSREPIW
+9È%()7)''-32)7
73*8;%6)981
TEKI
Å6-(3763'%7
TEKI
&)892)7%7*%0837
TEKI
,361-+Ì2
TEKI
')1)28371368)637
TEKI
%')637
TEKI
79)037
TEKI
)59-4%1-)283+)2)6%0 TEKI
È2(-')%2%0È8-'3
TEKI
È2(-')4362361%8-:%
TEKI
È2(-')436'Ì(-+3
TEKI
SOF TWA RE U T M 2
sección AA
SOFTWARE UTM2
(UNIVERSAL TESTING MACHINE 2)
Software desarrollado por Matest para permitir a los operadores una
cómoda operatividad y un uso fácil en el control de las máquinas
digitales de Matest.
El software se encuentra disponible en diferentes idiomas:
italiano, inglés, francés, español, alemán, polaco, checo, eslovaco, turco.
Es la solución más eficaz en los laboratorios por sus características de
versatilidad, con una amplia gama de personalizaciones, para los ensayos y la investigación.
El software es ideal para la gestión de una producción importante.
Contiene los archivos de los programas de ensayos de acuerdo a las
especificaciones de las normas EN así como de la normativa internacional más habitual.
14
La flexibilidad, la velocidad de ejecución, la precisión y el almacenamiento automático de datos son las características fundamentales del
software, concebido para facilitar al operador con pocos conocimientos de informática, una fácil realización de los ensayos y un correcto
funcionamiento del equipo.
Conectando un ordenador a la máquina de ensayos es posible la realización de los ensayos más complejos con solo presionar el botón
de inicio. UTM2 precisa un conocimiento básico del ordenador y no
requiere una experiencia previa específica para el uso el software con
éxito (con un bajo coste para la empresa).
Se facilita la impresión de los certificados de las actas de resultados
sugiriéndose una composición preestablecida, pero variable y personalizable por el usuario con su propio logotipo u otros.
El software UTM2 está desarrollado sobre la plataforma Windows y se
puede instalar en los sistemas operativos antiguos y nuevos, tales como
Windows 2000, XP,Vista, Windows 7.
instrumentos para ensayos de materiales
UTM2 Software - Licencias disponibles:
Características generales de UTM2
Rocas
1. Reconocimiento automático de la máquina con la que se
conecta.
A150N
Determinación del módulo elástico en la compresión
uniaxial y triaxial de rocas. Sistema automático con
un control de velocidad de carga constante incluso al
liberar la carga.
Betúnes Asfaltos
B043-01(N) Ensayo de compresión Marshall.
B043-02(N) Ensayo de tracción indirecta.
B043-03(N) Ensayos Leutner y Marshall.
Hormigónes
C109-10(N) Ensayo de compresión.
C109-11(N) Ensayo de flexión.
C109-12(N) Ensayo de tracción indirecta en probetas y adoquines
de hormigón.
C123 (N) “Servonet” para el control y gestión remota por PC
de las máquinas de ensayo.
C104-10N “Servo-Strain” para el servo control automático y
la gestión de la carga, el desplazamiento, la deformación.
Pruebas de punzonamiento en los platos, medida de
las deformaciones, apertura de grietas, deformación,
ductilidad, etc.
C125N
Determinación automática del Módulo Elástico
secante a compresión del hormigón. Sistema automático con un control de velocidad de carga constante incluso al liberar la carga.
Cementos y morteros
E163(N)
Ensayo de compresión.
E164(N)
Ensayo de flexión.
C123(N) “Servonet” para el control y gestión remota por
ordenador de las máquinas de ensayo.
S205-08
Ensayo de tracción en probetas de mortero.
E190N
Módulo de compresión elástica. Sistema automático con un control de velocidad de carga constante
incluso al liberar la carga.
2. Fácil configuración de la secuencia de operaciones de ensayo,
creación de un perfil de ensayo personalizado, salvable y reutilizable que permite ajuste de datos, ciclos de ensayo, canales y
menús de velocidades.
3. Memorización en la base de datos, de los ensayos con posibilidad de volver a elaborarse.
4. Control interactivo y remoto de la máquina de ensayo.
5. Permite la visualización de las cargas instantáneas, la definición
instantánea de la curva tensión/deformación/recorrido, el control remoto de las funciones generales de la máquina. Visualiza además las emergencias y los eventuales errores, calcula y
archiva todos los parámetros del ensayo efectuado con posibilidad de volver a procesar y de gestionar el archivo del ensayo.
sección AA
S O F TWARE UTM2
6. Los datos del ensayo pueden ser documentados mediante títulos o etiquetas de texto en los certificados de los ensayos o
sobre el gráfico deseado.
7. El usuario puede seleccionar los algoritmos de cálculo y, con
ellos el software procesará todos los resultados exigidos por las
Normas.
8. Los colores y las escalas gráficas de las ventanas activas pueden
ser elegidos libremente por el usuario, así como la ampliación de
los principales puntos de interés del gráfico.
9. El certificado de prueba se puede personalizar con las siguientes
variables: nombre de la empresa, tipo de prueba, fecha, tipo de
gráfico y número de las páginas.
Aceros
H009N
Ensayos de tracción de metales y otros materiales.
C123 -01N Ensayos de compresión con la máquina H011-01N.
Suelos
S218(N)
Ensayo CBR.
S218-01(N) Ensayos de compresión no confinada.
instrumentos para ensayos de materiales
15
sección AA
SOF TWA RE U T M 2
16
Software: B043-01(N) Licencia para el ensayo de compresión
Marshall.
Normas: EN 12697-34 / CNR N. 30 / ASTM D1559
NF P98-251-2 / BS 598 :107
Software: B043-02(N) Licencia para la prueba de tracción
indirecta sobre mezclas bituminosas.
Normas: EN 12697-23 / CNR N. 134 / ASTM D4123
Software: B043-03(N) Licencia para el ensayo Leutner y Marshall.
Normas: ALP A StB T.4 / EN 12697-34 / CNR N. 30
ASTM D1559 / NF P98-251-2 / BS 598 :107
Máquinas: B043 KIT (pág. 91) Prensa Marshall digital de 50 kN.
B044N SET (pág. 98) Visualizador digital para los
ensayos Marshall y CBR.
S214 KIT (pág. 379) Prensa CBR / Marshall digital de
50 kN.
B043-01 (N)
Plantilla de
resultados
B043-01(N)
Gráfica de carga/
deformación con
selección del registro.
S215 KIT(pág. 380) Bastidor de
carga universal digital
multivelocidad.
S205
(pág. 384) “Unitronic”
prensa universal.
Ensayo Marshall
Ensayo de tracción indirecta
Ensayo Leutner
B043-01(N)
Selección de los
algoritmos del
cálculo.
B043-01(N) Serie de probetas de ensayo.
B043-02(N) Introducción de
los datos.
B043-02(N) Informe del
ensayo.
B043-02(N) Gráfico carga/deformación.
instrumentos para ensayos de materiales
S O F TWARE UTM2
Software: C109-10(N) Licencia para ensayos de compresión de hormigón.
Normas: EN 12390-3, UNI EN 679 / UNI 6686, 6132,
BS 1881, UNE 83304, DIN 51220, ASTM C39, NF P18-411
Software: E163(N) Licencia para ensayos de compresión de morteros.
Normas: EN 196-1, ASTM C109
Software: E164(N) Licencia para ensayos de flexión de morteros.
Normas: EN 196-1, ASTM C348
Máquinas: C109N (pág.130) “Cyber-Plus” 8 Evolution con
pantalla táctil, unidad de ocho canales digitales, aplicable a todas las prensas de compresión y flexión de
hormigones y morteros.
C109N
C108N
sección AA
Software: C109-11(N) Licencia para ensayos de flexión de hormigón.
Normas: EN 12390-5, UNI EN 1340:4, UNI 6133,
BS 1881:118, NF P18-407, ASTM C78, C293
Máquinas: C108N (pág.127) Digitec, unidad de dos canales
digitales, aplicable a todas las prensas de compresión
y flexión de hormigones y morteros.
17
Ensayo de compresión
de hormigón
C109-10(N)
Informe de ensayo
a compresión
C109-10(N) Gráfico de ejecución del ensayo a compresión
C109-11(N)
Flexión: resumen de
los cálculos según
Norma
C109-11(N)
Informe de
ensayo a flexión
C109-11(N)
Gráfico de ejecución
del ensayo a flexión
C109-11(N) Flexión: presentación de los datos de ensayo
Ensayo a flexión de hormigón
instrumentos para ensayos de materiales
SOF TWA RE U T M 2
E164(N)
Presentación de los datos del ensayo a
flexión
sección AA
E164(N) Informe de
ensayo a flexión
Ensayo de flexión/compresión en morteros
18
E163(N) Informe de ensayo a compresión
Ensayo de tracción indirecta
E164(N) Gráfico de ejecución del ensayo a flexión
C109-12(N) Gráfico de
ejecución de ensayo
Software: C109-12(N) Licencia para ensayos de tracción indirecta sobre probetas cúbicas, cilíndricas y adoquines
de hormigón.
Normas: EN 12390-6, UNI EN 1338, 1339,
UNI 6135, ASTM C496
Máquinas: C101-01 (pág. 211) Dispositivo para el ensayo de
tracción indirecta sobre cilindros.
C103 (pág. 211) Dispositivo para el ensayo de tracción
indirecta sobre cubos y adoquines.
instrumentos para ensayos de materiales
S O F TWARE UTM2
Software: C125N Licencia para el módulo elástico secante a compresión del hormigón.
La licencia Servonet está incluida.
Normas: UNI 6556, ASTM C469, ISO 6784, DIN 1048
sección AA
Software: C123(N) “Servonet” Licencia para el servo-control automático y la gestión remota a través del ordenador. En esta licencia
están incluidos también los softwares para ensayos de compresión y flexión en hormigones y morteros.
Normas: EN 12390-3, 12390-5, 679, 196-1,
UNI 6686, 6132, BS 1881, ASTM C39, C78,
C109, C293, C348,
NF P18-411, P18-407, UNE 83304, DIN 51220
C098N
Software: A150N Licencia para el módulo elástico a compresión de
rocas. La licencia Servonet està incluida.
Normas: EN 9724-8, ASTM D3148, D2938, D5407, D2664,
ISRM
Software: E190N Licencia para el módulo elástico a compresión de
morteros. La licencia Servonet està incluida.
Norma: EN 13412
Máquinas: C104N (pág. 130) – “Servo-Plus” 8 Evolution con pantalla táctil.
Sistema automático servo controlado de 8 canales.
Aplicable a todas las prensas de compresión y flexión de hormigones y morteros.
19
C104N + C104-04
C098N (pág. 127) – “Autotec”. Sistema automático servo
controlado de 2 canales.
Aplicable a todas las prensas de compresión y flexión de hormigones y a las prensas de ensayos de morteros con monopistón.
C125N
Personalización y
composición de la presentación del ensayo.
C125N
Selección
de la presentación del
ensayo (UNI 6556)
C125N
Personalizaciones del
certficado de ensayo.
C125N
Pantalla durante el ensayo,
con “marker” en cada
variación.
C125N
Ensayo con dos ciclos
de confirmación.
instrumentos para ensayos de materiales
sección AA
SOF TWA RE U T M 2
Software: C104-10N “Servo-Strain”. Software / Firmware para
el control automático y la gestión de las prensas con
función de:
- tensión / deformación,
- desplazamiento,
- esfuerzo,
en los ensayos de deformación, ductilidad, comportamiento posterior a la ruptura de probetas de hormigón
armado con fibras (FRC), de polímeros reforzados con
fibras (FRP), y también para ensayos de investigación.
Pruebas de deflexión en vigas de hormigón reforzado
con fibras.
Normas: EN 11039-03, 14487-1,
14488-1, 14651-05
ASTM C1018
Ensayos sobre testigos de hormigón
proyectado realizando mediciones
de la absorción de energía.
Normas: EN 10834, 14488-3,
14488-05
Máquinas: C104-10N Servo-Strain (pág. 136)
+ C104N Servo-Plus Evolution (pág. 130)
Sistema servo-controlado en función de: carga o fuerza,
desplazamiento, deformación, adaptable a las máquinas
de ensayos de compresión y flexión Matest.
20
C104-10N + C089-04N
Gráfico Tensión / Deformación
instrumentos para ensayos de materiales
sección AA
S O F TWARE UTM2
E190N Personalización y composición de la presentación del ensayo.
E190N Gráfico típico
de ensayo en curso.
21
E190N Selección de la Norma del ensayo con posibilidad de personalizar los algoritmos de cálculo.
A150N Selección de la
Norma del ensayo con
posibilidad de personalizar
los algoritmos de cálculo.
E190N Introducción de los datos y personalización de la presentación del ensayo.
A150N Representación gráfica con posibilidad de personalización de las escalas y del tamaño de visualización.
A150N Personalización y
composición del certificado
de ensayo.
A150N Ejemplo de gráfico del ensayo en
curso con representación de las deformaciones longitudinales y transversales.
A150N Introducción de los datos y personalización de la presentación del ensayo.
instrumentos para ensayos de materiales
SOF TWA RE U T M 2
Software: H009N Licencia para los ensayos de tracción
Normas: EN 10002, ISO 527, 178, 604, 10113, 12275, ASTM A370
Máquinas: H002N a H008 (pág. 328 ÷ 335)
Prensas universales de ensayos de tracción de materiales metálicos.
sección AA
Máquinas: H011N y H011-01N (pág. 338) Prensas universales de
ensayos de tracción/compresión.
22
Ensayo de tracción de probeta en acero sin extensómetro,
visualizando la estricción del material con posibilidad de
ampliación de la zona de interés mediante la función del zoom.
Ejemplo de recuperación del archivo de un trazado del ensayo,
donde es posible seleccionar por el usuario que trazados mostrar,
modificar las escalas o personalizar los colores y renombrar los ejes.
Ejemplo de
impresión de informe del ensayo.
Selección de la Norma de ensayo con la posibilidad
de seleccionar los parámetros y personalizar el
algoritmo de cálculo.
Ensayo de tracción de probetas
en acero con extensómetro,
mostrando los símbolos de
los parámetros y los trazados
relativos en diferentes colores
seleccionables por el usuario.
instrumentos para ensayos de materiales
Ejemplo de pantalla de inserción de los datos del ensayo.
Ejemplo de impresión del certificado del
ensayo, personalizado con el logo del cliente
introducido en un archivo (JPG, BMP, TIFF, etc.).
Software: S218(N) Licencia para el ensayo CBR
Normas: EN 13286-47, CNR UNI 10009,
ASTM D1883, BS 1377:4, NF P94-078
Software: S218-01(N) Licencia para ensayos de compresión no confinada.
Norma: ASTM D2166
Máquinas: S216 KIT (pág. 379) Prensa CBR digital de 50 kN
S214 KIT (pág. 379) Prensa CBR/Marshall digital de 50 kN
S215 KIT (pág. 380) Bastidor de carga universal digital
multivelocidad.
S205 (pág. 384) Prensa Universal “Unitrónic”
B044N-SET (pág. 98) Visualizador digital para los ensayos
Marshall y CBR.
Introducción datos de ensayo.
sección AA
S O F TWARE UTM2
Selección algoritmos de cálculo.
Software: S205-08 Licencia para ensayos de
tracción en probetas de mortero.
Normas: ASTM C190, C307
AASHTO T132
Máquinas: S205-05 (pág. 384)
Prensa Universal “Unitronic”
Gráfico de carga deformación.
Informe del ensayo CBR.
Los softwares enumerados anteriormente se describen con detalle y codigos en los campos de aplicación específicos del catálogo.
El software está protegido por una llave de hardware que permite el uso del aparato sólo para las licencias adquiridas (en relación con la
normativa del perfil activado).
instrumentos para ensayos de materiales
23
HA RDWA R E
CYBER-PLUS 8 EVOLUTION
“PANTALLA TÁCTIL”
sección AA
SISTEMA DE ADQUISICIÓN DE DATOS CON 8 CANALES
ANALÓGICOS
24
Adaptable a las siguientes máquinas:
B039
Compactador de rodillo
B043-KIT Prensa Marshall digital
B044N
Sistema de adquisición de datos para ensayos Marshall,
CBR, ensayos no confinados, etc.
B055-10
Ductilómetros
C109N
Sistema de adquisición de datos para ensayos de compresión / flexión en hormigón y morteros.
C104N
Servo-plus para los ensayos de compresión / flexión de
hormigón y morteros.
C138N
Sistema digital para la calibración en fuerza de las máquinas
de ensayo.
C155N
Sistema digital para la verificación de estabilidad y uniformidad de la fuerza en las máquinas de compresión.
C405-15N Sistema de adquisición de datos para ensayos con: pistones
planos / deflectómetros para ensayos sobre forjados,
puentes, etc , placa de carga.
H003N, H002N, H011N, H011-01N Máquinas universales para
ensayos de tracción en aceros
S214-KIT Prensa digital para ensayos CBR/Marshall (2 velocidades)
S215-KIT Bastidor de carga universal digital multivelocidad.
S216-KIT Prensa CBR digital
S335N
Sistema de adquisición de datos para ensayos con: edómetros, corte directo, equipos triaxiales.
Especificaciones técnicas HARDWARE
- Procesador: 312 MHz ampliable hasta 806 MHz para aplicaciones
específicas
- Pantalla táctil a todo color LCD, QVGA (320x240 píxels)
- Teclado de selección con 5 botones. Puede sustituir por completo la
función de la pantalla táctil (para usarse fácilmente con guantes)
Hardware – Conectividad
- Ethernet 10/100 Mbit
- 1 x tarjeta SD
- 2 x puertos USB para: ratón, teclado, pen-drive, impresora, divisor USB
(para ampliar el número de puertos), y otros periféricos desde el PC
Hardware – I/O
- 8 canales ADC convertidor con 2 canales de alta resolución para el uso
con células de carga
Frecuencia de muestreo: hasta 200 Hz (en los 8 canales)
Número de bits: hasta 24
- 8 entradas digitales
- 8 salidas digitales
El motor de encendido
Válvulas de activación
- Ampliación de conectores
Hardware - Operaciones de control
- 2 x controladores de motor paso a paso
1 x controlador estándar
1 x controlador opcional
- Motor sin escobillas, a través del conector de expansión
Hardware – Almacenamiento
- Memoria interna flash, dedicada al software y a la configuración de
perfiles, máquina, canales (incluyendo calibraciones), ensayos, etc.
- Memoria ilimitada mediante dispositivos externos de memoria
Tarjeta-SD
Lápiz de memoria
Hardware – Varios
- Impresora térmica para gráficos incorporable (accesorio: C127N)
- Calendario Reloj
- Alarma de zumbador
Software
- Sistema operativo: “Windows Embedded CE 6.0 R3”
Interfaz de usuario sencilla
Fácil actualización de software y sistema operativo
- Ajustado a las configuraciones internacionales
Interfaz multi-idioma
Formato del sistema de fecha, hora y número
Sistemas de medición (S.I.; sistema U.S.)
- Software en módulos
A cada Norma de referencia de la máquina puede cargarse a través de
módulos de software fáciles de instalar
- Alta capacidad de cálculo
Superior capacidad de cálculo
Representación gráfica de los datos del ensayo
Independiente del uso del ordenador
Software – Idiomas
- italiano, inglés, francés, alemán, español, ruso, polaco. Otros idiomas bajo
pedido.
Software – Licencias
- Cada máquina tiene un único número de serie específico
- Cumplimiento de la Noma específica a través de los archivos de licencia
dedicada
Software - Registro e informe
- Registros de los resultados del ensayo: fecha, resultados, tablas
- Impresión:
A través de la impresora incorporada (accesorio C127N)
A través de una impresora PCL conectada a un puerto USB
Software - “Mantenimiento”
- Actualizaciones disponibles: sistema operativo, aplicaciones, licencias
(copia de seguridad y restauración), configuración (copia de seguridad y
restauración), registro de software.
- Nuevo “UTM”: control de la máquina a través de Ethernet (intranet,
internet)
- Conexión a Internet para asistencia remota
C104-05
PAQUETE DE ASISTENCIA EN LÍNEA REMOTA
La máquina cuenta con una conexión a Internet a través de la cual
la línea de Atención al Cliente de Matest proporciona un soporte
en tiempo real para analizar el problema, y encontrar una solución
posible, llevando a cabo una ejecución correcta de la prueba.
instrumentos para ensayos de materiales
sección A
ÁRIDOS - ROCAS
sección A
ÁRIDO S - ROC AS
Los áridos representan el producto mas empleado en la industria de la construcción: utilizados en la fabricación del hormigón,
mezclas bituminosas, morteros, bases para carreteras y vías de
ferrocarril, etc.
Las diferentes Normas Internacionales, y en particular las Normas
europeas EN, exigen numerosos ensayos sobre diferentes propiedades de los materiales como puedan ser: mecánicas, físicas,
geométricas, diferentes densidades, dureza, alterabilidad, etc.
Un estrato rocoso sufrirá alteraciones, respecto sus características
mecánicas iniciales, cuando se le somete a excavaciones, movimientos de tierras, etc.
Por esta razón, se hace indispensable un estudio de las características mecánicas de la roca intacta, para poder analizar el
comportamiento relativo, en la realización de infraestructuras, subterráneas como túneles, galerías o superficiales como canteras y
cimentaciones.
instrumentos para ensayos de materiales
25
ÁR I D OS - RO C A S
sección A
ESTUFAS DE SECADO PARA USO GENERAL
DE LABORATORIO
Convección natural, termostato con pantalla digital.
Diseñadas para la desecación, acondicionamiento de muestras y
determinación de la humedad.
De fabricación robusta, tiene doble pared y un aislamiento térmico
mediante 60 mm de fibra de vidrio.
La parte exterior delantera está fabricada en acero inoxidable, así
como la cámara interior, la rejilla y las paredes externas, también
están realizadas en acero inoxidable.
La temperatura se controla mediante un termorregulador con
panel digital, desde temperatura ambiente, hasta los 200 °C. Las
estufas se encuentran equipadas de un termostato de doble seguridad con un mayor umbral térmico para prevenir sobrecalentamientos accidentales y garantizar condiciones de trabajo seguras.
La estufa se suministra completa con dos rejillas de fácil extracción
y pudiendose colocar en varias alturas, piloto de encendido y
respiradero para un enfriamiento rápido.
Alimentación: 230V 50-60Hz monofásica
A007-01 KIT + A006-08
26
Modelo
A007
A007-01 KIT
A007-04 KIT
A007-08 KIT
Capacidad
en litros
Dimensiones
internas en mm.
L P H
Dimensiones
externas en mm
L P H
Nº de
puertas
Potencia
en Watios
Peso
en kg
Rejilla de
recambio
50
100
220
440
350x360x390
400x420x600
600x610x600
900x700x700
590x460x620
640x515x805
840x725x805
1140x760x910
1
1
1
2
750
1200
2000
3600
34
40
60
85
A006-01
A007-51
A007-52
A007-53
Termostato de doble
seguridad
A007-08 KIT + A006-08
ACCESORIO:
A006-08 Termómetro de control de mercurio 0-300 ºC, división 1 ºC.
instrumentos para ensayos de materiales
ÁRIDO S - ROC AS
ESTUFAS DE LABORATORIO, CON VENTILACIÓN FORZADA Y TERMOSTATO
DIGITAL. GRAN UNIFORMIDAD Y PRECISIÓN DE TEMPERATURAS
Modelo
A008-01 KIT
A008-03 KIT
A008-05 KIT
A008-07 KIT
sección A
NORMAS: EN 932-5 / EN 1097-5 / ASTM C127, C136, D558, D559, D560, D698, D1557, D1559
BS 1377 :1, 1924 :1 / UNE 103300
Particularmente indicada cuando se requiera gran
uniformidad y precisión de temperaturas dentro de
la cámara.
La exactitud de la temperatura y su uniformidad se
encuentran garantizadas dentro de las tolerancias
solicitadas por las Normas.
La cámara interior, la rejilla y la parte exterior
delantera son de acero inoxidable, mientras que las
paredes externas son de acero galvanizado.
De fabricación robusta, tiene doble pared y un aislamiento térmico mediante 60 mm de fibra de vidrio.
Temperatura controlada por medio de un preciso
termostato digital con escala desde temperatura
ambiente hasta 200 ºC. Las estufas se encuentran
equipadas con un termostato de doble seguridad
con un mayor umbral térmico para prevenir sobrecalentamientos accidentales y garantizar condiciones
de trabajo seguras.
La estufa se suministra completa con dos rejillas
de fácil extracción y pudiendose colocar en varias
alturas, piloto de encendido y respiradero para un
A008-07 KIT
enfriamiento rápido.
Alimentación: 230V 50-60Hz monofásica
27
Capacidad
en litros
Dimensiones
internas en mm.
L P H
Dimensiones
externas en mm
L P H
Nº de
puertas
Potencia
en Watios
Peso
en kg
Rejilla de
recambio en
acero inoxidable
100
220
440
750
400x420x600
600x610x600
900x700x700
900x640x1300
700x515x910
900x725x910
1250x760x1000
1250x700x1600
1
1
2
2
1250
2050
3700
4950
45
70
95
140
A008-51
A008-52
A008-53
A008-54
- Corriente de aire mediante ventilación forzado
- Sistema digital de control de temperaturas
- Cumple con la precisión y uniformidad de temperaturas según requerimientos de las Normas EN y BS
- Cámara y rejillas de acero inoxidable
- Aislamiento mediante un espesor de 60 mm de fibra
de vidrio
- Termostato doble que asegura condiciones de trabajo seguras
A008-07 KIT
ACCESORIOS:
A006-08 Termómetro de control de mercurio 0-300 ºC,
división 1 ºC.
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
sección A
Hornos de mufla
NORMAS: EN 12697-1 all. C, UNI EN 13108
Diseñados para el calentamiento a altas temperaturas.
Estructura construida en chapa de acero, frontal del horno realizado
en acero a presión para evitar la agresión de los humos ácidos.
El aislamiento térmico está realizado en fibras cerámicas para evitar
la mínima pérdida de calor y realizar un gran ahorro energético. Regulación electrónica con panel de temperatura obtenida
mediante termostato digital. Este horno también se puede utilizar
para la determinación del árido residual mediante la incineración de
mezclas bituminosas según el anexo C de la Norma EN 12697-1.
Temperatura máxima: 1100 ºC
Dimensiones internas: 210x320x145 mm
Dimensiones externas: 500x750x650 mm
Peso: 88 kg aprox.
Modelos Temperatura
máxima
28
A022
A023
1100°C.
1100°C.
Alimentación
230V 50-60 Hz 1F
400V 50-60 Hz 3F
Potencia
en Watios
3900
3900
A024
Horno de Mufla de 1200 ºC
NORMAS: EN 196-2, 196-21, 459-2
Utilizado para la determinación de la pérdida por ignición de las
cales y cementos, cloruros, dióxido de carbono y del contenido en
álcalis del cemento.
Temperatura máxima: 1200 ºC.
El aislamiento térmico está constituido por fibras cerámicas.
Mufla de calentamiento con enroscado desde la parte posterior y
molde de refracción de una pieza.
Puerta de apertura lateral, cierre por cuña de presión, y con un dispositivo de parada de la alimentación eléctrica con la puerta abierta.
El panel de control está situado en la parte inferior con un termostato digital con pantalla y magneto térmico para la protección del
sistema.
Dimensiones internas (axlxh): 145x250x100 mm
Dimensiones totales: 500x650x650 mm
Alimentación: 230V monofásica 50/60Hz 4200W
Peso: 70 kg
A024
instrumentos para ensayos de materiales
A022
A023-01
Horno de Mufla 1100 ºC
Gran capacidad
Horno montado sobre soporte, la mufla está constituida por 4
paneles que contienen resistencias radiantes independientes.
El aislamiento térmico se mantiene mediante láminas refractarias
micro-porosas de densidad gradual.
La regulación automática se realiza mediante un pirómetro electrónico de doble efecto con visualizador y temporizador de 0-24 horas.
Temperatura máxima: 1100 ºC.
Este horno también se puede utilizar para la “Determinación de la
resistencia de los áridos al choque térmico según las especificaciones de la Norma EN 1367-5”.
Dimensiones internas: (axlxh): 300x500x220 mm
Dimensiones totales: 750x1100x1650 mm
Alimentación: 400V 3Fases 50/60Hz 9kW
Peso: 400 kg
ACCESORIOS para Hornos de mufla:
A023-11 Programador de temperaturas.
A023-01
Contenido de Cloruros. Método Rápido
A106
NORMAS: BS 812:117 / BS 1377:3
Se utiliza para la determinación del contenido de cloruros en las
arenas y finos.
Horno para fundición
A019-01
Quantab tiras de valoración de cloruros, tipo 1175, escala entre
0,005% y el 0,1% (30 a 600 ppm) de Na Cl. Paquete de 40 tiras.
A019-02
Quantab tiras de valoración de cloruros, tipo 1176, escala entre
0,05% y el 0,1% (300 a 6000 ppm) de Na Cl. Paquete de 40 tiras.
A019-03
Tiras para la determinación de sulfatos, rango de detección
de 200 a 1600 mg/l. Paquete de 100 tiras.
Utilizado para fundir cera y otros materiales, suministrando calor
desde temperatura ambiente hasta un máximo de 350 ºC.
Completo con un termostato ajustable desde + 50 ºC a + 350
ºC con exactitud de ±1,5 ºC., la lámpara piloto se encuentra
totalmente aislada cumpliendo
exigencias CE.
Capacidad: 5 litros
Dimensiones internas:
Ø 200x160 mm
Alimentación:
230V 50/60Hz
monofásica 800W
Peso: 3 kg
sección A
ÁRIDO S - ROC AS
ACCESORIOS:
A106
V300-19
CERA DE PARAFINA, para uso general de laboratorio, con un
punto de fusión entre 50-54 ºC. Paquete de 5 kg.
V201
A019-01
A019-03
A019-02
Placas calefactoras, completas con termorregulador.
Secador de aire caliente,
para uso general de laboratorio, para
secar muestras de áridos y suelos.
Alimentación:
230V monofásica 50Hz 1200W
V201
Alimentación: 230V monofásico 50/60Hz
MODELOS:
V200
Diámetro de la placa 185 mm – 1500W
V200-02 Diámetro de la placa 220 mm – 2000W
B074
Diámetro de la placa 160 mm – 1000W
V200-01 Rectangular 200x300 mm – 1500W
V200-03 Rectangular 300x400 mm - 2400W
V200-05 Rectangular 400x500 mm – 3400W
V200-06 Rectangular 400x600 mm – 4000W
B074
V200-03
B073-01
V200
A009
B073-01
Horno de microondas
Agitador/calentador magnético para titulación y
Utilizado para secados rápidos,
determinación de la humedad, y
acondicionamiento de muestras.
Alimentación:
230V monofásica 50Hz 700W
Peso: 28 kg
agitación de líquidos y materiales semi-sólidos.
Diámetro de la placa 150 mm. Velocidad y temperatura variables
mediante reguladores electrónicos.
Suministrado completo con imanes recubiertos con teflón.
Alimentación: 230V 50Hz monofásica 400W
A009
instrumentos para ensayos de materiales
29
sección A
ÁR I D OS - RO C A S
A028
Medidores de humedad “Speedy”
Medidor de carburo universal
NORMAS: BS 6576 / ASTM D4944 / AASHTO T217 / UNE 7804
Para determinaciones precisas de la humedad “in situ” de suelos,
arenas, áridos. La reacción del sistema se produce cuando el
agua y el carburo de calcio entran en contacto formando un gas.
Completo con balanza electrónica, lata de reactivo, accesorios; el
conjunto se transporta en un maletín acolchado.
NORMAS: BS 6576 / AASHTO T217 / ASTM D4944 / UNE 7804
Para una determinación rápida y precisa del contenido de humedad
presente en arenas, gravas, áridos, suelos, etc. basado en el método
de carburo de calcio. El peso de la muestra puede variar de 3 a 100 g
determinando rangos de humedad que van desde 50% (3g) – 7,5% (20g)
– 1,5% (100g). La botella está provista y calibrada con un termómetro de
superficie. Con la agitación de la botella, una vez cerrada esta, se rompe
la ampolla de cristal que contiene el carburo de calcio, garantizando una
mayor precisión del ensayo. El equipo comprende la botella de pruebas
con el manómetro, una pequeña balanza, 25 ampollas de reactivo, accesorios, maleta. Dimensiones: 520x340x140 mm. Peso: 6 kg aprox.
MODELOS:
A025 KIT Equipo para la determinación rápida de la humedad de
capacidad 6 gramos. Rango de humedad: 0- 20%.
Peso: 6 kg
A028
30
A025 KIT
A026 KIT Equipo para la determinación rápida de la humedad de
capacidad 20 gramos. Rango de humedad: 0- 20%.
Peso: 8 kg
A028 SP
Medidor de carburo universal
Igual al mod. A028, pero con una botella más grande para poder
analizar 20 g de muestra con una humedad superior al 25%.
A028-01
Medidor digital de carburo universal
Igual al mod. A028, pero con manómetro digital para lecturas más
precisas con pantalla de presión y temperatura.
Suministrado completo.
RECAMBIOS:
A027-01
Reactivo para el ensayo de
humedad (lata de 450g).
ACCESORIOS:
A027-11
Equipo de calibración del Speedy.
A026 KIT
A028-02
A028-02
Medidor digital de carburo universal
Igual al mod. A028, equipado con impresora para obtener certificado de ensayo, con un máximo de 7 registros de presión/ tiempo.
Peso: 8 kg
RECAMBIOS:
A028-11
Ampollas de carburo
(paquete de 100)
instrumentos para ensayos de materiales
A028-01
A028-11
ÁRIDO S - ROC AS
A021-10
A021-10
Humidímetro digital microondas portátil
sección A
Para la determinación precisa, rápida y fácil del contenido de humedad en arena, áridos finos y gruesos de hasta 25 mm de diámetro.
Utilizando la última tecnología de microondas y microprocesadores, simplemente insertando las 5 puntas en el material a medir, la
pantalla nos mostrará el porcentaje de contenido de humedad.
Rango de medición: 0-20% con ±0,2% de precisión.
Frecuencia: 50Mhz; puerto de datos RS232, más de 150 lecturas de
almacenamiento.
Alimentación: 4 pilas AA
Peso: 1800 g
A021
Humidímetro electrónico “Microlance”
Este equipo electrónico mide el porcentaje de humedad y la
temperatura de la arena y áridos finos, hasta un máximo de 10 mm
diámetro, visualizándose directamente en la pantalla, simplemente
insertando la punta de la lanza.
Apto para los ensayos in situ y de laboratorio.
Rango de humedad: 0-35%, precisión 0,5%
Profundidad de medición: 1000 mm
Rango de temperatura: -20 °C a +60 °C, precisión de 0,5 °C.
Batería: 4x1.5V pilas AA
Dimensiones: 120x120x1200 mm. Peso: 2 kg
A021-01
Humidímetro
electrónico
“Microlance”
A029
Matraz de Chapman
NORMAS: ASTM C70 / AASHTO T142
Se utiliza para la determinación de la humedad superficial de los
áridos finos. Enrase a 200 ml entre los dos bulbos y desde 375
hasta 450 ml por encima del segundo bulbo. Peso: 500 g
A021
Igual al mod. A021,
pero con medidas hasta
2000 mm de profundidad.
Dimensiones:
120x120x2200 mm
Peso: 3 kg
A029
A035
A039
A030
Recipientes de reacción
A021 dettaglio
NORMAS: UNI 8520-22 / ASTM C289 / NF P94-048
UNE 146507-1
Se utilizan para la determinación química de la reactividad potencial
de los áridos con los álcalis del cemento portland en el hormigón.
Fabricados en acero inoxidable y provistos de una tapa hermética.
Capacidad: 60 ml aprox.
MONTADO
Peso: 2 kg
A030
Desecadores de cristal borosilicato
Completo con placa de porcelana perforada.
sin vacío
con llave para el vacío
A035
Diá. 200 mm
A036
Diá. 250 mm
A036-01 Diá. 300 mm
A039
Diá. 200 mm
A040
Diá. 250 mm
A040-01 Diá. 300 mm
V023-01
DESMOTADO
V023-01
ACCESORIO:
V300-15 Sales desecantes de gel de sílice, caja de 1000 g
Balanzas para la determinación de la humedad
Vea la sección “V” Equipamiento General pág. 435
instrumentos para ensayos de materiales
31
ÁR I D OS - RO C A S
sección A
Tamices de barras para la determinación del índice de lajas y forma de las partículas en
los áridos
NORMAS: EN 933-3 / UNI 8520-18
NF P18-561 / NLT 354
El bastidor es de aluminio anodizado y la malla está
formada por “barras de acero inoxidable con un
diámetro entre 5 y 15 mm “, según del espaciado
de las ranuras.
Las medidas de los tamices, las tolerancias de las
ranuras y el diámetro de las barras son comprobados individualmente cumpliendo todos ellos con la
Norma EN 933-3.
Cada tamiz se suministra completo con una
etiqueta identificativa con el número de serie.
Peso: 4 kg cada tamiz.
Modelo
32
A048-01
A048-02
A048-03
A048-04
A048-05
A048-06
A048-07
Ancho de
ranura en mm
2,50
3,15
4,00
5,00
6,30
8,00
10,00
Modelo
A048 KIT
Ancho de
ranura en mm
A048-08
A048-09
A048-10
A048-11
A048-12
A048-13
12,50
16,00
20,00
25,00
31,50
40,00
A048 KIT Conjunto completo de 13 tamices de 2,5 (A048-01) a
40 mm (A048-13) de ancho entre barras.
A048-14 Tamiz de barras de 9,5 mm de ancho entre barras.
Utilizado para comprobar el desgaste en las esferas de
diámetro nominal 10 mm de la máquina Micro-Deval.
Tamices para el índice de lajas
ACCESORIOS PARA TAMICES DE BARRAS:
A048-20 Conjunto de dos dispositivos, en aluminio anodizado,
completo con tornillos de acero inoxidable, para fijar un
tamiz de barras sobre otro y conseguir una columna de
tamices para utilizarlos en tamizadoras mecánicas.
A048-21 Tapa para tamices de barras, hecha de aluminio anodizado.
A048-22 Fondo para tamices de barras, en aluminio anodizado,
completo con dispositivo de acoplamiento para fijar a
las tamizadoras Matest modelos A059-02 / A059-03 /
A059-04 / A060-01.
A048-21
A048-21
A048-22
NORMA: BS 812
Se utilizan para determinar la lajosidad de los áridos, es decir, si su
espesor es inferior a 0,6 veces su diámetro nominal. Fabricado en
chapa de acero maciza, cumplen con las dimensiones especificadas
en las Normas y están disponibles en los siguientes tamaños de
abertura:
Modelo
A049-01
A049-02
A049-03
A049-04
A049-05
A049-06
A049-07
A048-20
A048-15
Calibre para el coeficiente
de forma
NORMA: UNI 8520 Parte 18a.
Se utiliza para determinar el volumen
de la esfera circunscrita. Fabricado en
chapa de latón macizo.
instrumentos para ensayos de materiales
A048-15
A049 KIT
Ancho de la Longitud de la
ranura mm
ranura mm
4,9
7,2
10,2
14,4
19,7
26,3
33,9
30
40
50
60
80
90
100
A049 KIT
Juego completo
de 7 tamices de
ranuras.
Peso: 15 kg
ÁRIDO S - ROC AS
Tamices de ensayo para análisis granulométricos
sección A
NORMAS: EN 933-1, EN 933-2 / ISO 3310-1, ISO 3310-2, ISO 565 / ASTM E 11 / AASTHO T27 / BS410
UNI 2331, UNI 2333 / DIN 4187-1 / UNE 7050
Todos los tamices están fabricados en acero inoxidable, tanto la malla como el bastidor y cumplen las Normas Internacionales.
Los tamices están disponibles en los siguientes diámetros: 200 - 250 – 300 - 315 - 400 - 450 mm y 8 “- 12”.
La abertura del tamiz está claramente marcada en la etiqueta metálica, con el número de serie para su identificación y trazabilidad.
Cada tamiz se suministra con el certificado de conformidad.
CÓMO COMPRAR LOS TAMICES DE MALLA
NORMAS: ISO 3310-1 / EN 933-1, 933-2, / BS410
UNE 7050 / DIN 4187-1 / UNI 2331, 2333 / ASTM E11
Las luces de los tamices de malla disponibles se enumeran en las
páginas siguientes y están codificados a partir del n ° 01 al 77.
El comprador debe añadir a este número:
A052-…
A051-…
A053-…
A054-…
A055-…
A044-…
A050-…
A043-…
para un bastidor de 200 mm diá.
para un bastidor de 250 mm diá.
para un bastidor de 300 mm diá.
para un bastidor de 315 mm diá.
para un bastidor de 400 mm diá.
para un bastidor de 450 mm diá.
para un bastidor de 8 “ diá.
para un bastidor de 12 “ diá.
A052-...
NOTA: Es posible ensayar hasta aprox. 1000 g. de material
mediante el uso de tamices de 200 mm de diámetro, y
3000 g con los tamices de 300 mm de diámetro.
CÓMO COMPRAR TAMICES DE CHAPA PERFORADA
“Sección cuadrada”
NORMAS: ISO 3310-2 / EN 933-2 / BS 410 / DIN 4187-1
Las aberturas disponibles de la perforación de la chapa perforada
de sección cuadrada, se enumeran en las siguientes páginas y se
codifican desde el n° 01 al 37.
El comprador debe añadir a este número:
A031-…
A032-…
A033-…
A034-…
para un bastidor de 200 mm diá.
para un bastidor de 300 mm diá.
para un bastidor de 400 mm diá.
para un bastidor de 450 mm diá.
A031-...
NOTA: La Norma EN 933-2 requiere que los tamices de luz
igual o superior a 4 mm deben ser de chapa perforada
quadrada y los inferiores de malla de alambre.
CÓMO COMPRAR TAMICES DE CHAPA PERFORADA,
“Sección Redonda”
NORMA: UNI 2334
Las aberturas disponibles en tamices de chapa con perforación
redonda se enumeran en las siguientes páginas y se codifican desde
el n° 01 al 40.
El comprador debe añadir a este número:
A037-… para un bastidor de 200 mm diá.
A038-… para un bastidor de 300 mm diá.
A041
A037-...
Certificado “UKAS” para tamices “MASTER”. Todos los
tamices pueden ser suministrados con certificado UKAS
para que sean clasificados como “TAMIZ MASTER”.
instrumentos para ensayos de materiales
33
ÁR I D OS - RO C A S
Tabla de los tamices de malla
sección A
NORMAS: EN 933-1, EN 933-2 / ISO 3310-1 / ASTM E11 / UNI 2331, UNI 2333 / UNE 7050 / BS 410 / DIN 4187-1
34
Luz de malla
mm
Nº ASTM
Numero
Bastidor diá.
200 mm
Bastidor diá.
300 mm
Luz de malla
mm
Nº ASTM
Numero
Bastidor diá.
200 mm
Bastidor diá.
300 mm
0,025
-
A052-00
A053-00
2,800
7
A052-40
A053-40
0,038
400
A052-01
A053-01
3,150
-
A052-41
A053-41
0,040
-
A052-02
A053-02
3,350
6
A052-42
A053-42
0,045
325
A052-03
A053-03
4,000
5
A052-43
A053-43
0,050
-
A052-04
A053-04
4,750
4
A052-44
A053-44
0,053
270
A052-05
A053-05
5,000
-
A052-45
A053-45
0,063
230
A052-06
A053-06
5,600
3,5
A052-46
A053-46
0,075
200
A052-07
A053-07
6,300
1-4”
A052-47
A053-47
0,080
-
A052-08
A053-08
6,700
0,265”
A052-48
A053-48
0,090
170
A052-09
A053-09
7,100
-
A052-49
A053-49
0,100
-
A052-10
A053-10
8,000
5-16”
A052-50
A053-50
0,106
140
A052-11
A053-11
9,500
3-8”
A052-51
A053-51
0,125
120
A052-12
A053-12
10,0
-
A052-52
A053-52
0,150
100
A052-13
A053-13
11,2
7-16”
A052-53
A053-53
0,160
-
A052-14
A053-14
12,5
1-2”
A052-54
A053-54
0,180
80
A052-15
A053-15
13,2
0,530”
A052-55
A053-55
0,200
-
A052-16
A053-16
14,0
-
A052-56
A053-56
0,212
70
A052-17
A053-17
16,0
5-8”
A052-57
A053-57
0,250
60
A052-18
A053-18
19,0
3-4”
A052-58
A053-58
0,300
50
A052-19
A053-19
20,0
-
A052-59
A053-59
0,315
-
A052-20
A053-20
22,4
7-8”
A052-60
A053-60
0,355
45
A052-22
A053-22
25,0
-
A052-61
A053-61
0,400
-
A052-23
A053-23
25,4
1”
A052-62
A053-62
0,425
40
A052-24
A053-24
26,5
1,06”
A052-63
A053-63
0,500
35
A052-25
A053-25
28,0
-
A052-64
A053-64
0,600
30
A052-26
A053-26
31,5
1 1-4”
A052-65
A053-65
0,630
-
A052-27
A053-27
37,5
1 1-2”
A052-66
A053-66
0,710
25
A052-28
A053-28
40,0
-
A052-67
A053-67
0,800
-
A052-29
A053-29
45,0
1 3-4”
A052-68
A053-68
0,850
20
A052-30
A053-30
50,0
2”
A052-69
A053-69
1,000
18
A052-31
A053-31
53,0
2,12”
A052-70
A053-70
1,180
16
A052-32
A053-32
56,0
-
A052-70S
A053-70S
1,250
-
A052-33
A053-33
63,0
2 1-2”
A052-71
A053-71
1,400
14
A052-34
A053-34
75,0
3”
A052-72
A053-72
1,600
-
A052-35
A053-35
80,0
-
A052-73
A053-73
1,700
12
A052-36
A053-36
90,0
3 1-2”
A052-74
A053-74
2,000
10
A052-37
A053-37
100,0
4”
A052-75
A053-75
2,360
8
A052-38
A053-38
106,0
4,24”
A052-76
A053-76
2,500
-
A052-39
A053-39
125,0
5”
A052-77
A053-77
instrumentos para ensayos de materiales
Tabla de los tamices de chapa perforada,
“SECCIÓN CUADRADA”
Tabla de los tamices de chapa perforada,
“SECCIÓN REDONDA”
NORMAS: EN 933-2 / ISO 3310-2 / BS 410 / DIN 4187-1
NORMA: UNI 2334
Luz de malla
mm
Bastidor diá.
200 mm
Bastidor diá.
300 mm
Luz de malla
mm
Bastidor diá.
200 mm
Bastidor diá.
300 mm
4,00
A031-01
A032-01
4,75
A031-02
A032-02
5,00
A031-03
A032-03
5,60
A031-04
A032-04
6,30
A031-05
A032-05
6,70
A031-06
A032-06
7,10
A031-07
A032-07
8,00
A031-08
A032-08
9,00
A031-34
A032-34
9,50
A031-09
A032-09
10,00
A031-10
A032-10
11,20
A031-11
A032-11
12,50
A031-12
A032-12
13,20
A031-13
A032-13
14,00
A031-14
A032-14
16,00
A031-15
A032-15
18,00
A031-35
A032-35
19,00
A031-16
A032-16
20,00
A031-17
A032-17
22,40
A031-18
A032-18
25,00
A031-19
A032-19
26,50
A031-20
A032-20
28,00
A031-21
A032-21
31,50
A031-22
A032-22
37,50
A031-23
A032-23
40,00
A031-33
A032-33
45,00
A031-24
A032-24
50,00
A031-25
A032-25
53,00
A031-26
A032-26
56,00
A031-36
A032-36
63,00
A031-27
A032-27
75,00
A031-28
A032-28
80,00
A031-37
A032-37
4,00
4,75
5,00
5,60
6,30
7,10
8,00
9,00
10,00
11,20
12,50
13,20
14,00
16,00
18,00
19,00
20,00
25,00
28,00
31,50
35,50
40,00
45,00
50,00
53,00
56,00
63,00
71,00
75,00
80,00
90,00
100,00
106,00
112,00
125,00
A037-01
A037-02
A037-03
A037-04
A037-05
A037-06
A037-07
A037-08
A037-09
A037-10
A037-11
A037-12
A037-13
A037-14
A037-15
A037-16
A037-17
A037-18
A037-19
A037-20
A037-21
A037-22
A037-23
A037-24
A037-25
A037-26
A037-27
A037-28
A037-29
A037-30
A037-31
A037-32
A037-33
A037-34
A037-35
A038-01
A038-02
A038-03
A038-04
A038-05
A038-06
A038-07
A038-08
A038-09
A038-10
A038-11
A038-12
A038-13
A038-14
A038-15
A038-16
A038-17
A038-18
A038-19
A038-20
A038-21
A038-22
A038-23
A038-24
A038-25
A038-26
A038-27
A038-28
A038-29
A038-30
A038-31
A038-32
A038-33
A038-34
A038-35
90,00
A031-29
A032-29
100,00
A031-30
A032-30
106,00
A031-31
A032-31
125,00
A031-32
A032-32
sección A
ÁRIDO S - ROC AS
instrumentos para ensayos de materiales
35
ÁR I D OS - RO C A S
Tamices para ensayos húmedos
A046
sección A
NORMA: ASTM E11
Se utiliza en el ensayo vía húmeda de los áridos finos.
Bastidor y malla en acero inoxidable.
Dimensiones del bastidor: diámetro 200 mm por 200 mm de altura.
MODELOS:
A045 Luz de malla 0,074 mm
A045-02 Luz de malla 0,063 mm
Tamizado en húmedo,Tapa + Fondo en acero
inoxidable
El agua entra a través de la boquilla montada en la parte superior
de la tapa y sale por el fondo arrastrando los finos a su paso.
Se suministra completo con dos juntas tóricas.
Modelo
A045-02
A045
36
A046-11
V179
Pincel de cerdas, pelo suave, 35 mm de diámetro.
V179-02 Pincel de doble composición, cerdas de latón y
cerdas de nylon.
V179-03 pincel de doble composición de nylon suave / de
nylon duro.
V179-05 pincel de pelo suave,
V179
3 mm de diámetro.
BS 812
V179-06 pincel plano de
60 mm, de nylon
V179-06
rígido para tamices.
V179-3
TAPA
FONDO
Diá. 200 mm Diá. 300 mm Diá. 250 mm
A056-02
A056
A056-01
A057
A057-01
A057-02
Conjunto de 10
juntas tóricas
A046
A046-02
A047
A047-02
Tapa + Fondo diá. 200 mm
Tapa + Fondo diá. 8”
Tapa + Fondo diá. 300 mm
Tapa + Fondo diá. 400 mm
A046-11
A046-11
A047-11
A047-12
V179-02
A057
A056
V179-5
Diá. 315 mm
A056-03
A057-03
Diá. 8”
A056-04
A057-04
Diá. 450 mm
A056-05
A057-05
Diá. 400 mm
A056-06
A057-06
Diá. 12”
A056-07
A057-07
A104
A104-01
Baño de ultrasonidos para limpiezas de
tamices
Baño de ultrasonidos para limpiezas de tamices
Se utiliza para una limpieza segura y correcta de tamices
que podrían ser dañados por los métodos
habituales. Indicado especialmente para
tamices de malla fina.
El baño acepta tamices de 200 mm y
8 “de diámetro.
Se suministra completo con temporizador 0-15 minutos.
Diámetro interior 260 mm, altura
180 mm
Capacidad: 10 litros
Fabricado en acero inoxidable, incorpora un generador electrónico de
38kHz de frecuencia.
Alimentación: 230V 50/60Hz
monofásica 300W
Peso: 8 kg
A104 / A104-01
Igual al mod. A104, pero con dimensiones interiores:
Diámetro 410 mm x 200 mm de altura
Acepta tamices de hasta 350 mm de diámetro.
Capacidad: 25 litros
Alimentación: 230V 50/60Hz monofásica 600W
Peso: 16 kg
instrumentos para ensayos de materiales
ACCESORIO:
A104-02
LÍQUIDO DE LIMPIEZA para baño de ultrasonidos,
envase de 25 litros.
ÁRIDO S - ROC AS
A058-05N
NORMA: EN 933-10
El equipo de barrido de aire esta destinado al tamizado en seco de productos en polvo o granulados, obteniendo curvas granulométricas de
entre 4 y 5.000 micras, mediante el uso de los tamices apropiados de 200 mm de diámetro.
El principio del método consiste en la utilización de un barrido de aire para hacer pasar las partículas a través de un tamiz. Este efecto se hace
a través de una máquina de vacío que provoca una disminución controlada de la presión.
Esta máquina de vacío está equipada con un sistema automático de limpieza con un filtro
de cartucho, lo que permite realizar un buen número de ensayos (algunas decenas)
antes de ser reemplazado.
El panel digital del microprocesador electrónico puede ajustar:
- El tiempo de tamizado de 0 a 99 minutos
- El rango de vacío de 0 a 99 bar
- La función de calibración
El equipo se suministra completo con dispositivo
de aspiración, tapa de plexiglás, filtro de cartucho,
5 bolsas de plástico, accesorios.
Alimentación: 230V monofásica 50/60Hz
Dimensiones: 450x600x400 mm
Peso: 25 kg aprox.
sección A
Tamizadora por barrido de aire
37
A058-14
A058-15
A058-05N con tamiz
A058-53
REPUESTOS:
A058-14 FILTRO DE CARTUCHO.
A058-15 BOLSAS DE PLÁSTICO
(paquete de 5 unidades).
TABLA DE LOS TAMICES DE 200 mm DE DIÁMETRO
PARA LA TAMIZADORA POR BARRIDO DE AIRE.
Aberturas desde 5 a 71 micras tienen “malla de nylon”
Aperturas desde 75 hasta 4000 micras tienen “malla de acero inoxidable”
Los tamices incluyen junta de goma hermética.
Nota: Los tamices de malla de acero inoxidable de 20 a 71 micras y malla de nylon de 75 a 4.000 micras están disponibles bajo pedido.
CODIGO LUZ DE MALLA
micron
CODIGO LUZ DE MALLA
micron
CODIGO LUZ DE MALLA
micron
CODIGO LUZ DE MALLA
micron
A058-20...........................5
A058-21........................10
A058-22........................15
A058-23........................20
A058-24........................25
A058-25........................28
A058-26........................30
A058-27........................37
A058-28........................41
A058-29........................48
A058-30........................50
A058-31........................53
A058-32........................55
A058-33........................58
A058-34........................60
A058-35........................63
A058-36........................65
A058-37........................70
A058-38........................71
A058-50........................75
A058-51........................80
A058-52........................90
A058-53.....................100
A058-54.....................106
A058-55.....................112
A058-56.....................125
A058-57.....................140
A058-58.....................150
A058-59.....................160
A058-60.....................180
A058-61.....................200
A058-62.....................212
A058-63.....................224
A058-64.....................250
A058-65.....................280
A058-66.....................300
A058-67.....................315
A058-68.....................355
A058-69.....................400
A058-70.....................425
A058-71.....................450
A058-72.....................500
A058-73.....................560
A058-74.....................600
A058-75.....................630
A058-76.....................710
A058-77.....................800
A058-78.....................850
A058-79.....................900
A058-80.................. 1000
A058-81.................. 1120
A058-82..................1180
A058-83.................. 1250
A058-84.................. 1400
A058-85.................. 1600
A058-86.................. 1700
A058-87.................. 1800
A058-88.................. 2000
A058-89.................. 2240
A058-90.................. 2360
A058-91.................. 2500
A058-92.................. 2800
A058-93.................. 3150
A058-94.................. 3350
A058-95.................. 3550
A058-96.................. 4000
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
Tamizadora electromagnética
sección A
NORMAS: EN 932-5 / ISO 3310-1
Esta tamizadora se activa mediante impulsos electromagnéticos, y gracias a su triple acción vibradora (vertical, lateral y rotacional) es indicada para realizar ensayos de tamizado donde se requiere un gran rendimiento y alta precisión, y cuando el uso sea intenso y continuado.
Además se recomienda para ensayos de tamizado precisos y también en materiales finos.
De construcción simple y robusta, esta tamizadora electromagnética puede alojar hasta 10 tamices y también es adecuada para ensayos de
tamizado por vía húmeda (modelos accesorios A046, A047).
Mediante el panel de control separado se puede ajustar:
- El tiempo de tamizado de 1 a 999 minutos
- La intensidad de vibrado
- Las pausas entre una vibración y la siguiente (sobre todo indicado especialmente para tamizado de material fino)
Alimentación: 230V 50Hz monofásica 450/750W
38
A059-01
A059
A0
59-01
01 KIT
KIT
A059-02
A059
A0
59-02 KIT
Modelo
A059-01 KIT
A059-02 KIT
A059-03 KIT
A059-04 KIT
Dimensiones bastidor tamiz diá.
Dimensiones en mm
200 mm - 8”
200 - 250 - 300 - 315 mm - 8” - 12”
200 - 250 - 300 - 315 - 350 - 400 mm - 8” - 12”
200 - 250 - 300 - 315 - 400 - 450 mm - 8” - 12” - 18”
320 x 380 x 850
380 x 440 x 1080
430 x 460 x 1150
480 x 500 x 1150
instrumentos para ensayos de materiales
Peso en kg
40
65
80
85
Triple acción vibradora:
- Vertical
- Lateral
- Rotacional
Panel de control con microprocesador digital con
funciones de:
- Temporizador de 0 a 999 minutos
- Intensidad de vibración ajustable
- Vibración ajustable en modo continuo o intermitente
sección A
ÁRIDO S - ROC AS
39
A059-03 KIT
A058
Armario de reducción de ruido
Para las tamizadoras de la serie A059 y A060-01, revestido internamente con un material insonorizante para la reducción de sonido
de acuerdo con las Directrices de la CE.
A059-04 KIT
A058 + A059-03 KIT
A059-21
ACCESORIO:
A059-21
MANDOS para una rápida
fijación / liberación de la viga superior.
Útiles para el desplazamiento vertical de la viga.
(No se puede usar con el modelo
A059 KIT-01)
Paquete de 2 mandos con las barras.
A059-21
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
A061N
sección A
Tamizadora mecánica de
gran capacidad
40
Diseñada para tamizar cantidades considerables de material de cualquier tipo de granulometría. Acepta hasta 60-70 kg de materiales
que corresponden aproximadamente a 30 litros de
muestra. De fabricación robusta, esta máquina puede
aceptar 6 bandejas de tamizado y un bandeja de
fondo recogedor. Se suministra con fondo recogedor,
pero sin las bandejas de tamizado, que deben pedirse
por separado. No se pueden vender en los mercados de
la CE sin protección (Ver accesorios).
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 585x790x850 mm
Peso: 180 kg aprox.
A061N
con bandejas de
tamizado
ACCESORIOS:
A061-97
PUERTAS DE SEGURIDAD para la parte superior y frontal, con
micro interruptor en cumplimiento de la Directiva CE de seguridad.
Si se abre la puerta mientras el agitador está trabajando, se detiene
de forma automática.
Las puertas también protegen del polvo.
A061-98
CABINA DE SEGURIDAD, fabricada en acero con micro interruptor, cumple con las Directivas CE de seguridad, forrado con material
de insonorización para la reducción del ruido. Si se abre la puerta
mientras el agitador está trabajando, se detiene automáticamente.
La cabina también protege del polvo.
Dimensiones: 900x900x h 1350 mm
A061-03 SOLO BANDEJA, sin malla, tamaño de 457x660x75 mm,
adecuado para las aberturas de malla de 125 a 6,3 mm.
A061-05 SOLO BANDEJA, sin malla, tamaño de 457x660x75 mm,
adecuado para las aberturas de malla de 5,6 a 1 mm.
A061N + A061-98
A061N + A061-97
instrumentos para ensayos de materiales
A061-06
SOLO BANDEJA, sin malla, tamaño de 457x660x75 mm, adecuado
para aberturas de malla de 0,850 a 0,063 mm.
ÁRIDO S - ROC AS
Luz de malla
en mm
Nº
ASTM
Modelo
0,038
0,045
0,053
0,063
0,075
0,080
0,090
0,100
0,106
0,125
0,150
0,160
0,180
0,200
0,212
0,250
0,300
0,315
0,320
0,355
0,400
0,425
0,500
0,600
0,630
0,710
400
325
270
230
200
170
140
120
100
80
70
60
50
45
40
35
30
25
A061-78
A061-79
A061-80
A061-81
A061-07
A061-08
A061-09
A061-10
A061-11
A061-12
A061-13
A061-14
A061-15
A061-16
A061-17
A061-18
A061-19
A061-20
A061-21
A061-22
A061-23
A061-24
A061-25
A061-26
A061-27
A061-28
Luz de malla
en mm
Nº
ASTM
0,800
0,850
1,000
1.180
1,25
1,400
1,600
1,700
2,000
2,360
2,500
2,800
3,150
3,350
4,000
4,750
5,000
5,600
6,350
6,700
7,100
8,000
9,500
10,00
11,20
12,50
20
18
16
14
12
10
8
7
6
5
4
3,5
1/4”
0,265”
5/16”
3/8”
7/16”
½”
Modelo
A061-29
A061-30
A061-31
A061-32
A061-33
A061-34
A061-35
A061-36
A061-37
A061-38
A061-39
A061-40
A061-41
A061-42
A061-43
A061-44
A061-45
A061-46
A061-47
A061-48
A061-49
A061-50
A061-51
A061-52
A061-53
A061-54
Luz de malla
en mm
Nº
ASTM
Modelo
13,20
14,00
16,00
19,00
20,00
22,40
25,00
25,40
26,50
28,00
31,50
37,50
40,00
45,00
50,00
53,00
56,00
63,00
75,00
80,00
90,00
100,0
106,0
125,0
0,530”
5/8”
¾”
7/8”
1”
1,06”
1¼”
1½”
1¾”
2”
2,12”
2½”
3”
3½”
4”
4,24”
5”
A061-55
A061-56
A061-57
A061-58
A061-59
A061-60
A061-61
A061-62
A061-63
A061-64
A061-65
A061-66
A061-67
A061-68
A061-69
A061-70
A061-70S
A061-71
A061-72
A061-73
A061-74
A061-75
A061-76
A061-77
sección A
BANDEJA DE CRIBAS PARA TAMIZADORA A061N, TAMAÑO 457x660x75 mm, MARCO ROBUSTO EN ACERO GALVANIZADO.
MALLA DE ALAMBRE TEJIDO EN ACERO INOXIDABLE.
NORMAS: EN 933-1, 933-2 / ASTM E11 / ISO 3310-1 / BS 410
A061-96 REPUESTO bandeja de recogida
BANDEJA DE CRIBAS DE CHAPA PERFORADA, “SECCIÓN QUADRADA” NORMAS: EN 933-2 / ISO 3310-2 / BS 410
Luz de malla en mm
4,00
4,75
5.00
5,60
6,30
6,70
7,10
8,00
9,00
9,50
10,00
11,20
12,50
A061-62
Modelo
A062-11
A062-12
A062-13
A062-14
A062-15
A062-16
A062-17
A062-18
A062-19
A062-20
A062-21
A062-22
A062-23
Luz de malla en mm
13,20
14,00
16,00
18,00
19,00
20,00
22,40
25,00
26,50
28,00
31,50
37,50
40,00
Modelo
A062-24
A062-25
A062-26
A062-27
A062-29
A062-30
A062-31
A062-32
A062-33
A062-34
A062-35
A062-36
A062-37
Luz de malla en mm
45,00
50,00
53,00
56,00
63,00
75,00
80,00
90,00
100,00
106,00
125,00
Modelo
A062-38
A062-39
A062-40
A062-41
A062-42
A062-43
A062-44
A062-45
A062-46
A062-47
A062-48
A062-18
instrumentos para ensayos de materiales
41
ÁR I D OS - RO C A S
A060-01
sección A
Tamizadora eléctrica motorizada
42
Acepta tamices de diá. 200 – 250 – 300 – 315 mm y 8” – 12”.
Esta tamizadora simple y de bajo coste funciona mediante un
motor eléctrico. Puede alojar hasta 8 tamices de 200 mm o 8” de
diámetro o 7 tamices de diá. 300 mm además del fondo y la tapa.
También pueden realizarse ensayos de tamizado por vía húmeda.
(ver accesorios mod. A046 y A047).
Provisto de un temporizador de 0 a 60 minutos.
Alimentación: 230V 50Hz monofásica 110W
Dimensiones: 350x400x950 mm
Peso: 24 kg aprox.
A058-01
Tamizadora manual para tamices de 200
mm y 8” de diámetro
Diseñadas para ensayos donde no se dispone de suministro
eléctrico. Girando la manivela la tamizadora imprime una vibración
vertical y lateral. Puede sostener hasta 6 tamices de 200 mm o 8”
de diámetro más el fondo y la tapa.
Dimensiones: 300x450x600 mm
Peso: 16 kg aprox.
A060-01
Microesferas de vidrio con
Certificado NIST para calibración de tamices
La calibración de los tamices o la inspección
de las condiciones de desgaste de la malla,
puede ser realizada mediante microesferas de
vidrio. Estos modelos se suministran con certificado NIST (Instituto Nacional de Estándares
y Tecnología) en cajas de 5 botellas.
A058-01
A057-31 ÷ A057-44
PERLAS DE CRISTAL PARA CALIBRACIÓN
Modelo
Diá. en mm
Modelo
Diá. en mm
A060-31
0.000 a 0.050
A060-41
0.750 a 1.000
A060-32
0.040 a 0.070
A060-42
1.000 a 1.250
A060-33
0.070 a 0.110
A060-43
1.250 a 1.550
A060-34
0.090 a 0.150
A060-44
1.550 a 1.850
A060-35
0.100 a 0.200
A060-45
1.700 a 2.000
A060-36
0.150 a 0.250
A060-46
2.000 a 2.300
A060-37
0.200 a 0.300
A060-47
2.300 a 2.600
A060-38
0.250 a 0.500
A060-48
2.500 a 2.850
A060-39
0.400 a 0.600
A060-49
2.850 a 3.300
Modelo
Tamiz tamaño
(micras μm)
Peso por
botella (g)
A057-31
A057-32
A057-33
A057-34
A057-35
A057-36
A057-37
A057-38
A057-39
A057-40
A057-41
A057-42
A057-43
A057-44
45
63
75
90
125
150
250
300
425
500
600
1000
1180
2000
1
1
1
1
1
1,5
2,5
2,5
2,5
2,5
2,5
7
10
20
Otros modelos con diferentes tamaños a
los que se encuentran en la lista pueden ser
Nota: Las luces de malla superiores a 4 mm pueden ser verificadas utilizando un calibre de precisión. solicitados bajo pedido.
A060-40
0.500 a 0.750
instrumentos para ensayos de materiales
A060-50
3.300 a 3.600
ÁRIDO S - ROC AS
Cuarteadores
Modelo
Materiales
Acero
A062
A063
A064
A065
A065-01
A066
A067
inox
inox
Pintado
”
”
”
”
Ancho de
ranura
1/4”
1/2”
3/4”
1”
1 1/2”
2”
2 1/2”
-
6,3 mm
12,7 mm
19 mm
25,4 mm
38 mm
50,8 mm
63,5 mm
A062
A063
Tamaño max.
muestra en mm
Nº de
ranuras
Peso
en kg
Repuestos:
bandejas
5
10
13
20
25
40
50
12
12
12
12
8
8
8
0,8
1,2
11
11
11
13
18
A062-02
A063-02
A064-02
A065-02
A065-02
A066-02
A067-02
sección A
NORMAS: EN 933-3, UNI 8520 / BS 812:1, 1377:2, 1924:1
ASTM C136, C702 / UNE 83120 / AASHTO T27, T87
NF P18-553
Se utilizan para la división precisa en dos porciones representativas
de materiales como: áridos, arena, grava y similares. Fabricados con
robusta chapa de acero inoxidable, o pintados, se suministra con
dos bandejas de recogida.
43
A068
A064÷A067
A068
Cuarteador de gran capacidad
NORMAS: EN 933-3, UNI 8520 / BS 812:1, 1377:2, 1924:1
ASTM C136 / UNE 83120 / AASHTO T27, T87
Usado para la división de muestras de ensayo demasiado voluminosas para ser manipuladas convenientemente.
Se puede utilizar con cualquier tipo de material desde tamaño
arena hasta 108 mm. Cada conducto de caída tiene 12 mm de
ancho, lo que permite aberturas regulables de 12-24-36-48-6072-84-96-108 mm. Se suministra completo con dos bandejas de
recogida. La capacidad de la tolva de llenado es de 30 litros con
apertura de palanca.
De construcción muy robusta, está completamente galvanizada
para protegerla de la corrosión.
Peso: 55 kg
ACCESORIO:
A068-11 RUEDAS (conjunto de 4) con
freno, para un fácil desplazamiento del cuarteador de gran
capacidad en el laboratorio.
RECAMBIO:
A068-01 Bandeja para el mod. A068
A068-11
Densidad aparente y cálculo de huecos
NORMAS: EN 1097:3 / ASTM C29-97 / UNI 8520:6 / BS 812
ISO 6872 / CNR N. 62, 63, 64
Se utilizan para determinar la densidad aparente y la porosidad de
los áridos. Fabricados en acero inoxidable, los modelos de 10 y 20
litros tienen asas.
A069
Recipiente de 1 litro
A069-01
Recipiente de 5 litros
A069-02
Recipiente de 10 litros
A069-03
Recipiente de 20 litros
A069-02
A069-01
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
A072
Lajas/Calibre de ranuras
Calibre para áridos/ Índice de forma
NORMA: BS 812
Se utiliza para verificar si el árido tiene forma de laja, es decir, si su
espesor es inferior a 0,6 veces su diámetro nominal.
Fabricado con chapa robusta de acero inoxidable.
Peso: 600 g
NORMAS: EN 933-4, 933-5, 933-7 / DIN 4226 / CNR N.95
NLT 354
Para medir la relación longitud/espesor (coeficiente de forma) de
los áridos.
Peso: 500 g
sección A
A070
A071
A070
A072
A071
44
Índice de agujas
NORMA: BS 812
Se utiliza para verificar si el árido es alargado, es decir, si la longitud
es superior a 1,8 veces su diámetro nominal.
Montado sobre una base de madera.
Peso: 1 kg
Propiedades geométricas de los áridos.
Determinación del coeficiente de flujo de
los áridos finos.
NORMAS: EN 933-6 / NF P18-564 / CNR N. 113
ASTM C1252
A073
Determinación a la resistencia al aplastamiento de áridos ligeros
Equipo para la determinación del coeficiente de flujo
NORMAS: EN 13055-1 método 1 y 2
Se utiliza para medir el índice de flujo de los áridos finos (forma y
angulosidad), con dimensiones hasta 4 mm. El índice de flujo de un
árido es el tiempo necesario en segundos para que un volumen
conocido de áridos fluya por una abertura conocida.
La unidad está formada básicamente por un contenedor, dos embudos de policarbonato de 85 mm de altura, 60° parte
cónica, con un diámetro de 12 o
16 mm., base de apoyo, válvula, jarra.
Dimensiones: 200x240x h 600 mm.
Peso: 8 kg aprox.
MODELOS:
A081-01 método 1
Aparato para la determinación de la resistencia al aplastamiento
de áridos ligeros con diámetro 4-22 mm, y una densidad aparente
superior a 150kg/m3, integrado por: cilindro superior e inferior de
113 mm de diámetro interior, anillo de altura regulable, pistón, base.
Fabricado en acero, bañado contra la corrosión.
Dimensiones: 180 mm de diámetro por 260 mm de altura
Peso: 15 kg aprox.
A081-02 método 2
Aparato para la determinación de la resistencia al aplastamiento
de áridos ligeros con una densidad aparente superior a 150kg/m3,
integrado por: cilindro superior e inferior de 76 mm de diámetro
interior, anillo de altura regulable, pistón,
base.
Fabricado en acero, bañado contra la
corrosión.
Dimensiones: 100 mm de diámetro
por 200 mm de altura
Peso: 6 kg aprox.
A081-01
instrumentos para ensayos de materiales
A073
ÁRIDO S - ROC AS
A075
Máquina de desgaste Los Ángeles
ACCESORIOS NECESARIOS:
A076-01 Juego de 12 ESFERAS ABRASIVAS conforme a las
Normas ASTM / AASHTO / CNR / UNI / UNE / NLT
sección A
NORMAS: EN1097-2 / ASTM C131/ UNI 8520-19 / EN 12697-17 / EN 12697-43 / NF P18-573
UNE 83116 / AASHTO T96 / CNR N° 34 / NLT 325
Se utiliza para determinar la resistencia de los áridos a la abrasión.
Comprende un pesado cilindro de acero de 711 mm de diámetro
y 508 mm de longitud interior, montado sobre un robusto bastidor.
El cilindro gira a 31÷33 r.p.m.
La máquina está conectada a un contador digital automático
mediante el cual se puede fijar el número de revoluciones del
tambor. Se suministra sin las esferas abrasivas, que deben pedirse
por separado según las Normas que deba cumplir la máquina. No
se pueden vender en los mercados de la CE sin protección
(ver accesorios).
Alimentación: 230 V 50 Hz monofásica 750 W
Dimensiones: 1000x800x1000 mm
Peso: 370 kg
A075
45
A076-02 Juego de 12 ESFERAS ABRASIVAS conforme a las
Normas EN / NF
ACCESORIOS DE MEJORA:
A075-11
CABINA DE SEGURIDAD, fabricada en chapa de acero, de
acuerdo con las normativas de seguridad de la CE.
Cuando se abre la puerta de la cabina durante el ensayo de Los
Ángeles, un micro interruptor para
automáticamente la rotación del
tambor.
Dimensiones: 1100x1180x1250 mm
A076-11
Peso: 150 kg aprox.
A075+A075-11
A076-01
A075-12
CABINA DE SEGURIDAD, fabricada en chapa de acero, forrado
con material de insonorización para la reducción del ruido, de
acuerdo con las normativas de seguridad de la CE.
Cuando se abre la puerta de la cabina durante el ensayo de Los
Ángeles, un micro interruptor para automáticamente la rotación del
tambor.
Dimensiones: 1100x1180x1250 mm. Peso: 160 kg aprox.
A075+A075-12
A076-11
DISPOSITIVO para una sujeción rápida y fácil de la tapa del tambor.
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
A077
sección A
Máquina Micro-Deval
46
A078-15
DETERMINACION DE LA RESISTÉNCIA
AL DESGASTE
NORMAS: EN 1097-1 / EN 13450
NF P18-572 / NF P18-576
UNE 83115 / CNR N° 109
Se utiliza para determinar la resistencia de
los áridos a la abrasión. La máquina comprende
básicamente un fuerte bastidor donde se apoyan cilindros
de acero inoxidable, pudiéndose montar:
4 cilindros de 200 mm de diámetro x 154 mm
2 cilindros de 200 mm de diámetro x 400 mm
2 cilindros de 200 mm de diámetro x 154 mm y 1 cilindro de 200 mm de diámetro x 400 mm.
La unidad se suministra completa, equipada con un
panel de control independiente y un contador de
revoluciones digital automático.
Suministrada sin cilindros de acero inoxidable ni esferas abrasivas de acero las cuales deben pedirse por separado (ver accesorios
necesarios). No se pueden vender en los mercados de la CE sin
protección (ver mod. A077-01).
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 1000x450x920 mm
Peso: 150 kg aprox.
A078-12
A078-15
A077
ACCESORIOS DE MEJORA:
A078-12 CILINDRO de acero inoxidable de 200 mm de diámetro por 400 mm de largo. Conforme a las Normas
EN 13450, NF P18-572
A078-13 Esferas de acero inoxidable de 30 mm de diámetro.
Paquete de 12 esferas. NF P18-576
A078-14 Esferas de acero inoxidable de 18 mm de diámetro.
Paquete de 52 esferas. NF P18-576
A078-16 CILINDRO “ALTO RENDIMIENTO”, acero inoxidable,
200 mm de diámetro por 152 mm de largo. EN 1097-1
A078-12
A048-14 TAMIZ DE BARRAS, de 9,5 mm de ranura, utilizado
para verificar el desgaste de las esferas de acero de
tamaño nominal 10 mm.
A077-01
Máquina Micro-Deval, igual que el modelo A077, pero
equipada con una protección en chapa de acero y un micro interruptor de seguridad, forrado con material de insonorización para
la reducción del ruido, de acuerdo con las normativas de seguridad
de la CE. Si se abre la protección mientras funciona el Micro Deval,
la máquina se para automáticamente.
Dimensiones: 1150x600x1150 mm
Peso: 190 kg aprox.
ACCESORIOS NECESARIOS:
A078-15 CILINDRO estándar de acero inoxidable, de 200 mm
(necesarios 4) x 154 mm
de longitud
A078-11 Juegos de 20 kg de esferas
abrasivas de acero inoxidable
de 10 mm de diámetro.
EN 1097-1
instrumentos para ensayos de materiales
A078-11 + A048-14
A077-01 + A078-15
ÁRIDO S - ROC AS
A079
NORMAS: NF P18-577 / ASTM D2-33
Se utiliza para determinar la resistencia a la abrasión de los áridos,
tanto por el método seco como por el húmedo. La máquina
comprende básicamente un bastidor de acero donde se fijan dos
cilindros. Se suministra completa con un un contador de revoluciones digital automático y dos bandejas de recogida.
No se pueden vender en los mercados de la CE sin protección
(ver mod. A079-01, A079-02).
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 1500x520x1280 mm
Peso: 140 kg
A079
A079-01
sección A
Máquina para ensayos Deval
Máquina para ensayos Deval, igual que el modelo
A079, pero equipada con una protección en chapa de acero de
acuerdo con las normativas de seguridad de la CE.
Si se abre la protección mientras funciona el Deval, la máquina se
para automáticamente.
Dimensiones: 1650x650x1400 mm
Peso: 170 kg
47
A079-02
Máquina para ensayos Deval, igual que el modelo
A079, pero equipada con una protección en chapa de acero,
forrada con material de insonorización para la reducción del ruido
de acuerdo con las normativas de seguridad de la CE.
Si se abre la protección mientras funciona el Deval, la máquina se
para automáticamente.
Dimensiones: 1650x650x1400 mm
Peso: 180 kg
A079-02
Máquina para prueba de resistencia al
impacto
NORMAS: BS 812 / NF P18-574
Se utiliza para determinar el valor de resistencia al impacto de los
áridos y seleccionarlos para aplicaciones determinadas. La máquina
tiene un sistema de desenganche automático de la masa batiente,
un dispositivo contador de golpes y un dispositivo bloqueador
de seguridad. Equipo robusto, con todas las superficies de acero
templado para reducir al mínimo el desgaste. Todo el equipo está
cadmiado para proteger de la corrosión.
Dimensiones: 445x300x880 mm, Peso: 60 kg
La máquina se puede adquirir en dos versiones:
- realizada de acuerdo a la Norma BS 812
- realizada de acuerdo a la Norma NF P18-574
A080KIT
Máquina para prueba de resistencia al impacto NORMA: BS 812
Consistente en:
A080-04 CONJUNTO DE BASTIDOR para el ensayo
A080-02 MOLDE CILÍNDRICO de diámetro 102x50 mm, con
un recipiente cilíndrico de medidas 75 mm de diámetro
x 50 mm de profundidad, barra apisonadora.
A080 KIT
A080-01KIT
Máquina para prueba de resistencia al impacto NORMA: NF P18-574
Consistente en:
A080-04 CONJUNTO DE BASTIDOR para el ensayo
A080-03 MOLDE CILÍNDRICO de diámetro 102x52 mm.
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
S158-20 KIT
sección A
Juego para el ensayo del equivalente de
arena (completo)
48
EVALUACIÓN DE LOS ÁRIDOS FINOS
NORMAS: EN 933-8 / NF XP18-598 / CNR N.27
UNI 8520-15 / UNE 83131
El juego comprende:
S158-03 Cilindro de medida de plexiglass graduado a 100 y a
380 mm (5 piezas)
S158-02 Tapón de goma para cilindro (2 piezas)
V176-02 Regla graduada 500 mm de acero inoxidable
V136-01 Embudo, boca ancha
S158-05 Bote de medida con 200ml de capacidad
V121
Botella de plástico, 5 litros de capacidad
S158-10 Tubo irrigador con grifo y sifón EN/ASTM
S158-13 Pistón para medir el nivel de la arena
A052-37 Tamiz de diá. 200 mm, luz de malla 2 mm
S158-09 Solución concentrada, 1000 ml
V170
Cronómetro digital
S158-11 Soporte para colgar el sifón y la botella
S158-12 Estuche de transporte, diá. 550x250x400 mm
Peso total: 18 kg
S158-20 KIT
S158-08
S159-01 KIT
S159-01
Equivalente
de
arena (kit simple)
NORMAS:
EN 933-8
NF XP18-598
UNI 8520-15
UNE 83131
El kit comprende:
S159-11
S158-03 Cilindro de S159-01 KIT
medida en
plexiglass graduado en 100 y 380 mm (4 piezas)
S158-02 Tapón de goma para cilindro (2 piezas)
V176-02 Regla graduada 500 mm en acero inoxidable
V136-01 Bote de medida con 200ml de capacidad
S158-05 Bote de medida con 200ml de capacidad
V121
Botella de plástico, 5 litres de capacidad
S158-10 Tubo irrigador con grifo y sifón EN/ASTM
S158-13 Pistón para medir el nivel de la arena
S158-09 Solución concentrada, 1000 ml
Peso total: 5 kg
S159 KIT Equivalente de arena (kit simple)
NORMAS: ASTM D2419 / AASHTO T176
El kit comprende los mismos productos que el modelo S159-01
KIT pero conforme las Normas antes mencionadas.
ACCESORIOS:
S158-08 Embudo metálico de acuerdo a las Normas EN, NF, UNI
S159-11 Maletín de transporte de plástico para los modelos
S159KIT o S159-01KIT, excepto la botella V121.
S160 N
+ S158-03
+S158-02
S158 KIT
Equivalente de arena (kit completo)
NORMAS: ASTM D2419 / AASHTO T176
El kit es idéntico al mod. S158-20 KIT a excepción de:
S158-01 Cilindro de medida en plexiglas graduado a 100 y a 380
mm con etiqueta adhesiva transparente graduada en
mm y pulgadas (5 piezas)
S158-04 Bote de medida con 88ml de capacidad
S158-07 Pistón para medir el nivel de la arena
A052-44 Tamiz de diá. 200 mm con apertura de 4,75 mm
S160 N
Agitador motorizado para equivalente de arena
NORMAS: EN 933-8 / ASTM D2419 / AASHTO T176
NF XP18-598 / UNE 83131 / CNR N.27 / UNI 8520-15
La unidad permite una agitación uniforme y constante con un
ciclo de ensayo automático. Carrera de la oscilación de 203 mm a
175÷180 ciclos/min. Completo con temporizador digital, detiene
automáticamente el agitador al final del ensayo. No se pueden vender
en los mercados de la CE sin protección (ver mod. S160-01N).
Alimentación: 230V 50Hz monofásica 250W
Dimensiones: 700x360x350 mm. Peso: 30 kg
S160-01 N
Agitador motorizado para equivalente de arena
S160-01 N + S158-03 +S158-02
instrumentos para ensayos de materiales
Tal como el descrito anteriormente, pero equipado con una
cubierta de seguridad con rejilla de acero, conforme a las directivas
de seguridad de la CE. Cuando se abre la cubierta de seguridad,
durante la realización del ensayo, un micro interruptor para automáticamente el equipo.
ÁRIDO S - ROC AS
Ensayo del azul de metileno
EVALUACIÓN DE LOS ÁRIDOS FINOS
NORMAS: EN 933-9 / NF P94-068 / UNI 8520-15 / UNE 83180
Utilizado para determinar el contenido de arcilla en las partes finas
de los áridos. El conjunto comprende:
S157-01 Agitador eléctrico ajustable de 400-700 rpm, completo
con hélice de 70 mm de dia. 230V monofásico 50Hz
S157-02 Bureta de 50x0,1 ml con grifo
S157-03 Filtros de papel de 90 mm de dia. (paquete de 100)
S157-04 Varilla de vidrio dia. 8x300mm
S157-05 Vaso de precipitado de plástico de 2000 ml
S157-06 Base de soporte para el agitador
S157-07 Base de soporte para la bureta
S157-08 Recipiente 200x150x80 mm
V300-28 Azul de metileno 100 g
V300-29 Caolinita 500 g
Peso total: 10 kg
NOTA: Cada elemento puede pedirse por separado.
ACCESORIO:
S157-10 DISPENSADOR AUTOMATICO 0-10 ml. con div. 0,1 ml.
Capacidad 1000 ml
(una alternativa a la bureta S157-02+S157-07)
S157-10
Ensayo de las propiedades geométricas
de los áridos. Ensayo de clasificación de
los componentes de los áridos gruesos
reciclados.
NORMA: prEN 933-11:2008
S156-20
Émbolo, para la probeta graduada.
El ensayo consiste en una clasificación
manual de una lista de los materiales
constituyentes de una muestra de árido
grueso reciclado. La proporción de cada
componente en la muestra se determina
y se expresa como porcentaje de la
masa, a excepción de la proporción de
partículas en suspensión que se expresa
como un volumen de la masa. Fabricado
en acero inoxidable. Peso: 500 g aprox
sección A
S157 KIT
V101-07
ACCESORIO:
V101-07 PROBETA DE VIDRIO
GRADUADA, de 2000 ml de capacidad.l
B022
PARA LA DETERMINACIÓN DE LAS ARCILLAS, LIMOS,Y
POLVO EN LOS ÁRIDOS FINOS Y GRUESOS DEL ENSAYO DE
SEDIMENTACIÓN SEGÚN
S157-20
ACCESORIO:
S132-03
BOTELLA, vidrio pyrex, 1 litro de
capacidad, con tapón hermético.
Equipo automático ensayo azul de metileno
S144
Este instrumento determina automáticamente la cantidad de arcilla
en la arena, dando resultados exactos y repetibles, con el consecuente
ahorro de tiempo (aprox. 30 minutos cada prueba). El aparato se
compone de: bomba de precisión,
S157-20
un colorímetro, unidad de control,
filtros, líquidos, polvo, accesorios.
Alimentación:
230V monofásica 50Hz
Dimensiones:
300x400x350mm aprox.
Peso:10 kg aprox.
49
Agitador rotatorio de botellas.
NORMAS:
BS 812
ASTM C117
Para girar de una a
tres botellas o frascos
al mismo tiempo sobre
su eje longitudinal con
velocidad de rotación ajustable de 0 hasta 85 rpm.
Alimentación:
230V 50Hz monofásica
Dimensiones: 385x295x160 mm
Peso: 10 kg aprox.
S157 KIT
S156-20
Pipeta de Andreasen,
25 ml de capacidad, fabricada en
vidrio, utilizada para una extracción exacta y precisa de material
en suspensión y posterior análisis.
B022+S132-03
S144
S144-01
S144-01
SOPORTE PARA LA PIPETA, para
subir y bajar con precisión y sin
transmitir vibraciones a la pipeta
Andreasen. Peso: 10 kg aprox.
instrumentos para ensayos de materiales
sección A
ÁR I D OS - RO C A S
50
A124
A082
Aparato para la compactación del filler
Equipo para la determinación de resistencia al aplastamiento de los áridos 150 mm
de diámetro
SE UTILIZA PARA DETERMINAR LOS HUECOS DEL FILLER
COMPACTADO EN SECO
NORMAS: EN 1097-4 / BS 812 / CNR N° 23 / NLT 177
Formado por:
un cilindro de 25,4 mm de diámetro interno, un émbolo de deslizamiento libre dentro del cilindro con tolerancia lateral máxima de
0,20 ± 0,05 mm; 4 columnas; una base metálica.
Para realizar el ensayo se requiere un equipo de medida (vernier
calibre con precisión de 0,01 mm): ver accesorio.
Peso: 4 kg
ACCESORIO:
V175-03
CALIBRE DIGITAL VERNIER, carrera 0-150 mm x resolución
0,01 mm
A124
NORMA: BS 812:110
Comprende un cilindro de acero de 150 mm de diámetro nominal,
un pistón, una base, una barra de compactación y un cilindro de
115 mm de diámetro x 180 mm de profundidad. Se utiliza para
áridos que pasan el tamiz de luz 12,7 mm y son retenidos por el de
9,52 mm.
Todo el equipo está cincado anticorrosión. Peso: 20 kg
A083
Equipo para la determinación de resistencia al aplastamiento de los áridos 75 mm
de diámetro
NORMA: BS 812:110
Comprende un cilindro de acero de 75 mm de diámetro nominal,
un pistón, una base, una barra de compactación y un cilindro de 57
mm de diámetro x 90 mm de profundidad. Se utiliza para áridos de
diámetros inferiores a 9,52 mm.
Todo el equipo está cincado anticorrosión. Peso: 8 kg
A082
A083
V175-03
A085
Tela para cuartear (no ilustrada)
NORMA: ASTM C702 - METODO B
Se utiliza para cuartear suelos y áridos in situ .
Dimesiones: 140x140 cm.
A084
A086
Aparato “Siphon Can”
Volúmetro para áridos
NORMA: BS 812 - Part 2
Se utiliza para determinar el contenido de humedad en condiciones conocidas. Se suministra completo con cilindro graduado de
medida, tubos de goma sujetados con abrazaderas, grifos y una
barra para remover.
Peso: 5 kg
NORMA: BS 812
Se utiliza para medir la densidad
de áridos gruesos por el método
de desplazamiento de agua.
Está formado por un recipiente
metálico cilíndrico de 150 mm
de diámetro x 350 mm de altura
con un tubo de sifón fijado a 250
mm de la base. Peso: 3 kg
A084
ACCESORIO:
V101-04 Probeta de vidrio
graduada de 250 ml
de capacidad.
instrumentos para ensayos de materiales
A086
ÁRIDO S - ROC AS
Determinación de la densidad aparente y absorción de agua de los áridos
NORMAS: EN 12390-7 / EN 1097-6 / UNI 6394-2 / BS 812:2, 1881:14 / ASTM C127, C128 / AASHTO T84 / DIN 12039 / NLT 154
Para la realización de este ensayo, se necesita un equipamiento general suplementario, como pueden ser: estufas, tamices, balanzas, etc., y
los equipos específicos:
V085
Cestillo para medir la densidad 200 mm de diámetro por 200 mm de altura, luz de malla 3,35 mm, todo
de acero inoxidable.
V073-01
V041
Bastidor para pesada hidrostática
Datos técnicos: Ver apartado “V” pág. 438
Picnómetro, vidrio Pyrex, con tapón, tubo capilar y embudo.
V041
Se utiliza para determinar los huecos y la densidad aparente de los
áridos.
V103
Capacidad 500 ml
V103-01 Capacidad 1000 ml
sección A
V041
Picnómetro, vidrio Pyrex, de boca ancha de 50 mm de diámetro, con tapón de tubo capilar. Se utiliza para evaluar la densidad
por volumen y los huecos de los áridos.
V105-04 Capacidad 500 ml
V105-05 Capacidad 1000 ml
V105-06 Capacidad 2000 ml
V085
51
S148
Cono y cilindro compactador para absorción de
arenas, utilizados para determinar el peso específico y la absorción
de los áridos finos.
V105-05
V103
Determinación de la densidad de las partículas del filler. Método del picnómetro.
NORMAS: EN 1097-7 / NF P18-558 / BS 812
Para la realización de este ensayo se necesita un equipamiento
general suplementario, como pueden ser: estufas, tamices, balanzas,
etc., y los equipos específicos:
S148
Botella del peso específico, tipo Gay Lussac,
fabricada en vidrio Pyrex con tapón de tubo capilar; utilizada para
determinar la densidad de las partículas y la densidad del filler en
los áridos finos.
V108-01 Capacidad 50 ml
V108-02 Capacidad 100 ml
V108-03 Capacidad 250 ml
V108-01
V108-02
E136
Baño termostático con sistema de circulación de
agua, realizado en acero inoxidable. Equipado con un dispositivo
de enfriamiento, tipo serpentín, para conectarse a la red de agua
corriente.
Capacidad: 40 litros. Termostato digital
Rango de temperatura: de ambiente hasta 90 °C
Precisión: ±0,5 ° C.
Dimensiones internas:
510x350x230 mm
Dimensiones generales:
680x420x420 mm
Fuente de alimentación:
230W 50/60Hz
monofásica 2000W
E136
Peso: 28 kg aprox.
Determinación de la densidad relativa
y absorción de agua en los áridos para
tamaños inferiores a 10 mm.
NORMAS:
BS 812:2, 1377:2 / ASTM D 854
AASHTO T100
S147
S147
Picnómetro de vidrio,
con cono de aluminio y junta de
caucho. Capacidad: 1 kg
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
A092
sección A
Machacadora de mandíbulas de laboratorio
52
NORMA: UNE 83 120
Diseñada para triturar cualquier tipo de material, incluso el más
duro. La estructura es de hierro fundido, el eje de acero rectificado,
y las mandíbulas de manganeso. La apertura de las mandíbulas se
regula de 2 a 15 mm por medio de una cuña.
Tamaño de mandíbulas: 100x60 mm
Producción: de 100 a 400 kg/hora
La machacadora es apropiada para preparar el material
para que posteriormente se reduzca a polvo con el
molino A091.
Completo con cabina de seguridad de acero
siguiendo las directrices de seguridad de la CE, y
cajón recogedor.
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 450x1000x620 mm
Peso: 115 kg
A092
sin cabina
A092
con cabina
A091-10
Molino de jarros
A091-10 + A091-11
Diseñado para reducir de 5 mm a polvo
materiales granulares como cemento, piedras, áridos, y materiales duros. Se suministran sin
jarrones que deben pedirse por separado (ver accesorios necesarios).
El molino acepta jarrones con capacidades de 300cc o de 1000cc.
El jarro es de material cerámico Prokorund, con sus correspondientes esferas de carga de porcelana. Se suministra con cabina de acero para la insonorización y micro interruptor de acuerdo
con las directrices de seguridad de la CE. Temporizador incorporado.
R.p.m.: 400 aprox.
ACCESORIOS NECESARIOS::
Alimentación:
A091-11 Jarrón de 300 cc. de capacidad, completo con esferas.
230V 50Hz monofásica 750W
Dimensiones:
A091-12 Jarrón de 1000 cc.de capacidad, completo con esferas.
350x710x410 mm.
detalle de
Peso: 50 kg
los jarrones
A091-02
Molino de jarros, para un jarro de capacidad 1500 cc.
A093
Se suministra “completo” con jarro i esferas.
Mezclador de materiales secos
Diseñado para mezclar materiales secos tales como: polvos,
cemento, yeso y materiales granulares. Asegura una mezcla
perfecta y homogénea en poco tiempo. El mezclador
consiste en dos conos asimétricos opuestos y una bandeja para recoger el material mezclado. Se suministra
completo con un temporizador.
El volumen de los conos es de 30 litros.
Capacidad de mezcla: 10 kg de material
Velocidad de rotación: 30 r.p.m.
No se pueden vender en los mercados de la
CE sin protección (ver mod. A093-11).
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 700x700x1200 mm
Peso: 130 kg
A093
instrumentos para ensayos de materiales
ACCESORIO:
A093-11
CABINA DE SEGURIDAD, fabricada en
chapa de acero, revestida con material
de aislamiento acústico para la reducción
del ruido, conforme a las directrices de
seguridad de la CE.
Al abrir la puerta de la cabina con la mezcladora en marcha, un micro interruptor
detiene la rotación del tambor de forma
automática.
Dimensiones: 850x800x1300 mm
Peso: 50 kg aprox.
ÁRIDO S - ROC AS
A113
PÉNDULO MEDIDOR DE LA RESISTÉNCIA AL DESLIZAMIENTO (SKID TESTER)
sección A
NORMAS: EN 1097-8 / EN 1338, 1341, 1342
EN 13036-4, 1436 / ASTM E303 / BS 812 :114
CNR N. 105, 140
NF P18-578, P18-575 NLT 174
El aparato es adecuado tanto para ensayos “in
situ” como para aplicaciones de laboratorio,
pudiéndose realizar dos tipos de ensayos:
- para la medición de la superficie de fricción en
pavimentos (asfalto de carreteras) y propiedades
de resistencia al deslizamiento;
- para el valor de pulimento de los áridos en el ensayo de
pulimento acelerado.
El péndulo de fricción también es adecuado para llevar a
cabo los ensayos sobre:
A113
- las piedras naturales conforme a la Normas
EN 1341, 1342;
- pavimentos de losas de hormigón EN 1338.
El péndulo mide la pérdida de energía cuando el borde de la goma
del patín de caucho es impulsado sobre la superficie de ensayo.
Un dispositivo de elevación con sistema anti deslizante se incorpora
en la base del péndulo para garantizar las operaciones de reglaje
preciso. El sistema de ajuste de altura es simple y seguro.
El puntero, hecho de aleación ligera, tiene fricciones extremadamente bajas garantizando una alta precisión en los resultados.
El mecanismo de liberación del brazo del péndulo tiene un original
solución para reducir al mínimo la fricción dando una mayor precisión. El péndulo se suministra completo con:
- incorporación de escalas adicionales para la determinación
del valor de los ensayos sobre pulimento de los áridos:
- regla de plexiglás, para verificar la longitud de la zona de ensayo;
- termómetro de -10 a +110 °C para la medida de la temperatura de la superficie;
- silla, frasco lavador, cepillos, conjunto de herramientas para
uso de la máquina;
- maleta de transporte;
- certificado de calibración según la Norma EN 1097-8.
El péndulo se suministra
“SIN” patines de goma que
deben pedirse por separado
(ver accesorios).
Dimensiones de la maleta:
730x730x330 mm
Peso: 32 kg
A113 contenido en la maleta
53
ACCESORIOS:
A110-03 Patín de goma montado para ensayos “in situ”
(superficie de pavimentos), con certificado de
conformidad.
A110-01 Patín de goma montado para ensayos de pulimento acelerado sobre áridos (en laboratorio),
con certificado de conformidad.
A110-11 Placa base de metal para ensayos del valor de
pulimento acelerado de piedras en laboratorio
y ensayos sobre piedra natural y adoquines de
hormigón. Suministrado “sin” el dispositivo de
sujeción, que debe pedirse aparte.
A110-12 Dispositivo de sujeción para el ensayo del valor de
pulimento de la piedra en laboratorio.
A110-13 Dispositivo de sujeción para las pruebas sobre las
piedras naturales (EN 1341, 1342), para adoquines
de hormigón (EN 1338) y ensayos de deslizamiento sobre superficies de madera (EN 1339).
A110-20 Lamina rosa pulida (10 hojas) para la calibración
del péndulo.
A110-11 + A110-12
A110-03
A110-01
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
A128N
sección A
Máquina de pulimento acelerado
54
DETERMINACIÓN DEL COEFICIENTE DE PULIMENTO ACELERADO (CPA)
NORMAS: EN 1097-8, EN 1341, 1342, 1343 / BS 812:114
NF P18-575 / CNR N.105
Mide la resistencia de los áridos de carreteras, pavimentos de adoquines, pavimentos de
bloques de piedra frente a la acción del pulido de las ruedas de los vehículos en la
superficie en las carreteras. Las probetas se confeccionan con sus correspondientes moldes. La muestra de ensayo se coloca en la rueda giratoria del
equipo, la cual admite 14 muestras. Al girar de la rueda porta muestras, la
probeta entra en contacto con un neumático de goma maciza el cual incorpora un brazo de palanca tarado. Una tolva suministra una carga continua
y con velocidad constante de polvo abrasivo, que entra en contacto
entre la rueda y la muestra. Velocidad de la rueda porta muestra:
de 310 a 330 r.p.m. El polvo esmeril es depositado sobre la
muestra a través de una abertura controlada. Un depósito
de agua se encarga del suministro de agua a una velocidad
controlada. El panel de control digital, equipado en la parte
posterior de la máquina, permite seleccionar la duración
de la prueba. Durante la ejecución del ensayo, podemos
observar en la pantalla el tiempo restante así como la
velocidad de rotación de la rueda porta probetas. La máquina proporciona un método de preparación por pulido
de muestras de piedra para su uso con el péndulo de resistencia
al deslizamiento mod. A113 cuando se utiliza en el laboratorio.
El equipo se suministra completo con 2 ruedas de goma (una
para el tamaño grano y el otro para el polvo esmeril), juego de 4
moldes para muestras y 2 tapas. El árido de control, el granulado
y el polvo esmeril deben pedirse por separado (ver accesorios).
Alimentación: 230V 50Hz monofásica 750W
Dimensiones: 1800x820x600 mm. Peso: 175 kg
ACCESORIOS:
A128-02 Grano Esmeril, paquete de 25 kg
A128-03 Polvo Esmeril, paquete de 5 kg
A128-04 Árido de control, sin clasificar, bolsa de 25 kg
A128-05 Árido de referencia del CPA (Piedra Criggion), sin
clasificar, bolsa de 25 kg
A049-02 Tamiz de lajas, ranura de 7,2 por 40 mm, para separar
los áridos de carreteras a ensayar.
DEBERÍA DECIR: RECAMBIOS:
A128-11 Molde (sin tapa)
A128-12 Tapa para moldes
A128N
A128N detalle de la parte posterior
con el panel de control
C129
Ensayo de abrasión Böhme, sirve
para medir la pérdida de volumen en las pruebas
de abrasión bajo tensión en muestras de:
- adoquines
- losas de hormigón
- losas fabricadas con piedras naturales
- losas de piedra natural
NORMAS: EN 1338:2004 / EN 1339, 1340, 13892-3
EN 14157 / DIN 52108
Vea la sección “C” pág. 220 Hormigón.
instrumentos para ensayos de materiales
C129
A111
A112
Máquina de abrasión
Ensayo de abrasión para piedras naturales
y hormigón
DETERMINACIÓN DEL COEFICIENTE DE ABRASIÓN (AAV)
NORMAS: EN 1097-8 / BS 812:3
El ensayo mide la resistencia de los áridos al desgaste superficial
por abrasión. Una inadecuada abrasión de los áridos de la capa de
rodadura de las carreteras, provocará una pérdida de la microtextura, necesaria para mantener la resistencia al deslizamiento a
alta velocidad. La máquina consiste en un fuerte bastidor montado
sobre amortiguadores ajustables, con una rueda de chapa de
acero de 610 mm de diámetro, la cual gira a 28/30 r.p.m. en un
plano horizontal, un eje de acero rectificado con funcionamiento
de precisión sobre cojinetes, motor eléctrico, caja de engranajes,
rascadores para la eliminación de la arena, cuenta revoluciones.
Se suministra completo con dos moldes para muestras, dos platos
planos y dos bandejas, pesos, dispositivo de fijación.
Alimentación: 230V monofásica 50Hz
Dimensiones: 800x700x 100 mm. Peso: 200 kg
RESISTÉNCIA A LA ABRASIÓN SOBRE PIEDRAS NATURALES
Y BALDOSAS DE HORMIGÓN PARA PAVIMENTOS
NORMAS: EN 1338, 1341, 1342, 1343, 14157
CEN ISO-TC 178 / UNI 10532 / BS 6717:2001
Se utiliza para determinar la resistencia a la abrasión y desgaste de
probetas de cemento, hormigón y piedras naturales, midiendo la
longitud del surco producido en la superficie de la muestra por un
disco abrasivo con un espesor de 70 mm que gira a una velocidad
controlada y una presión constante sobre la muestra. Debe intercalarse una carga de material abrasivo entre el disco y la muestra. El
instrumento se suministra con un aspirador para recoger el polvo,
controlador de velocidad electrónico, y un dispositivo de paro automático después de un número de revoluciones, 1 kg de material
abrasivo, accesorios y una cabina de protección de acuerdo a las
directrices de la CE.
Alimentación: 230V monofásica 50Hz 500W
Dimensiones: 450x420x800 mm
Peso: 85 kg
sección A
ÁRIDO S - ROC AS
A112 / A112-10
A111
ACCESORIOS:
A111-11 Arena de sílice graduada. Paquete de 25 kg
A112-10
Ensayo de abrasión de ladrillos y azulejos
NORMAS: EN 102 / EN 12808-2 / CEN ISO-TC178 / ISO 10545-6
Igual que el modelo A112, pero con el espesor del disco de 10 mm.
Recomendable para los ladrillos y azulejos de cerámica.
V179-05 Brocha de pelo suave 3 mm de diámetro. BS 812
RECAMBIO:
A111-12 Dos moldes de muestras.
RECAMBIO:
A112-01 Arena abrasiva de corindón blanco grado 80.
Paquete de 5 kg.
instrumentos para ensayos de materiales
55
ÁR I D OS - RO C A S
A105
sección A
Calcímetro de
Dietrich-Frühling
56
CONTENIDO DE
CARBONATOS EN LOS
ÁRIDOS
Se utiliza para la determinación de carbonato
cálcico (CaCO3) en ciertos
productos como calizas
y margas. Básicamente
consiste en un recipiente de
vidrio en el cual tiene lugar
la reacción entre el carbonato cálcico presente en el
producto y una solución de
ácido clorhídrico.
El gas resultante se recoge
A105
y se mide en un dispositivo
conectado al recipiente.
Como el volumen de gas (CO2) producido es proporcional a la
cantidad de CaCO3 contenido en el material, es posible calcular el
porcentaje de CaCO3.
Dimensiones: 400x200x1100 mm
Peso: 13 kg
ACCESORIOS:
A116-11
Cilindro de vidrio para determinar el
peso específico de los suelos.
Completo con una tapa de vidrio.
Dimensiones: 75 mm de diámetro
por 300 mm de altura.
A116-12 Tapón de goma para el
cilindro A116-11
A116-11
A116-12
C279-02
PANEL DE CONTROL SEPARADO
Completo con el interruptor ON/OFF, temporizador, fusible,
protecciones eléctrica.
A108
Máquina para la determinación del coeficiente de trituración
Compuesta por una guía metálica de 500 mm de largo y 140
mm de ancho, adecuada para contener 500 gr de las muestras de
áridos. La guía se desliza a lo largo y transversalmente a través de
volantes.
En el centro de la mesa se dispone
una rueda metálica de 400 kg de
peso con banda de 50 mm
de ancho.
El ensayo consiste en pasar
la rueda sobre los áridos de
la guía doce veces.
Dimensiones:
1200x500x1850 mm
Peso: 640 kg
A108
S132
Carta de colores estándar
C279-02
A117 + A116-11 + A116-12
NORMAS: ASTM C40 / AASHTO T21 / UNI 8020-14
Para la determinación de las impurezas orgánicas en los suelos y
áridos finos.
Carta de escalas con 5 vidrios de referencia.
S132-01
A117
Agitador giratorio para cilindros
NORMA: EN 1997-2 / BS 1377:2
Se utiliza para determinar el peso específico de suelos, y funciona
haciendo girar dos cilindros de gas a 50 r.p.m. aprox. para satisfacer
la Norma BS.
El agitador está equipado con un embrague conforme a las directivas de seguridad de la CE.
Se suministra sin cilindros, los cuales deben pedirse por separado.
Alimentación: 230V 50Hz monofásica 150W
Dimensiones: 550x430x500 mm
Peso: 20 kg
instrumentos para ensayos de materiales
S132-02
S132-03
S132
S132-01 Botella de ensayos con tapón para graduar impurezas;
vidrio pyrex, 500 ml - ASTM C40
S132-02 Botella de ensayos con tapón para graduar impurezas; vidrio
pyrex, 500 ml; marcada en 130 y 200 ml - UNI 8020-14
S132-03 Botella de ensayos con tapón para graduar impurezas;
vidrio pyrex, 1000 ml - ASTM C40
V300-24 Hidróxido de Sodio, paquete de 1000 g
ÁRIDO S - ROC AS
Ensayos sobre las propiedades térmicas y de alteración de los áridos
Determinación de la resistencia a la congelación y descongelación
NORMAS: EN 1367-1 / EN 932-5
sección A
Se da la información necesaria sobre los áridos sujetos a ensayos
de ciclos de congelación y descongelación.
El estrés por frío en los áridos depende del grado de saturación del
agua y el porcentaje de la congelación. El ensayo se realiza sobre
áridos de dimensiones entre 4-63 mm.
A103-10
Recipiente de acero inoxidable con capacidad nominal de
A103-10
2000 ml.
Se suministra completo con tapa de acero inoxidable.
Peso: 600 g aprox.
A103-11
Lastre de acero galvanizado, utilizado en los ensayos de áridos
ligeros.
Peso: 2 kg aprox.
A103-11
57
Ensayo de Sulfato de Magnesio
Ensayo para determinar las propiedades térmicas y de alteración de
los áridos.
NORMA: EN 1367-2, comparable con la ASTM C88, UNE 7136
UNI 8520-10
A103
Determinación del comportamiento y la
resistencia a la congelación y descongelación
de los áridos
NORMAS: EN 1367-1
CNR N° 80
UNI 8520-20
BS 812:124
ASTM C671, C682
C314
Cámara climática
V125-03
V172-05
A103
CESTILLO en malla de acero inoxidable de 120 mm de diámetro x
160 mm de altura, apertura de malla 3,35 mm.
V172-05
Hydrómetro graduado a 20 ºC, escala
1200-1300 g/ml con precisión de
0,001 g/ml.
V125-03
RECIPIENTE de acero estañado
con tapa hermética, 200 mm de
diámetro x 200 mm de altura
520 litros de capacidad
Rango de temperatura
de -20 a +60 °C.
Rango de humedad de10 a 90%
Con ciclos de ensayo programables.
Detalles técnicos y otros modelos descritos en la sección “C”
pág. 245 del Hormigón.
C314
C348N *
Sierra para rocas y albañilería
Acepta discos de hasta Ø. 350 mm.
Altura útil de corte: 110 mm
ACCESORIOS:
C350-13 Hoja de diamante diámetro 350 mm
C352
Dispositivo para sujetar los cilindros y testigos
C353
Dispositivo para fijar las muestras de forma irregular
C348N+C352
* NOTA:
Detalles técnicos y otros modelos de sierra quedan descritos en la
sección “C” pág. 254 del Hormigón.
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
sección A
Determinación de la contracción por
desecación
ENSAYO PARA DETERMINAR LA PROPIEDAD TÉRMICA Y LA
ALTERABILIDAD DE LOS ÁRIDOS.
NORMAS: EN 1367-4 / BS 812:102
A107
MOLDE PRISMÁTICO 50x50x200 mm con tres bandas, para
determinar la propiedad térmica y la alterabilidad de los áridos en
la contracción por secado del hormigón.
El ensayo se ejecuta con hormigones en proporciones fijas de
mezcla y el tamaño máximo de los áridos 20 mm.
Peso: 8 kg
A107
COMO ALTERNATIVA:
E078 KIT
COMPARADOR DE VARIACIONES LINEALES con reloj indicador
digital S382-01,12 mm de recorrido y 0,001 mm de división, con
batería y conexión RS232 a la PC.
S382-11 Cable de conexión a la PC modelo S382-01
S382-12 SOFTWARE para S382-01
E078-01 Referencia de la barra para el molde A101
(UNI 8520-22)
E078-06 Referencia de la barra para el molde A107
(UNI EN 1367-4)
E077 KIT
E078 KIT
E078-01
E078-06
A107-11
58
RECAMBIO:
A107-11
Inserciones para el molde A107. Paquete de 12 piezas.
Determinación de la reactividad
potencial de álcali en áridos para su uso
en hormigones
NORMA: UNI 8520-22
A101
MOLDE PRISMÁTICO, 25x25x280 mm con tres bandas y seis
inserciones de acero para determinar las variaciones dimensionales
de la muestra.
Hecho de acero, dureza Vickers HV 400 aprox.
Dimensiones: 120x300x h 35 mm
Peso: 4,5 kg
A101
E087-06
A101-11
ACCESORIOS:
A101-11 Piezas de inserciones de acero para molde A101.
Paquete de 12 piezas.
Determinación de la resistencia al
choque térmico
A023-01
Horno de mufla 1100 °C de gran capacidad
NORMA: EN 1367-5
Se utiliza para la determinación de la resistencia al choque térmico
de áridos sujetos al calentamiento y secado, en la producción de
mezclas bituminosas en caliente.
En el ensayo se aplica a áridos calientes y mojados una temperatura
de 700 °C durante 180 segundos, y se compara la pérdida de
fuerza y la pérdida de finos, obtenido según la Norma EN 1097-2
antes y después de la prueba de calentamiento.
El horno también se puede utilizar en los ensayos de laboratorio
en general.
Datos técnicos: ver pág. 28
Alimentación: 400V 50/60Hz Trifásico 9kW
ACCESORIOS:
A107-20 PLACA DE ENSAYO, metálica 440x240x4 mm con 12
mm de canto
E087-06 COMPACTADOR, hecho de madera dura, para
compactar la muestra.
A107-21 SOPORTE para placa de
ensayo, metálico.
ACCESORIOS ADICIONALES:
A107-22 PLACA a prueba de
fuego, 445x250x10 mm
E077 KIT
COMPARADOR DE VARIACIONES LINEALES. Con reloj indicador de 5 mm de recorrido y 0,001 mm de división mod. S375.
Vea la sección de catálogo “E”, pág. 291.
A107-23 MALLA de acero
inoxidable, tamaño de
445x250 mm, 2 mm de
luz.
instrumentos para ensayos de materiales
A023-01
A109
A122
Abrasímetro
Peine de Barton (perfilómetro) 300 mm
de largo
NORMAS: EN 154 / EN ISO 10545-7
Adecuado para determinar la resistencia a la abrasión de cerámicas
esmaltadas y otros materiales. Este instrumento tiene tres puestos
de ensayo, pudiendo trabajar con cargas abrasivas húmedas (PEI) o
cargas abrasivas secas (MCC).
Su excentricidad es de 22,5 mm.
Va a 300 revoluciones por minuto.
Se entrega completo con una protección de seguridad según las
directivas de la CE.
Alimentación: 230V 50Hz monofásica 300W
Dimensiones: 400x700x500 mm
Peso: 38 kg
Se utiliza para evaluar la rugosidad superficial. Este simple dispositivo, de 300 mm de largo, permite analizar una superficie disponiendo sobre ella un conjunto
A122
de delgados alambres
de acero.
Dimensiones:
300x120 mm
A122-01
Peso: 1kg
A122-01
Peine de Barton (perfilómetro)
150 mm de largo. Igual que el mod. A122,
pero de 150 mm
de largo.
sección A
ÁRIDO S - ROC AS
A122-10
59
A109
A122-10
Prueba de inclinación (Tilt Test)
A115
Kit de Mohs
NORMA: EN 101
Utilizado para la determinación de la dureza superficial de los materiales. Contiene una caja con 9 minerales de la escala de dureza
de Mohs, barra de cobre, un cristal pequeño y un pequeño imán.
Peso: 500 g
A115
Índice de velocidad de propagación de
ultrasonidos en las rocas
Equipo de ultrasonidos, ver apartado “C” Hormigón los modelos
C369N÷C372N.
pág. 265÷267
El instrumento mide el coeficiente de rugosidad de una muestra de
roca o de las juntas.
La muestra es por lo general un testigo de roca cortada por la
mitad longitudinalmente, o un testigo de roca intercalado entre
otros dos. La unidad también está diseñada para evaluar la posible
tendencia al escurrimiento de mezclas bituminosas que cubren
las pendientes de las presas sometidas a altos niveles de radiación
solar. La tendencia al escurrimiento es la deformación permanente
de la viscosidad de un material.
El aparato consiste en un plano inclinado regulable en que la se
coloca la muestra.
Ángulo de inclinación: 0 - 50 °
Diámetro máx.de la muestra: 100 mm
El plano se inclina lentamente hasta que se produce el deslizamiento de la superficie superior de la muestra en la inferior.
El índice de rugosidad puede evaluarse a partir de la inclinación del
ángulo medido.
A132
Dimensiones:
270x175x265 mm
Peso: 5 kg aprox.
A132-01
A132
C372N
Martillo de Geólogo, de punta de pico
afilada, para la identificación preliminar de rocas. Peso:
600 g aprox.
A132-01 Martillo de Geólogo, con punta de cincel,
para la identificación preliminar de rocas. Peso: 400 g
aprox.
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
C381
sección A
Esclerómetro para rocas
MODELO DE BAJA ENERGIA DE IMPACTO
NORMAS: ASTM D5873 / ISRM
El Martillo de impacto se utiliza en los ensayos de clasificación de rocas. La probeta
de roca cilíndrica, (normalmente NX de
54,7 mm de diámetro) se apoya en una
base especial (accesorio) en posición horizontal, y el esclerómetro realiza la prueba
en toda su longitud, para obtener
una media de todas las lecturas.
Energía de impacto: 0,74 Nm
Rango de medida:
10÷60 N/mm2. Peso: 2 kg
ACCESORIO:
A121
Soporte Universal
60
C381
C390
A125-02
A095
A121
NORMA: ASTM D5873
Para fijar las probetas cilíndricas o de roca de EX a NX durante los
ensayos de clasificación realizados con el esclerómetro mod. C381.
Peso: 20 kg
C390
Yunque de Calibración
NORMAS: EN 12504-2 / ASTM D5873, C805
Utilizado para la verificación periódica obligatoria de los martillos
de ensayo según especificaciones de la Norma EN
Datos técnicos: véase la sección “C” pág. 262 de Hormigón.
Dimensiones: diámetro 150x230 mm. Peso: 16 kg
Pulidora-Desvastadora, se utiliza para la preparación
de probetas de roca y muestras metalográficas. El disco tiene 200
mm de diámetro y una velocidad de rotación de 300 r.p.m.
La máquina se entrega completa con un disco de trabajo de baquelita y un juego de 25 discos abrasivos de carburo de silicio.
Alimentación: 230V 50Hz monofásica 200W
Dimensiones: 370x500x300 mm
Peso: 31 kg
RECAMBIO:
A095-01
DISCO ABRASIVO
de carburo de silicio.
Paquete de 25 discos.
A125
Ensayo de carga puntual (Point Load Test)
NORMA: ASTM D5731
Se utiliza para determinar los valores de resistencia de una muestra
de roca, tanto en el campo como en el laboratorio. El equipo
consta de un bastidor para la aplicación de cargas de hasta 55 KN,
el cual lleva incorporado un gato hidráulico manual.
El instrumento acepta probetas de roca de hasta 4” (101,6 mm) de
diámetro que se introducen entre dos puntas cónicas. Una escala
graduada indica la distancia entre las dos puntas. La carga aplicada
se obtiene a través de un transductor de presión y visualizado en
una pantalla digital de escala de precisión de 0-56 kN –65.000
divisiones –0,001 kN de resolución y precisión ± 1%. El índice de
resistencia (IS) se obtiene mediante la fórmula P:D2, donde P es la
fuerza aplicada y D la distancia entre las dos puntas cónicas.
Se suministra completo con una caja de madera para el transporte
y accesorios. Dimensiones: 400x530x720 mm. Peso: 25 kg
ACCESORIOS:
E142-10
SOFTWARE para descargar los resultados del ensayo al ordenador.
A125-02 Plato inferior y superior con rótula para convertir el
Point Load en una pequeña prensa portátil (ver apartado “C” Hormigón, modelo C094) pág. 219
RECAMBIO:
A125-01 Juego de dos puntas cónicas templadas.
instrumentos para ensayos de materiales
A125
A095
C298
C300-08
Máquina rectificadora de probetas
Dispositivo de preparación de superficies
de testigos
NORMAS: EN 12390-3 / ASTM D4543 / UNI 6132
Diseñada para pulir y rectificar probetas cilíndricas y cúbicas de
hormigón, rocas, piedras naturales, etc. con una altura máxima
de 350 mm. Las probetas se fijan a la mesa mediante estribos
adecuados, asegurando un perfecto acoplamiento y bloqueo. El
cabezal giratorio se mueve radialmente y alternativamente en los
dos sentidos por medio de un motor eléctrico accionado por un
pulsador.
El movimiento vertical del cabezal abrasivo tiene una precisión de
0,05 mm.
La máquina pulidora se suministra completa con un tanque de recogida y decantación de agua, una electrobomba, una gran pantalla
de protección resistente al agua, ocho sectores abrasivos.
Se suministra sin mordazas de bloqueo ni sectores abrasivos de
diamante, que deben pedirse por separado (ver accesorios).
C298 / C299
Utilizado conjuntamente con la máquina rectificadora, prepara caras
planas y paralelas de testigos de roca.
El dispositivo acepta hasta
4 testigos de 20 a 55 mm
de diámetro y se puede
montar en la mayoría de las
máquinas rectificadora.
Peso: 7 kg aprox.
C300-08
A130
Durabilímetro Slake (Slake durability test)
sección A
ÁRIDO S - ROC AS
NORMA: ASTM D4644
Este equipo ha sido desarrollado para evaluar la durabilidad de la
roca al debilitamiento y desintegración cuando se somete a la simulación de efectos de la alterabilidad por el clima. Las muestras de
roca se secan y luego se someten a una prueba de estrés dentro
de un tambor que gira en el agua. La prueba se lleva a cabo en
diferentes tiempos y el desgaste se valora por la pérdida de peso
de la muestra.
El sistema incorpora una unidad de accionamiento del motor
montado en una placa base que hace girar a dos (o hasta cuatro)
tambores de acero inoxidable fabricados con malla de 2 mm, 140
mm de diámetro x 100 mm de largo.
Los tanques se llenan con agua hasta un nivel de 20 mm por
debajo del eje del tambor. Un contador de tiempo digital detiene
automáticamente el motor después de la hora programada.
El equipo se suministra completo con dos tambores con sus tanques, pudiendo aceptar dos tambores adicionales (ver accesorios).
Alimentación: 230V 50Hz monofásica 250W
Dimensiones: 350x740x300 mm aprox.
Peso: 30 kg aprox.
- Superficie de la mesa de trabajo: 775x280 mm
- Diámetro del cabezal de pulido: 330 mm
- Ancho útil vertical: mínima 90 mm máxima 350 mm
- Alimentación: 220/400V trifásica 50Hz 2200W
- Dimensiones: 1220x1080x (h) 1730 mm
- Peso: 410 kg
C299
Máquina rectificadora de probetas automática
Igual que el modelo C298, pero el movimiento radial del cabezal
está equipado con un sistema final de carrera, garantizando un
desplazamiento completamente automático en ambas direcciones,
sin necesidad de activar el pulsador.
ACCESORIO:
C300-02 SECTORES DE DIAMANTE (cantidad necesaria: 8 unidades) especialmente indicados por su larga duración y
su gran abrasividad.
Accesorios adicionales están detallados en la sección “C” Hormigón
pág. 249
A130
A130-11
ACCESORIO:
A130-11
TAMBOR DE MALLA
completo con el tanque,
base y accesorios para
conectarse con la unidad
A130.
instrumentos para ensayos de materiales
61
ÁR I D OS - RO C A S
C377
sección A
Equipo para micro-perforación de testigos
62
NORMA: UNI 10766
Extraer una muestra de micro-testigo de una roca es un método
no destructivo muy válido, ya que permite el análisis y las evaluaciones precisas (resistencia a la compresión) sin causar ningún
daño, teniendo en cuenta la dimensión del agujero que puede ser
eventualmente tapado con mortero.
El sistema de la extracción de micro-testigos es válido y fiable si se
combina con la sonda de ultrasonidos y el martillo de impacto. La
extracción de micro-testigos es fácil, correcta y requiere la presencia de un único operador.
El equipo consta de:
- eficaz taladro eléctrico, 230V monofásico 50Hz
- ensamblado con bridas guía
- protector de perforación
- brocas de impregnación de diamante pera testigos de
Ø 28 x 100 mm
- brocas de impregnación de diamante pera testigos de
Ø 28 x 200 mm
- 2 pinzas auto bloqueantes para ajustar la guía con bridas de
montaje a la superficie.
- juego de accesorios que comprende: los anclajes, brocas, llaves
fijas, tornillos.
- maleta de transporte.
Dimensiones: 550x400x200 mm aprox. Peso: 10 kg aprox.
C377-05
MÁQUINA DE RECORTE / CORTE PARA TESTIGOS
Máquina para cortar y repasar testigos para los ensayos de
compresión, donde una superficie completamente plana es una
condición básica para obtener resultados correctos.
El equipo está hecho de acero inoxidable y aluminio, y se suministra
con disco de diamante de diámetro 180 mm.
A tal efecto, deberá utilizarse la máquina perforadora saca testigos
C377-10 (incluido en el equipo de micro-perforación) y el depósito de agua con bomba de pie mod. C377-01.
C377-05
C377
Nota:
Los valores máximos previstos para la compresión
de micro-testigos suelen ser inferiores a 60 kN.
La prensa de compresión portátil modelo C094
(ver pág. 219), o la máquina de compresión de
cemento (ver pág. 312) se puede utilizar convenientemente.
El devastado de los testigos puede realizarse con
la máquina de pulido mod. C298 + el dispositivo
mod.C300-08 (ver pág. 249) .
C377-02
C377-01
ACCESORIO:
C377-01
TANQUE DE AGUA CON BOMBA DE PIE, que deja las manos
de los operadores libres para perforar.
COMO ALTERNATIVA:
C377-02
AIRE-AGUA tanque de presión, con 10 litros de capacidad.
instrumentos para ensayos de materiales
RECAMBIOS:
C377-10 TALADRO ELÉCTRICO, adecuado para micro-testigos.
C377-15 CORONA DE DIAMANTE de diámetro 28 x 100 mm
C377-16 CORONA DE DIAMANTE de diámetro 28 x 200 mm
ÁRIDO S - ROC AS
A129
Equipo para ensayos de corte directo en rocas
NORMAS: ASTM D5607* / ISRM
Se utiliza para determinar la resistencia y la estabilidad al deslizamiento de rocas de tamaño máximo de 115x125 mm, o probetas
de diámetro máximo de 102 mm, en laboratorio o en obra.
El equipo está compuesto de una caja en dos mitades, dos gatos de
corte en las dos direcciones horizontales, un gato vertical para carga,
dos manómetros de precisión tipo Bourdon de diámetro 150 mm,
equipo calibrado a 50 kN y div. 1 kN, dos bombas manuales, manguitos hidráulicos de conexión rápida, comparadores 25x0,01 mm.
Dimensiones: 600x250x460 mm
Peso: 46 kg
A129-01
ACCESORIOS:
A129-01 MOLDE DE FORMA, para preparar la
probeta con dimensiones y geometría
requerida por la caja de corte.
A129-02 ACUMULADOR DE PRESIÓN, completo con bomba
para poder absorber las variaciones de volumen de
la probeta y garantizar un empuje vertical constante
durante el ensayo.
A129-03* Conjunto de 4 comparadores 10 mm de carrera x
0,002 mm de división, completos con soportes para
medida del desplazamiento vertical como se pide en la
Norma ASTM D5607.
A129-04 Yeso Inglés Crystacal para preparar probetas.
Saco de 25 kg.
A127
sección A
A129-02
A129
63
A129-03
Tronzadora
Activa muestras de roca o de metal que deben adoptarse cortes suaves y en frio, de conformidad con el pliego de condiciones metalográfico. Diámetro del disco 200 mm adecuado para
testigos de hasta 60 mm de diámetro.
Completo con sistema de
enfriamiento, conjunto de discos,
pinza de precisión y soporte
de muestras.
Alimentación:
A127
400V trifásica 50Hz 1,3kW
(monofásica bajo pedido)
Dimensiones:
570x720x550 mm
Ensayo de tracción indirecta para testigos de
Peso: 75 kg
roca
S205 + E171
NORMA: ASTM D3967
Este método de ensayo se realiza midiendo la resistencia a la
tracción uniaxial de una muestra de roca sometido a compresión
a lo largo de su diámetro. El modelo que figura en forma de disco
circular tiene espesor entre 0,2 de 0,75 a su diámetro.
Normalmente se utiliza un diámetro de muestra NX 54 mm.
El ensayo se realiza a través de la Máquina Universal de Ensayos
“Unitronic” mod. S205, que tiene una capacidad de 50 kN, donde
se controla la carga y el desplazamiento. La máquina está equipada
con una célula de carga eléctrica, dispositivo para una compresión
adecuada mod. E171, accesorios. El equipo completo está descrito
y representado en la sección “S” Suelos, pág. 384.
instrumentos para ensayos de materiales
sección A
ÁR I D OS - RO C A S
64
A150N
Determinación del
MÓDULO ELÁSTICO
monoaxial y triaxial de
compresión de rocas
A150N + C089-04N
Sistema: Automático con control del gradiente incluso en el descenso.
NORMAS: UNI 9724-8 / ASTM D7012 / ISRM / UNE 22950-3
Puede ser utilizado con una prensa de gran estabilidad
MATEST con capacidad de 2000 o 3000 kN, junto con el
Sistema Servocontrolado automático “Servo-Plus Evolución”
(mod. C104N).
El equipo comprende:
C134
• Sistema hidráulico
C125-12
Formado por una central hidráulica que, a través de una
sofisticada válvula pilotada automáticamente por la centralita
electrónica, permite el control del gradiente de carga en
salida, el mantenimiento de un dato de carga y el “control
del gradiente de carga en el descenso”.
La regulación del gradiente de carga efectuado por una
válvula muy sensible accionada por un motor paso a paso, permite una acción micrométrica sobre el gradiente, garantizando excelentes
resultados. Un sensor de posición con haz láser, permite un posicionamiento rápido del pistón, con una sensibilidad de precarga del ensayo
de aproximadamente 0,1 por 1000 de la capacidad máxima.
• Sistema electrónico de medida
La centralita de control y elaboración de datos, de elevadas prestaciones, controlada por un microprocesador de 32 bits, tiene la
posibilidad de gestionar hasta 8 canales de alta resolución para el control de células de carga o transductores, con un puente de bandas
extensométricas. La centralita contiene dos convertidores Analógico/Digitales de última generación con resolución de 24 bits. El sistema
elabora las señales de las células de carga y de los extensómetros suministrando todos los datos necesarios para una elaboración sucesiva a
través del P.C. según las más recientes Normas Internacionales para esta aplicación.
instrumentos para ensayos de materiales
ÁRIDO S - ROC AS
El usuario debe introducir una serie de datos relativos a la probeta del ensayo y al tipo de prueba, que desea realizar. Por ejemplo: forma de la
probeta (cilíndrica, cúbica o prismática), dimensiones, edad de la probeta, valor medio de resistencia de rotura, etc. El equipo permite la verificación
de la lectura correcta de las galgas extensométricas y si todo vuelve a entrar en las tolerancias previstas, gestiona el dato medio de la deformación
indicada en los transductores y elaborada por la centralita, y transmite todos los datos del ensayo a través del puerto serie de comunicaciones RJ45
(Network Connection) al PC del usuario o a un PC que se tiene que pedir aparte (no esta incluido en el software).Todos los datos del ensayo serán
procesados por el software y transformados en una gráfica de carga/deformación y carga/tiempo, siguiendo las especificaciones de las Normas.
El software da la posibilidad de imprimir en una impresora estándar un certificado del ensayo detallando todos los datos relativos al ensayo, así como
el gráfico correspondiente. Con el software se incluye la licencia “Servonet” mod.C123N. Los extensómetros (propuestos en las dos versiones:
A y B) no están incluidos en el equipo y deben de pedirse aparte (ver accesorios).
ACCESORIO:
A150-01N
Software para el ensayo del Módulo Elástico Secante a Compresión del Hormigón.
NORME: UNI 6556 / ASTM C469 / ISO 6784 / DIN 1048
NOTA:
El módulo elástico de las rocas mod. A150N debe utilizarse junto con:
A) Extensómetros (bandas extensométricas) monouso, modelo
eléctrico (obligatorio para realizar ensayos con las células de
Hoek), disponibles en diferentes tamaños,
o
B) Extensómetros / Compressómetros electrónicos, universales
de estructura mecánica los cuales no están incluidos en el
suministro estándar y tienen que ser pedidos por separado (ver
accesorios).
COMO ALTERNATIVA:
B) C134
C134 EXTENSÓMETRO / COMPRESSOMETRO, electrónico,
universal, de estructura mecánica.
Detalles técnicos: ver pág. 192
sección A
• Software de adquisición y elaboración de datos UTM2. (Universal Testing Machine 2) Licencia para el Módulo Elástico de ROCAS
El software desarrollado en la línea funcional del UTM2 (menú de ventanas sobre base Windows) contiene memorizados los perfiles de
las Normas más usadas, pero que el usuario puede modificar según desee, personalizando el perfil del ensayo, que será luego ejecutado
de manera completamente automática por la máquina..
C134-10
PLANTILLA para regular y calibrar la
longitud de la base del extensómetro
C134.
65
C134
ACCESORIOS:
A) EXTENSÓMETROS
ELÉCTRICOS DE UN SOLO
USO (galgas extensométricas),
paquete de 10 unidades.
C125-10...C125-13
Modelos disponibles:
C125-10 Extensómetro eléctrico, longitud de base 10 mm
C125-11 Extensómetro eléctrico, longitud de base 20 mm
C125-12 Extensómetro eléctrico, longitud de base 30 mm
C125-13 Extensómetro eléctrico, longitud de base 60 mm
C125-15
Kit para la aplicación de las galgas extensométricas, compuesto de:
cola, soldador, líquido limpiador, accesorios y todo contenido en un
maletín.
Pantalla típica donde se representan las deformaciones longitudinales y
las deformaciones transversales durante la realización del ensayo.
C125-09
MODULO DE INTERFAZ “accesorio necesario” para conectar
hasta 4 extensómetros eléctricos de un solo uso. Este módulo
permite también la calibración automática, con una compensación
térmica especial, desde cero y
en el rango de medidas. Este
garantiza una precisión cinco
veces superior a la solicitada
por las Normas.
C125-09
Datos del ensayo
instrumentos para ensayos de materiales
ÁR I D OS - RO C A S
ENSAYOS TRIAXIALES DE PROBETAS DE ROCAS
NORMAS: ASTM D2664, D5407, D3148, D2938 / ISRM / UNI 9724-8
sección A
El ensayo triaxial se efectúa con una probeta de roca contenida en
una cámara (célula de Hoek) envuelta en una membrana de látex.
La muestra estará sometida a una carga axial y a una presión isotrópica constante durante todo el ensayo, normalmente comprimida
entre 5 y 60 MPa.
66
Los extensómetros eléctricos se
aplican directamente en la superficie de
la probeta de roca, su función es dar
información automática en tiempo real
de varios parámetros:
- deformación radial combinada con la deformación axial para
obtener el Coeficiente de Poisson
- valor de tensión en relación a la deformación axial y radial
- el valor máximo o de rotura
- módulo de Young tangente y secante, medido en la curva de la
deformación axial
- valor máximo de tensión en condiciones triaxiales.
Las Normativa piden que durante el ensayo de carga a compresión de la probeta de roca, esta carga se aplique de modo
continuo para poder obtener una rotura de la misma en un tiempo
comprendido entre 5 y 10 minutos, con un incremento de la carga
constante comprendido entre 0,5 y 1,0 MPa/segundo.
A tal fin se recomienda utilizar un prensa de compresión con valor
de 1500, 2000 o 3000 kN (Ver apartado de Hormigón) combinada
con el sistema automático servocontrolado “Servo-Plus Evolution”
mod. C104N y el sistema automático para la determinación del
Módulo Elástico de Rocas mod. A150N, que comprende el Software de adquisición y elaboración de datos.
La presión lateral, introducida por el operador, se mantiene constante entre ±1% utilizando:
C104N LP
Sistema automático servocontrolado “Servo-Plus Evolution” que
garantiza una regulación de la presión hasta 80 MPa.
C089-04N + A150N
instrumentos para ensayos de materiales
C104N LP
ÁRIDO S - ROC AS
Células de Hoek para ensayos triaxiales en probetas de roca
Para utilizarse con presiones de hasta 70 MPa.
Se utiliza para medir la resistencia de probetas cilíndricas de roca que están sometidas a ensayo triaxial.
Una Célula de Hoek básica consiste en:
cuerpo completo de la célula con tapones roscados superior e inferior, dos conexiones hidráulicas laterales, dos pistones cóncavos y dos
convexos, cementados y templados, manguito de goma sintética.
sección A
A137-03
A137 - A139
A137-02
A136-01
MODELOS:
Dimensiones probeta Medida Juego
Diámetro x altura
de platos
(1 par)
A137 38,10x 75 mm
A138 42,04x 85mm
A139 54,74x100mm
1,5”
BX
NX
A136-01
A136-01
A136-01
Pistones cóncavo
y convexo
de recambio
Manguito
de recambio
A137-02
A138-02
A139-02
A137-03
A138-03
A139-03
Corona diamantada
Longitud
útil 200 mm
Par de
adaptadores
para la extrusión
A137-04
A138-04
A139-04
A141-02
A141-03
A141-04
NOTA: El par de platos A136-01 se utilizan para distribuir la carga y evitar que el pistón de la célula haga marcas sobre los platos de la prensa.
El juego de adaptadores del extractor se compone de un plato de extrusión, un tapón y un soporte para el cuerpo de la célula.
A147
Dispositivo de compresión de testigos de roca
NORMA: ASTM D2938
Se utiliza para realizar pruebas de compresión testigos de muestras de roca con
un diámetro máximo de 55 mm y una altura entre 95 y 110 mm. El pistón de carga
es sostenido por dos resortes; el cilindro de compresión superior está equipado
con un asiento esférico, y el plato inferior se apoya en la base.
Carrera del pistón: 20 mm - diámetro de los platos: 55 mm
Altura libre: máx. 112 mm, min. 92 mm - Dureza de los platos: 60 HRC
Dimensiones: 151 mm de diámetro por 249 mm de altura
Peso: 10 kg aprox.
A147
A140-01
Máquina saca testigos, utilizada en el laboratorio con
las coronas diamantadas (accesorios A137-04 ÷ A139-04) para
obtener testigos de muestras a partir de roca de forma irregular.
El motor eléctrico con dos velocidades, 1500/2700 rpm, provisto
de embrague y doble sistema de aislamiento conforme a las directivas de seguridad CE.
Completo con un sistema de bloqueo de probeta, dispositivo de
enfriamiento con agua y cubeta de recogida.
Alimentación: 230V 50Hz monofásica 1800W. Peso: 60 kg aprox.
A137-04
A140-01
A141
A141
Extractor
Se utiliza para extraer la muestra de roca del manguito de goma, evitando la salida del
fluido por la presión lateral. Se suministra sin los adaptadores, que deben pedirse por
adaptadores
separado (ver tabla). Peso: 12 kg.
instrumentos para ensayos de materiales
67
ÁR I D OS - RO C A S
A142
Sistema de presión hidráulica constante e
isotrópica para célula de Hoek
sección A
El equipo consiste en una bomba manual, completada con un manómetro de precisión, alcanzando presiones de 70 MPa, completo
con un tanque y sus tubos de conexiones, que supone una fuente
de presión continua a la célula Hoek.
Peso: 18 kg
68
ACCESORIO:
A129-02
Acumulador de presión, completo con bomba para mantener la
presión constante durante el ensayo.
A142+A129-02
Permeabilidad de las rocas con célula de
Hoek
Para medir la permeabilidad o el flujo de agua a través de una
muestra de roca con un sistema controlado de agua a presión.
Las células Hoek pueden equiparse con sus tapones (accesorio),
enroscados al cuerpo de la célula.
El juego consiste en un tapón superior y uno inferior, completado
con un dispositivo de suplementos.
A138-05
A137-05
MODELOS:
A137-05 Probetas de 38,10 mm de diámetro
A138-05 Probetas de 42,04 mm de diámetro
A139-05 Probetas de 54,74 mm de diámetro
A144
S275
Dispositivo para permeabilidad, montado sobre
un soporte, se conecta al tapón de cierre de la célula de Hoek.
Bureta de 50 ml de capacidad con divisiones de 0,1 ml.
ACCESORIO:
S325
Tubo de nylon opaco. Carrete de 25 m.
Sistema de presión constante de aceite/
agua para ensayos de permeabilidad
La regulación de la presión costante es infinitamente variable entre
0 y 3500 kPa. Para utilizarse con la Célula Hoek, equipado con
tapones de cerrado y un dispositivo de permeabilidad.
La unidad consiste en una bomba hidráulica motorizada, recipiente
aceite/agua, dispositivo de pistón/resorte, y 10 l de aceite de alta
viscosidad.
Se suministra completo con manómetro de precisión para controlar la presión, escala 0-3500 KPa.
Alimentación: 230V monofásico 50Hz
Peso: 20 kg
S275
A137-05
A137
A144
instrumentos para ensayos de materiales
sección B
sección B
BETUNES - ASFALTOS
BETU NES - AS FALTOS
69
La utilización de materiales bituminosos está principalmente
dirigida a la construcción de carreteras.
Los hormigones bituminosos, también llamadas mezclas bituminosas, están esencialmente compuestos por áridos y ligantes con una
innumerable variación de mezclas.
Es muy importante disponer del equipamiento idóneo para realizar
toda una serie de ensayos y así poder determinar el contenido de
ligante, el rozamiento interno, la cohesión, la consistencia, el punto
de reblandecimiento, la viscosidad, la composición de los áridos, el
porcentaje de huecos, el ensayo Marshall, así como otra serie de
parámetros.
Los equipos indicados en esta sección satisfacen ampliamente
todo este tipo de ensayos, de acuerdo a las nuevas normativas EN
sobre ensayos de materiales en carreteras, reemplazando estas las
anteriores normativas nacionales.
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B005
Método del contenido en betún mediante horno de ignición.
sección B
NORMAS: EN 12697-39, EN 13108 / ASTM D6307 / AASHTO TP53 / NCAT (National Centre for Asphalt Technology) / BS (DD)
B005
70
La unidad mide el contenido en betún procedente de pavimentos de
mezclas bituminosas, con una precisión de 0,11 %, utilizando un método
rápido, preciso, sin agresiones al medio ambiente, y de bajo coste.
El método de ignición reduce el tiempo de ensayo comparándolo con la
extracción por disolventes. Una muestra de 1200-1800 g de aglomerado
asfaltico, utilizando este horno, puede analizarse en 30-45 minutos.
La unidad puede admitir muestras de hasta 5000 gramos!
El horno de MATEST tiene una balanza interna, que va midiendo el peso
de la muestra automáticamente durante el proceso de combustión,
ahorrando un tiempo importante y aumentando la productividad en el
laboratorio. El método de combustión sustituye al de la extracción por
disolventes, más caro y lento, eliminando el coste generado por la compra
de los disolventes y por otro lado el coste de la eliminación de estos.
El horno de MATEST elimina la exposición, del técnico de asfaltos, a
disolventes tóxicos. El sistema de cierre automático impide la apertura de
la puerta de la cámara durante el tiempo crítico de ensayo. Este sistema
proporciona seguridad al operador y asegura la correcta ejecución del
ensayo. Este horno es el único en el mercado que contiene un sistema
postcombustión de alta temperatura, utilizándose conjuntamente con
un filtro cerámico patentado para reducir las emisiones del proceso de
ignición hasta en un 95%. Nuestro sistema tiene la capacidad de admitir
factores de corrección positivos o negativos para mezclas que contengan cal hidratada. Este horno único detecta automáticamente el punto
final dentro de un 0,01% del peso de la muestra. El software del horno
permite escoger entre el modo automático o manual. En el modo automático, el equipo detecta el punto final del ensayo; el software finaliza
el ensayo, imprime los resultados y emite una señal acústica de aviso.
instrumentos para ensayos de materiales
En el modo manual, el equipo detecta el
punto final; la unidad emite la señal acústica
pero continúa el ensayo hasta que el usuario acciona el botón de paro. Una vez se ha
parado el equipo, la puerta se desbloquea y
se imprimen los resultados. El software del
horno compensa automáticamente el cambio
de peso de la muestra debido al cambio de
temperatura de la muestra y su recipiente.
Esta compensación se calcula para cada muestra analizada, a diferencia de los modelos de
la competencia que asignan un número fijo a
una amplia gama de tamaños de muestras.
El horno se suministra completo con 4
cestas, 2 bandejas, 2 tapas, un manipulador,
una cesta de seguridad para el enfriamiento,
placa aislante, guantes, careta, 4 rollos de cinta
de impresora.
Dimensiones externas: 552x654x933 mm
Dimensiones internas: 355x355x355 mm
Alimentación:
230V 50Hz monofásica 4800W 20A
Rango de temperaturas: 200-650º C.
Peso: 120 kg
B005 - accesorios
A022
Horno Mufla 1100 ºC
NORMA: EN 12697-1 all. C, EN 13108
Este horno se utiliza para la determinación de la materia mineral
residual mediante la incineración de las mezclas bituminosas.
Detalles técnicos: véase la
sección “A” Áridos, pág. 28.
ACCESORIO:
V114-10
Cubeta de evaporación de
SÍLICE, de diá.130x23 mm
(160 ml de capacidad).
A022
BETU NES - AS FALTOS
B008
Grupo automático de extracción
de betunes
sección B
NORMAS: EN 12697-1, EN 13108
CNR a. VII N °38 / DIN 1996 / ASTM D2172
Se utiliza para realizar análisis seguros de mezclas bituminosas utilizando el percloroetileno (PCE) o el tetracloroetileno disolvente clasificado como: R40 no cancerígeno
(ver nota *), para la determinación cuantitativa de ligante o
betún contenido en morteros o mezclas bituminosas.
El ensayo se realiza en sólo un ciclo automático completo:
- lavado, disgregación y separación de la mezcla bituminosa
- separación del filler de la solución formada por el disolvente, el betún y el filler
- recuperación y destilación del disolvente permitiendo
una reutilización del mismo.
Esta unidad, en un período de tiempo corto, realiza
una serie de análisis que normalmente requieren
un largo tiempo y gran trabajo, además de reducir
costes de extracción. La unidad comprende:
- Un sistema de tamizado electromagnético, que
proporciona una doble acción vibradora (vertical/rotacional) con una tapa para el vaporizador
de disolvente, para el lavado y disgregado de la
muestra. El sistema de tamizado está montado
sobre una unidad centrifugadora, de forma que
la solución de lavado se vierte directamente en el
B008
vaso giratorio de la centrifugadora.
- Una centrifugadora de flujo continuo, con una velocidad
de rotación de 11.000 r.p.m., equipada con un vaso de acero
inoxidable de 120 mm de diámetro, y una capacidad de 400 g
aprox. de filler.
- Una unidad de recuperación del disolvente, con una capacidad
de aprox. 50 l/h, equipada con un sistema de refrigeración, y
automatismos para que la unidad se ponga en marcha y pare
automáticamente al principio y final de la destilación.
- Un panel de control separado permite programar todas estas
funciones en un sistema completamente automático. También es
posible seleccionar la función manual que permite activar cada
función específica analizada previamente.
Esta unidad se suministra completa con:
- Dos vasos de filler para la centrifugadora.
- Cuatro tamices de acero inoxidable de 200 mm de diámetro y
luces de malla: 0,063 - 0,250 - 0,800 - 2 mm
- Un bastidor sólo de 200 mm de diámetro para aumentar la
capacidad del primer tamiz
- Juego de juntas para los tamices.
Se puede disponer de tamices con otras luces de malla, mediante
pedido. Un ciclo completo de extracción se realiza en 25 minutos y
la cantidad máxima de mezcla por extracción es de 3500 g.
Alimentación: 400V trifásica 50Hz 5,5kW
Dimensiones totales: 1400x680x1820 mm. Peso total: 185 kg
* NOTA: además de la percloroetileno (PCE) o el tetracloroetileno, es posible
utilizar también el tricloroetileno (CHC1=CC12), pero de acuerdo
con la Directiva 2001/59/CE, se clasifica “R45”, y por lo tanto
considerado como un disolvente peligroso (Toxico y cancerígeno).
71
ACCESORIO:
B008-11
Revestimiento de papel para el vaso de la centrífuga.
Dimensiones: 370x200 mm
Paquete de 100 piezas.
RECAMBIOS:
B008-01 Vaso de filler de acero inoxidable y 120 mm de diámetro
B008-02 Tamiz de 200 mm de diámetro con junta hermética (cuando
haga el pedido rogamos especifique la luz de la malla).
B008-05 Únicamente el bastidor del tamiz de diámetro 200 mm
B008-06 Juntas tóricas de viton para tamices de 200 mm de diá.
Paquete de 10 piezas.
B008-10
Cabina de extracción
B008-10
La cabina permite a la unidad
de extracción automática de
betún, reducir al mínimo la
difusión de vapores y disolventes tóxicos en el laboratorio.
La estructura es de aluminio
anodizado y las paredes de
cristal de seguridad. El equipo
se suministra con 4 puertas de entrada, un aspirador eléctrico para
la extracción de vapores, y un equipo de filtraje adecuado con
carbón activo. Para este equipo se precisa una habitación con una
altura interior de al menos 3 m.
Alimentación: 380V trifásica 1100W
Dimensiones máximas: 1950x980x2630 mm. Peso: 140 kg aprox.
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
72
B011
ACCESORIOS NECESARIOS:
Extractora centrífuga 1500/3000g de
capacidad
B010-11 VASO Y TAPA CON 1.500 g DE CAPACIDAD.
De alta precisión mecanizado sobre fundición de aluminio. Peso: 3,6 kg.
B010-15 FILTRO DE DISCO, 1500 g CAPACIDAD. Paquete de
100 piezas.
B010-12 VASO Y TAPA CON 3000 g DE CAPACIDAD.
De alta precisión mecanizado sobre fundición de aluminio. Peso: 4,6 kg.
B010-16 FILTRO DE DISCO, 3000 g DE CAPACIDAD. Paquete
de 100 piezas.
NORMAS: EN 12697-1 all. B.1.5, EN 13108 / ASTM D2172
AASHTO T164A
Se utiliza para la determinación del porcentaje de betún en mezclas
bituminosas. Consiste en un vaso rotativo, extraíble, de aluminio
(accesorio de 1500g o 3000g), colocado en un recipiente cilíndrico
de aluminio.
El equipo tiene un panel de control individual, con una tarjeta
electrónica que incorpora un automatismo de corriente alterna,
controlando automáticamente la rampa de aceleración rotatoria
del vaso de 0 a 3600 r.p.m., siguiendo la normativa, con una parada
automática rápida de la rotación del vaso al final del ensayo.
Se suministra completo con un regulador de velocidad y una pantalla digital de visualización de la frecuencia.
La centrifugadora se suministra sin vaso y tapa de aluminio y sin
filtros de papel, que deben solicitarse aparte.
Alimentación: 230V monofásica 50/60Hz 550W
Dimensiones: 550x380x500 mm
Peso: 50 kg aprox.
ACCESORIO:
TRICLOROETILENO, DISOLVENTE PARA LA EXTRACCIÓN DE
BETÚN. No podemos suministrarlo por problemas de envío.
B010-11
B010-15
B010-12
B010-16
• Acepta vasos de 1500g y 3000g de
capacidad
• Control de velocidad de 0-3.600
rpm con “Inversor” a 50/60Hz
• Panel de control por separado
para el control de la velocidad y las
revoluciones en la pantalla digital.
• Modelo anti-explosivo (B011-01)
• Posibilidad de dispositivos de seguridad CE (B011-10)
B011
B011-01
Extractora centrífuga “antiexplosiva”
1.500/3.000g de capacidad
Mismo mod. B011, pero equipado con un motor eléctrico especial
anti-explosivo.
El panel de control tiene que instalarse en una zona anti-explosiva.
instrumentos para ensayos de materiales
OPCIÓN DE ADAPTACIÓN:
B011-10
SISTEMA DE SEGURIDAD MEDIANTE MICROINTERRUPTOR
ELECTROMAGNÉTICO
impidiendo la apertura de la
B011-10
tapa cuando la centrífuga está
en funcionamiento de trabajo,
o mientras el vaso está en
rotación.
Conforme a las directivas de
seguridad de la CE.
No es aplicable a la versión de
centrífuga antiexplosiva
mod. B011-01.
B014
B021
Extractora de flujo continuo, sin filtros
Recuperadora de disolventes - 10 litros/
hora
NORMAS: EN 12697-1 all. B.2.1, EN 13108 / DIN 1996
CNR N° 38 / ASTM D1856
Diseñada para la separación rápida y sin filtros del filler de la
solución de ligante u otras mezclas que contengan sedimentos
(cemento, suelo, arcilla) en suspensión.
Puesto que no se requiere filtro, no hay dispersión del material
para asegurar la máxima precisión en resultados. La solución se
vierte dentro del embudo superior y cae dentro del vaso rotor
de 70 x 200 mm. Debido al efecto centrífugo, el líquido asciende
verticalmente dejando el filler y las partículas minerales en las
paredes del vaso. La centrifugadora se suministra completa con el
vaso de aluminio, dos tamices de 2 mm y 0,063 mm de luz de malla
respectivamente. La velocidad de rotación es de 11500 r.p.m., con
una rampa automática y un control de velocidad prefijado.
La capacidad de extracción es de hasta 100 g de filler por ensayo.
Alimentación: 230V monofásica 50Hz 600W
Dimensiones: 350x600x720 mm.
Peso: 60 kg
Esta unidad eficiente y compacta, fácil de instalar, es totalmente
autónoma. Está provista de dos tanques: uno para el disolvente
limpio y otro para el disolvente sucio y un sistema de enfriamiento
por agua que sólo necesita estar conectada a un grifo. También
viene equipada con un mecanismo de seguridad, que desconecta el
equipo cuando el nivel de disolvente es demasiado bajo o una vez
se ha completado el proceso.
Fabricada totalmente de acero inoxidable de muy alta calidad (AISI
316).
Se suministra completa con embudo/tanque con un tamiz incorporado, y 10 m de tubo de plástico.
Alimentación: 230V monofásica 50/60Hz 1300W
Dimensiones: 320x400x650mm
Peso: 17 Kg
sección B
BETU NES - AS FALTOS
73
RECAMBIO:
B014-01 Vaso de aluminio de 70 mm de diámetro x 200 mm de alto
ACCESORIO:
TRICLOROETILENO, DISOLVENTE PARA LA EXTRACCIÓN DE
BETÚN.
No podemos suministrarlo por problemas de envío.
B021
B014-01
• Realizada todo en acero inoxidable de alta
calidad (AISI 316) y serpentines de cobre.
• Dispositivo de parada de seguridad por finalización del ensayo o por sobrecalentamiento.
• Recuperación de filler sin sistema de filtros
• Caudal continuo a 11.500 rpm
• Rampa automática de la velocidad
B014
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
74
B016-10 Extractor en caliente
MÉTODO DEL PAPEL DE FILTRO
NORMAS: EN 12697-1 app. B.1.1
EN 13108, EN 12697-14
BS 598 :102
La unidad se utiliza para extraer el betún de
las mezclas bituminosas, y para determinar su
contenido en agua. El equipo consta de un
recipiente metálico completo con un cestillo
de malla y filtros, un colector tipo Dean Stark,
un condensador de Liebig, papel de filtro de
diámetro 400 mm (paquete de 25 unidades).
Dimensiones: 480x480x900 mm
Peso: 22 kg aprox.
ACCESORIO:
V200-02 Placa calefactora de diá. 220 mm.
230V monofásica 50/60Hz 2000W
RECAMBIO:
B016-15 Papel de filtro de 400mm de diá.
(100 unidades).
B017 KIT
B016-20 KIT
Método Soxhelet
modificado
B016-10
Equipo de extracción en caliente
MÉTODO DEL FILTRO DE MALLA DE ALAMBRE
NORMAS: EN 12697-1 all. B.1.2, EN 13108
CNR a. VII N° 38 / DIN 1996
Este equipo consiste en un recipiente cilíndrico Tapa refrigede vidrio que contiene un cesto de malla
rante de acero
inoxidable metálica de 0,063 mm
B017 KIT inoxidable
de luz. La muestra de aglomerado (cantidad máxima 400 g)
se coloca dentro del cesto, y el
disolvente se vierte dentro de
la jarra. El cesto se coloca en
el recipiente, que se cubre con
una tapa refrigerante conectada
al agua corriente. El equipo se
coloca sobre una placa calefactora y el disolvente, que hierve y
condensa en el cesto, disuelve el
betún. El filler que va pasando a
través de la malla del cesto debe
separarse utilizando un extractor
centrífugo.
Dimensiones:
V200
160 mm de diámetro x 335 mm.
Peso: 5 kg
ACCESORIOS:
B017-02 Cesto de malla de acero inoxidable de 0,4 mm de luz
B017-04 Cesto de doble malla de acero inoxidable de 0,063 y
0,4 mm de luz
V200
Placa calefactora de 185 mm de diámetro 230V
monofásica 50-60Hz 1500W
V173-03 Rejilla de malla con centro cerámico aislante
RECAMBIOS:
B017-01 Cesto de malla de acero inoxidable de 0,063 mm de luz
B017-03 Recipiente cilíndrico de vidrio pyrex.
B017-05 Tapa refrigerante de acero inoxidable con junta.
instrumentos para ensayos de materiales
B016-20 KIT
NORMAS:
EN 12697-1 app.B.1.3
EN 13108
Consiste en un frasco de
5.000 ml de capacidad,
extractor de 2.000ml, tubo
de vapor, condensador; todo
realizado en vidrio.
Completo con 25 filtros de
cartucho de diá. 80x200mm,
manta calefactora eléctrica,
soporte y pinzas.
Alimentación: 230V monofásica 50/60Hz 900W
Dimensiones:
400x400x1000ml aprox.
Peso: 20kg aprox.
RECAMBIO:
B061-03
Filtros de cartucho Soxhelet
(paquete de 25 unidades).
B061 KIT
Extractor
Kumagawa
(Soxhelet)
capacidad 1 litro
NORMA:
EN 12697-1 app. B.1.3
EN 13108 / LCPC / CNR N°38
Se utiliza para extraer el betún
de emulsiones. Consiste en un
dispositivo calefactor eléctrico, un
balón de 1l de capacidad, tubos
de vidrio, unidad refrigerante y 25
filtros de cartucho.
Alimentación:
230V monofásica 50/60Hz 750W
B061 KIT
B061-01 KIT
Extractor Kumagawa
(Soxhelet) capacidad
2 litros
Básicamente similar al mod. B061,
pero con 2 litros de capacidad.
RECAMBIOS:
B061-02 FILTROS DE CARTUCHO, de 58 mm
de diámetro x 170 mm para el Kumagawa de 1 litro.
Paquete de 25 unidades.
B061-03 FILTROS DE CARTUCHO, de 80 mm de diámetro x
200 mm para el Kumagawa de 2 litros. Paquete de 25
unidades.
B018
B019 KIT
Equipo de recuperación de betún.
Método de la bomba de vacío
Extractor de reflujo capacidad 1000 g
MÉTODO DE EXTRACCIÓN EN CALIENTE DEL CONTENIDO SOLUBLE DE BETÚN (RECUPERACIÓN DEL BETÚN)
NORME: EN 12697-1, all. B.3.1, EN 13108 / BS 598:102
Se utiliza para la separación del disolvente de la solución de betún/
disolvente aglutinante/solvente, y para determinar el contenido de
betún en una mezcla de áridos/betún.
El equipo consta de:
- Baño de agua para mantener el agua hirviendo durante todo
el ciclo de recuperación, con la cubierta y el termostato digital,
dimensiones interiores 280 mm x 280 xh 230. Esta unidad se
puede utilizar también como baño de agua con fines generales.
- Dos frascos de vidrio con 250 ml de capacidad, tapones de goma,
tubos y llaves.
- Vacuómetro (para ser conectado a la bomba de vacío).
- Frasco Pyrex, 1000 ml de capacidad, que se utiliza como una
botella de vacío.
Alimentación: 230V monofásica 50Hz 1000W
B061-02
Peso: 25 kg aprox.
V203
B018
ACCESORIOS NECESARIOS:
V203+V205-10
Bomba de vacío para producir un vacío de hasta 220 mbar, con
regulador de vacío.
Alimentación: 230V monofásica 50Hz.
Peso: 5 kg aprox.
NORMAS: ASTM D2172 / AASHTO T164-B
Este equipo sencillo, tiene el mismo principio de funcionamiento
que el mod. B017. Consta de un frasco cilíndrico de vidrio que
contiene un soporte metálico que sujetan dos conos de malla de
acero inoxidable y un condensador de metal en la parte superior
del frasco. Se entrega completo con 100 papeles de filtro y rejilla
aislante. Dimensiones: 160 mm x 510 mm. Peso: 5 kg
ACCESORIO:
V200
Placa calefactora diá. 185 mm.
230V monofásica 50/60Hz 1500W
RECAMBIOS:
B019-01 Papel de filtro, paquete de 100
B019-02 Recipiente cilíndrico de vidrio pyrex
B019-03 Condensador metálico
B019-04 2 conos de acero inoxidable con soporte
V173-03 Rejilla de malla de alambre con centro de cerámica
sección B
BETU NES - AS FALTOS
B020 KIT
Extractor de reflujo capacidad 4000 g
Similar al mod. B019, pero con 4000 g de capacidad.
Dimensiones: 280 mm x 510 mm
Peso: 9 kg
ACCESORIOS:
V200-02 Placa calefactora diámetro 220 mm.
230V monofásica 50/60Hz 2000W
V205-10
RECAMBIOS:
B020-01 Papel de filtro, paquete de 100 unidades.
B020-02 Recipiente cilíndrico de vidrio pyrex.
B020-03 Condensador metálico
B020-04 2 conos de acero inoxidable con
soporte
V173-04 Rejilla de malla de alambre con centro
de cerámica
B020 KIT
B019 KIT
MEDICIÓN DE LA TEMPERATURA EN MEZCLAS BITUMINOSAS
NORMA: EN 12697-13
V154
Termómetro digital con microprocesador
Rango: -50 ºC+950 ºC, resol. 0,1 – 1ºC.
Suministrado “sin” sondas que deben
pedirse por separado
(ver accesorios).
Detalles técnicos:
consultar la sección”V”
pág. 446.
ACCESORIOS:
V154-01 Sonda de penetración,
120 mm de largo
V154-02 Sonda de superficie, 260
mm de largo
V154-01
V154
V200-02
V200
instrumentos para ensayos de materiales
75
BE TUN E S - A S FA LTO S
B067N
sección B
Picnómetro de vacío de 10 litros de capacidad
76
NORMAS: EN 12697-5, EN 13108 / ASTM D2041 / AASHTO T209, T283
PESO ESPECÍFICO TEÓRICO MÁXIMO PARA PAVIMENTOS DE MEZCLAS BITUMINOSAS NO COMPACTADAS
(ENSAYO DEL ARROZ)
Fabricado en Plexiglás transparente, con válvula y manómetro,
se utiliza para la determinación rápida del contenido de mezclas
B067N
bituminosas, el peso específico de los áridos, el máximo peso
específico teórico en mezclas no compactadas de materiales bituminosos para carreteras y los porcentajes de huecos en las mezclas
compactadas.
Para realizar ensayos solicitando un valor último de vacio mínimo
de 30mm/Hg.
Dimensiones: 300 mm de diámetro x 450 mm de alto
Peso: 8 kg aprox.
V205-01+
V205-10+V205-12+
ACCESORIOS:
V230-03+ B067-11
A059-02 KIT
VIBRO-DESAIREADOR ELECTROMAGNÉTICO, con ajuste de la
A059-02 KIT
intensidad de vibración.
Para la evacuación del aire ocluido mediante la vibración del picnómetro. Esta unidad se puede utilizar también como una tamizadora. V205-01 + V205-10 + V205-12
Detalles técnicos: véase la sección “A” Áridos, pág. 38.
BOMBA DE VACÍO, PORTÁTIL DOS ETAPAS, completa con
B067-11 ELASTICOS, para fijar el Picnómetro al vibro-desaireador.
regulador de vacío y trampa para la condensación del agua.
Detalles técnicos: véase la sección “V”, pág. 453.
RECUPERADOR DE BETÚN POR EVAPORACIÓN ROTATIVA
B065
V230-03 TUBOS PARA EL VACÍO, 3 m de largo..
Equipo rotativo de evaporación
NORMAS: EN 12697-1, 12697-3
Esta unidad se utiliza para recuperar el betún de un disolvente,
reduciendo al mínimo los cambios en las propiedades del asfalto. El
ensayo se realiza mediante la destilación del residuo de la solución
de disolventes y mezclas bituminosas. El matraz de destilación
rotativo está parcialmente sumergido en un baño de aceite caliente,
y la solución se somete a alto vacío, con una precisa regulación de
la presión (hasta +/- 0,1 kPa) según las especificaciones de la norma
EN 12697-3.
El asfalto recuperado se puede utilizar para realizar más ensayos,
según sea necesario. El equipo de evaporación rotativo está fundamentalmente compuesto por:
- Matraz de destilación de 1000 ml de capacidad.
- Motor de velocidad variable, adecuado para hacer girar el frasco a
una velocidad comprendida entre 20 y 270 rpm.
- Condensador.
- Matraz de recuperación de disolventes, 1000 ml de capacidad.
- Baño de aceite caliente.
El ángulo del matraz de destilación/rotativo es de
15 ° aprox. El instrumento se suministra completo,
con tubo de vidrio con válvula de tres vías y
manguera flexible y transparente para la toma de
disolventes. El equipo rotativo requiere una bomba
de vacío y un sistema de regulación del vacío (ver
accesorios).
Alimentación: 230V monofásica 50Hz
Peso: 27 kg aprox.
instrumentos para ensayos de materiales
ACCESORIOS:
B065-12 SISTEMA DE REGULACIÓN DE VACÍO, incluye válvula
de regulación, manómetro y medidor de vacío digital de
1 mbar resolución - 230V monofásica 50Hz
V205-01 BOMBA DE VACÍO de dos etapas.
Detalles técnicos: ver pág. 453 - 230V monofásica 50Hz
V230-03 TUBO DE GOMA, preparado para el vacío, 3 m de
largo.
B065-14 ACEITE TÉRMICO, lata de 5 kg
B065-15 BALON DE EVAPORACIÓN, vidrio, plano, 3 l de
capacidad.
B065-13 MATRAZ DE DESTILACIÓN de 2000 ml de capacidad
(ASTM D5404)
B065
B065-12
V205-01+ V230-03
BETU NES - AS FALTOS
RESISTENCIA A LOS COMBUSTIBLES
NORMAS: EN 12697-43, EN 13108
El ensayo se refiere a la determinación de la resistencia de un pavimento o una mezcla bituminosa frente al combustible de aviación.
Estas dos normas requieren, entre otros ensayos específicos, el
ensayo de desgaste:
A075
Máquina de
desgaste de
Los Ángeles
Detalles técnicos:
consulte la sección
“A” Áridos, pág. 45.
A075
DETERMINACIÓN DE LA AFINIDAD ENTRE ÁRIDOS Y
BETUNES
NORMAS: EN 12697-11, EN 13108
El equipo está formado por:
B022
Máquina para la rotación de frascos, con
velocidad de rotación regulable de 0 a 85 rpm, se utiliza para la determinación de la afinidad entre áridos y betunes, expresado por el
registro visual del grado de recubrimiento de betún sobre mezclas
bituminosas no compactadas, después de una agitación mecánica
por rotación en presencia de agua.
La máquina puede rodar hasta 3 botellas simultáneamente.
Alimentación:
230V monofásica 50Hz
Dimensiones:
385x295x160 mm
Peso: 10 kg aprox.
B022 + B022-11
B022-11
B022-12
B022-11
BOTELLA DE ENSAYO, de vidrio al borosilicato, 500 ml de capacidad, el diámetro 86 mm, altura 176 mm, 34 mm de diámetro de
apertura del cuello, según los requerimientos de la EN.
B022-12
VARILLA DE VIDRIO con un diámetro de 6 mm con 35 mm de
largo y tubo de goma apropiado.
TOMA DE MUESTRAS DE TESTIGOS DE MEZCLAS BITUMINOSAS EN CARRETERAS PARA LA DETERMINACIÓN DE
PROPIEDADES FÍSICAS Y COMPOSICIÓN
NORMA: EN 12697-27
C319
Máquina
sacatestigos de
pavimentos
Detalles técnicos, otros
modelos de máquinas, las
coronas extracción de
muestras, etc. se describen
en la sección “C” pág. 250.
sección B
PÉRDIDA DE PARTÍCULAS EN MEZCLAS DRENANTES
NORMAS: EN 12697-17, EN 13108
El ensayo se refiere a la determinación de la pérdida por abrasión
de partículas de las mezclas drenantes.
C319
MÉTODO DE COMPACTACIÓN POR VIBRACIÓN PARA LA
PREPARACIÓN DE PROBETAS DE ENSAYO EN MEZCLAS
BITUMINOSAS, aplicable a mezclas abiertas y testigos, para la
determinación de la densidad de compactación de una mezcla
bituminosa según las especificaciones de la EN.
NORMAS: EN 12697-9, 12697-10, 12697-32 / BS 598:10
B097
MOLDE P. R. D., molde
abierto por un lado a lo
largo de su generatriz, sujeto a la placa base mediante
anclajes rápidos, cadmiado
contra la corrosión, se
utiliza, en el control de
calidad, para determinar el
grado de compactación de
pavimentos de materiales
bituminosos.
Peso: 12 Kg
S197-01
S197
B097-03
B097-02
B097
S197
MARTILLO VIBRADOR con motor con doble aislamiento, gatillo
en el mango, para compactación de mezclas bituminosas y cálculos
de porcentaje de compactación. También se puede utilizar para la
compactación de muestras de Proctors y CBR.
Detalles técnicos: véase la sección “S”, pág. 374.
ACCESORIOS:
B097-01 Base de pisón compactador pequeña, diá. 102 mm
B097-02 Base de pisón compactador grande diá. 146 mm
B097-03 Vástago de 300 mm de largo para pisón
S197-01 Marco de soporte para la compactación con el martillo
vibrante (ver pág. 374).
instrumentos para ensayos de materiales
77
BE TUN E S - A S FA LTO S
sección B
ENSAYO DE INDENTACIÓN UTILIZANDO PROVETAS CÚBICAS O MARSHALL
NORMAS: EN 12697-20, EN 13108
Esta EN describe el método de ensayo para determinar la profundidad de indentación de las mezclas bituminosas denominadas mastic asphalt y rolled asfalt,
aplicando una fuerza a través de un cilindro indentador acabado en una base
circular plana. El ensayo se realiza sobre áridos con un tamaño nominal menor
o igual a 16 mm. Este método de ensayo se lleva a cabo en los denominados
mastics bituminosos en asfaltos de carreteras, así como en la impermeabilización
y nivelación de suelos en la edificación.
El ensayo de la indentación se puede aplicar también en probetas Marshall. Las
muestras se deben acondicionar, junto con sus moldes al menos 60 minutos
bajo el agua a una temperatura de ensayo de 40°C o 22°C respectivamente,
con ±1°C de precisión.
B059-10
Penetrómetro de indentación de mezclas
asfálticas
78
Comprende:
- Marco básico robusto con el tornillo de penetración del dispositivo de carga fijo.
- Dos pistones de penetración intercambiables con 1 y 5 cm2 de
superficie.
- Dos discos metálicos con un peso total de 500 N (51 kg) que se
coloca en el dispositivo de carga.
- Comparador analógico para medir la penetración de 30 mm de
carrera y sens. 0,01 mm.
- Baño de agua de acero inoxidable completo con llave de descarga de agua.
El calentador, los moldes cúbicos, y el molde de ensayo, “no están
incluidos” y tienen que pedirse por separado (ver accesorios).
Dimensiones: 530x600xh 820 mm. Peso: 160 kg
B059-10
ACCESORIOS:
B059-15
MOLDE CÚBICO 70,7 mm.
Para preparar las muestras cúbicas.
Fabricado en acero, fácilmente desmontable.
Peso: 4350 g
B059-21
B059-16
MOLDE DE ENSAYO DE PENETRACIÓN (AJUSTABLE) 69 mm.
Utilizado durante el ensayo de penetración de la probeta cúbica.
De aleación de aluminio.
Peso: 1850 g
B059-17 BASE, realizado de acero, para fijar la muestra de Marshall en el Penetrómetro.. Peso: 1100 g
B059-15
B059-16
B059-18
instrumentos para ensayos de materiales
B059-18 DISPOSITIVO DE CALIBRACIÓN para el Penetrómetro de Indentación. Peso: 700 g
B059-17
B059-21
SISTEMA TERMOSTATICO DIGITAL, con resistencia de inmersión.
Se calienta el agua a la temperatura requerida a 22 °C o a 40
°C con una precisión de ±1 °C conforme a los requisitos de las
Normas.
Alimentación: 230V monofásica 50Hz 1500W
Peso: 3 kg. aprox.
BETU NES - AS FALTOS
B022-20
Cesta de escurrimiento, dimensiones 100x100x100
mm, realizado en chapa de acero inoxidable con perforaciones de
3,15 mm de diá. Peso: 500 g aprox.
B022-20
B024-10
Permeámetro de Flujo radial
NORMA: EN 12697-40
Se utiliza para determinar el tiempo necesario para que 4 litros de
agua se disipen a través de una corona circular en la superficie de
un pavimento bituminoso en condiciones conocidas.
Consistente en:
- tubo acrílico de 125 mm de diámetro interior, 560 mm de largo,
marcado en 1 litro y 5 litros
- varilla interna con válvula formada por una pelota de goma
- base de madera con junta de estanqueidad
Dimensiones: 800x450x680 mm
Peso: 7 kg aprox.
sección B
ENSAYO DE ESCURRIMIENTO DEL LIGANTE, MÉTODO DE
LA CESTA
Para determinar el escurrimiento de diferentes materiales bituminosos obtenidos de las mezclas de áridos, finos y aditivos, evaluando
el resultado del escurrimiento. NORMAS: EN 12697-18, EN 13108
B022-21
B022-21
Bandeja de acero inoxidable, de dimensiones de
B024-10
160x160x10 mm.
Peso: 500 g aprox.
79
DETERMINACIÓN DE LA DENSIDAD APARENTE DE MEZCLAS BITUMINOSAS POR EL MÉTODO DE LA PESADA
HIDROSTÁTICA
NORMAS: EN 12697-6, 12390-7, EN 13108 / CNR N. 40
ASTM D1188, D2726 / AASHTO T166-93
V085
Bastidor para determinar el peso específico
Utilizado para la determinación del peso específico de los materiales, y en concreto para medir la densidad aparente de las probetas
de mezclas bituminosas compactadas en laboratorio así como los
testigos de mezclas de asfalto de las
V075-11
carreteras.
Detalles técnicos:
consultar la sección “V”
pág. 438.
ACCESORIOS:
V041
CESTA PARA LA DENSIDAD,
de acero inoxidable, 200 mm
de diá. por 200 mm de altura.
V075-11
BALANZA DIGITAL 6000g
capacidad x 0,1 g sens. Detalles
técnicos y otros modelos: ver la
sección “V”, pág. 437.
V041
V085
A106
HORNILLO PARA CERA
Detalles técnicos: véase la
sección “A” pág. 29.pag. 29
V300-19
CERA DE PARAFINA, paquete de 5000g.
B024
Permeametro
Permeámetro
PARA LA DETERMINACIÓN “IN SITU” DE LA DRENABILIDAD
DE LOS PAVIMENTOS
NORMAS: ITALIAN HIGHWAY SYSTEM, COMPARABLE AL
MPW DE BÉLGICA.
Se utiliza principalmente “in situ” para realizar y comprobar la permeabilidad y drenaje de los pavimentos de carreteras y de hormigón, tierras compactadas, etc. El ensayo consiste en llenar un cilindro
con agua, después de haberlo colocado herméticamente sobre la
superficie a ensayar, y en calculando el tiempo necesario para que el
material absorba una determinada cantidad de agua. El instrumento
se compone de un cilindro de plexiglass sin fondo, de 140 mm de
diámetro, fijado en una base. Sobre el cilindro hay dos muescas
negras muy visibles con una distancia entre ellas de 250 mm.
Dimensiones: 260x260x425 mm
Peso: 8 kg
ACCESORIO:
B024-01
PESO 5 kg, de forma
anular, para situar en la
base del permeámetro
a fin de mejorar su
adherencia a la superficie
de ensayo.
B024
B024-01
A106
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
80
B027
E094
Mezclador de 20 litros de capacidad
Mescolatrice capacità 5 litri
NORMA: EN 12697-35
Este mezclador de gran capacidad ha sido diseñado para mezclar las
muestras bituminosas para ensayos de compactación, formulas Marshall,
ensayos de tracción indirecta, así como otros ensayos que precisan una gran
homogeneidad. Gracias a la acción planetaria este mezclador asegura una
mezcla completa y uniforme. La máquina está provista con un dispositivo de
velocidad variable que permite establecer una amplia gama de velocidades:
- de 20 a 130 rpm para la acción planetaria
- de 60 a 390 rpm para la acción giratoria.
La cubierta de acero inoxidable se puede levantar para inspeccionar la
cubeta, apagándose automáticamente el motor, para evitar accidentes, según
directivas de seguridad de la CE. Un temporizador permite seleccionar el
tiempo de mezcla o la mezcla continua. El mezclador se suministra completo
con recipiente de acero inoxidable de 20 litros capacidad, pero “sin” pala
batidora, “sin” acoplamiento y “sin” calentador eléctrico que debe pedirse por separado (ver accesorios). B027-06
Alimentación: 400V trifásica 50Hz 1,1kW
(230V monofásica bajo pedido)
Dimensiones: 489x693xh944 mm
B027-03
Peso: 110 kg aprox.
NORMA: EN 12697-35 / BS 598:107
Este equipo de mezcla se utiliza básicamente para la mezcla de los
materiales bituminosos.
Gracias a su doble acción de mezcla giratoria y planetaria asegura
una mezcla uniforme.
Con doble selector de velocidad (140 o 285 r.p.m.).
La amasadora se entrega completa con un recipiente de acero
inoxidable, pero sin la pala o pala batidora, que deben pedirse por
separado (ver accesorios).
Alimentación: 230V monofásica 50Hz 800W
Dimensiones:
450x400x480 mm
Peso: 50 kg
E095 + B028-03
B027
B027-02
E095
Amasadora de 5 litros de capacidad
B027-05
B027-01
ACCESORIOS para B027:
B027-03 BATIDOR DELGADO de alambre, según especificaciones EN
B027-06 BATIDOR GRUESO de alambre, según especificaciones EN
B025-08 ACOPLAMIENTO batidor/eje para B027-03, B027-06, B027-04
B027-01 CALENTADOR ELÉCTRICO, completo con termorregulador. Alimentación: 230V monofásica 50/60Hz 1000W
OTROS MODELOS DE MEZCLADORES, QUE NO SE ADAPTAN A LAS NORMAS:
B027-02 Batidor espinas de pez
B027-04 Batidor en espiral
B027-05 Gancho batidor
B025-09 ACOPLAMIENTO batidor/eje para el B027-05, B027-02
RECAMBIO: B027-11 CUBETA de acero inoxidable, 20 litros de
capacidad.
instrumentos para ensayos de materiales
Igual que el mod. E094, pero equipada también con protecciones de seguridad según las directivas de seguridad de la CE.
Nota: La utilización correcta de las amasadoras mod. E094 y
E095 requiere calentar el recipiente con la muestra bituminosa
a la temperatura especificada por las Normas. Para este propósito se utiliza una estufa de laboratorio, y la mezcla del ensayo
se realiza inmediatamente después de sacar el recipiente de la
estufa (2 minutos de tiempo, aprox.). Como método alternativo
se puede utilizar el calentador mod. B028-01.
E095-01
E095-03
B028-03
B028-01
ACCESORIOS PARA LOS MODELOS E094 Y E095:
B028-03 PALA BATIDORA, en alambre fino de acero inoxidable,
conforme a las especificaciones EN
B028-01 MANTA CALEFACTORA ELÉCTRICA, completa con termorregulador. Alimentación: 230V monofásica 50-60Hz 800W
E095-03 BATIDORA, hecha de acero inoxidable.
RECAMBIO:
E095-01 Cubeta de acero inoxidable, 5 litros de capacidad.
BETU NES - AS FALTOS
DETERMINACION DE LA COMPACTACION DE MEZCLAS BITUMINOSAS EN CALIENTE
B031N
Compactadora Marshall automática EN (impactos)
ACCESORIOS:
B031-01
CABINA, forrada con aislantes
acústicos, reduciendo el ruido dentro
de los límites de la CE.
Dimensiones: 800x800x2000 mm aprox.
Peso: 100 kg aprox.
81
B031N
B031-11
Equipo de medida de la compresibilidad
B031N + B031-01
RECAMBIO:
B033-11 Martillo de compactación completo
MOLDE DE COMPACTACIÓN STANDARD,
Según Normas EN 12697-10 / EN 12697-30.
Chapado contra la corrosión.
Comprende:
B031-05 Cuerpo central del molde. Peso 1,7 kg
B031-06 Collar de llenado. Peso 1,5 kg
B031-07 Placa base con asas. Peso 3,1 kg
B031-08 Suplemento (que se añade a la compactadora B031N
cuando se utiliza el mod ASTM Marshall molde.B029)
Este dispositivo electrónico, fijado en la compactadora B031, mide
el espesor de la probeta durante la compactación.
La unidad incluye un transductor de 50 mm de recorrido con 0,1
mm de resolución, conectado a
una gran pantalla digital LCD. El
transductor es de tipo magnético
B031-11
sin contacto, evitando las vibraciones mecánicas y la
fatiga dando unos resultados fiables y precisos
durante mucho tiempo.
La unidad de lectura
posee un puerto de
conexión a ordenador
para la descarga, gestión
B031-11
y archivo de datos del
ensayo.
MOLDE
COMPLETO
B031-05
B031-07
sección B
NORMAS: EN 12697-10 / EN 12697-30 comparable a: BS 598:107
Este equipo de construcción robusta, compacta de forma automática la mezcla bituminosa
parando el motor después de un número prefijado de golpes, visualizándose en un contador
digital automático.
El mecanismo de liberación está diseñado de manera que el martillo deslizante caiga desde la
misma altura en todos los golpes.
El molde se mantiene en su posición mediante un dispositivo de sujeción rápida.
El compactador incluye una base de hormigón vibrado sobre el que se ha montado un
bloque de madera laminada.
Masa deslizante de peso: 4535 ± 15 g
Altura de caída libre: 457 ± 5 mm
Frecuencia de impacto: 50 golpes en 55/60 segundos
La máquina está equipada con puerta de seguridad, conforme a las
directivas CE de seguridad.
Cuando se abre la puerta, el equipo se detiene automáticamente y no
se puede operar. Todas las partes móviles están rápida y fácilmente accesibles para su mantenimiento. El compactador se suministra completo,
“excepto por el molde” que debe pedirse por separado.
Alimentación: 230V monofásica 50Hz 300W
Dimensiones: 500x500x1890 mm
Peso: 220 kg
B031-06
B031-08
Exjemplo de pantalla
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
ESTABILIDAD MARSHALL ASTM - COMPACTACIÓN DE PROBETAS
B033
sección B
Compactadora Marshall automática para moldes de 4” de Ø
NORMAS: ASTM D1559, D6926 / CNR N° 30 / AASHTO T 245 / NF P98-251-2
Esta máquina de construcción robusta, ha sido diseñada para eliminar el laborioso proceso de la
compactación manual. La muestra se compacta automáticamente deteniéndose el motor una vez
que se ha completado el número predeterminado de golpes, visualizándose en la pantalla digital. El
mecanismo de liberación está diseñado de manera que el martillo deslizante caiga desde la misma
altura en todos los golpes. La unidad incorpora un pedestal de madera para la compactación. El
mecanismo de accionamiento levanta el martillo de compactación de 4,53 Kg galvanizado contra la
corrosión, a una altura de 457 mm permitiendo la caída libre a razón de 60 golpes por minuto.
Esta compactadora es adecuada sólo para moldes Marshall de diámetro 4”.
La compactadora se suministra completa, “a excepción” del molde que debe pedirse por separado.
No se pueden vender en los mercados de la CE, sin protecciones de seguridad (ver mod. B033-01
y B033-03).
Alimentación: 230V monofásica, 50Hz 300W
Dimensiones: 540x400x1600 mm
Peso: 95 Kg
B033
82
B033-01
Compactadora Marshall automática
para moldes de 4” de Ø
Mismo mod. B033, pero equipado con una cabina de
seguridad, conforme a la Directiva CE. Al abrir la puerta
de la cabina durante el proceso de compactación, un
micro interruptor detiene automáticamente la unidad.
B033-01
B033-11
B033-04
ACCESORIOS:
B033-03
CABINA DE SEGURIDAD INSONORIZADA, realizada en acero,
con micro interruptor, en cumplimiento de la directiva seguridad
CE, recubierta interiormente con material insonorizante para la
reducción de ruido.
Accesorio para el modelo B033.
Si se abre la puerta, mientras que la compactadora está trabajando,
se detiene de forma automática.
Dimensiones: 660x660x1900 mm. Peso: 70 kg aprox.
B033-04 PLACA DE ACERO, diá.100x50 mm, para calentar el
martillo compactador.
B033 + B033-03
instrumentos para ensayos de materiales
RECAMBIO:
B033-11 MARTILLO DE COMPACTACIÓN
Completo para compactadoras B033, B033-01, B031N.
B032-KIT
B035-01
Compactadora Marshall
“manual” para moldes de
4” de Ø
Compactadora Marshall automática para
moldes de 6” y de 4” de Ø
NORMAS: ASTM D1559, D6926
AASHTO T245
Igual que el mod.B033, pero la maza se
levanta y libera de forma manual.
Dimensiones: 320x320x1600 mm
Peso: 60 kg
El montaje se compone de:
B034
MAZA DE COMPACTACIÓN con un
peso deslizante de 4,53 kg, guiada a lo
largo de un eje. Cadmiado anti-corrosión.
Peso: 10 kg
B036
MAZA DE COMPACTACIÓN, que consiste en un bloque de madera, con una placa
de acero en la parte superior. El dispositivo
se completa con un dispositivo para la
fijación rápida del molde. Cadmiado contra
la corrosión. Peso: 42 kg
B037
NORMAS: ASTM D1559, D6926, D5581 / AASHTO T245
Este equipo compacta de forma automática probetas Marshall de
6” y 4” de diámetro deteniéndose después de un número prefijado
de golpes. Se suministra completa “a excepción de la maza de compactación de 6” de diámetro (mod.B035-11) y la maza de 4” de
diámetro” (mod.B035-12), así como los moldes, que deben pedirse
por separado. No se pueden vender en los mercados de la CE, sin
cabinas de seguridad (ver mod.B035-02 y B035-03).
Alimentación: 230V monofásica 50Hz 500W
Dimensiones: 460x570x1700mm
Peso: 110 kg aprox.
B035-02
B037
B034
sección B
BETU NES - AS FALTOS
Compactadora Marshall automática
para moldes de 6”y de 4” de Ø
Mismo mod.B035-01, pero equipado con los dispositivos de seguridad conformes a la Directiva CE.
83
B036
B032 KIT
Guía y apoyo de la maza.
B032-01
B032-05
B034
Compactadora Marshall “manual” para
moldes de 6” y de 4” de Ø
NORMAS: ASTM D1559, D6926, D5581
AASHTO T245
Se suministra completa, con una maza de
compactación de 6” de diámetro, pedestal de
madera cubierto con placa de acero, dispositivo
de sujeción del molde, y el apoyo y guía de la
maza. Dimensiones: 320x320x1700mm
Peso: 70 kg aprox.
ACCESORIOS:
B034
MAZA DE COMPACTACIÓN
de 4” de diámetro, completa, para
compactadora B032-01.
B032-11
COLLAR DE REDUCCIÓN para fijar
el molde B029KIT (4 “de diá.) a la compactadora Marshall mod B032-01.
B035-11
B035-12
B035-01
RECAMBIO:
B032-05
MAZA DE COMPACTACIÓN de 6”
de diámetro, completa, para compactadora B032-01.
B032-11
ACCESORIOS:
B035-11 MAZA DE COMPACTACIÓN de 6” de diámetro, para
compactadoras B035-01 y B035-02
B035-12 MAZA DE COMPACTACIÓN de 4” de diámetro, para
compactadoras B035-01 y B035-02
B032-01
B035-03 CABINA DE SEGURIDAD INSONORIZADA, realizada
en acero, revestido con material insonorizante, en
cumplimiento de la directiva de seguridad de la CE.
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
84
B029 KIT
S114
Molde de compactación Marshall de 4” de Ø
Extrusora
Universal
NORMAS: ASTM D1559, D6926 / AASHTO T245 / CNR N° 30
NF P98-251-2
Diámetro interior 101,6 mm (4 “)
Fabricado en acero, cadmiado contra la corrosión.
Peso: 3 kg
Consistente en:
B030
CUERPO DEL MOLDE solamente. Peso: 1200 g
B030-01 COLLAR DE LLENADO solamente (ASTM,
AASHTO, CNR). Peso: 800 g
B030-02 PLACA BASE solamente. Peso: 1000 g
De accionamiento manual,
mediante un pistón hidráulico de 5 toneladas, está
diseñado para la extrusión
de probetas de diá.4 “ y 6 “.
Para la extracción de muestras Marshall, CBR, Proctor
normal y modificado.
Dimensiones:
diá. 300x500 mm
Peso: 30 Kg
Nota:
La normativa francesa NF P98-251-12 requiere un collar de llenado
con unas dimensiones ligeramente diferentes, pero encaja perfectamente el cuerpo del molde y la placa base.
B030-01NF COLLAR DE LLENADO sólo (NF P98-251-2).
Peso: 800 g
B030-06
S114
B079
Cabina con aspiración
Utilizada para la extracción de los vapores y gases tóxicos causados
por la extractora centrífuga, extractores en caliente, refrentadoras
de hormigón, etc. evitando su difusión por el laboratorio.
Completa con aspirador eléctrico, alumbrado eléctrico, interruptores, instalación eléctrica y de
agua, ventanas, estantes. La
puerta frontal esta realizada
con material transparente,
elevable para facilitar un fácil
acceso a la mesa de trabajo.
Alimentación: 230V monofásica 50Hz 350W
Dimensiones:
1250x750x2600 mm aprox.
Peso: 180 Kg
PLACA BASE con asas (Alternativa a mod.B030-02)
ACCESORIOS:
B030-03
PLACA DE EXTRACCIÓN, para extraer las probetas del molde.
Se utiliza conjuntamente con el receptor B030-04.
Peso: 1400 g
B030-04
RECEPTOR DE LA MUESTRA, que se utiliza para recibir muestras
expulsado por el B030-03 extrusora.
Peso: 1300 g
B030-05
DISCOS DE PAPEL de diámetro 100 mm. Paquete de 100.
B029-01
Molde de compactación Marshall, de 6” de Ø
B030-06
NORMA: ASTM D5581-96
Consistente en el cuerpo del molde, collar de llenado y
placa base. Diámetro interior: 152,4 mm (6 “).
Fabricado en acero, cadmiado contra la corrosión.
Peso: 5 kg aprox.
B079
B030
B030-04
B030-01
B029-01
B030-02
B029 KIT
instrumentos para ensayos de materiales
B030-03
B030-05
BETU NES - AS FALTOS
B040
Compactador giratorio
NORMAS: EN 12697-10, 12697-31 / ASHTO T312 / SHRP M-002
El compactador giratorio se utiliza para simular y reproducir las condiciones reales de compactación alcanzadas en las operaciones actuales
de la pavimentación de carreteras, determinando, de esta manera, las propiedades de la compactación del aglomerado. Los resultados
adquiridos, también pueden utilizarse en la investigación de las características mecánicas y volumétricas de las mezclas bituminosas.
Esta máquina es capaz de ejecutar ensayos en mezclas de asfalto emulsionado, así, como en mezclas estándar. Para ello, se requiere un
molde perforado (ver accesorios).
El ensayo de compactación giratoria ha sido reconocida y aprobada por el Strategic Highway Research Program (SHRP) y normalizado por
las instituciones AASHTO y EN.
Las características de este producto hacen que esta máquina sea mucho más fácil
de utilizar y con las mejores prestaciones que en la actualidad pueden encontrarse
en el mercado. El equipo permite almacenar en memoria hasta de 20 ensayos y un
puerto USB que permite la conexión a una serie de periféricos como impresoras u
ordenadores permitiendo la descarga de datos y la impresión de informes.
sección B
Mediante un pistón hidráulico, se aplica una presión constante, a la muestra objeto de ensayo colocada en un molde cilíndrico, combinando-se con un movimiento giratorio cuyos grados, del ángulo de rotación, están dirigidos por un sistema hidráulico servo-controlado.
Características principales:
- Cumplir con los criterios Superpave y FHWA.
- Presión de consolidación: seleccionable de 90 a 1000 kPa
- Ángulo de giro: regulable de 0 ° a 1,5 ° Interno y Externo
- Velocidad de rotación: 30 ± 0,5 rotaciones/minuto
- El número de rotaciones: ajustable desde 1 hasta 999
- Dos modos de funcionamiento disponibles:
• La compactación de la muestra, de acuerdo al número seleccionado de las
rotaciones
• La compactación hasta llegar a una altura seleccionada de la muestra
- Adquisición de datos: número de rotaciones, altura de la muestra, ángulo de
rotación, valor de la resistencia al corte (accesorio).
- Transferencia de datos (de salida): USB y puerto RS232 para conectar impresoras,
ordenadores, o memorias flash.
- Unidad de medida: Sistema Internacional
- Memoria interna: posibilidad de guardar hasta 20 ensayos.
85
El compactador giratorio se suministra con un bloque de altura estándar, lubricante,
cable de alimentación, impresora, RS232 y cable USB, mientras que los moldes,
papel de filtro, y la extrusora, se deben solicitar por separado (ver accesorios).
Alimentación: 240V monofásica 50Hz 12A 1440W
Dimensiones: 1740x760x650mm
Peso: 227 kg
B040
ACCESORIOS:
B040-11 Molde cilíndrico Ø 100mm
B040-12 Molde cilíndrico Ø 150mm
B040-15 Molde cilíndrico perforado Ø 100mm
B040-16 Molde cilíndrico perforado Ø 150mm
B040-20 Papel de filtro para moldes de Ø 100mm
B040-21 Papel de filtro para moldes de Ø 150mm
B040-06 Extrusor de gravedad
B040-07 DAVII – Dynamic Angle Verification para medir y verificar el ángulo de giro
B040-25 KIT para el control de la presión
B040-26 Dispositivo para la determinación del valor de corte
B040-16 Detalle del molde cilíndrico perforado
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B039
COMPACTADOR DE RODILLO
sección B
NORMA: EN 12697-33
86
Este compactador de rodillo totalmente desarrollado y fabricado por Matest se utiliza para realizar losas de muestras representativas de los
diversos tamaños y mezclas bituminosas extendidas y compactadas en las carreteras.
La compactación se realiza a través de un segmento de rodillo con operaciones de rotación alternadas simulando la acción “in situ” de un
rodillo. Las losas se compactan hasta la densidad seleccionada y se utilizan posteriormente en el ensayo de huella con el equipo B038 de
Matest (ver pág. 88).
A partir de las losas pueden extraerse testigos o cortarse para la obtención de probetas tanto cilíndricas como prismáticas para los ensayos de fatiga por flexión, tracción indirecta, fluencia estática y dinámica, rigidez, Ensayo de 4 puntos, etc.
EL COMPACTADOR DE RODILLO ESTÀ FORMADO POR:
- Marco de acero resistente, mesa de soporte para el molde con
sistema de desplazamiento alternativo, desplazamiento de la mesa
y control de la presión de carga vertical
- Unidad de control electrónico con pantalla táctil a color,
funciona como un PC estándar basado en el sistema
operativo Windows para la gestión y análisis de
los datos, resultados de los ensayos y gráficos. La
interfaz de icono de la pantalla táctil, permite una
fácil puesta en marcha de los parámetros y una
ejecución inmediata del ensayo.
Conexión directa a la Intranet (Conexión a una
red LAN) e Internet para poder establecer una
comunicación remota y recibir de inmediato un
análisis de diagnóstico del potencial problema
por los técnicos de Matest, así como para las
descargas de las actualizaciones del software.
Detalles técnicos de hardware: ver pág. 24
Memoria de almacenamiento ilimitado con: 2
puertos USB, una ranura para tarjetas SD, puerto
serie RS232/485.
Están instalados tres transductores: para maniobrar
el rodillo, para los desplazamientos de la mesa
y para la presión vertical de la carga. El ciclo de
compactación puede ser programado definiendo
una cierta carga o el valor de la deformación.
Cuando se ha programado el valor de la deformación, el
sistema de forma automática programa las cargas adecuadas para
obtener el espesor final seleccionado.
La flexibilidad del programa garantiza la producción de muestras
con una densidad y dimensiones uniformes, cumpliendo las
especificaciones de las normas y las necesidades de la investigación. Una interfaz amigable y fácil de usar permite una inmediata y
completa ejecución del ensayo de forma automática, la adquisición y procesamiento de datos del ensayo, así como el informe
del ensayo y los archivos correspondientes.
El compactador de rodillo se suministra “sin” segmento de rodillos,
molde de las losas, ni plato de centrado, que debe pedirse por
separado (ver accesorios).
instrumentos para ensayos de materiales
B039
Detalle del panel de control
BETU NES - AS FALTOS
ESPECIFICACIONES TÉCNICAS:
- Posibilidad de usar segmentos de rodillos de diferentes tamaños
(ver accesorios): ancho hasta 400 mm y el radio de 490 mm, con
obtener losas de dimensiones:
320x260mm hasta 180 mm de espesor
305x305x25 a 100 mm de espesor
400x305x25 a 100 mm de espesor
500x400mm, hasta 180 mm de espesor
- Fuerza vertical seleccionable hasta un máx.de 38 kN (a 8 bar)
- Densidad de compactación programable
- Cabina de seguridad de policarbonato según directivas CE
- Posicionamiento simple y rápido del rodillo y del molde
- De fácil mantenimiento
- Alimentación: 230V 50/60Hz monofásica 550W
- Dimensiones: 2200x1030 xh 1880 mm (2410 mm con la cabina
abierta)
- Peso: 1300 kg
sección B
B039
con la cabina abierta
B039-05
ACCESORIOS:
SEGMENTO DE RODILLO, dimensiones disponibles:
B039-04 RODILLO para el molde de 320x260mm
B039-05 RODILLO para el molde de 500x400mm
B039-06 RODILLO para el molde de 400x305mm
B039-07 RODILLO para el molde de 400x305mm
MOLDES para preparar placas de aglomerados. Dimensiones
disponibles:
B038-09 Molde para losas de 320x260x180mm
B038-10 Molde para losas de 305x305x50mm
B038-11 Molde para losas de 305x305x100mm
B038-12 Molde para losas de 400x305x50mm
B038-13 Molde para losas de 400x305x100mm
B038-18 Molde para losas de 500x400x180mm
87
B039-06
B039-07
B039-21 Placa de centrado para moldes de 400x305mm
B039-22 Placa de centrado para moldes de 305x305mm
B039-23 Placa de centrado para moldes de 320x260mm
Calentamiento del segmento de rodillo
Este dispositivo permite la calefacción y el control de la temperatura del segmento de rodillo montado en el compactador, lo que
evita el enfriamiento de la muestra cuando entra en contacto con
una superficie fría.
El equipo está compuesto por:
B039-02
B038-09 ÷ B038-18
Unidad de Control
Montado en el compactador de rodillo, posee un circuito termorregulador, con una sonda para medir y ajustar la temperatura
desde ambiente hasta 150 °C. Está conectado con el segmento de
rodillo y equipado con resistencias calefactoras.
B039-03
Calentador del Segmento de Rodillo
El segmento de rodillo (mod. B039-04 con B039-07) está equipado
con un conjunto de resistencias de calentamiento que se conectan
a la unidad de control, garantizando una temperatura controlada en
el segmento de rodillo.
B039-22
B039-21
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B038
EQUIPO PARA EL ENSAYO DE RUEDA CARGADA (WHEEL TRACKING)
sección B
NORMAS: EN 12697-22 / BS 598:110
Este ensayo, ejecutado en laboratorio, consiste en la evaluación de la profundidad de deformación (rodera) en una mezcla bituminosa,
sometida a ciclos de pasadas de una rueda de goma lastrada, bajo condiciones controladas y constantes de temperatura. En la realización
del ensayo, el equipo de rodadura simula el efecto del tráfico y así poder medir la susceptibilidad de la deformación de las muestras de
mezclas bituminosas.
El aparado de rueda cargada Matest realiza el ensayo de acuerdo con los procedimientos A y B (6 o 2 ensayos), especificados de forma
detallada en la Norma EN.
Especificaciones técnicas
- La máquina satisface plenamente las especificaciones de la EN 12697-22 y de la BS
598:110.
- Desplazamiento de la mesa: 230 +/- 5 mm
- Tabla de frecuencia del ciclo: ajustable desde
15 hasta 40 ciclos por minuto.
88
- Rueda de goma con neumático duro con
diámetro exterior de 200 mm
- Carga de la rueda sobre la muestra:
700N + /-10N (EN 12697-22) o 520N
(BS 598:110)
La carga se aplica en la muestra a través de
una palanca.
La carga efectiva aplicada en la muestra puede ser ajustada por unos posicionamientos
micrométricos del peso.
- Medida de la profundidad de rodadura de
forma continua y en tiempo real, (penetración
de la rueda en la muestra) mediante un
transductor lineal de 40 mm de recorrido
y 0,01 mm de precisión.
B038 con las puertas abiertas
- El marco del equipo es de una robusta aleación de aluminio y está encerrada en una cabina climática con temperatura ajustable desde 30
a 65 °C. ±1,0 °C. La cabina está equipada con dos puertas con vidrio aislante para la inspección.
- La tabla porta-muestras tiene unas dimensiones: 400x390 mm y
puede aceptar losas rectangulares de varios tamaños:
305 x 305 mm, 50 o 100 mm de altura
305 x 400 mm, 50 o 100 mm de altura
200 mm. de diámetro en testigos, 50 mm de altura
Los marcos de confinamiento de la muestra no están incluidos y
tienen que pedirse por separado (ver accesorios).
- El aparado de rueda cargada Matest también acepta muestras
con dimensiones de hasta a 400 x 500 mm, 180 mm de altura
(este molde se puede compactar con un compactador de
rodillo Matest).
- La máquina se suministra con adaptadores para un correcto
posicionamiento del molde y su bloqueo.
- El sistema de seguimiento de la rueda está equipada con tres
sensores de temperatura:
una sonda, conectada con el termorregulador, para el control y
ajuste de la temperatura de la cabina
2 sondas para medir la temperatura dentro de la muestra.
instrumentos para ensayos de materiales
B038 detalle
BETU NES - AS FALTOS
Firmware
El firmware de ensayos multilingüe permite:
- La gestión y el control automático de la máquina y ensayos.
- Configuración de los parámetros del ensayo.
- Adquisición y procesamiento de los datos del ensayo.
- Visualización en tiempo real de: número de ciclos, profundidad
de la rodera, temperaturas. Temporalización real de los tipos
de ciclos el cual puede ser visualizado utilizando el puerto serie
conectado a un PC.
- Menú de calibración para configurar y comprobar todos los datos
del ensayo.
- Desde el tablero de control, es posible seleccionar los parámetros
establecidos de adquisición de datos y procesamiento, de acuerdo
con los procedimientos de la norma BS y EN, con:
Datos de identificación de las muestra (placas) en el ensayo.
Ciclo de la frecuencia.
Número de pasos para finalizar el ensayo.
Profundidad máxima de la rodera para finalizar el ensayo.
Frecuencia de muestreo de la profundidad del surco dejado.
Medida de la temperatura.
Grosor de la muestra (losa).
B038 detalle
El uso del aparado de rueda cargada B038 requiere conexión a un
PC con Windows 98, 2000, XP como requisitos mínimos.
sección B
Hardware
- El sistema de adquisición y procesamiento de datos se encuentra
totalmente gestionado por un microprocesador.
- Teclado multifuncional, con codificador para la configuración fácil
y rápida
- Pantalla gráfica grande 320x240 píxeles.
- RS 232 para conexión a PC.
Alimentación: 230V 50/60Hz monofásica 2200W
Potencia nominal de la mesa: 500W
Dimensiones: 1580x650xh 1790 mm
Peso: 400 kg aprox.
89
B038-09 ÷ B038-18
ACCESORIOS:
* B038-09 MOLDE
Tamaño de 320 x 260 x 180 mm
* B038-10 MOLDE
Tamaño de 305 x 305 x 50 mm
* B038-11 MOLDE
Tamaño de 305 x 305 x 100 mm
* B038-12 MOLDE
Tamaño de 400 x 305 x 50 mm
* B038-13 MOLDE
Tamaño de 400 x 305 x 100 mm
B038-14 MOLDE para testigos de muestra
de 200 mm de diámetro, 50 mm de
altura
* B038-18 MOLDE
Tamaño de 500 x 400 x 180 mm
H009-01 PC completo con monitor LCD de 17 “,
teclado, ratón, cables, instalación.
B038 con las puertas cerradas
Notas:
* Estos moldes también pueden ser utilizados con el Compactador
de Rodillo Matest.
Están disponibles, bajo pedido, placas para reducir el espesor del
molde.
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
sección B
Prensas para ensayos Marshall
Estabilidad y deformación
90
B042 KIT
Modelos disponibles
B042 KIT Prensa mecánica Marshall con anillo dinamométrico
B043 KIT Prensa digital Marshall con célula de carga
S212-S215 KIT Prensa Universal Multivelocidad (ver pág. 378)
S213-S214 KIT Prensa para ensayo CBR/ Marshall de doble
velocidad (ver pág. 378)
S205
Prensa UNITRONIC (ver pág. 384)
B042 KIT
Prensa mecánica Marshall 30 kN
NORMAS: EN 12697-34, EN 13108
ASTM D1559, D6927-06 / AASHTO T245 / BS 598:107
NF P98-251-2 / CNR N° 30
Construida con un robusto bastidor, es capaz de realizar tanto ensayos de compresión como de tracción, fácil de usar, se ha diseñado
para operar con un mínimo de mantenimiento. La velocidad es de
50,8 mm/minuto, gracias a un motor eléctrico sobredimensionado.
La carga aplicada se mide mediante un anillo dinamométrico de
precisión de 30 kN incorporando un sistema de paro de medida
máxima, entregándose con el certificado de calibración pertinente.
El equipo incluye dispositivo eléctrico para el paro automático
cuando se llega a la máxima capacidad de carga del anillo, para prevenir cualquier daño por sobrecarga. Interruptores fin de carrera
para fijar un máximo y un mínimo de recorrido.
La unidad se entrega completa con un anillo dinamométrico de 30
kN de capacidad, medidor del desplazamiento, cabezal de rotura, y
comparador.
Alimentación: 230V monofásica 50Hz 750W
Dimensiones: 410x400x1110 mm
Peso: 110 kg
RECAMBIOS:
B046N
NORMAS: EN, ASTM, NF, BS, CNR, AASHTO
Diámetro interno de 101,6 mm (4 “Ø).
Totalmente abierto en la parte frontal, con lo cual, la muestra se
introduce fácil y rápidamente. Peso: 6 kg
B047
MEDIDOR DE LA DEFORMACIÓN O FLUENCIA
Montado en la parte superior de la mordaza, dispone de un dispositivo de freno que frena la aguja al alcanzarse el desplazamiento
máximo.
Peso: 0,5 kg
B047-01
COMPARADOR
Desplazamiento
10 mm x 0,01 mm.
para ser utilizado junto
con el Medidor de
deformación B047.
Dispositivo para el ensayo de tracción indirecta
NORMAS: EN 12697-23 / ASTM D4123 / CNR 134
Utilizado para la determinación de la resistencia a tracción indirecta
y la tensión radial de una probeta Marshall de diámetro 4” o 6”
cuando se le aplica una carga vertical. Suministrado completo con
cuchillas de apoyo para probetas de diámetro 4” y 6”. Fabricado en
acero, con tratamiento anticorrosivo.
Dimensiones: diá. 248x270 mm. Peso: 14 kg
B047-03
Juego de dos comparadores de 10 mm de carrera y sensibilidad
0,01 mm. Completo con soportes ajustables para la medida de las
deformaciones de las probetas.
B047-03
B047-03
B047-01
B046N
instrumentos para ensayos de materiales
ACCESORIOS:
B047-02
B047
B047-02
BETU NES - AS FALTOS
B043 KIT
Prensa Digital Marshall de 30 kN de capacidad
B043-01N
SOFTWARE UTM2 (Máquina Universal Multiensayos 2)
Licencia para los ensayos MARSHALL
NORMAS: EN 12697-34 / CNR N. 30 / ASTM D1559
BS 598 :107 / NF P98-251-2
Programa de procesamiento de datos para
“X-Y ESTABILIDAD/DEFORMACIÓN”
Detalles generales y descripción técnica: ver UTM2 pág.14
RECAMBIO:
B046N
MOLDES DE ESTABILIDAD DE 4 “Ø
NORMAS: EN, ASTM, NF, BS, CNR
El diámetro interior es de 101,6
mm (4 “), el molde está completamente abierto en la parte
delantera y la introducción de la
muestra se hace muy fácil, evitando así operaciones de desmontaje.
Peso: 6 Kg
sección B
NORMAS: EN 12697-34, 12697-23, 12697-12, EN 13108
ASTM D1559, D6927-06 / AASHTO T245 / BS 598:107
NF P98-251-2 / CNR N° 30
El bastidor de la prensa es el mismo que el mod. B042 KIT, pero la
carga se mide con una célula de carga de 50 kN con transductores
de presión de alta precisión; la deformación se mide con transductor electrónico de desplazamiento de 50 mm de carrera y de ±
0,1%. de linealidad. El módulo Cyber-Plus Evolution unidad de 8
canales con pantalla digital y microprocesador (detalles técnicos:
ver B044N-SET página 98, detalles técnicos del Hardware: ver pág.
24) mide y muestra al mismo tiempo, la estabilidad en kN y la deformación en mm conservando los valores y con la posibilidad de
transferirlos a un PC y una impresora a través de un puerto RS232.
Se suministra completo con molde de estabilidad.
Alimentación: 230V monofásica, 50Hz 900W
Dimensiones: 650x400x1100 mm. Peso: 120 Kg
ACCESORIOS para B043 KIT:
91
B043 KIT
Nota:
La prensa de ensayos Marshall B043 KIT, complementada con los
accesorios específicos (ver abajo) están indicadas para le realización
de los siguientes ensayos:
Corte directo (Leutner) entre capas de
mezclas bituminosas
B046 N
NORMA: ALP A StB T.4
Ensayo de corte directo (LEUTNER) en los riegos de adhesión
entre capas de mezclas bituminosas, realizado sobre testigos de
150 mm o 100 mm obtenidos a partir de la extracción de testigos
de la carretera o en las muestras realizadas en el laboratorio.
Accesorios necesarios:
B043 KIT Prensa Digital Marshall
B047-10 Cabezal de ensayos LEUTNER para probetas de
150 mm de diá.
B047-11
Adaptadores del cabezal
de ensayo LEUTNER
para probetas
de 100 mm de diá.
B043-03N
Software para ensayos
Marshall y Leutner.
B043-01N: Ejemplo de la gráfica carga/deformación “x-y”
B047-10 + B047-11
...sigue...
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
sección B
DETERMINACIÓN DE LA RESISTENCIA A LA TRACCIÓN
INDIRECTA
NORMAS: EN 12697-23 / ASTM D4123 / CNR N.134
Equipos: Prensa Marshall Digital KIT B043, y:
92
B047-02
DISPOSITIVO PARA EL ENSAYO DE TRACCIÓN INDIRECTA
PARA PROBETAS DE DIÁMETROS DE 4 “y 6”
Se utiliza para medir la resistencia a tracción indirecta y la tensión
radial de una probeta Marshall de 4 “y 6”, cuando se le aplica una
carga vertical. Se suministra completo con cuchillas de apoyo de
diámetros entre 4 “y 6 “. Fabricado en acero, con tratamiento
anticorrosivo.
Dimensiones: diá. 248x270 mm. Peso: 14 kg
B047-04
JUEGO DE DOS TRANSDUCTORES LINEALES RESISTIVOS
10 mm de recorrido, precisión y linealidad de ±0,3%. Completa con
soportes y accesorios para la medida de las deformaciones.
B044-03
B047-02
B047-04
B047-04
B044-03
TRANSDUCTOR DE DESPLAZAMIENTO “adicional”, de 50 mm de
recorrido, para una doble medida del desplazamiento vertical de la
muestra durante el ensayo de tracción indirecta
Se suministra completo con cable y conector. Cuando se utiliza con
el software B043-02N se da el valor medio de los dos transductores.
B043-02N
SOFTWARE DE UTM2 (Máquina Universal Multiensayos 2)
Licencia para el ensayo de TRACCIÓN INDIRECTA
Normas: EN 12697-23 / CNR N. 134
ASTM D4123
Para características técnicas y prestaciones generales del UTM2 ver
pág. 14.
GALGAS DE BLOQUE. Grado 1
Se utiliza para calibrar los transductores de desplazamiento lineal.
Modelos:
S336-43 Galga de bloque, de longitud nominal 10 mm.
S336-47 Galga de bloque, de longitud nominal 50 mm.
Detalles técnicos: ver a la pág. 417.
B043-02N: Informe del ensayo
DETERMINACIÓN DE LA SENSIBILIDAD AL AGUA DE LAS MUESTRAS BITUMINOSAS
NORMAS: EN 12697-12, EN 13108
Este ensayo determina el efecto de la saturación y la aceleración
del condicionamiento del agua a la resistencia en el ensayo de
tracción indirecta de las mezclas bituminosas, para evaluar el efecto
de la humedad sometiendo a la muestra a diferentes condiciones.
Equipos: Marshall Digital probador B043 KIT, accesorios para la
resistencia a tracción indirecta, y también:
B052-02
Baño de agua, digital, con sistema de refrigeración
Rango de temperatura: +3 a +95 ºC, precisión ±1 °C. (Las Normas EN 12697-12 y 12697-23 requieren un rango de temperatura
seleccionable entre 5 y 25 °C).
Capacidad: 45 litros.
Dimensiones interiores: 635x360x205 mm
El baño también puede ser utilizado para los ensayos Marshall y de
laboratorio en general. Detalles técnicos: ver pág. 101.
instrumentos para ensayos de materiales
B052-02
BETU NES - AS FALTOS
PRENSAS MULTIENSAYOS, TAMBIÉN DISPONIBLE PARA ENSAYOS MARSHALL
S213
Prensa CBR/Marshall 2 velocidades y 50 kN
sección B
La prensa está provista de dos rangos de velocidad fijos, fácilmente
intercambiables mediante un selector:
1,27 mm/min para ensayos CBR
50,8 mm/min para ensayos Marshall.
Suministrados “sin” anillo dinamométrico ni accesorios que tienen
que pedirse por separado.
Detalles técnicos: ver pág. 378.
S212
Prensa universal multivelocidad de 50 kN
Esta máquina motorizada con control electrónico digital mediante
microprocesador, es adecuada para llevar a cabo todos los ensayos
donde el rango de velocidades requerido se encuentre entre 0,5 y
63 mm/min con una carga máxima de 50 kN
Por tanto, puede realizar:
• Ensayo Marshall a una velocidad de 50,8 mm/min
• Ensayo de tracción indirecta en probetas Marshall
• Ensayos de compresión, CBR, triaxial rápido.
El rango de velocidad es infinitamente variable, fácil y rápido de
seleccionar. El puente superior se puede ajustar en altura.
Suministrado “sin” anillo dinamométrico ni accesorios que tienen
que tienen que pedirse por separado.
Detalles técnicos: ver pág. 378.
93
S213
con accesorios para el ensayo Marshall
ACCESORIOS para las prensas S212 y S213:
Ensayo MARSHALL, 4 “Ø:
S212-05 Pistón de carga
B046N Molde de estabilidad 4 “Ø
B047
Medidor de deformación
B047-01 Indicador para marcar la medida de la deformación
S370-08S Anillo dinamométrico de 30 kN con un dispositivo
eléctrico de parada de seguridad
S374
Dispositivo de frenado para mantener la carga máxima
Ensayo MARSHALL de 6 “Ø (solo con la prensa S212)
NORMA: ASTM D5581-96
S212-05 Pistón de carga
B046-02 Molde de estabilidad de 6 “de diámetro
B047
Medidor de deformación
B047-01 Indicador para marcar la medida de la deformación
S370-10S Anillo dinamométrico de 50 kN con
un dispositivo eléctrico de parada
de seguridad
S374
Dispositivo de frenado para
mantener la carga máxima
S212
NOTA:
Las prensas S212 y S213 son adecuadas también para los ensayos de
tracción indirecta (EN 12697-23)
con los dispositivos específicos que
se describen en la pág. 90, 92.
B046-02
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
sección B
PRENSAS MULTIENSAYOS:
COMBINADAS CON “CYBER-PLUS 8 EVOLUTION”, SISTEMA DIGITAL CON PANTALLA TÁCTIL
Especificaciones técnicas:
La prensa es la misma que para las estructuras de carga anteriores (mod. S212 - S213), pero la carga se mide con una célula de carga de
50 kN con transductores de presión de alta precisión. La deformación se mide con transductor electrónico de desplazamiento de 50 mm
de carrera y de ± 0,1%. de linealidad.
El “CYBER-PLUS 8 EVOLUTION” es un sistema multicanal, informatizado de visualización digital (datos técnicos: ver mod. B044N-SET
en la página siguiente), mide y muestra al mismo tiempo la carga (estabilidad) en kN y la deformación (fluencia) en mm conservando los
valores y con la posibilidad de imprimir los certificados y los gráficos directamente en una impresora láser a través de un puerto USB o de
transferirlos a un PC vía Ethernet.
MODELOS DISPONIBLES:
S214 KIT
CBR/Marshall Prensa digital computerizada de 2 velocidades
Detalles técnicos de la prensa: ver mod. S213, pág.378.
Se suministra completa con el sistema “Cyber-Plus 8 Evolution” (B044N-SET, detalles en
pág. 98, detalles de Hardware en pág. 24), célula de carga y transductores de desplazamiento,
pero “sin” accesorios, que deben pedirse por separado.
S215 KIT
94
Prensa universal digital computerizada de multivelocidad
Los detalles técnicos del bastidor: ver mod. S212, pág. 378.
Se suministra completo con el sistema “Cyber-Plus 8 Evolution” (B044N-SET detalles en
pág. 98, detalles de Hardware en pág. 24), célula de carga y transductores de desplazamiento, pero “sin” accesorios que deben pedirse por separado.
S214 KIT + accesorios MARSHALL
PROGRAMAS PARA LAS PRENSAS COMBINADAS CON EL
SISTEMA “CYBER-PLUS 8”:
B043-01N SOFTWARE UTM2 (Máquina Universal Multiensayos 2)
Licencia para el ensayo MARSHALL
Normas: EN 12697-34 / CNR N. 30 / ASTM D1559
B043-02N SOFTWARE UTM2 (Máquina Universal Multiensayos 2)
Licencia para el ensayo TRACCIÓN INDIRECTA
Norme:
EN 12697-23 / CNR N. 134 / ASTM D4123
Descripción y detalles técnicos del software UTM2: ver pág. 14.
H009-01 ORDENADOR PERSONAL, con monitor LCD 17”,
teclado, ratón, cables de conexión, instalación y puesta
en marcha del software adquirido.
C128
Impresora láser, para la impresión de los gráficos y
certificados del ensayo, se conecta directamente a la
Cyber-Plus 8 a través del puerto USB.
S215 KIT + accesorios MARSHALL
ACCESORIOS PARA LAS PRENSAS,
MOD.S214 KIT Y S215 KIT :
Ensayos MARSHALL
S212-05 Pistón de carga
B046N
Molde de estabilidad 4 “Ø
B046-02 Molde de estabilidad de 6 “Ø
(solamente con la prensa
S215 KIT) Norma: ASTM D5581-96
instrumentos para ensayos de materiales
NOTA:
B046-02
Las prensas S214 KIT y S215 KIT son adecuados también para el ensayo de tracción indirecta y el de corte
directo entre capas (Leutner), mediante el uso de los
dispositivos específicos que se describen en la pág. 91.
BETU NES - AS FALTOS
S206
PRENSA UNIVERSAL ELECTROMECÁNICA PARA ENSAYOS DE COMPRESIÓN, FLEXIÓN Y TRACCIÓN EN MATERIALES DE LA
CONSTRUCCIÓN CON SISTEMA DE SERVOCONTROL DE FUERZA O DE DESPLAZAMIENTO/DEFORMACIÓN.
La máquina está constituida por una base sólida que contiene los componentes de transmisión y los instrumentos de control del hardware.
La base tiene dos columnas, de acero de alta resistencia con revestimiento de cromo duro.
El travesaño superior se puede ajustar en altura, para poder ubicar los accesorios con los que realizar los ensayos específicos.
La cruceta inferior móvil funciona mediante un sistema de tornillo con recirculación de bolas, que a través de un servomotor controlado,
asegura la correcta aplicación de la carga y la velocidad constante.
Las dos crucetas prevén acoplamientos para fijar los dispositivos diferentes de ensayo (ver accesorios).
La tensión se mide por una célula de carga eléctrica, y el desplazamiento de la cruceta por los transductores, todos incorporados en la máquina. Es posible sustituir las
células eléctricas de carga por otras de menor capacidad, para satisfacer requisitos
de ensayo específicos.
Especificaciones técnicas:
- Max. fuerza: 200kN (compresión y tracción)
- Max. luz vertical: 800 mm (sin accesorios)
- Max. luz vertical con platos de compresión: 700 mm
- Diámetro de los platos de compresión: 180 mm (parte superior del plato en la rótula)
- Distancia entre columnas: 610 mm
- Recorrido de la cruceta: ± 200 mm (400 mm en total)
- Velocidad de ensayo : de 0,01 a 100 mm/min
- Rango en fuerza: de 1 N/s hasta 5 kN/s
- Resolución del desplazamiento de: 0,01 mm con una precisión superior a 0,2%
- Máquina de Clase: 1
La prensa multiensayos se suministra con una célula de carga de 200kN, transductores de desplazamiento de la cruceta, software para los ensayos Duriez, Marshall y
CBR, PC con pantalla LCD, teclado, mouse, cables de conexión, platos de compresión superior e inferior. “No se incluye”: la impresora y accesorios para los ensayos
S206
específicos que deben pedirse por separado (ver accesorios).
Alimentación: 230V 50Hz 850W monofásica. Dimensiones: 1350x510xh 2250 mm. Peso: 850kg aprox.
sección B
MULTI-ENSAYOS 200 kN
95
ACCESORIOS: C128 IMPRESORA LASER, modelo de banco, para gráficos y certificados, con conexión directa a través de USB.
Ensayos principales y accesorios específicos:
MATERIALES
Mezclas
bituminosas
ENSAYO
Duriez
NORMA
NF P98-251-1/4
ACCESORIOS
juego Duriez (ver pág.118)
Marshall
EN 12697-34
ASTM D1559
Molde de estabilidad B046N
Pistón de carga S212-05
Tracción indirecta
EN 12697-23
ASTM D4123
Dispositivo de tracción Indirecta
B047-02.
Conjunto de dos medidores de B047-03
Pistón de carga S212-05
Corte Leutner
ALP A StBT.4
Cabezal Leutner B047-10
Espaciadores 100mm de diá. B047-11
Pistón de carga S212-05
Accesorios adicionales específicos para los ensayos de:
Hormigón y mortero (compresión, flexión, perforación, etc.) – Suelos (CBR) – Aceros (tracción), figuran en la sección de suelos, pág. 390.
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
S205
UNITRONIC 50 kN, PRENSA UNIVERSAL MULTIFUNCIÓN DE COMPRESIÓN/FLEXIÓN Y TRACCIÓN PARA:
sección B
- ENSAYOS DE COMPRESIÓN/FLEXIÓN, DE 50 kN MAX. CAPACIDAD DE CARGA
- ENSAYOS DE TRACCIÓN, 25 kN MAX. CAPACIDAD DE CARGA (accesorios mod. S205-05)
CON SISTEMA DE CONTROL AUTOMÁTICO DE FUERZA O DE DESPLAZAMIENTO/DEFORMACIÓN, para los ensayos de:
96
Mezclas bituminosas:
- MARSHALL
- TRACCIÓN INDIRECTA
- CORTE DIRECTO (Leutner) entre capas de aglomerado
Suelos:
- CBR (California Bearing Ratio)
- COMPRESIÓN SIMPLE
- TRIAXIAL RÁPIDO
Hormigón:
- FLEXIÓN DE VIGAS
- FLEXIÓN DE AZULEJOS
Datos técnicos:
- Capacidad de compresión máxima: 50 kN
- Capacidad de tracción máxima: 25 kN (accesorio S205-05)
- Velocidad de ensayo ajustable de 0,01 a 51 mm/minuto
- Relación de fuerza ajustable de 1 a 15000 N/s
- Máx. recorrido del travesaño: 100 mm
- Luz entre columnas: 380 mm
- Max. luz vertical: 850 mm
Alimentación: 230V 1500W monofásica 50/60Hz
Dimensiones: 500x450x1450mm. Peso: 130 kg aprox
Cemento:
- FLEXIÓN de probetas 40x40x160mm
- COMPRESIÓN de cubos de 40, 50, 70 mm
- TRACCIÓN en probetas de mortero (accesorio mod. S205-05)
Metal, plástico, cables, cuerdas, telas, papeles, etc.
- ENSAYO DE TRACCIÓN, 25 kN de capacidad máxima de
tracción (accesorio mod.S205-05)
Bloques de arcilla:
- PUNZONADO
Rocas y piedras:
- TRACCIÓN INDIRECTA UNIAXIAL
Diferentes materiales:
Mediante el uso de dispositivos adecuados, la prensa Unitronic,
dentro de los límites de 50 kN de capacidad máx. realiza ensayos
de compresión/flexión y de 25 kN en tracción (ver accesorio
S205-05), también realiza ensayos de compresión, flexión, tracción
directa y tracción indirecta, con control automático de carga o de
desplazamiento / deformación.
S205
con célula
de carga
La carga es aplicada por un pistón impulsado por un motor “sin
escobillas con circuito cerrado a través de un codificador óptico”
y controlado por un microprocesador. El pistón de carga posee
interruptores de final de carrera para salvar a la máquina de manipulaciones accidentales. El panel de control se coloca de frente y se
suministra con una membrana que tiene 6 pulsadores interactivos
multifunción guiado por un menú, una pantalla gráfica de gran
tamaño y un puerto RS232 para conexión a PC.
Especificaciones de hardware y software:
- Pantalla gráfica en Negativo azul “320 x 240 píxeles”
- 4 salidas analógicas A/D para transductores o células de carga
- Memoria permanente y reloj-calendario
- Procesamiento del ensayo completamente automático, con la
adquisición en tiempo real y visualización de la carga/desplazamiento o deformación, o la curva de carga/tiempo/deformación.
- Memoria de más de 100 ensayos, con la posibilidad de visualizar/
borrar archivos de ensayo
- Funciones en varios idiomas: Italiano, Inglés, Francés, Español
instrumentos para ensayos de materiales
NOTA:
Otras aplicaciones específicas para los ensayos sobre:
- Suelos, Rocas
- Hormigón, bloques de arcilla
- Cemento
- Ensayos de tracción, etc.
en la pág. 384 se describen los detalles técnicos, fotos y accesorios.
BETU NES - AS FALTOS
S205
Ensayo de estabilidad Marshall
Ensayo de tracción indirecta
NORMAS: EN 12697-34 / ASTM D1559 / AASHTO T245
BS 598 :107 / NF P98-251-2 / CNR N° 30
Desarrollo de ensayos con control del desplazamiento.
Accesorios necesarios:
S337-34 Célula de carga medidora de tensiones, capacidad 50 kN.
S212-05 Pistón de carga.
B046N
Molde de estabilidad.
B043-01 Software para el ensayo Marshall.
NORMAS: EN 12697-23 / ASTM D4123 / CNR N° 134
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-34 Célula de carga medidora de tensiones, capacidad 50 kN.
S212-05 Pistón de carga.
B047-02 Dispositivo de tracción indirecta para muestras de diá.4 “y 6”
B047-04 Juego de dos transductores de desplazamiento con
accesorios.
B043-02 Software para el ensayo de tracción indirecta.
sección B
UNITRONIC, APLICACIONES ESPECÍFICAS EN LOS MATERIALES BITUMINOSOS
97
B043-02 Software del
ensayo de tracción indirecta
Archivo de ensayo
Marshall
B043-01 Software del ensayo
Marshall
Corte directo (Leutner) entre capas de mezclas bituminosas
NORMA: ALP A StB T.4
Ensayo de corte directo (LEUTNER) en los riegos de adhesión entre capas de mezclas bituminosas, realizado sobre testigos de 150 mm o 100 mm obtenidos a partir de la extracción
de testigos de la carretera o en las muestras realizadas en el laboratorio.
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-34 Célula de carga medidora de tensiones, capacidad 50 kN.
S212-05 Pistón de carga.
B047-10 Cabezal de ensayos LEUTNER para probetas de 150 mm de diá.
B047-11 Adaptadores del cabezal de ensayo LEUTNER para probetas de 100 mm de diá.
B043-03 Software para ensayos Marshall y Leutner.
NOTA:
Accesorios necesarios antes mencionados, son comunes para los diferentes ensayos. Se recomienda que al realizar el pedido se verifique,
para evitar duplicaciones. Aplicaciones específicas adicionales se describen en la pág. 384.
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
B044N SET
B044N-SET
98
Cyber-Plus 8 Evolution “Pantalla Táctil”
Sistema de adquisición y procesamiento de datos. 8 canales.
Desarrollada para la implementación y mejora de cualquier tipo
de las máquinas existentes (incluso las no fabricadas por Matest)
aplicable a:
- Prensa mecánica Marshall mod. B042 KIT.
- Prensa de 2 velocidades CBR/Marshall mod. S213.
- Prensa Universal de multivelocidad mod. S212.
- Máquina motorizada de carga para CBR mod. S211 KIT.
Cyber-Plus 8 Evolution permite:
- Adquisición de hasta 8 canales analógicos/digitales: célula de carga
y transductores potenciométricos lineales de desplazamiento
vertical y/o horizontal.
Para la realización de los siguientes ensayos:
MARSHALL: EN 12697-34 / ASTM D1559 / CNR N. 30
NF P98-251-2 / BS 598 :107
- ENSAYO DE TRACCIÓN INDIRECTA: EN 12697-23 / ASTM D4123
- DETERMINACIÓN DE LA SENSIBILIDAD AL AGUA DE MUESTRAS BITUMINOSAS: EN 12697-12
- ENSAYO CBR: EN 13286-47 / CNR / UNI 10009 / ASTM D1883
BS 1377 / NF P94-078.
- ENSAYOS DE COMPRESIÓN NO CONFINADA: ASTM D2166
- Control remoto de la unidad digital a través de PC y software UTMII
Especificaciones del hardware:
- 8 canales independientes para las células de carga o transductores
potenciómetricos o medidores de tensión para la carga, deformación o medidas del desplazamiento
- Alimentación estabilizada de los canales analógicos: 5 Vcc y 3Vcc
- Entrada analógica: ±20 mV y ±5 V
- Resolución nominal: 24 bits.
- Adquisición de hasta 200 lecturas en cada canal.
- Sistema de seguridad on/off específico
instrumentos para ensayos de materiales
- Pantalla gráfica táctil en color 1/4 VGA
- Sistema de hora y calendario
Especificaciones del Firmware:
- Visualización instantánea de la carga medida por una célula
extensométrica.
- Visualización instantánea de la deformación medida por cuatro
transductores lineales de desplazamiento.
- Visualización de la gráfica del ensayo.
- Visualización de fecha y hora.
- Configuración y calibración semi-automática de todos los transductores conectados.
- 20 de los pasos de programa se pueden configurar por el usuario
final.
- Corrección automática del origen del eje en los ensayos CBR/
Marshall.
- Cálculo automático y visualización de todos los resultados de
acuerdo a la Norma.
- Establecimiento de todos los parámetros para el ensayo: alarmas,
umbral de cero, porcentaje del ensayo, parámetros de cálculo.
- Fecha/hora y selección de idioma (Italiano, Inglés, Francés, Alemán,
Español, Polaco).
- Archivo ilimitado para cada tipo de ensayo
- Símbolos en los botones de función
- Mensajes informativos (alarmas de planificación, configuración de
la célula de carga y del transductor de presión, etc.)
- Función de seguridad para la parada automática de la máquina
cuando se alcanza una carga máxima y deformación del transductor de presión.
- Impresión de los resultados en la impresora incorporada gráfica
térmica (C127N accesorio). Transferencia y gestión a través de
Ethernet de los datos presentados en tiempo real.
Detalles técnicos de hardware: ver pág. 24.
BETU NES - AS FALTOS
B044N-SET está compuesto por:
B044N
CYBER-PLUS 8 EVOLUTION. Unidad de adquisición de datos, tal
como se describe.
Alimentación: 230V 50/60Hz monofásica
B043-02N
SOFTWARE UTM2 (Máquina de Ensayos Universal 2)
Licencia para el ensayo de RESISTENCIA A TRACCIÓN INDIRECTA
NORMAS: EN 12697-23 / CNR N. 134 / ASTM D4123
sección B
S337-34
CÉLULA DE CARGA, capacidad de 50 kN, con una alta precisión
de los transductores de tensión, con cable y conector.
S336-14
TRANSDUCTOR DE DESPLAZAMIENTO, 50 mm de recorrido,
con linealidad del ± 0,1%, con cable y conector.
Accesorios para la fijación de la célula de carga y el transductor a la
máquina de ensayos. El sistema se suministra totalmente calibrado,
con certificado de calibración, y listo para usar.
Cada artículo puede pedirse por separado.
ACCESORIOS:
B043-01N
SOFTWARE UTM2 (Máquina de Ensayos Universal 2)
Licencia para el ensayo MARSHALL
Programa de procesamiento de datos para “X-Y ESTABILIDAD/
DEFORMACIÓN”
NORMAS: EN 12697-34 / CNR N. 30 / ASTM D1559
BS 598 :107 / NF P98-251-2
99
S218N
SOFTWARE UTM2 (Máquina de Ensayos Universal 2)
Licencia de ensayo de CBR
NORMAS: EN 13286-47 / CNR/UNI 10009 / ASTM D1883
BS 1377 / NF P94-078
S218-01N
SOFTWARE UTM2 (Máquina de Ensayos Universal 2)
Licencia para el ensayo de COMPRESIÓN NO CONFINADA
NORMAS: ASTM D2166
Descripción y detalles técnicos del software UTM2: ver pág. 14.
C127N
Impresora gráfica de papel térmico incorporable.
H009-01
ORDENADOR PERSONAL, con monitor LCD de 17 “, teclado,
ratón, cables de conexión, instalación y puesta en marcha del
software adquirido.
C128
Impresora láser para la impresión del certificado de
ensayo e impresión de gráficos con conexión directa al
CYBER-PLUS 8.
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
Baños de agua para las probetas Marshall
NORMAS: EN 12697-34, EN 13108 / ASTM D1559, D5581 / AASHTO T245
Se utiliza para mantener las probetas Marshall en agua a una temperatura constante de 60°C ± 1°C y las muestras de mezclas bituminosas
a 37,8°C ± 1°C.
Estos baños también son ideales para uso general en laboratorio.
MODELOS:
sección B
B051
100
Baño de agua Marshall
El interior del tanque y la tapa son de acero inoxidable, la caja
exterior es de chapa de acero pintada con aislamiento de lana.
Las muestras se depositan en una plataforma de acero inoxidable
perforado, separada de la parte inferior. El baño tiene una capacidad de 46 litros y está diseñado para un máximo de 20 probetas
Marshall.
Rango de temperatura: desde ambiente hasta 95 °C.
Dentro de las dimensiones: 615x505x150 mm
Dimensiones máximas: 660x540x230 mm
El baño se entrega “sin” termostato ni resistencia que
deben pedirse por separado (ver accesorios).
Peso: 18 kg
B051
“ACCESORIO NECESARIO” para el baño B051:
B051-01
SISTEMA DE CALENTAMIENTO CON TERMOSTATO
ANALÓGICO con elemento de calentamiento por inmersión.
Alimentación: 230V 50/60Hz monofásica 1500W
B051+B051-01
Como alternativa:
B051-02
SISTEMA DE CALENTAMIENTO CON TERMOSTATO DIGITAL
completo con resistencia de inmersión.
El sistema digital garantiza más control de la exactitud de la temperatura del agua a 60 ± 1°C o 37,8 ±1°C conforme a lo
solicitado por las Normas.
Alimentación:
230V 50/60Hz monofásica 1500W
B051-01
B051-02
C306-03
C306-03
Panel de control independiente, con interruptores y protecciones
eléctricas para que los termostatos B051-01 y B051-02 cumplan la
Directiva CE de seguridad.
instrumentos para ensayos de materiales
DETALLE B051-02
BETU NES - AS FALTOS
B052
Baño de agua digital
Este baño está totalmente realizado en acero inoxidable de doble
pared con aislamiento de lana. Las muestras se depositan en
una plataforma separada de la parte inferior. Completo con
agitador eléctrico y termostato digital “para la recirculación continua del agua”, lo que garantiza una
temperatura constante y uniforme de 60 ± 1°C o
37,8 ± 1°C según lo prescrito por las Normas. El baño
puede ubicar hasta 20 probetas Marshall
Capacidad: 60 litros
Rango de temperatura: desde ambiente hasta 95 °C
El baño está equipado con un termostato de doble seguridad
para evitar sobrecalentamientos accidentales.
Dimensiones interiores: 700x550x165 mm
Dimensiones exteriores: 900x640x340 mm
Alimentación: 230V monofásica, 50/60Hz 1500W
Peso: 28 Kg
sección B
B052+B052-10
B052-01
101
B052-01
Baño de agua digital
Idéntico al mod.B052, pero:
Dimensiones interiores: 430x420x160 mm
Dimensiones exteriores: 620x500x330 mm
El baño puede almacenar hasta 9 probetas Marshall.
Capacidad: 30 litros
Alimentación: 230V monofásica 50/60Hz 1200W
Peso: 15 Kg
B052-02
Baño de agua digital con sistema de refrigeración
Idéntico al mod. B052, pero equipado con una unidad de enfriamiento ubicada bajo el baño, para controlar la temperatura del
agua cuando la temperatura ambiente es muy alta.
Rango de temperatura de: + 3 a + 95 °C, precisión: ± 1 °C.
El baño puede contener hasta 12 probetas Marshall
Capacidad: 45 litros
Dimensiones interiores: 635x360x205 mm
Dimensiones exteriores: 800x430x1000 mm
Alimentación: 230V monofásica, 50/60Hz 1650W
Peso: 60 Kg
B052-02
ACCESORIOS PARA LOS MOD. B051 ÷ B052-02
B052-10
Termómetro de control de Alcohol de 0-100 °C
subdivisiones de 1°C.
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B053-10
sección B
Equipo de Cohesión
NORMAS: EN 12274-4 / ASTM D3910
Este instrumento se utiliza para los ensayos de cohesión en mezclas, y para determinar la consistencia adecuada o diseñar mezclas
de lechadas bituminosas. El cilindro neumático incorporado en la
unidad, aplica una presión sobre la muestra. Un equipo de torque
manual suministrado con el equipo de cohesión, mide la fuerza
de torsión determinando la total solidificación de la mezcla. Se
suministra completo con 5 moldes de diá. 60 x 6h mm, 5 moldes
de diá. 60 x 10h mm, accesorios, piezas de repuesto. Para realizar el
ensayo se precisa un equipo de aire a presión.
Dimensiones: 400x250x300 mm aprox.
Peso: 20 kg aprox.
ACCESORIOS:
V206
Compresor de aire. 230V, 50Hz, monofásica.
102
MOLDES cuadrados con 4 orificios para preparar la muestra:
B053-12 MOLDE 140x140x6,3 mm
140x140x10 mm
B053-13 “
B053-14 “
200x200x13 mm
B053-15 “
250x250x19 mm
B053-10
B053-20
Abrasímetro planetario (no ilustrado)
DETERMINACIÓN DEL DESGASTE
NORMAS. EN 12274-5 / ASTM D3910
La unidad consta de un mezclador planetario, la lechada bituminosa se
coloca en el interior del recipiente aplicándose una fricción orbital mediante una manguera de goma midiéndose posteriormente el desgaste.
Alimentación: 230V 50Hz monofásica
Dimensiones: 340x460xx500 mm aprox.
Peso: 40 kg aprox.
S148
REPUESTOS:
B053-16 MOLDE diá.60 x 6h mm (5 piezas)
B053-17 MOLDE diá.60 x 10h mm (5 piezas)
Determinación de la
Consistencia
B053-05
Índice y regularidad de la dispersión del
ligante y las gravillas
NORMAS: EN 12272-1 / BS 598:108
Este equipo se utiliza para determinar la regularidad de propagación de los tratamientos superficiales de carreteras. El dispositivo
consiste en una bandeja cuadrada de 300 mm, levantada por cuatro
cadenas que se fija en una balanza de resorte.
El índice de dispersión es directo
midiéndose en kg/m2
Peso: 1500g aprox.
B053-05
NORMA: EN 12274-3
CONO Y COMPACTADOR
PARA LA ABSORCIÓN DE
ARENA, también se utiliza para la
determinación de la absorción y
el peso específico
de los áridos finos
Peso: 600 g aprox.
B053
S148
“Vialit” - Ensayo de adhesividad
B053
NORMAS: EN 12272-3 / NF P98-274-1
Se utiliza para evaluar la adhesión global y la adhesión activa entre
asfalto y áridos en la ejecución de riegos con gravilla o tratamientos
superficiales de carretera.
El equipo está formado por:
Seis bandejas de metal para ensayos
Bola de acero de 512 g
Base metálica con tres puntos de apoyo vertical y varilla metálica
de 500 mm de altura con soporte
Rodillo metálico manual recubierto de goma lastrado con perdigones
Peso: 40 kg aprox.
RECAMBIO:
B053-01 Bandeja metálica de ensayo.
instrumentos para ensayos de materiales
BETU NES - AS FALTOS
A113
PÉNDULO MEDIDOR DE LA RESISTENCIA A LA FRICCIÓN Y AL DESLIZAMIENTO
MEDICIÓN DE LA RESISTENCIA AL DESLIZAMIENTO DE LAS SUPERFICIES DE LOS AGLOMERADOS.
NORMAS: EN 13036-4 / EN 1097-8 / ASTM E103
El aparato es adecuado tanto para ensayos
“in situ” como para aplicaciones de laboratorio,
pudiéndose realizar dos tipos de ensayos:
sección B
- para la medición de la superficie de fricción
en pavimentos (asfalto de carreteras) y propiedades de resistencia al deslizamiento;
- para el valor de pulimento de los áridos en el
ensayo de pulimento acelerado.
El péndulo de fricción también es adecuado para llevar a
cabo los ensayos sobre:
- las piedras naturales conforme a la Normas
EN 1341, 1342;
- pavimentos de losas de hormigón EN 1338.
El péndulo mide la pérdida de energía cuando el borde
de la goma del patín de caucho es impulsado sobre la
superficie de ensayo.
Un dispositivo de elevación con sistema anti deslizante se incorpora
en la base del péndulo para garantizar las operaciones de reglaje
preciso. El sistema de ajuste de altura es simple y seguro.
El puntero, hecho de aleación ligera, tiene fricciones extremadamente bajas garantizando una alta precisión en los resultados.
El mecanismo de liberación del brazo del péndulo tiene un original
solución para reducir al mínimo la fricción dando una mayor precisión. El péndulo se suministra completo con:
- incorporación de escalas adicionales para la determinación
del valor de los ensayos sobre pulimento de los áridos;
- regla de plexiglás, para verificar la longitud de la zona de ensayo;
- termómetro de -10 a +110 °C para la medida de la temperatura de la superficie;
- silla, frasco lavador, cepillos, conjunto de herramientas para
uso de la máquina;
- maleta de transporte;
- certificado de calibración según la Norma EN 1097-8.
El péndulo se suministra “SIN” patines de goma que deben pedirse por separado (ver accesorios).
Dimensiones de la maleta:
730x730x330 mm
Peso: 32 kg
A113
103
ACCESORIOS:
A110-03 Patín de goma montado para ensayos “in situ”
(superficie de pavimentos), con certificado de
conformidad.
A110-01 Patín de goma montado para ensayos de pulimento acelerado sobre áridos (en laboratorio),
con certificado de conformidad.
A110-11 Placa base de metal para ensayos del valor de
pulimento acelerado de piedras en laboratorio
y ensayos sobre piedra natural y adoquines de
hormigón. Suministrado “sin” el dispositivo de
sujeción, que debe pedirse aparte.
A110-12 Dispositivo de sujeción para el ensayo del valor de
pulimento de la piedra en laboratorio.
A110-13 Dispositivo de sujeción para las pruebas sobre las
piedras naturales (EN 1341, 1342), para adoquines
de hormigón (EN 1338) y ensayos de deslizamiento sobre superficies de madera (EN 1339).
A110-20 Lamina rosa pulida (10 hojas) para la calibración
del péndulo.
A110-11 + A110-12
A113 contenido en la maleta
A110-03
A110-01
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
104
B056 KIT
B057 KIT
Penetrómetro estándar
Penetrómetro semiautomático
NORMAS: EN 1426 / ASTM D5 / BS 2000 / NF T66-004
AASHTO T49 / UNI 4162 / UNE 7013 / NLT 124 / CNR N° 24
Se utiliza para determinar la consistencia de una muestra bituminosa en condiciones fijas de carga, tiempo y temperatura. La
penetración es expresada en la distancia de décimas de milímetros
verticalmente penetrados con una aguja estándar. El penetrómetro
estándar es de construcción robusta, con una base de aluminio y
tornillos de nivelación, una barra niquelada vertical, y un “dispositivo micrométrico de ajuste vertical”. El deslizador es de bronce,
con caída libre.
El dial, graduado en 360° (división de 0,1 mm.), tiene un
diámetro de 150 mm. El penetrómetro se suministra
con tope y botón para la liberación de la carga al
presionar, ajuste a cero automático, ajuste micrométrico, juego de pesas de 50 y 100 g, aguja de
penetración, vasos de bronce portamuestras de
diá.55x35 mm y 70x45 mm.
Dimensiones: 220x170x410 mm.
Peso: 11 Kg
La estructura es básicamente como el mod. B056 KIT, pero con un
electroimán y un dispositivo electrónico con temporizador digital
programable que libera automáticamente la cabeza del émbolo
y se asegura de la caída libre de la aguja durante el ensayo de 5
segundos.
Alimentación: 230V monofásica, 50/60Hz 200W
Dimensiones: 220x280x410 mm
Peso: 15 Kg
B057 KIT
B056 KIT
B057-02
B057-03
ACCESORIOS:
B057-02 ESPEJO, para un fácil ajuste de la aguja.
B057-03 RECIPIENTE DE TRANSFERÉNCIA, de vidrio, con
soporte.
B057-06 AGUJA DE PENETRACIÓN DE ACERO ENDURECIDO, suministrado con Certificado de Verificación de
UKAS. Peso: 2,5 ± 0,05 g
B057-07 AGUJA DE PENETRACIÓN DE ACERO ENDURECIDO, cada aguja es verificada individualmente y lleva el
número de serie grabado y responde perfectamente a
la especificación EN 1426. Peso: 2,5 ± 0,05 g
B057-08 TERMÓMETRO, IP 38C. Rango: 23 °C a +26 °C
Graduación 0,1 °C.
B089
TERMÓMETRO, EN, Rango: 19 °C a +27 °C. Graduación 0,1 °C - ASTM 17C
instrumentos para ensayos de materiales
RECAMBIOS:
B057-01 AGUJA DE PENETRACIÓN. Peso: 2,5 ± 0,05 g
B057-04 Pesa de 50 g.
B057-05 Pesa de 100 g.
V122-05 VASO PARA MUESTRAS, hecho de latón
de diá. 55x35 mm
V122-06 VASO PARA MUESTRAS, hecho de latón
de diá. 70x45 mm
B056-01 KIT
B056-02 KIT
Penetrómetro digital estándar
Penetrómetro digital semiautomático
NORMAS: EN 1426 / ASTM D5 / BS 2000 / NF T66-004
AASHTO T49 / UNI 4162 / UNE 7013 / NLT 124 / CNR N° 24
Se utiliza para determinar la consistencia de una muestra bituminosa en condiciones fijas de carga, tiempo y temperatura .La
penetración es expresada en la distancia en décimas de milímetro
verticalmente penetrados con una aguja estándar. El penetrómetro
estándar es de construcción robusta, con una tabla con base de
aluminio con tornillos de nivelación, barra vertical niquelada y
“dispositivo micrométrico de ajuste vertical”.
El deslizador es de bronce y de caída libre.
La lectura digital de los valores de penetración se realiza en mm
y pulgadas, con resolución de 0,01 mm, pantalla LCD de 5 dígitos,
con ajuste a cero en cualquier posición.
Energía: Pila de 1,5 V.
El penetrómetro se suministra con botón de liberación y parada,
ajuste a cero automático, ajuste micrométrico, sistema de pesas 50
y 100 g, aguja de penetración, vaso de muestras realizado en latón
de diá. 55x35 mm y 70x45 mm.
Dimensiones: 220x170x410 mm.
Peso: 11 Kg
La estructura es básicamente como el mod.B056 KIT, pero con un
electroimán y un dispositivo electrónico con temporizador digital programable que libera automáticamente la cabeza del émbolo y asegura
la caída libre de la aguja durante los 5 segundos que dura el ensayo.
Alimentación: 230 V monofásica, 50/60 Hz 200 W
Dimensiones: 220x280x410 mm. Peso: 15 Kg
ACCESORIOS:
B057-02 ESPEJO, para un ajuste fácil de la aguja.
B057-03 RECIPIENTE DE TRANSFERÉNCIA, de vidrio, con apoyo.
B057-06 AGUJA DE PENETRACIÓN DE ACERO ENDURECIDO, suministrada con Certificado de Verificación de
UKAS. Peso: 2,5 ± 0,05 g
sección B
BETU NES - AS FALTOS
B057-07 AGUJA DE PENETRACIÓN DE ACERO ENDURECIDO, cada aguja es verificada por separado y lleva el
número de serie grabado, respondiendo perfectamente
a la especificación EN 1426. Peso: 2,5 ± 0,05 g
B057-08 TERMÓMETRO, IP 38C
Rango: +23 °C a +26 °C.
Graduación 0,1 °C
B057-03
B089
TERMÓMETRO, EN, Rango:
19 °C a +27 °C. Graduación
0,1 °C - ASTM 17C
B056-02 KIT
B056-01 KIT
B057-02
RECAMBIOS:
B057-01 AGUJA DE PENETRACIÓN. Peso: 2,5 ± 0,05 g
B057-04 PESA de 50 g.
B057-05 PESA de 100 g.
V122-05 VASO para muestras, hecho de latón, de diámetro
55x35 mm
V122-06 VASO para muestras, hecho de latón, de diámetro
70x45 mm
instrumentos para ensayos de materiales
105
BE TUN E S - A S FA LTO S
ACCESORIO:
B058-01
RECIPIENTE BAÑO DE AGUA lleva incorporado una bobina termostática, que se conecta
al baño del mod. B058. Se mantiene la temperatura de la muestra del betún, directamente
en el penetrómetro, evitando la transferencia.
B056 KIT
B058
sección B
B058 detalle
106
B058-01
B059 KIT
B058
Baño de agua termostatado para
penetrómetro
Suministra al agua la temperatura requerida de 25 ± 0,1 °C. La
unidad consta de un recipiente de acero inoxidable de 10 litros
de capacidad con aislamiento de lana, calentador eléctrico con
termostato digital, bomba a motor con conexiones, dispositivo de
serpentín para refrigeración mediante agua corriente, para mantener una temperatura constante del baño cuando la temperatura
ambiente es ligeramente superior.
La muestra bituminosa se sumerge en el baño de agua y se coloca
en el penetrómetro sólo en el momento del ensayo, utilizando el
recipiente de transferencia (accesorio mod. B057-03).
Alimentación: 230V monofásica, 50/60Hz 350W
Dimensiones: 375x335x420 mm
Peso: 12 Kg
Penetrómetro digital automático
NORMAS: EN 1426 / ASTM D5 / BS 2000 / NF T66-004
NLT 124 / AASHTO T49 / UNI 4162 / UNE 7013
CNR N° 24
Medida digital de los valores de la penetración.
Rango de medición: 50 mm, sens. 0,01 mm
Aproximación motorizada de la aguja, guiado por la cámara
(diámetro de la aguja = 5 mm en el monitor).
Control eléctrico de la aproximación.
Dispositivo electromecánico de bloqueo
y liberación de la aguja.
Retorno motorizado de la aguja.
Puerto USB para impresora o
conexión PC
Se suministra completo con aguja,
pesas, vasos porta muestras.
Alimentación:
230V monofásica, 50Hz
Dimensiones:
260x320x540 mm
Peso: 23 kg
B059 KIT
B016
B016
B060
Baño de aire
Toma muestras Bacon
Se utiliza para ablandar el betún antes de realizar una serie de
ensayos incluyendo la ductilidad, punto de inflamación, la penetración, la pérdida por calor. El interior del vaso, está hecho de
acero inoxidable y cuenta con 600 g de capacidad. Completo con
termorregulador y lámpara piloto.
Alimentación: 230V monofásica, 50/60Hz 500W
Dimensiones: 140x140x350 mm
Peso: 5 Kg
NORMAS: EN 58 / CNR N° 81, N° 98
ASTM D140 / AASHTO T40
Se utiliza para obtener muestras de asfaltos o de
aceites de varios niveles dentro de un tanque de
almacenamiento por el método “thief”.
Hecho de latón. Capacidad 237 ml
Dimensiones: diámetro 50x250 mm
Peso: 2 kg
instrumentos para ensayos de materiales
B060
BETU NES - AS FALTOS
B066 KIT
Estufa de película fina y rotatoria - ASTM
B064 KIT
B066 KIT
B066-01 KIT
Estufa de película fina y rotatoria - EN
sección B
EFECTO DEL CALOR Y DEL AIRE EN UNA PELÍCULA
DE ASFALTO EN MOVIMIENTO ROTATORIO. MÉTODO
RTFOT
NORMAS: ASTM D2872 / AASHTO T240
CNR N° 54
Utilizado para medir el efecto del calor y el aire sobre de
una capa de material bituminoso semisólido en movimiento. El marco externo y la cámara interna son de
acero inoxidable, con aislamiento de fibra de vidrio en la
cámara intermedia. Provista de una gran puerta de vidrio
para las inspecciones. El horno debe estar conectado a un
suministro de presión de aire adecuada. Se suministra completo
con: termostato digital de precisión para mantener los 163 °C
de temperatura, termómetro de control ASTM 13C, dispositivo
de ventilación, conjunto de ocho contenedores de vidrio de diá.
64x140 mm. El horno está equipado con un termostato de doble
seguridad para evitar un sobre-calentamiento accidental.
Alimentación: 230V monofásica, 50Hz 1700W
Dimensiones: 620x620x910 mm
Peso: 55 Kg
NORMA: EN 12607-1
Igual que para el mod. B066, pero con la cámara de ensayo modificada para cumplir con las especificaciones EN 12607-1.
Se suministra completo.
RECAMBIOS:
B066-02 Contenedor de vidrio de diá.64x140 mm
B064-03 Termómetro ASTM 13C. Rango: de 155 °C. a +170 °C.
div.0,5°C.
Horno para asfalto con plataforma de rotación
PELICULA FINA Y DETERMINACIÓN DE LA PÉRDIDA DE PESO. MÉTODO TFOT
NORMAS: EN 12607-2, EN 13303 / CNR N° 50 / ASTM D6, D1754 / AASHTO T47, T179 / BS 2000 / UNE 7110 / NF T66-011
Cámara interna y armazón externo de acero inoxidable, doble
pared de aislamiento de fibra de vidrio, doble puerta. Termorregulador digital para el control de temperatura. El horno está equipado
de un termostato de doble seguridad para prevenir accidentes
por sobre-calentamientos. La placa gira a 5-6 rpm. Se suministra
completo con vidrio de control y termómetro ASTM 13C, +155 a
+170 °C subdivisiones 0,5° C. El horno se suministra “sin plataforma giratoria ni accesorios”, que debe pedirse por separado.
Alimentación: 230V monofásica, 50Hz 1500W
Dimensiones interiores: 330x330x330 mm
Dimensiones exteriores: 460x450x700 mm
Peso: 40 Kg
EL HORNO MOD. B064 PUEDE EQUIPARSE EN DOS VERSIONES, CON LOS SIGUIENTES ACCESORIOS:
B064-01 KIT
Plataforma de rotación completa con 9 contenedores de diá. 55x35
mm para la “Determinación de la pérdida por calor”:
Normas EN 13303 / ASTM D 6 / BS 2000 / NF T066-011
AASHTO T47 / CNR N° 50
B064-02
Plataforma de rotación, con dos contenedores de diá. 140x9, 5 mm
para la “Determinación de la capa fina”:
Normas EN 12607-2 / ASTM D1754 / AASHTO T149 / UNE 7110
B064-01 KIT
B064-02
B064 KIT + B064-01 KIT
RECAMBIOS:
V122-05 Recipiente de latón. Dia. 55x35 mm
B064-04 Recipiente de acero inoxidable de dia. 140x9, 5 mm
instrumentos para ensayos de materiales
107
BE TUN E S - A S FA LTO S
B054
sección B
Ductilómetro
108
NORMAS: EN 13589 / EN 13398
ASTM D113 / AASHTO T51 / NF T66-006
NLT 126 / UNE 7093 / CNR N° 44
Se utiliza para determinar la ductilidad bituminosa, que es decir, la distancia a la que una
probeta de betún se puede estirar en condiciones
controladas, antes de su ruptura. El ductilómetro
básicamente consiste en un carro móvil que viaja a
lo largo de dos guías. El carro es impulsado por un
motor eléctrico, dentro de un tanque de gran tamaño
que está equipado con un termostato digital, calentador
eléctrico de inmersión, un serpentín de enfriamiento para
circulación de agua fría y bomba. Este modelo funciona de
forma automática a una velocidad de 50 mm/min esto es su
máximo recorrido es de 1500 mm. El tanque y la estructura
externa son todos de acero inoxidable con aislamiento de fibra de
vidrio. La temperatura del baño de agua se mantiene constante a
25 ºC ± 0,5 °C por un termorregulador digital. La unidad está equipada con un termostato de doble seguridad para evitar sobrecalentamientos. Fuerza de tracción máxima: 300 N, precisión: ± 0,1 N. El
ductilómetro puede aceptar hasta 3 muestras de forma simultánea.
Se suministra completo “salvo” por el molde y la placa base de las
probetas que deben pedirse por separado (ver accesorios).
Alimentación: 230V monofásica, 50Hz 1000W
Dimensiones: 2140x350x400 mm. Peso: 95 Kg
B055
B054
B055
Ductilómetro con sistema de refrigeración
Igual que para el mod. B054, pero equipado con refrigeración
incorporada para la unidad de ensayos con la temperatura del agua
entre + 5°C y + 25°C. Dimensiones: 2140x350x750 mm.
Peso: 130 Kg
ACCESORIOS:
B054-01
MOLDE PROBETA DUCTILIDAD - NORMAS: ASTM, AASHTO
Se utiliza para preparar la muestra, realizado en latón, mecanizado
con precisión. Se suministran sin placa base. Peso: 300 g
B054-03
MOLDE PROBETA DUCTILIDAD- NORMA: EN 13398
Se utiliza para preparar la muestra, realizado en latón, mecanizado
con precisión. Se suministran sin placa base. Peso: 300 g
B054-04
MOLDE PROBETA DUCTILIDAD - NORMA: EN 13589
Se utiliza para preparar la muestra, realizado en latón, mecanizado
con precisión. Se suministran sin placa base. Peso: 300 g
B054-02 PLACA DE BASE para moldear las probetas de ductilidad.
B054-03
B054-01
instrumentos para ensayos de materiales
B054-04
B054-02
B077 KIT
Aparato Fraas
B077 KIT
PUNTO DE RUPTURA
NORMAS: EN 12593
Este equipo se utiliza para determinar el punto de ruptura de
betunes semisólidos y sólidos. Se
trata de un dispositivo de flexión
con dos tubos concéntricos de
resina que se deslizan, mordazas
para la probeta de ensayo, sistema manual de flexión por manivela, dispositivo de enfriamiento
con tres contenedores, lámina
de acero especial, termómetro
IP 42C.
Peso: 4 kg
RECAMBIOS:
B077-01
Lámina (resorte) de acero
especial.
B077-02
Termómetro IP 42C.
BETU NES - AS FALTOS
B055-10
Ductilómetro con adquisición de datos
sección B
Especificaciones técnicas y mecánicas: mismo mod. B054, pero actualizado con:
- Cyber-Plus 8 Evolutión: sistema de adquisición y procesamiento de datos con “pantalla táctil de color” ¼VGA, resolución de 24 bits.
Lleva a cabo la adquisición y procesamiento de datos de forma automática. Impresión del certificado de ensayo a través de la impresora
(accesorio) conectada directamente al puerto USB. Equipado con ranuras para insertar pendrives o tarjetas SD de memoria infinita con
conexión directa al PC. Detalles del hardware: ver pág. 24
- Una célula de carga eléctrica de 50 N completamente instalada y calibrada. (Posibilidad de instalar hasta 3 células).
Suministrados “sin” molde de probetas y base (ver accesorios).
ACCESORIOS:
B055-15
CÉLULA DE CARGA
eléctrica, 50 N de capacidad,
con instalación y calibración
(posibilidad de instalar hasta 3
células).
B055-16
UNIDAD DE REFRIGERACION,
incorporada en la máquina, para
ensayos con temperatura del agua
de 5 °C a 25°C
109
B055-10
C128
IMPRESORA LASER, modelo de banco, para los gráficos y los
certificados con conexión directa a través de USB.
Moldes de ductilidad y placa base: ver pág. 108.
B055-20
Ductilómetro con adquisición de datos
“Alto rendimiento”
Desarrollado y fabricado para los ensayos de ductilidad y para la
investigación.
- El Motor paso a paso ofrece una gama de velocidades variable
desde 1 hasta 50 mm/min con un sistema digital de medición de
desplazamiento.
- Se pueden ensayar hasta 4 muestras de forma simultánea.
- Célula de carga eléctrica de alta capacidad 500 N (posibilidad de
conectar hasta 4 células).
- Cyber-Plus 8 Evolution sistema de adquisición y procesamiento
de datos con “pantalla táctil a color” (para detalles técnicos: ver
más arriba).
- Cubierta superior de vidrio
Suministrados “sin” moldes de probetas y la base (ver accesorios).
Alimentación: 230V 50Hz 1000W monofásica
Dimensiones: 2140x400x450mm. Peso: 110 kg aprox.
ACCESORIOS:
B055-25
Célula de carga eléctrica, 500 N, con instalación y calibración
(posibilidad de instalar hasta 4 células).
B055-26 UNIDAD DE REFRIGERACIÓN, para las ensayos con
temperatura del agua entre +5 °C y +25 °C
C128
IMPRESORA LASER,
modelo de banco, para
gráficos y certificados
con conexión directa a
través de USB
Moldes de ductilidad y
placa base: ver pág.108.
Detalle: cuatro células de carga de 500 N
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B072
Aparato de anillo y bola. Punto de reblandecimiento
sección B
NORMAS: EN 1427 / ASTM D36 / AASHTO T53 / NF T66-008
Comparable a: BS 2000 / UNI 4161 / DIN 52011 / UNE 7111 / CNR N°35
El reblandecimiento del betún depende, entre otros factores, de la temperatura del
material, donde con el incremento de la temperatura, aumenta el reblandecimiento
del betún. La unidad consiste en un vaso de precipitados pyrex, un marco de latón, dos
anillos, dos guía de centrado y dos bolas. Peso: 900 g
ACCESORIOS:
B072-01 TERMOMETRO ASTM 15C de -2 a +80 °C
subdivisiones 0,2 °C
B072-01
B074-01
B072
B072-02 TERMOMETRO ASTM 16C de +30 a +200 °C
subdivisiones .0,5 °C
B072
B074
B073-01
110
Placa calefactora con agitador magnético
Completada con termorregulador para el ajuste de la temperatura
y agitador magnético con ajuste electrónico de 100 a 1200 rpm.
Adecuada para realizar ensayos en agua destilada con el punto de
reblandecimiento entre +30 °C a +80 °C. Versión alternativa al
mod. B074 + B074-01.
Alimentación: 230V monofásica 50/60Hz 700W
Peso: 4 kg aprox.
B073-02
Placa calefactora con agitador magnético
B072-07
Mismo mod. B073-01, pero con una resistencia eléctrica con más
potencia de calefacción, adecuada “también” para los ensayos en
glicerina con puntos de reblandecimiento de más de 80 °C hasta
+150 °C. Alimentación: 230V monofásica 50/60Hz 1000W
Placa de vertido, para
verter la mezcla bituminosa en
los anillos cónicos de bronce,
según especificaciones de la
Norma EN 1427.
Dimensiones: 75x50x10 mm
B072-07
B074
Placa calefactora, con termorregulador para el ajuste de
RECAMBIOS para B072:
B072-03 Bolas de acero de
diámetro 9,5 mm
la temperatura.
Alimentación: 230V monofásica, 50/60Hz 1000W
Peso: 6 kg
B072-04 Anillo cónico de latón
ACCESORIO:
B074-01
B072-06 Vaso de precipitados
Pyrex
B072-05 Guía de centrado
de las bolas
B072
Agitador eléctrico, accesorio para la placa calefactora
B074 para asegurar una temperatura más uniforme en el baño.
Se suministra completo con soporte vertical y la base.
Alimentación: 230V monofásica, 50Hz 100W
Peso: 3 kg
B073-01
instrumentos para ensayos de materiales
B072-01
BETU NES - AS FALTOS
B070N
Aparato de anillo y bola automático. Punto de reblandecimiento
Este equipo de ensayos “de alta tecnología” digital con microprocesador, diseñado y fabricado por Matest, determina automáticamente el punto de reblandecimiento de betunes y breas.
Dos sensores láser detectan la caída de las bolas determinando el
punto de reblandecimiento.
La temperatura del baño se mide con un sistema electrónico
manteniendo el gradiente (5 ºC/min) según lo especificado por las
Normas.
Un agitador magnético con ajuste electrónico de la velocidad entre
0 y 160 rpm también garantiza una temperatura uniforme en el
recipiente durante la ejecución del ensayo.
Se pueden seleccionar dos parámetros del ensayo mediante el
menú del microprocesador:
- ensayo con agua destilada y hervida para puntos de reblandecimiento entre 30º y 80 °C;
- ensayo con glicerina para puntos de reblandecimiento de 80º
hasta 150 °C.
Selección de idioma: Inglés, Francés, Español, Alemán e Italiano.
Funciones de: reloj/calendario, número de ensayos, usuario/nombre
del cliente, notas generales, inicio/final del ensayo.
Visualización en tiempo real de la temperatura del baño, desarrollo
del ensayo, rpm del agitador.
El equipo de ensayo está compuesto básicamente por:
- placa calefactora de vitrocerámica con desconexión automática al
final del ciclo de ensayo;
- pantalla gráfica de alta resolución, 320x240 píxeles con teclado de
membrana;
- microprocesador, a través de una base de menús controla todos
los parámetros seleccionados de: calentador/agitador, sonda de
temperatura, sensores láser, fase de precalentamiento de la placa,
registros de todos los resultados en su memoria permanente,
almacenando hasta un máximo de 300 ensayos.
sección B
NORMAS: EN 1427 / ASTM D36 / AASHTO T53 / NF T66-008;
Comparable a: BS 2000 / UNI 4161 / DIN 52011 / UNE 7111 / CNR N. 35
B070N
Funciones principales:
Gran pantalla gráfica: 320x240 píxeles
Memorización de hasta 300 ensayos
RS 232 para PC
Selección en varios idiomas
Sencillo menú del microprocesador con el fin de controlar
todas las fases del ensayo
Componentes de alta calidad: sensores láser, agitador electro
magnético, placa de calentamiento de vitrocerámica
Totalmente automático
RS 232 para descargas al PC.
Equipo centrador de bolas de acero.
Alimentación: 230V 50/60Hz monofásica 700W
Dimensiones: 500x350xh550 mm
Peso: 20 kg aprox.
ACCESORIOS:
B070-11
BARRAS CON EXTREMOS ESFÉRICOS (juego de 2 piezas) para
el control y la calibración del instrumento.
RECAMBIOS para B070N:
B072-03 Bolas de acero de 9,5 mm de diámetro
B070-15 Anillo cónico de bronce cromado
B070-16 Guía de centrado, de bronce cromado
B070-17 Vaso de precipitados Pyrex
B070-11
B070-16
B070-15
B070-17
B072-03
instrumentos para ensayos de materiales
111
sección B
BE TUN E S - A S FA LTO S
B075
B069 KIT
Agua en emulsiones bituminosas
Destilación fraccionada de productos bituminosos
NORMAS: EN 1428, 12847 / ASTM D244 / NF T66-023, T66-113
Se utiliza para determinar el agua en productos derivados del
petróleo o materiales bituminosos, mediante la destilación con
disolventes volátiles inmiscibles en agua. El equipo consta de:
Balón de vidrio de 500 ml
Recipiente de vidrio de 25 ml de capacidad con divisiones de 0,1 ml.
Condensador de reflujo de vidrio
Calentador eléctrico con termorregulador y abrazaderas.
Alimentación:
230V monofásica 50/60Hz 500W
Peso: 8 kg aprox.
NORMAS: ASTM D402 / AASHTO T78 / NF T 66-003 / UNE 7112, 7072
Se utiliza para medir la cantidad de los componentes más volátiles
en el fraccionamiento de productos asfálticos. El equipo consta
de: un “calentador eléctrico con termo regulador”, matraz de
destilación, tubo de condensación, adaptador, pantalla protectora,
receptor, soportes, probeta graduada, termómetro ASTM 8C -2 a
+400 °C subdivisiones 1 °C.
Alimentación: 230V monofásica, 50/60Hz 750W. Peso: 12 kg
B069-11 Termómetro de repuesto ASTM 8C
B069 KIT
B076
Agua en materiales
bituminosos (Dean-Stark)
112
B075
NORMAS: ASTM D95, D244
AASHTO T55, T59 / IP 74-77
CNR No. 101 / NLT 123
Idéntico al mod. B075, excepto para el
receptor con capacidad de 10 ml.
Emulsiones bituminosas:
Residuo de tamizado
NORMA: EN 1429
B076-21 Tamiz de acero inoxidable, 75 mm de diá. 0,5 mm de
abertura
B076-22 Tamiz de acero inoxidable, 75 mm de diá. 0,16 mm de
abertura
B076-24 Fondo y tapa, de acero inoxidable, 75 mm de diá.
B076-21 ÷ B076-24
A122-10
Ensayo de inclinación (Tilt Test)
El instrumento mide el coeficiente de rugosidad de una junta. El
equipo está también diseñado para ensayar la tendencia a la posible
fluencia de las mezclas bituminosas que cubre una pendiente de
una contención, en zonas con alta radiación solar. La tendencia a
la fluencia es la deformación permanente de un material viscoso.
El equipo consiste en un plano inclinado ajustable en la que el
muestra se coloca.
Ángulo de inclinación: 0 - 50°
Diámetro máx. de la muestra: 100 mm
El plano se inclina lentamente hasta que se produce el deslizamiento de la superficie superior de la muestra sobre la parte inferior.
El índice de rugosidad puede evaluarse a partir del ángulo de
inclinación medido.
Dimensiones: 270x175x265 mm.
Peso: 5 kg aprox.
Emulsiones bituminosas:
Estabilidad de la mezcla con cemento
NORMA: EN 12848
B076-23 Tamiz de acero inoxidable, 75 mm de diá. 2 mm de
abertura
B076-22 Tamiz de acero inoxidable, 75 mm de diá. 0,16 mm de
abertura
B076-24 Fondo y tapa, de acero inoxidable, 75 mm de diá.
instrumentos para ensayos de materiales
A122-10
B063-10
B063 KIT
Ensayo de la carga de las partículas
Equipo de destilación de emulsiones
bituminosas
DETERMINACIÓN DE LA POLARIDAD DE LAS PARTICULAS
EN EMULSIONES BITUMINOSAS
NORMAS: EN 1430 / CNR N. 99 / ASTM D244
Este equipo se utiliza para identificar la carga de las partículas de las
emulsiones bituminosas.
El equipo consta de:
- Miliamperímetro de hasta 10 mA de escala con soporte incorporado
- Resistencia variable
- Dos electrodos de acero inoxidable
- Dispositivo de aislamiento
- Vaso de 500 ml de capacidad
- Varilla de vidrio
Alimentación:
230V 50/60Hz monofásica
Dimensiones: 200x200x600mm
Peso: 3 kg aprox.
NORMAS: EN 1431 / ASTM D 244 / AASHTO T 59
CNR N° 100
Se utiliza para la determinación del fraccionamiento de materiales
bituminosos mediante el ensayo de destilación.
El conjunto está formado por: una retorta de aluminio, conectores
de vidrio, incluido condensador, soportes, probeta graduada, dos
termómetros ASTM 7C rango -2 a +300 °C, con quemador de
gas anular y con interrupción controlada de gas, mediante válvula
y sensor de llama. Puede venderse en los mercados de la CE, pero
no puede usarse en espacios cerrados.
Peso: 12 kg
sección B
BETU NES - AS FALTOS
RECAMBIO:
B063-01 Termómetro ASTM 7C
113
B063-10
B063 KIT
B072-20
Equipo Wilhelmi, punto de
reblandecimiento
NORMAS: EN 1871 / DIN 1996-15
Se utiliza para determinar el punto de reblandecimiento de materiales bituminosos para la construcción de carreteras, según el método Wilhelmi.
El punto de reblandecimiento es la temperatura
en que la capa de material termoplástico, sufre
una deformación por el peso de una esfera de
acero de 13,9 g. El equipo consta de un anillo dividido en dos mitades en un soporte metálico, vaso
de precipitados, bola de acero de 15 mm de diá.
Peso: 2 kg aprox.
B072-20 + B072-02
B063-05
Estabilidad al almacenamiento de las
emulsiones bituminosas
NORMA: NF T66-022
Este equipo se utiliza para la determinación de la estabilidad de
almacenamiento de las emulsiones por
decantación. Se compone de una fuente
de alimentación de corriente de 12 V estabilizada, electrodo cilíndrico, base con
soporte, recipiente de acero inoxidable
de 500 ml capacidad, vidrio de reloj.
Alimentación: 230V 50/60Hz monofásica
Dimensiones: 200x200x500 mm
Peso: 5 kg aprox.
ACCESORIOS para B072-20:
B072-02
TERMÓMETRO, ASTM 16C, escala de +30 °C.+200 °C, subdivisiones.0,5 °C.
B073-02
CALENTADOR ELÉCTRICO CON AGITADOR MAGNÉTICO,
siendo adecuado para ensayos de agua y glicerina, con punto de
reblandecimiento máximo de 150 °C.
Alimentación: 230V 50/60Hz monofásica 1000W
Peso: 4 kg aprox.
Ver pág.110
B063-05
instrumentos para ensayos de materiales
BE TUN E S - A S FA LTO S
B065
sección B
Equipo de Evaporación Rotativo
114
DETERMINACIÓN DE LA RESISTÉNCIA
AL ENVEJECIMIENTO. ENSAYO DEL FRASCO EVAPORADOR
ROTATIVO. MÉTODO RFT. NORMA: EN 12607-3
Esta unidad se utiliza para evaluar el efecto de endurecimiento de
una muestra bituminosa. El ensayo se realiza mediante la introducción de 100 g de ligante bituminoso en el matraz de rotación. La
muestra se calienta a 165 °C y el aire a temperatura ambiente es
soplado en el frasco que contiene el mismo ligante endurecido. El
efecto de endurecimiento se evalúa por los ensayos del punto de
penetración, viscosidad y reblandecimiento. El equipo de Evaporación Rotativa está fundamentalmente compuesto por:
matraz de destilación de 1000 ml de capacidad girado por un
motor de velocidad ajustable de 20 a 270 rpm, condensador, frasco
de recuperación de disolventes, baño de aceite caliente.
El ángulo del matraz giratorio/destilación es de 15°.
El instrumento se suministra completo con tubo de vidrio con
válvula de tres vias y manguera flexible transparente para la entrada
de soluciones. El equipo rotatorio requiere una bomba de vacío y
sistema de regulación del vacío (ver accesorios en pág.76).
Alimentación: 230V monofásica 50Hz.
Peso: 27 kg aprox.
B075-05
Determinación de la solubilidad
de los ligantes bituminosos
NORMAS: EN 12592 / ASTM D2042 / IP 47
El conjunto se compone de:
crisol de Gooch completo, con embudo y anillo
de goma Matraz de filtración de 500 ml de
capacidad con tapón de goma. Filtros discos de
fibra de vidrio tipo Whatman, 25 mm de diá.
(paquete de 100). Peso: 1000 g aprox.
B075-01
B075-05
Probeta graduada con dos tubos laterales y
tapón
B075-01
EMULSIONES BITUMINOSAS:
DETERMINACIÓN DE LA TENDENCIA
A LA SEDIMENTACIÓN
NORMAS: EN 12847 / IP 485
El cilindro cuenta con 600 ml de capacidad,
con marca en 500 ml y está provisto de dos
tubos laterales. Peso: 800 g aprox.
Para realizar este ensayo, también es necesario el equipo para la determinación del agua
en emulsiones bituminosas equipo
mod. B075. Ver pág. 112.
B075-08
B090
Valor de rotura de las emulsiones catiónicas.
Método del filler mineral.
NORMAS: EN 13075-1 / IP 494
Equipo para la determinación del valor de la rotura de las emulsiones catiónicas (versión manual) que comprende:
embudo dispensador de filler, completo con base de soporte y
pinza, espátula de níquel, dos capsulas de porcelana.
Peso: 2 kg aprox.
ACCESORIOS PARA LA VERSIÓN AUTOMÁTICA:
B090-10 Agitador eléctrico con 260 rpm., 230V 50Hz, monofásico.
S157-06 Base soporte para agitador.
B090-11 Hélice para agitador.
B090-12 Recipiente metálico, capacidad 500 ml.
B090-20 Filler de referencia, 50 kg (dos bolsas de 25 kg).
B090
B090-10
B075-08
Tubo de vidrio con filtro de
vidrio
EMULSIONES BITUMINOSAS: DETERMINACIÓN DEL PODER
DE PENETRACIÓN. NORMAS: EN 12849 / IP 487
El tubo de vidrio de diámetro interior 41,5 mm por 115 mm de
altura, y equipado con un filtro de vidrio con tamaño de poro entre
0,160 y 0,250 mm. Peso: 300 g aprox.
instrumentos para ensayos de materiales
B065
B090-11
B090-12
BETU NES - AS FALTOS
B080
Viscosímetro de flujo, “Standard TAR”
(BRTA, Redwood)
NORMAS: ASTM D 940, D 1665 / AASHTO T54 / BS 2000
NF T66-020 / CNR N° 102
Se utiliza para comparar la viscosidad específica de aceites y alquitranes utilizados en carreteras, con la viscosidad del agua. Se compone de un baño de agua completo con un termorregulador digital
de precisión, agitador eléctrico, dispositivo de refrigeración, matraz
de Engler. El viscosímetro está equipado de un termostato de doble
seguridad para prevenir sobre calentamientos accidentales.
Alimentación: 230V monofásica, 50Hz 300W
Dimensiones: 265x270x550 mm
Peso: 12 kg
B080+B082-01
NORMAS: EN 12846 / EN 13357 / IP 184
NF T66-005 / BS 2000
B084-01 KIT
Estándar TAR (BRTA, Redwood)
Viscosímetro Digital
Se utiliza para determinar la viscosidad de los destilados del betún
y del petróleo de carreteras. El instrumento consiste en un baño de
acero inoxidable (tanque), agitador, reóstato, calentador eléctrico
de inmersión con termostato digital para mantener el agua a la
temperatura deseada, y serpentín de enfriamiento conectado al
suministro de agua corriente.
El viscosímetro está equipado con un termostato de doble seguridad para prevenir accidentes por sobre calentamientos. Se suministra con termómetro de control de vidrio IP 8C, rango de 0 - 45 °C,
subdivisiones de 0,2 ºC, probeta graduada de 100 ml de capacidad.
Suministrados “sin” el vaso, ni galga pasa-no pasa, ni válvula de bola
que deben pedirse por separado (ver accesorios).
Alimentación: 230V 50/60Hz monofásica 300W
Dimensiones: 265x270x550 mm. Peso: 12 kg
sección B
Viscosímetro Engler digital
B084-02 KIT
“Dos Elementos” TAR estándar
(BRTA, Redwood) Viscosímetro Digital
Estructura básicamente como el mod. B084-01, pero con
“DOS ELEMENTOS”
B081
Viscosímetro digital Engler de “dos elementos”
Básicamente la misma estructura que el mod. B080, pero con “dos
elementos”, de accionamiento eléctrico, suministrado completo.
Peso: 20 kg
ACCESORIOS para Engler:
B082-01 TERMOMETRO ASTM C 23 rango +18 +28 °C
subdivisiones 0,2 °C
B082-02 TERMOMETRO ASTM C 24 rango +39 +54 °C
subdivisiones 0,2 °C
B082-03 TERMOMETRO ASTM C 25 rango +95 +105 °C
subdivisiones 0,2 °C
B082-04 TERMÓMETRO NF T66-020 rango 0-55 °C
subdivisiones 0,2 °C
B082-06 Matraz de calibración de Kohlraush de 200 ml de
capacidad
B082-07 Filtro de malla, ASTM N° 50
RECAMBIO: B082-05 Matraz de ensayo Engler
B083-01 ÷ B083-10
ACCESORIOS para TAR estándar:
Normas: EN, NF, IP
B083-01 Galga pasa-no pasa para orificios de 4 mm diámetro
B083-02 Vaso con orificio de 4 mm de diámetro
B083-03 Válvula de bola de 4 mm diámetro
Normas: EN, NF, IP, BS
B083-04 Galga pasa-no pasa para orificios de 10 mm diámetro
B083-05 Vaso con orificio de 10 mm de diámetro
B083-06 Válvula de bola de 10 mm diámetro
Norma: EN 12846
B083-08 Galga pasa-no pasa para orificios
de 2 mm diámetro
B083-09 Vaso con orificio
de 2 mm de diámetro
B083-10 Válvula de bola
de 2 mm diá.
RECAMBIOS:
B083-07
Termómetro 8C IP, rango
de 0 - 45 °C, subdivisiones 0,2 °C.
V101-03
Probeta de vidrio graduada,
Capacidad 100 ml
B084-01 KIT + accesorios
instrumentos para ensayos de materiales
115
BE TUN E S - A S FA LTO S
B086 KIT
sección B
Cleveland de vaso abierto para punto de
inflamación y combustión
116
NORMAS: EN 22592 / ASTM D92 / AASHTO T48
IP 36/67 / UNE 7075 / NF T60-118 / ISO 2592
Se utiliza para determinar los puntos de inflamación y combustión
de aceites lubricantes y productos derivados del petróleo.
Completo con vaso de latón, termómetro IP 28C (11C ASTM)
rango -6 a +400 °C, calentador eléctrico con termorregulador,
doble línea de fusibles. Suministrado “sin” dispositivo de llama de
gas que debe pedirse por separado.
Alimentación: 230V 50/60Hz monofásica 600W. Peso: 10 kg
B086-02
ACCESORIO “NECESARIO”:
B086-02
DISPOSITIVO DE LLAMA DE GAS, con válvula de cierre del gas,
controlada por un sensor de llama y un termostato de máxima, con
botón de reinicio. Se puede vender en los mercados de la CE, pero
no puede utilizarse en espacios cerrados.
RECAMBIO:
B086-10 Termómetro IP 28C (11C ASTM), rango de -6 a +400 °C.
B087
Viscosímetro digital Saybolt
Se utiliza para determinar la viscosidad de los productos derivados
del petróleo a determinadas temperaturas comprendidas entre 20
y 100 ºC (70 a 210°F). Fabricado en acero inoxidable, el Viscosímetro Saybolt se suministra completo con dos boquillas intercambiables “Furol” y “Universal”, baño de aceite, calentador eléctrico
con termorregulador digital, agitador, serpentín de enfriamiento y
matraz de viscosidad. Termómetros, embudo de filtración, ni el tubo
de retirada “no están incluidos” y debe pedirse por separado.
El viscosímetro está equipado con un sistema de termostato de
doble seguridad para evitar sobre
calentamientos accidentales.
B087-11
Alimentación:
230V monofásica, 50/60Hz 500W
Dimensiones: 270x270x550 mm.
Peso: 12 kg
B087-12
ACCESORIOS:
Termómetros Saybolt
Rango
Subdivisiónes
B089
B089-01
B089-02
B089-03
B089-04
B089-05
+19 a +27°C
+34 a +42°C
+49 a +57°C
+57 a +65°C
+79 a +87°C
+95 a +103°C
0,1°C
0,1°C
0,1°C
0,1°C
0,1°C
0,1°C
ASTM 17C
ASTM 18C
ASTM 19C
ASTM 20C
ASTM 21C
ASTM 22C
B086 KIT
B087-01
Viscosímetro Saybolt de dos elementos
Estructura básicamente como el mod. B087, pero con dos tubos.
Suministrado completo, excepto los termómetros, el embudo de
filtro y el tubo de retirada
B087-11 EMBUDO DE FILTRO con aro de filtro de malla.
B087-12 TUBO DE RETIRADA completo.
RECAMBIOS:
B089-06 Boquilla FUROL
B089-07 Boquilla UNIVERSAL
B089-08 Matraz SAYBOLT de 60 ml de capacidad
instrumentos para ensayos de materiales
B087-01
BETU NES - AS FALTOS
B092 KIT
Equipo de Tag de vaso cerrado. Punto de inflamación
NORMAS: ASTM D56 / API 509
Apropiado para ensayos de inflamación de líquidos volátiles entre -18 y +80 ºC
(0 y 175 ºF) (excepto fuel oils). Suministrado completo con vaso, baño de agua, tapa,
dispositivo deslizante, dispositivo calentador termorregulador, termómetro ASTM 9C de
rango -5 ºC a +110 ºC y termómetro ASTM 57C de rango –20 ºC a +50 ºC.
Alimentación: 230V monofásica 50Hz 600W
Dimensiones: 200x300x400 mm aprox.
Peso: 6 kg
sección B
B092 KIT
B093 KIT
Equipo de Tag de vaso abierto. Punto de
inflamación
NORMAS: ASTM D1310, D 3143
Para la determinación del punto de inflamación en vaso abierto de materiales inflamables volátiles con puntos de inflamación entre
-18 y +80 ºC (0 y 175 °F).
Se suministra completo con vaso, baño de
agua, dispositivo de calentamiento
con termorregulación, los termómetros ASTM 9C -5 a +110 °C y
ASTM 57C -20 a +50 °C.
Alimentación:
230V monofásica, 50Hz 600W
Dimensiones:
200x300x400 mm aprox.
Peso: 6 kg
RECAMBIOS:
B092-10 Termómetro ASTM 9C
B092-11 Termómetro ASTM 57C
B094-10 Termómetro ASTM 10C
B093 KIT
Hubbard-Carmick picnómetros peso
específico
NORMAS: EN ISO 3838 / ASTM D70 / NF T66-007
V111
Tipo cilíndrico, 24 ml
V111-01 Tipo cónico, 25 ml
V111-01
B091
Tanque de envejecimiento
a presión (PAV)
B094 KIT
Pensky-Martens equipo digital. Punto de
inflamación
NORMAS: EN 22719 / ASTM D93 / AASHTO T73 / IP 34, 35
Se utiliza para la determinación del punto de inflamación de
productos derivados del petróleo por el método del vaso cerrado,
con un punto de inflamación entre 40 °C y 360 °C. Se suministra
completo con un agitador, pantalla de protección, baño de hierro
fundido, calentador eléctrico con dos termómetros termorreguladores digitales ASTM 9C -5 a +110 °C div. 0,5 C, y ASTM 10C
+90 a +370 °C div.2 °C. El equipo dispone de un alimentador de
llama de gas.
Alimentación:
230V monofásica, 50Hz 600W
Peso: 6 kg
V111
NORMAS: UNI EN 14769 / ASTM PS36 / AASHTO PP-1 / SHRP
La unidad ha sido desarrollada para simular el envejecimiento de las
mezclas de betunes al cabo de 5 a 10 años. La muestra se expone
a altas presiones y temperaturas durante 20 horas, para simular el
efecto del envejecimiento oxidativo en el tiempo, mediante la verificación de las características frente al ensayo de penetración y el
punto de reblandecimiento anillo y bola. El recipiente del envejecimiento a presión se suministra completo con accesorios, software,
puerto RS232 con cable para conexión al PC. Para realizar el
ensayo se precisa una fuente de aire comprimido.
Alimentación: 230V 50Hz 550W monofásica
Dimensiones:
660x450x410 mm
Peso: 76 kg aprox.
B091
B094 KIT
instrumentos para ensayos de materiales
117
sección B
BE TUN E S - A S FA LTO S
118
Equipo para ensayos Duriez
B099-10
NORMAS: NF P98 - 251 1/4
Se utiliza para determinar las propiedades mecánicas y físicas de las
mezclas bituminosas.
Equipo de ensayos Duriez para probetas de 120 mm de diámetro:
Molde de ensayo
B095-0
B095-02 Pistón de penetración
B095-03* Pistón de penetración ranurado
B095-04 Pistón superior/inferior
B095-05* Pistón superior/inferior ranurado
B095-06 Dos soportes temporales
B095-07 Cilindro de desmoldeo
Equipo del círculo de arena o mancha de
arena
Equipo Duriez para probetas de 80 mm de diámetro:
B096-01 Molde de ensayo
B096-02 Pistón de penetración
B096-03* Pistón de penetración ranurado
B096-04 Pistón superior/inferior
B096-05* Pistón superior/inferior ranurado
B096-06 Dos soportes temporales
B096-07 Cilindro de desmoldeo
* Utilizado para ensayos en frío en mezclas de emulsiones bituminosas.
NORMAS: EN 13036-1 / ASTM E965 / CNR N. 94 / NF P98 216-1
Características de las carreteras y de las superficies de pistas de
aterrizaje. Medición de la superficie del pavimento para determinar
la profundidad promedio de la macrotextura utilizando la técnica
volumétrica del círculo o mancha de arena.
El equipo consta de:
disco esparcidor con mango y superficie recubierta de goma; pantalla para vientos, cepillo suave y de alambres; compás ajustable con
rosca de 300 mm graduado sobre regla; cilindro metálico para la
medición de volumen de las esferas; dos picnómetros de vidrio con
tapa de rosca metálica y orificio de vertido; tres cilindros graduados
de 10,25 y 50 ml de capacidad; protector de rodillas y funda de
transporte. Peso: 4 kg aprox.
B099-10
ACCESORIOS:
B099-15 MICROESFERAS DE VIDRIO, de 250/180 micras de
diámetro según norma EN 13036-1
B099-16 ARENA NATURAL DE 300/150 micras, saco de 25 kg
ASTM D965
B099-17 ARENA NATURAL DE 150/75 micras, saco de 25 kg
ASTM D965
B095-01 ÷ B095-07
S206
MULTI-ENSAYOS 200kN
PRENSA UNIVERSAL ELECTROMECANICA PARA COMPRESIÓN DE PROBETAS DURIEZ DE 80 mm y 120 mm DE
DIAMETRO CON SISTEMA DE CARGA SERVOCONTROLADO
O DESPLAZAMIENTO / DEFORMACIÓN
La máquina también es adecuada para los ensayos sobre:
- Mezclas bituminosas (Marshall, corte Leutner, tracción indirecta)
- Hormigón (flexión en vigas y tejas de barro, tracción indirecta en
cilindros, cubos y adoquinados, perforación)
- Cemento y mortero (compresión y flexión)
- Suelo (CBR)
- Barras de acero (tracción)
Detalles técnicos: ver pág. 390.
S206
instrumentos para ensayos de materiales
BETU NES - AS FALTOS
B111
Densímetro “No nuclear” electromagnético, con sensor de temperatura por infrarrojos
El medidor de densidad electromagnética es un dispositivo de detección no nuclear, que permite medir la densidad del aglomerado en la
propia obra, en tiempo real. Este instrumento de tecnología avanzada permite el control de calidad a los operadores, identificando de forma
inmediata los puntos del pavimento con una densidad baja, ejecutando las pertinentes
acciones correctivas que conduzcan a una uniformidad en los pavimentos.
sección B
Las mediciones de la densidad, están relacionadas con la propiedad
dieléctrica del asfalto en los primeros 40 mm de profundidad. Este
instrumento permite la lectura continua a lo largo del pavimento
para detectar burbujas de aire o falta de uniformidad. El mango
en forma de L está destinado a reducir el esfuerzo de agacharse
cuando se realizan muchas medidas. Los ensayos se pueden ejecutar también a altas temperaturas, cuando el pavimento está todavía
caliente (máx. 175 °C).
El densímetro electromagnético permite:
- Los ensayos del pavimento.
- Mediciones en tiempo real, en un modo continuo.
- LCD de visualización de:
• Densidad media.
• % Densidad máxima.
• % Huecos.
119
- No son necesarias correcciones de humedad o de temperatura.
- Dispositivo no nuclear, de máxima seguridad para el operador
- Placa de prueba de referencia para comprobar la estabilidad del
equipo rápidamente.
- Almacenamiento de hasta 999 registros de datos de medición y
puerto RS-232.
- El sensor de infrarrojos para una medición precisa de la superficie de la carretera (opcional).
- Baterías recargables para un uso continuado de 32h.
- Cargador estándar de 230V/50Hz o 12Vcc.
Dimensiones: 229x406x152 mm
Peso: 5 kg
Modo de ensayo
Mediciones continuas
Promedio de la medición de múltiples datos
Modo segregación
B111
Software
avanzado
Almacenamiento
en memoria
Interfaz PC
Tiempo
de recarga
Teclado
y LCD
sí
sí
sí
sí
sí
sí
sí
sí
sí
2-3 horas
Multifunción
30 teclas
4 líneas LCD
B111
B111
B111
instrumentos para ensayos de materiales
sección B
BE TUN E S - A S FA LTO S
120
B098
B099 KIT
Dispositivo de viga móvil
MOT borde recto
Se utiliza para detectar y corregir cualquier irregularidad en las superficies de carreteras, tanto en mezclas bituminosas como en hormigón. La unidad consta esencialmente de una viga fija de 3 metros
de largo con dos ruedas rígidas en las extremidades. En el medio
de la viga hay una unidad sensor que incluye una rueda conectada
a un indicador, ofreciendo una ampliación de 4:1 y midiendo las
desviaciones de la superficie. Las desviaciones se muestran en una
escala calibrada en incrementos de 2 mm hasta 10 mm y de 5 mm
hasta 25 mm. La viga se suministra en tres piezas que son rápidamente ensamblados en el lugar. Peso: 55 kg aprox.
MEDICIÓN DE LA REGULARIDAD DE LA SUPERFICIE DEL
PAVIMENTO
NORMA: EN 13036-7
Que consiste en:
B099N
B098-01 KIT
Dispositivo de viga móvil con unidad de
registro gráfico
Mismo mod. B098, pero que comprende una registradora gráfica,
proporcionando un registro permanente del perfil de la superficie.
Registra hasta 1000 metros de superficie en rollos de papel especial
de gráfico. Se suministra completo con 10 rollos gráficos y dos
plumas con punta de fibra. Peso: 60 kg aprox.
RECAMBIOS:
B098-11 Paquete de 10 rollos
de la tabla para
aprox. 1000 metros
carrera.
B098-12 Plumilla con punta de
fibra para su uso con
la grabadora.
B098-01 KIT
MOT borde recto
Fabricado en aleación de aluminio anodizado, se utiliza para medir
las irregularidades del pavimento en carreteras, suelos, pavimentos
de hormigón. La longitud es 3000 mm, 26 mm de ancho, regulable
en altura de 0 a 30 mm.
Se suministra sin cuñas graduadas.
Peso: 9 kg aprox.
B099-01N
CUÑAS GRADUADAS, de aleación de aluminio anodizado
(juego de dos).
B100
Viga Benkelman
NORMA: CNR N° 141
Fabricada en aleación de aluminio, completa con comparadores
y diversos accesorios. Se utiliza para medir la deflexión de la
superficie de una carretera, provocada por el paso de las ruedas de
los vehículos. La viga se pone entre los neumáticos del vehículo y
en contacto con el pavimento a ensayar.
La medida de la deformación se realiza
cuando el vehículo pasa sobre el área de
ensayo. La longitud de la viga Benkelman
es de 250 cm. La relación de medidas
entre los extremos y el punto de apoyo
es de 4:1. Se suministra completa con
una caja portátil de madera. Peso: 16 kg
B102
Viga Benkelman
B099 KIT
B099-01N
B100-02
ACCESORIO:
B100-02
Dispositivo de calibración de la Viga Benkelman, completa para los
mod. B100 y B102.
instrumentos para ensayos de materiales
NORMA: NF P98-200-2 / AASHTO T256-77
Básicamente similar al mod. B100, pero realizada según Normas
Francesas. Relación de medida 2:1. Se suministra completa con caja
de transporte de madera.
Peso: 16 kg
B100
B102
BETU NES - AS FALTOS
B103-10
NORMA: NF P94-117-1
La placa está equipada con un dispositivo central para medir la
deformación estática en los pavimentos de las carreteras (Ev2)
con la viga Benkelman, y la capacidad portante de un suelo in-situ.
(Estándar: CNR N. 146, método A) La placa también posee tres
orificios laterales atornillados por tres puntos para realizar las medidas de la capacidad portante de un suelo in-situ (Normas: CNR N.
146 método B / BS 1377:9 / CNR N. 92 ASTM D1195, D1196).
Se suministra completo con dispositivo de acoplamiento para el
gato hidráulico.
Peso: 25 kg
B103-10
EJEMPLOS DE USO DE LA PLACA DE CARGA DE ALUMINIO:
B103-05KIT
sección B
Placa de carga de 600 mm de diámetro de
fundición de aluminio con nervaduras de
refuerzo
Equipamiento de la placa de carga,
capacidad 200 kN
B103-05KIT
B100
ACCESORIOS:
B100
Equipo de viga Benkelman de acuerdo con
las Normas: CNR N. 141 / AASHTO T256-77
B102
Equipo de viga Benkelman de acuerdo con las Normas:
NF P98-200-2 / LCPC
NORMA: NF P94-117-1
Sirve para determinar la deformación estática del pavimento flexible (Ev2) en el centro de la placa de carga. Se utiliza con el equipo
Benkelman mod. Beam. B100 y B102.
El equipo consta de:
B103-10 Placa de carga de 600 mm de diámetro de fundición
de aluminio, con costillas de refuerzo y dispositivo de
acoplamiento.
S225-01 Pistón hidráulico de 200 kN de capacidad, con bomba
de mano, tubo de goma con conectores rápidos, un
conjunto de varillas de extensión de diferentes longitudes y bolsa de transporte.
S225-02 Manómetro de precisión de 0 a 200 kN, div.1 kN
S226-13 Rótula superior.
Peso total: 70 kg aprox.
Nota: cada elemento puede pedirse por separado.
Ejemplos de uso de la placa de carga de aluminio de 600 mm de
diámetro para ensayos de placa en un suelo in-situ con el equipo
de placa de 200 kN mod. S225 KIT (ver pág. 393 del catálogo).
B100
B102
S225KIT + B103-10
instrumentos para ensayos de materiales
121
122
instrumentos para ensayos de materiales
sección C
HORMIGÓN
Sección C
HO RMIGÓN
El correcto y cuidadoso control del hormigón fresco y endurecido,
son factores esenciales para la realización de cualquier tipo de
edificación.
La calidad final del hormigón utilizado en las estructuras, depende
de muchas variables como: trabajabilidad, consistencia, control del
tiempo de curado, densidad aparente, contenido de aire, resistencia a la compresión, la temperatura, las variaciones lineales, etc.
Matest propone una gama completa de máquinas de ensayo y
de investigación en el hormigón para satisfacer prácticamente
todas las variables de calidad antedichas, en conformidad con las
Normas EN, ASTM y las Normas internacionales más conocidas.
En la segunda parte de esta sección se detallan una completa
gama de instrumentos disponibles para ensayos no destructivos,
para investigación y evaluación del progresivo envejecimiento y durabilidad de las estructuras de hormigón sometidas a los ataques
químicos, la contaminación del aire, el tiempo.
instrumentos para ensayos de materiales
123
HO RM I G ÓN
MÁQUINAS DE ENSAYO A COMPRESIÓN Y FLEXIÓN
En la sección de Hormigón estamos en condiciones de proporcionar la más amplia y completa gama de la actualidad de máquinas de
ensayo de compresión y flexión disponibles en el mercado mundial, por lo que Matest es el fabricante líder de máquinas de ensayo.
La versatilidad y flexibilidad de la producción de máquinas de ensayos de Matest permiten al usuario final seleccionar y combinar los grupos
de compresión / flexión con el fin de satisfacer y personalizar cualquier requisito específico.
sección C
En las páginas siguientes se describen:
1) Características generales de las prensas de compresión con
diferentes sistemas de control y medición (pág. 125, 126)
2) Máquinas de ensayos a compresión, prensa de cuatro columnas
pretensadas, conforme a las Normas:
ASTM C39 / BS 1610 / 6686 UNI parte 1,2 / AASHTO T22
NF P18-411 / UNE 83304
(pág. 139 ÷ 169)
3) Máquinas de ensayos a compresión, con cuatro columnas
“ensayada para dar una gran estabilidad a la prensa”, conforme
a las Normas:
EN 12390-4 y BS 1881 / DIN 51220 / UNI 6686 parte 3, y la
determinación de la compresión secante automática “módulo
de elasticidad” en hormigón con control del gradiente de carga
incluso cuando se libera esta, conforme a las Normas:
ASTM C469, ISO 6784, UNI 6556, DIN 1048 (pág. 170 ÷ 191)
4) Máquinas de ensayos a flexión, conforme a las Normas:
EN 12390-5 / EN 1340:4 / ASTM C78, C293 / UNI 6133
BS 1881:118 / NF P18-407 / UNE 83305 / AASHTO T97
(pág. 194 ÷ 206)
5) Grupos combinados de compresión, flexión, tracción indirecta, cerámicos; prensas de compresión / flexión de cemento
adecuados para personalizar y satisfacer cualquier necesidad
específica (pág. 208, 209).
124
instrumentos para ensayos de materiales
HO RMIGÓN
MÁQUINAS DE ENSAYOS A COMPRESIÓN
ES BIEN CONOCIDO TÉCNICAMENTE, QUE LOS BASTIDORES SOLDADOS DE LAS PRENSAS, PUEDEN TENER VALORES
ESTRUCTURALES IMPREVISIBLES Y PROBLEMAS, MIENTRAS QUE LA CONFIGURACIÓN EN QUATRO COLUMNAS GARANTIZA
UNA UNIFORMIDAD TENSIONAL EN TODOS LOS NIVELES DE CARGA.
MATEST FABRICA “MÁQUINAS DE ENSAYOS A COMPRESIÓN CON BASTIDORES DE CUATRO COLUMNAS”, Y OFRECE DOS
DISEÑOS BASICOS DE PRENSAS:
NORMAS: ASTM C39 / BS 1610 / NF P18-411 / UNE 83304
AASHTO T22 / UNI 6686 parte 1, 2
Modelos descritos en las págs. 139 ÷ 169
• MÁQUINAS CON CUATRO COLUMNAS “ENSAYADAS PARA UN
BASTIDOR DE ALTA ESTABILIDAD” NORMAS: EN 12390-4
BS 1881 / DIN 51220 / UNI 6686 parte 3
Modelos descritos en las págs. 170 ÷ 191
sección C
• MÁQUINAS CON BASTIDOR DE CUATRO COLUMNAS PRETENSADAS
125
DESCRIPCIÓN GENERAL
Prensa muy fuerte y robusta para garantizar una alta rigidez y estabilidad. El puente superior va provisto de rotula rectificada y pulida y
plato de compresión. Los platos de compresión son de superficie endurecida de más de 55 HRC y rectificados. Una característica sobresaliente de estas maquinas es su notable simplicidad tanto constructiva como de funcionamiento, son por tanto resistentes, fáciles de usar y
mantener, y diseñadas para un uso continuo. Están diseñadas conforme a las Normas Internacionales, tales como: EN, ASTM, AASHTO, BS,
NF, DIN, UNI, UNE. Están disponibles con capacidades de 1300 kN, 1500 kN, 2000 kN, 3000 kN, 5000 kN, tanto manuales como motorizadas, con uno o dos indicadores, con el sistema de medición electrónico de visualización digital, y con la consola automática servo controlada
con microprocesador. Las diferentes versiones dan la posibilidad de ensayar cubos, cilindros, bloques. Todas las máquinas pueden equiparse
con dispositivos de seguridad.
Sistema hidráulico
El pistón es de gran diámetro: ello permite que el circuito hidráulico trabaje a baja presión alargando la vida de los componentes y
aumentando la precisión de los resultados. El pistón está rectificado
y pulido, y utilizándose un juego de tres juntas de alta calidad.
Los modelos motorizados presentan un dispositivo analógico para
visualizar, pre-seleccionar y controlar el gradiente de carga aplicada,
permitiendo un ritmo de carga uniforme, tal y como requieren las
Normas. Están provistas de un sistema de aproximación rápido del
pistón para evitar tiempos muertos de acercamiento de la probeta
al plato superior.
El grupo hidráulico es multipistón, asegurando la continuidad del
suministro.
Un indicador de movimiento permite visualizar en cada instante el
recorrido del pistón durante el ensayo de compresión.
Dispone de una cubierta que
impide la entrada de polvo de
la probeta rota al cilindro de la
prensa, evitando dañar las
juntas.
instrumentos para ensayos de materiales
HO RM I G ÓN
SISTEMAS DE MEDICIÓN DE CARGA
(A)
sección C
A) MANÓMETROS
Los manómetros son de tipo tubo Bourdon. Estos están previstos de indicador de carga máx., ajuste a cero y un espejo para
evitar errores de paralaje.
El manómetro de baja presión está totalmente protegido
contra sobrecargas por un dispositivo de control de presión.
B) CYBER-PLUS Evolution, sistema de OCHO canales analógicos,
para la adquisición, visualización y procesamiento de los datos
del ensayo, con el software y la impresión de resultados y de
certificado. Resolución de hasta 500.000 divisiones.
Visualización en PANTALLA TÁCTIL A COLOR, como en un
ordenador.
Detalles técnicos: ver mod. C109N, pág. 130
BB) DIGITEC, sistema de DOS canales analógicos, para la adquisición, visualización y procesamiento de los datos del ensayo
con el software (accesorio) y impresión de resultados y de
certificado.
Detalles técnicos: ver mod.: C108N, pág. 127
126
BB) C108N
B) C109N
C) SERVO-PLUS Evolution, sistema automático servo asistido,
para proporcionar ensayos automáticamente durante todas las
etapas, con el apoyo de la tecnología electrónica de Cyber-Plus
Evolution.
Detalles técnicos: ver mod.: C104N, pág. 130
CC) AUTOTEC, sistema automático servo asistido, proporciona
ensayos completamente automáticos durante todas las
etapas, con el apoyo de la tecnología electrónica Digitec.
Detalles técnicos: ver mod. C098N, pág. 127.
CC) C098N
C) C104N
+ C104-04
Calibración y precisión
Todas las máquinas de ensayo están calibradas con instrumentos
de alta precisión electrónica y garantizada en la clase “1” (error
máximo ≤ de ± 1%). También a partir del 1% en todo el recorrido.
Junto con la máquina se suministra un certificado de calibración.
instrumentos para ensayos de materiales
HO RMIGÓN
Sistema informatizado de dos canales de visualización gráfica para
controlar y gestionar todo tipo de máquinas de ensayo automáticas
(Autotec C098N) y semi-automáticas (Digitec C108N), para la adquisición,
visualización, procesamiento, impresión y almacenamiento de los datos de
ensayo y de certificados, con software de control remoto desde ordenador.
PARA ACTUALIZAR O COMPLETAR SU MÁQUINA DE ENSAYOS DE COMPRESIÓN Y FLEXIÓN PARA HORMIGÓN O MORTERO
(también para otros fabricantes).
El sistema puede manejar y procesar los datos en cumplimiento de
la Norma EN 12390 y diferentes Normas Internacionales, para los
siguientes ensayos:
•
•
•
•
•
•
sección C
C108N DIGITEC
C098N AUTOTEC
Compresión en hormigón
Flexión en hormigón
Tracción Indirecta de cubos y cilindros de hormigón
Compresión y flexión en mortero
C127N Impresora gráfica incorporada
RS232 Conexión con control remoto para el ordenador
127
C127N Impresora gráfica incorporada
Compresión y flexión en Morteros
Compresión en hormigón
C098N
C108N
H009-01
Conexión RS-232 con control
remoto para el ordenador
Flexión en hormigón
Tracción Indirecta en cubos y
cilindros de hormigón
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
Especificaciones Digitec / Autotec:
- 2 canales analógico-digitales conectables a dos prensas distintas
de compresión / flexión.
- Puesta en marcha simple e inmediata de los parámetros y ensayos, menú de ensayos. Su uso no requiere personal especializado.
- Rápido acercamiento, contacto y rotura de la muestra bajo el
control directo de la bomba (Autotec C098N)
- Control automático de la velocidad (Autotec C098N)
- Visualización continua de carga.
- Detección de la carga de ruptura
- Elaboración automática del valor de la resistencia específica.
- Almacenamiento de archivos de hasta 1000 ensayos y archivos de
100 distintos tipos de muestras.
- Pantalla gráfica de alta resolución: píxeles 192x64.
- Selección de las unidades de fuerza: kN, lb
- Idiomas: Inglés, Francés, Alemán, Español, Italiano, Polaco, Checo,
Turco.
- Clase: 0,5% a partir del 10% del valor máximo, bajo pedido del
1% del valor máximo.
Configuración de prueba
Ejecución de la prueba con el índice del controlador
128
Estructura técnica
- Sistema de adquisición y procesamiento de datos de 24 bits, resolución efectiva: 17 bits
- Interfaz del operador compuesta por 5 botones multi-función, los iconos de función aparecen en la pantalla.
- Ambos canales analógico-digitales aceptan sensores, transductores o celdas de carga de 2 mV / V
- Algoritmo automático guiado linealmente asegurando una elevada precisión (clase 0,5)
- Distintos dispositivos de seguridad programables para el equipo o la muestra así como la posibilidad de introducir un porcentaje del valor
máximo alcanzado durante la ejecución del ensayo, motor con protección térmica y configuración de diferentes alarmas.
- El firmware contiene en memoria las muestras más utilizadas: área, peso, peso específico.
- Posibilidad de personalizar las muestras con tamaños especiales.
- Interface RS232: Este permite la transferencia de datos o resultados del ensayo directamente al ordenador (a través de Microsoft Hyperterminal) o con el control remoto del sistema mediante el software UTM2 (accesorio)
Menú
La pantalla muestra fecha y hora de carga, carga
aplicada instantánea y carga individual, último
ensayo efectuado, índice de control, comandos
de función rápida, configuración en uso, canales
analógicos y activación de la alarma.
Ajuste de la alarma de carga máxima
Canal de configuración / calibración
instrumentos para ensayos de materiales
Funciones de los iconos (selección del ensayo, archivos, visualización de
alarmas)
HO RMIGÓN
MODELOS:
C108N
ACCESORIOS:
C127N Impresora gráfica de papel térmico
C127N
Digitec
C098N
Software
Para la ejecución remota del ensayo y la transferencia
automática y presentación de los resultados en un
ordenador
C108N
Autotec
C109-10 Software para el ensayo de COMPRESIÓN del hormigón
Sistema de 2 canales servo asistidos para una ejecución completamente automática del ensayo.
El sistema consta de:
- Digitec C108N unidad de
datos adquiridos
- Bomba eléctrica multipistón con caudal variable
(ver C114 mod.) impulsada
por un microprocesador
(sistema fiable y silencioso,
para un uso intensivo y
C098N
prolongado)
Alimentación:
230V monofásica 50Hz
Dimensiones:
420x290x950mm
Peso: 60 kg
C109-11 Software para el ensayo de FLEXIÓN del hormigón
C109-12 Software para el ensayo de TRACCIÓN INDIRECTA en
muestras de hormigón
E163
Software para el ensayo de COMPRESIÓN en morteros
E164
Software para el ensayo de FLEXIÓN en morteros
C123
Software “Servonet” para todos los ensayos mencionados anteriormente. Adecuado para ser utilizado
exclusivamente con el sistema Autotec.
sección C
C127-11 Repuesto de rollos de papel térmico para
la impresora
2 canales de la unidad para la adquisición
y elaboración de datos, como se describe.
Alimentación: 230V 50/60Hz monofásica
Dimensiones: 230x145x240mm
Peso: 4 kg
H009-01
ORDENADOR PERSONAL
Completo con pantalla LCD de 17 “, teclado, ratón, cables de
conexión. El suministro del ordenador incluye la instalación del
software adquirido.
H009-01
TRANSDUCTOR DE PRESIÓN
Utilizado con Digitec y Autotec, suministrado junto con el cable de conexión
adecuado y certificado de calibración.
Modelos disponibles: ver pág. 216
C098-01N
C098-01N
Autotec de “dos prensas”
Sistema de 2 canales servo asistidos,
válvula hidráulica de tres vías para la
opción de conectar y utilizar dos prensas
de ensayos.
C116N
C098-01N
instrumentos para ensayos de materiales
129
HO RM I G ÓN
N
O
I
T
U
L
EVO
sección C
C109N CYBER-PLUS
C104N SERVO-PLUS
Evolución electrónica con 8 entradas analógicas para ensayos de
compresión y flexión en equipos de hormigón y mortero.
Diseñado con la última tecnología, un innovador sistema semejante al PC con pantalla táctil, empleado para controlar y gestionar todo tipo
de máquinas de ensayo automáticas (Servo-Plus Evolution C104N) y semiautomáticas (Cyber-Plus Evolution C109N).
Para actualizar o completar su máquina de ensayos de compresión y flexión en hormigón y mortero (también para otras marcas que no
sean Matest).
El sistema puede gestionar y procesar los siguientes ensayos:
Compresión y flexión en morteros
Compresión en hormigón
130
C127N Impresora gráfica
incorporada
Tracción en el acero
Flexión en hormigón
C109N
Tracción indirecta en
bloques y cilindros de
hormigón
C104N
(C104-04)
instrumentos para ensayos de materiales
Conexión a
Internet para
asistencia a distancia
online.
C128 USB impresora láser
para los gráficos y los
certificados
H009-01
Conexión al
ordenador. Control
remoto desde
ordenador.
HO RMIGÓN
Interruptor de seguridad
Impresora gráfica
incorporada
8 entradas analógicas
para conectar hasta 8
células de carga y transductores
sección C
Características principales:
La unidad de control de Cyber / Servo-Plus Evolution funciona como un ordenador estándar basado en el sistema operativo Windows.
El interfaz de iconos gráficos en la pantalla táctil permite una fácil configuración de los parámetros y una ejecución inmediata del ensayo.
Pantalla de alta resolución a color ¼ VGA, ofrece todas las funciones de un ordenador para gestionar y analizar los datos, los resultados de
los ensayos y los gráficos.
2 puertos USB
131
Ranura para tarjeta SD
(memoria ilimitada)
LA UNIDAD PUEDE FUNCIONAR CON:
La Pantalla táctil parecida a un ordenador normal, ¼ VGA
El Botón de dirección lo suficientemente grande para ser usado
con o sin guantes
La conexión de un teclado o un ratón como en
un ordenador normal
La conexión directa del Cyber/Servo Plus Evolution a Intranet (conexión directa a una red LAN) e Internet permite establecer una
comunicación a distancia y recibir el análisis y el diagnóstico de un problema potencial, con capacidad de ejecutar el ensayo a distancia, y
proporcionar actualizaciones del software. Los técnicos de Matest comprobarán la unidad ubicada en el extranjero, para garantizar una
asistencia rápida y profesional.
Acceso directo a Internet para
conexión de asistencia a distancia
Sistema operativo Windows
parecido a un ordenador
estándar.
Pantalla táctil a color,
¼VGA
...continúa...
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
Pantalla táctil con teclado virtual
alfanumérico (qwerty), fácil de
utilizar
Opciones internacionales e ilimitadas de selección del idioma
Panel direccional tradicional con 5 teclas
para un uso estándar o con guantes
Ensayo de Compresión.Visualización
en tiempo real del gráfico de
carga / tiempo
Fácil y sencilla selección de los
ensayos (compresión)
132
Selección de ejemplos,
Módulo de Elasticidad
Memoria de aalmacenamiento ilimitado
con: 2 puertos
puerto USB* para ordenador, 1
ranura para tarjetas SD*
(* memorias no incluidas)
Control del gradiente automático
para evitar el desmoronamiento de
la muestra conforme a la Norma
ASTM C39.
Impresora gráfica
incorporada
Impresora láser para gráficos y certificados con
conexión directa a través de USB
instrumentos para ensayos de materiales
HO RMIGÓN
Configuración funcional del canal simple y fácil
de usar. 8 entradas analógicas para conectar
hasta 8 células de carga o transductores
Infinito número de
combinaciones de
ensayos y
calibraciones perfil
Salida serie RS232. Conexión
directa a Internet. Conexión
a Ethernet de 100 Mbits, para
conectar la unidad a la red
sección
ió C
Menú de calibración
del canal de carga.
Fácil configuración
del canal de
calibración
Menú de configuración de un canal
de carga. Rápida configuración
del canal
133
Procesador de 312 MHz ampliable a 806 MHz de 32 bits
Hardware de alto rendimiento y
elevada tecnología
Funciones principales
- Interfaz muy intuitivo que simplifica el uso de la máquina (el
ensayo se inicia después una sencilla introducción de datos)
- Mayor capacidad de cálculo y visualización de datos (gráficos en
pantalla y impresión de gráficos)
- Alta capacidad de gestión para el marco multilingüe y la configuración internacional (fecha y hora, unidades decimales, unidad de
medida).
- Software elástico que permite la instalación de nuevos ensayos
cuando lo desee.
- Gestión del perfil de la configuración
- Supervisión de la configuración y calibración de los canales analógicos
- Gestión de alarmas
- Configuración de los parámetros de Ethernet
- Configuración de los ajustes internacionales
- Funciones de diagnóstico de hardware
- Funciones para la actualización y licencias del software
- Ejecución de ensayos a través de los parámetros personalizados
- Varios niveles de protección (contraseña) para evitar el acceso a
los menús de configuración por parte del personal no autorizado.
Ciber-Plus Evolution C109N y Servo-Plus Evolution C104N
se suministran completos con licencias para la ejecución de los
siguientes ensayos:
- COMPRESIÓN en hormigón
- FLEXIÓN en hormigón
- ENSAYO DE TRACCIÓN INDIRECTA en cilindros y cubos de
hormigón
- COMPRESIÓN de mortero
- FLEXIÓN en mortero
En conformidad a las siguientes Normas: UNI EN, ASTM, BS, NF,
UNE, DIN, etc.
… continúa…
instrumentos para ensayos de materiales
HO RM I G ÓN
MODELOS:
C104N
C109N
Servo-Plus Evolution
Ciber-Plus Evolution
unidad de 8 canales para la adquisición y elaboración de datos.
Alimentación: 230V 1F 50/60Hz 70W
Dimensiones: 245x55x260mm
Peso: 5 kg
sección C
C127N
Unidad de 8 canales servo asistidos para una ejecución totalmente
automatizada del ensayo. La máquina se compone de:
- Sistema de adquisición de datos Cyber- Plus Evolution C109N
- Bomba eléctrica multi-pistón de caudal variable (ver C114 mod.)
controlada mediante microprocesador (sistema fiable y silencioso,
para un uso intensivo y extendido)
Alimentación: 230V monofásica 50Hz 750W
Dimensiones: 420x290x1120mm
Peso: 60 kg
C109N
C127N
134
C127N
C104-01N
Servo-Plus Evolution para
“dos prensas”
Unidad servo asistida suministrada con válvula hidráulica de tres vías con la opción de conectar y usar
DOS PRENSAS DE ENSAYO.
C104-02N
Servo-Plus Evolución para
“tres prensas”
C104N
Unidad servo asistida suministrada con válvula hidráulica de cuatro vías con la opción de conectar y usar
TRES PRENSAS DE ENSAYO.
C127N
C104-01N
C104-04
C104N + C104-04
ACCESORIO:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
La bomba y el sistema digital están encerrados para mejorar el
diseño y el aspecto de la máquina.
instrumentos para ensayos de materiales
HO RMIGÓN
ACCESORIOS:
C127N
Impresora gráfica sobre papel térmico.
C127-11
Rollo de repuesto de papel térmico para la impresora
C109-10N Software para la COMPRESIÓN del hormigón
C109-11N Software para la FLEXIÓN del hormigón
Software
Para la ejecución a distancia del ensayo mediante transferencia
automática y presentación de los resultados en un ordenador.
E163N
Software para COMPRESIÓN de morteros
E164N
Software para FLEXIÓN de morteros
C123N
Software “Servonet” para todos los ensayos mencionados anteriormente. Apto para ser usado sólo con
el sistema Servo-Plus Evolution.
EN EL LABORATORIO DEL
CLIENTE
TELEASISTENCIA EN
LÍNEA DE MATEST
sección C
C109-12N Software para el ENSAYO DE TRACCIÓN INDIRECTA del hormigón
135
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través de la cual el equipo del Servicio de Atención al Cliente de Matest proporcionan
ayuda en tiempo real, para analizar cualquier problema potencial, hallar una solución posible, y efectuar una correcta ejecución del ensayo.
H009-01
ORDENADOR PERSONAL
Completo con pantalla LCD de 17 “, teclado, ratón, cables de
conexión. El suministro del mismo incluye la instalación del software
adquirido.
C128
Impresora láser de sobremesa para gráficos y certificados, con
conexión USB directa.
C128
H009-01
TRANSDUCTOR DE PRESIÓN
Utilizado con Cyber-Plus y Servo-Plus
Evolution control units, suministrado con
el cable de conexión adecuado
y certificado de calibración.
Modelos disponibles: ver pág. 216
C116N
instrumentos para ensayos de materiales
HO RM I G ÓN
C104-10N
SERVO-STRAIN
sección C
SOFTWARE-FIRMWARE para la gestión automática servo asistida de la máquina de ensayo para medir:
- CARGA O FUERZA
- DESPLAZAMIENTO
- ESFUERZO
El software / firmware “servo-strain” “EXCLUSIVO” para utilizarse
con máquinas de ensayo Matest “servo-plus evolution”.
El sistema está conectado a transductores de desplazamiento o
esfuerzo que permiten realizar automáticamente los siguientes
ensayos:
- Flexión en vigas de hormigón reforzado con fibras (ASTM C1018
/ EN 11039-03, 14487-1, 14488-1, 14651-05)
- Ensayo de medida de la flexión del hormigón proyectado con
medición de la energía absorbida (EN 10834, 14488-3, 14488-05)
- Deformación, módulo de elasticidad y ductilidad de materiales de
construcción.
- Ensayos de investigación
gráfico carga-deformación
136
La carga aplicada es controlada automáticamente por el “servo-plus evolution” de la máquina.
El desplazamiento del pistón o el esfuerzo / deformación de la muestra son controlados por el software “servo-strain”, a través de un
transductor lineal de galgas extensiométricas (accesorios), calculando valores tales como la desviación, absorción de energía, módulo de
elasticidad, ductilidad.
Características técnicas:
Consulte “servo-plus evolution” mod. C104N (pág. 130), además de la:
- Visualización en tiempo real de todos los datos del ensayo Gráficamente / Numéricamente (carga, esfuerzo, desplazamiento, absorción
de energía, flexión, ductilidad, módulo de elasticidad, etc.)
- Impresión de los resultados del ensayo y del certificado mediante la impresora incorporada, o con una impresora láser (accesorios)
conectada directamente a la máquina a través del puerto USB.
- Gestión personalizada de los archivos exportables a través de un pendrive.
- Posibilidad de conectar hasta 3 prensas de ensayo
- Ocho canales analógicos para conectar las células de carga o transductores de presión o transductores lineales de desplazamiento/deformación y con la tecnología de las galgas extensiométricas.
Informe del ensayo
instrumentos para ensayos de materiales
HO RMIGÓN
PRINCIPALES APLICACIONES DEL SERVO-STRAIN:
Esfuerzo, módulo de elasticidad, ductilidad, comportamiento después de la ruptura
sección C
Los ensayos de compresión en probetas de hormigón, hormigón reforzado con fibras (FRC), hormigón armado, hormigón con fibras revestidas de polímeros (FRP), materiales de construcción, y para ensayos experimentales y de investigación con el fin de evaluar el comportamiento de una muestra sometida a esfuerzos de compresión.
Se utiliza una máquina de compresión de elevada estabilidad de con el uso de “Servo-Plus Evolution” y además:
S336-14
TRANSDUCTOR DE DESPLAZAMIENTO LINEAL, tecnología de
la galga extensiométrica, 50 mm de recorrido.
Otros modelos de transductores de desplazamiento lineal que
figuran en la pág. 417
C104-31
SOPORTE para el transductor de desplazamiento.
137
S336-14 + C104-31
C089-10N + C104-10N
Medida de la deformación en vigas de hormigón reforzadas con fibras
100x100x400 (500) mm y 150x150x500 (600) mm
Normas: EN 11039-03, 14487-1, 14488-1, 14651-05 / ASTM C1018
Se utiliza con el bastidor de la máquina de flexión con Servo-Plus Evolution
(a elegir entre los modelos C090-07N, C091-03N) y la incorporación de los
equipos específicos necesarios para realizar el ensayo, que se describe y se
ilustra en detalle en pág. 202
C090-15 fijado en la máquina de flexión C090-07N
Ensayo de flexión del hormigón proyectado con
mediciones de la absorción de energía.
C090-14 + S336-14
Fijado en la máquina de flexión C090-07N
Normas: EN 10834, 14488-3, 14488-05. Se utiliza el bastidor de la máquina
de flexión con el modelo Servotronic C090-07N, con la incorporación de los
equipos específicos necesarios para realizar el ensayo, que se describe e ilustra en
detalle en pág. 203
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
138
instrumentos para ensayos de materiales
HO RMIGÓN
MÁQUINAS DE ENSAYOS A COMPRESIÓN, BASTIDOR DE CUATRO COLUMNAS
PRETENSADAS PARA LOS ENSAYOS DE PRODUCCIÓN HABITUALES.
(Los modelos descritos en la págs. 140 ÷ 169)
NORMAS: UNI 6686 parte 1 y 2 / ASTM C39 / BS 1610 / NF P18-411 / UNE 83304 / AASHTO T22
Características técnicas:
cados.
• Dispositivos para visualizar el recorrido del pistón durante el
ensayo.
• Las columnas son pretensadas proporcionando una elevada
rigidez.
• El pistón con 50 mm de recorrido y el cilindro están provistos
de un protector de alta calidad.
• El depósito va provisto de nivel de aceite y tapón de descarga
de aceite.
• Dispositivo de selección rápida para visualizar, preseleccionar y
controlar del flujo de aceite.
• La bomba de alimentación es multipistón para asegurar una
continuidad en la carga.
• Rápida aproximación de pistón para evitar tiempos muertos.
• La rótula está rectificada y pulida.
sección C
• Platos de compresión endurecidos a más de 55 HRC y rectifi-
Disponible en las siguientes capacidades: 1300 kN / 1500 kN / 2000 kN / 2000 kN BLOQUES / 3000 kN / 3000 kN BLOQUES / 5000 kN
Modelos motorizados o manuales.
Sistema de medición de carga: Manómetro tipo
Bourdon, unidades en pantalla gráfica “DIGITEC” o
“CYBER-PLUS EVOLUTION”, sistemas automáticos
servo controlados “AUTOTEC” o “SERVO-PLUS
EVOLUTION”.
139
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 1300 kN
Para ensayar probetas cilíndricas de hasta Ø. 160x320 mm y probetas cúbicas de hasta
150 mm de lado
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22 / BS 1610
NF P18-411 / UNE 83304
140
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro
- Manómetros de 250 mm de diámetro con escalas de resistencia específica para probetas cúbicas de 150 mm y cilíndricas de 150 a 160 mm de diámetro
- Graduación de los manómetros: 1300 kN con divisiones cada 4 kN - 600 kN con divisiones
cada 2 kN
- Sistema hidráulico de retorno automático
del aceite al llegar al final de su recorrido
máximo y así evitar la salida del pistón
fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados):
230 V monofásica 50Hz 750W
- Dimensiones: 630x350x1260 mm
- Peso: 540 ÷ 580 kg
C020 + C111 + C126
C022 + C111
C024D + C127N + C121
C025A + C127N +C121
COMPRESIÓN 1300 kN de capacidad
Modelo
Manual
C020
C021
C022
C023
C024 D
C025 A
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176+50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 mm de alto para probetas cilíndricas de
Ø 110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C041-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar probetas cilíndricas de diámetro.
150x300mm y 160x320mm con “topes de refrentado”(ASTM C1231)
C107-10 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de 150 mm y 6 “
C107-12 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas
de Ø 150 mm dureza Shore A 60
C107-10
C107-21 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas
de Ø 150 mm dureza Shore A 70
C107-25 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas
de Ø 160 mm dureza Shore A 60
C107-26 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 70
Nota: Los topes de refrentado sólo se puede
utilizar en la cámara de ensayo con altura libre
de 376 mm, mod. C041-11.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada
al motor de bombeo de la máquina para activar una
segunda prensa. Detalles técnicos: ver pág. 215
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”, sólo para las máquinas digitales.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”, sólo para las máquinas digitales.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas.
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 1300 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de
Tracción Indirecta en máquinas
digitales. Detalles técnicos.
Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407
UNI 6133
C106
Detalles técnicos: ver pág. 212
C109-11
SOFTWARE para ensayos de
flexión en probetas prismáticas de hormigón
con máquinas digitales.
Detalles técnicos: ver pág. 14
E170
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación para
prensas. Ver pág. 214
C097-01
C109-10 Software de compresión
instrumentos para ensayos de materiales
141
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 1300
Para ensayar probetas cilíndricas de hasta Ø 160x320 mm y probetas
cúbicas hasta 150 mm de lado
kN
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22 / BS 1610 / NF P18-411 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro.
- Sistema hidráulico de retorno automático del aceite
al llegar al final de su recorrido máximo y así evitar la
salida del pistón fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 630x350x1260 mm
- Peso: 540 ÷ 580 kg
142
C025N + C127N + C121 + C121-51 + C111 + C126
C024N + C127N + C121
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el
servicio de Atención al Cliente Matest ofrece soporte en tiempo
real para analizar el problema, para encontrar una solución posible,
y efectuar la ejecución del ensayo.
COMPRESIÓN 1300 kN de capacidad
Modelo
Motorizado
C024 N
C025 N
•
•
instrumentos para ensayos de materiales
C025N + C104-04 + C127N + C111-01
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176 + 50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 de alto para probetas cilíndricas de Ø
110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C119 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C041-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar probetas cilíndricas de diámetro.
150x300mm y 160x320mm con “topes de refrentado”(ASTM C1231)
C107-10 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de 150 mm y 6 “
C107-12 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-10
C107-21 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 70
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 60
C107-26 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 70
Nota: Los topes de refrentado sólo se puede utilizar
en la cámara de ensayo con altura libre de 376 mm,
mod. C041-11. Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 1300 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6. Detalles técnicos: ver pág. 211.
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C106
C109-11N
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
E170
C126
BANCADA de sustentación para
prensas. Ver pág. 214
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C097-01
C109-10N Software de compresión
instrumentos para ensayos de materiales
143
HO RM I G ÓN
sección C
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 1500 kN
Para ensayar probetas cúbicas de hasta 150 mm de lado y probetas cilíndricas de hasta
Ø 160x320 mm. NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22 / BS 1610 / NF P18-411 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro.
- Manómetros de 250 mm de diámetro con escalas de resistencia específica de probetas cúbicas de 150 mm y probetas cilíndricas 150 y 160
mm de diámetro
- Graduación de manómetros: 1500 kN con divisiones de 5 kN - 600 kN
con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados): 230V monofásica 50Hz 750W
- Dimensiones: 630x350x1260 mm
- Peso: 540 ÷ 580 kg
144
C041A + C127N + C121
C040D + C127N + C121
C038 + C126 + C111
COMPRESIÓN 1500 kN de capacidad
Modelo
Manual
C036
C037
C038
C039
C040 D
C041 A
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176+50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 de alto para probetas cilíndricas de Ø
110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C041-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar probetas cilíndricas de diámetro
150x300mm y 160x320mm con “topes de refrentado”(ASTM C1231)
C107-10 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de 150 mm y 6 “
C107-12 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO
C107-10
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-21 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas
de Ø 150 mm dureza Shore A 70
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 60
C107-26 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza
Shore A 70
Nota: Los topes de refrentado sólo se puede utilizar
en la cámara de ensayo con altura libre de 376 mm,
mod. C041-11. Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada
al motor de bombeo de la máquina para activar
una segunda prensa. Detalles técnicos: ver pág. 215.
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”, sólo para las máquinas digitales.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”, sólo para las máquinas digitales.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 1500 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de
Tracción Indirecta en máquinas
digitales. Detalles técnicos.
Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS1881:118 / NF P18-407
UNI 6133.
C106
Detalles técnicos: ver pág. 212
C109-11
SOFTWARE para ensayos de
flexión en probetas prismáticas de
hormigón con máquinas digitales.
Detalles técnicos: ver pág. 14
E170
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349
Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación
para prensas. Ver pág. 214
C097-01
C109-10 Software de compresión
instrumentos para ensayos de materiales
145
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 1500
Para ensayar probetas cúbicas de hasta 150 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
kN
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: UNI 6686, parte 1 e 2 / ASTM C39 / AASHTO T22 / BS 1610 / NF P18-411 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro.
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 630x350x1260 mm
- Peso: 540 ÷ 580 kg
146
C041
C041N
1 + C127N + C121
C041N + C104-04 + C1
C127
C127N
27N
27
N + C1
C111
11
C040N + C127N + C111-01
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el
servicio de Atención al Cliente Matest ofrece soporte en tiempo
real para analizar el problema, para encontrar una solución posible,
y efectuar la ejecución del ensayo.
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
COMPRESIÓN 1500 kN de capacidad
Modelo
Motorizado
C040 N
C041 N
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176+50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 de alto para probetas cilíndricas de Ø
110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún
suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C119 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C041-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar probetas cilíndricas de diámetro.
150x300mm y 160x320mm con “topes de refrentado”(ASTM C1231)
C107-10 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de 150 mm y 6 “
C107-12 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
C107-10
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-21 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 70
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 60
C107-26 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza
Shore A 70
Nota: Los topes de refrentado sólo se puede utilizar
en la cámara de ensayo con altura libre de 376 mm,
mod. C041-11. Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada
al motor de bombeo de la máquina para activar una
segunda prensa. Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 1500 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO
DE FLEXIÓN para probetas
prismáticas de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos de
flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
E170
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación
para prensas. Ver pág. 214
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
C097-01
C109-10N Software de compresión
instrumentos para ensayos de materiales
147
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
Para ensayar probetas cúbicas de hasta 150 mm de lado y probetas cilíndricas de
hasta Ø 160x320 mm
sección C
NORME: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22
NF P 18-411 / BS 1610 / UNE 83304
148
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro.
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 2000 kN con divisiones
de 5 kN - 600 kN con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al final
de su recorrido máximo y así evitar la salida del pistón fuera del
cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados): 230V monofásica 50Hz 750W
- Dimensiones: 690x400x1320 mm
- Peso: 650 ÷ 700 kg
C055D + C127N + C111
C056A + C127N - C111
C053 + C119-03
COMPRESIÓN 2000 kN de capacidad
Modelo
Manual
C051
C052
C053
C054
C055 D
C056 A
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176+50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 mm de alto para probetas cilíndricas de
Ø 110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”, sólo para las máquinas digitales.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”, sólo para las máquinas digitales.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C112-10 CONJUNTO DE PLATOS GRANDES DE COMPRESIÓN
SUPERIOR + INFERIOR 245x510x55 mm CON ROTULA para
realizar “además” ensayos con bloques y probetas cúbicas de
200 mm de lado
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119-03 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-05 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C056-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar probetas cilíndricas de diámetro
150x300mm y 160x320mm con “topes de refrentado”(ASTM C1231)
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6 “
C107-10
C107-12 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza Shore A 60
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 60
Nota: Los topes de refrentado sólo se puede utilizar en la cámara de
ensayo con altura libre de 376 mm, mod. C056-11.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada
al motor de bombeo de la máquina para activar
una segunda prensa. Detalles técnicos: ver pág. 215
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de
Tracción Indirecta en máquinas
digitales. Detalles técnicos.
Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407
UNI 6133.
C106
Detalles técnicos:
ver pág. 212
C109-11
SOFTWARE para ensayos de
flexión en probetas prismáticas de hormigón
con máquinas digitales.
Detalles técnicos: ver pág. 14
E170
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero
40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación
para prensas. Ver pág. 214
C097-01
C109-10 Software de compresión
instrumentos para ensayos de materiales
149
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD
Para ensayar probetas cúbicas hasta 150 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
2000 kN
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22
NF P 18-411 / BS 1610 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 216 mm de diámetro.
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 690x400x1320 mm. Peso: 650 ÷ 700 kg
150
C104-04
C056N + C127N + C121-05
C055N + C127N
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el
servicio de Atención al Cliente Matest ofrece soporte en tiempo
real para analizar el problema, para encontrar una solución posible,
y efectuar la ejecución del ensayo.
C056N + C127N + C111
COMPRESIÓN 2000 kN de capacidad
Modelo
Motorizado
C055 N
C056 N
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-30 SUPLEMENTO, 20 mm de alto para probetas cilíndricas de Ø
150x300 mm
C111
SUPLEMENTO, 176 de alto para probetas cúbicas de lado
150 mm
C111-01 SUPLEMENTOS, 176+50 mm de alto para probetas cúbicas
de 150 y 100 mm de lado
C111-03 SUPLEMENTO, 100 de alto para probetas cilíndricas de Ø
110x220 mm
C111-03 + C111-30 SUPLEMENTOS, 100 + 20 mm de alto para
probetas cilíndricas de Ø 100x200 mm
C111-21 SUPLEMENTO, 50 mm alto
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren
ningún suplemento.
C112-10 CONJUNTO DE PLATOS SUPERIOR + INFERIOR GRANDES
DE COMPRESIÓN 245x510x55 mm CON ROTULA para
realizar “además”, ensayos con bloques y probetas cúbicas de
200 mm de lado
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C119-03 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-05 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C056-11
CÁMARA DE ENSAYO con altura libre de 376 mm, con un suplemento
de 40 mm de alto, que permite ensayar
probetas cilíndricas de diámetro 150x300mm
y 160x320mm con “topes de refrentado”
(ASTM C1231)
C107-10
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6 “
C107-12 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de Ø 160 mm
C107-20 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore A 60
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm dureza Shore A 60
Nota: Los TOPES DE REFRENTADO sólo se
puede utilizar en la cámara de ensayo con altura
libre de 376 mm, mod. C056-11.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C107
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407
C106
UNI 6133.
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos de
flexión en probetas prismáticas de
hormigón. Detalles técnicos: ver pág. 14
E170
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de sustentación para
prensas. Ver pág. 214
C115-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
C097-01
C109-10N Software de compresión
instrumentos para ensayos de materiales
151
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
Para ensayar probetas cúbicas de hasta 200 mm de lado y probetas cilíndricas de
hasta 280 mm de alto
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22
NF P 18-411 / BS 1610 / UNE 83304
152
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 282 mm
- Platos de compresión de 287 mm de diámetro.
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 2000 kN con divisiones de
5 kN - 600 kN con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados):
230V monofásica 50Hz 750W
- Dimensiones: 690x400x1320 mm
- Peso: 670 ÷ 720 kg
C058-05A + C127N + C111-26
C058-04D + C127N + C111-26
C058-03 + C126
COMPRESIÓN 2000 kN de capacidad
Modelo
C058
C058-01
C058-02
C058-03
C058-04 D
C058-05 A
Manual
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-26 SUPLEMENTO, 76 mm de alto para probetas cúbicas de lado
200 mm
C111-26 + C111-22
SUPLEMENTOS, 76+50 mm de alto para probetas cúbicas de 200 y
150 mm de lado
C111-26 + C111-22 + C111-22
SUPLEMENTOS, 76+50+50 mm de alto para probetas
cúbicas de 200, 150 y 100 mm de lado
C111-22 SUPLEMENTO, 50 mm de alto
C111-31 SUPLEMENTO, 20 mm de alto
C110-20
C110-20 PLATO INFERIOR DE COMPRESION, de dureza superior a 55
HRC, Ø 165x50 mm para el ensayo de probetas cúbicas de 100
mm de lado (como una alternativa al suplemento de 50 mm de
alto)
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún
suplemento.
C112-10 CONJUNTO DE PLATOS SUPERIOR + INFERIOR GRANDES
DE COMPRESIÓN 245x510x55 mm CON ROTULA para
realizar “también” ensayos con bloques.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119-03 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-05 SISTEMAS DE PROTECCION
ANTIIMPACTOS, de policarbonato,
con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de
seguridad. Ver pág. 214
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de
la máquina para activar una segunda
prensa.
Detalles técnicos: ver pág. 215
C115-01
C097-01
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa
con “transductor de presión adecuado”, sólo para las máquinas digitales.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”, sólo para las máquinas digitales.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C107-01
DISPOSITIVO DE AUTO-CENTRADO
para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas
de 100 mm de diámetro.
Detalles técnicos: ver pág. 213
C107-01
C100
dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496 detalles
técnicos y otros modelos: ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C103
dispositivo de ensayo de TRACCIÓN
C100
INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de
Tracción Indirecta en máquinas
digitales. Detalles técnicos.
Ver pág. 14
C103
153
C106
DISPOSITIVO PARA ENSAYO DE
FLEXIÓN para probetas prismáticas de hormigón.
EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:118
NF P18-407 / UNI 6133.
Detalles técnicos: ver pág. 212
C106
C109-11
SOFTWARE para ensayos
de flexión en probetas prismáticas
de hormigón con máquinas digitales.
Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas.
Ver pág. 214
E170
C123
Software “servonet”
C109-10 Software de compresión
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD
Para ensayar probetas cúbicas hasta 200 mm de lado y probetas
cilíndricas de hasta 280 mm de alto
2000 kN
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22
NF P 18-411 / BS 1610 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 282 mm
- Platos de compresión de 287 mm de diámetro.
- Sistema hidráulico de retorno automático del aceite
al llegar al final de su recorrido máximo y así evitar la
salida del pistón fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 690x400x1320 mm
- Peso: 670 ÷ 720 kg
154
C058-05N + C104-04 + C127N + C111-26
C058-04N + C127N + C111-26
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el
servicio de Atención al Cliente Matest ofrece soporte en tiempo
real para analizar el problema, para encontrar una solución posible
y efectuar la ejecución del ensayo.
COMPRESIÓN 2000 kN de capacidad
Modelo
C058-04 N
C058-05 N
instrumentos para ensayos de materiales
Motorizado
•
•
C058-05N + C127N
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C110-20
C107-01
DISPOSITIVO DE AUTO-CENTRADO
para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas
de 100 mm de diámetro.
Detalles técnicos: ver pág. 213
C107-01
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C110-20 PLATO INFERIOR DE COMPRESION, De dureza superior a 55
HRC, Ø 165x50 mm para el ensayo de probetas cúbicas de 100
mm de lado (como una alternativa al suplemento de 50 mm de
alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún
suplemento.
C100
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas cúbicas.
EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C112-10 CONJUNTO DE PLATOS SUPERIOR + INFERIOR GRANDES
DE COMPRESIÓN 245x510x55 mm CON ROTULA para
realizar “también” ensayos con bloques
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C119-03 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-05 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO
de seguridad. Ver pág. 214
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C115-01
C103
155
C106
DISPOSITIVO PARA ENSAYO
DE FLEXIÓN para probetas prismáticas de hormigón.
EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:118
NF P18-407 / UNI 6133.
Detalles técnicos: ver pág. 212
C106
C109-11N
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349. Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación para prensas.
Ver pág. 214
C097-01
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD, completa con
“transductor de presión adecuado”.
Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
C097-01
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”,
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C111-26 SUPLEMENTO, 76 mm de alto para probetas cúbicas de lado
200 mm
C111-26 + C111-22 SUPLEMENTOS, 76+50 mm de alto para probetas cúbicas de 200 y 150 mm de lado
C111-26 + C111-22 + C111-22
SUPLEMENTOS, 76+50+50 mm de alto para probetas cúbicas de 200,
150 y 100 mm de lado
C111-22 SUPLEMENTO, 50 mm de alto
C111-31 SUPLEMENTO, 20 mm de alto
E170
C123 N
Software “servonet”
C109-10N Software de compresión
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
Para ensayar bloques máx. 500x300 mm, probetas cúbicas de hasta 300 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
sección C
NORMAS: EN 772-1 / UNI 6686, parte 1 e 2 / ASTM C39, E447 / AASHTO T22
NF P18-411 / BS 1610, 6073 / UNE 83304
156
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión: 510x320x55 mm
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 2000 kN con divisiones de
5 kN - 600 kN con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados): 230V monofásica 50Hz 750W
- Dimensiones: 870x600x1400 mm
- Peso: 850 ÷ 900 kg
C077D + C127N + C105 + C111-08 + C121-01
C078A + C127N + C105 + C111-08 + C121-01
C075 + C111-05 + C121-01
COMPRESIÓN 2000 kN de capacidad
Modelo
Manual
C073
C074
C075
C076
C077 D
C078 A
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-22 SUPLEMENTO, 50 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
C111-50
SUPLEMENTO, se elimina el complicado
procedimiento para levantar el plato rectangular inferior y agregar suplementos. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
C112-05
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C105 TORNILLO CENTRAL, facilita el ajuste de los platos de compresión de tamaño grande. Detalles técnicos: ver pág. 210
C111-27 SUPLEMENTO RANURADO, 20 mm de altura, para el tornillo central
C111-23 SUPLEMENTO RANURADO, 50 mm de altura, para el tornillo central
C111-28 SUPLEMENTO RANURADO, 76 mm de altura, para el tornillo central
C111-08 SUPLEMENTO RANURADO, 126 mm de altura, para el tornillo central
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C121-01 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de
C107-10
seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas de Ø 150 mm dureza
Shore A 60
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA,
para fijar en la máquina de ensayo, para obtener mayor
espacio libre vertical de la cámara de ensayo y
cumplir con las Normativas ASTM C39 y
AASHTO T22
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox. Detalles técnicos: ver pág. 213
C110-30
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C097-01 GAMA DIGITAL DUAL DE BAJA
C115-01
CAPACIDAD, completa con
“transductor de presión adecuado”,
sólo para las máquinas digitales. Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”, sólo
para las máquinas digitales. Detalles técnicos: ver pág. 210
sección C
ACCESORIOS PARA MÁQUINAS DE BLOQUES DE 2000 kN:
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos: ver pág. 211
157
C100
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo a
TRACCIÓN INDIRECTA para
adoquines y probetas cúbicas de
dimensiones máx. 300x500mm, fijados
directamente en los platos de compresión
de gran tamaño. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de Tracción Indirecta
en máquinas digitales.
C103-01
Detalles técnicos: Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas de hormigón EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS
1881:118 NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón
con máquinas digitales.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
Para ensayar bloques máx. 500x300 mm, probetas cúbicas de hasta 300 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
3ISTEMADIGITALDEPANTALLATfCTIL #YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: EN 772-1 / UNI 6686, parte 1 e 2 / ASTM C39, E447 / AASHTO T22
NF P18-411 / BS 1610, 6073 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 510x320x55 mm
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 870x600x1400 mm
- Peso: 850 ÷ 900 kg
C078N + C127N
+ C105 + C111-08
+ C121-08
158
C077N + C127N + C105 + C111-08 + C121-08
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para mejorar el
diseño y el aspecto de la máquina.
C104-05
C078N + C104-04 + C105 + C111-08 + C121-08 + C127N
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el servicio de Atención al Cliente Matest ofrece soporte en tiempo real
para analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
COMPRESIÓN 2000 kN de capacidad
Modelo
Motorizado
C077 N
C078 N
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-22 SUPLEMENTO, 50 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
C111-50
SUPLEMENTO, Se elimina el
complicado procedimiento para levantar el plato
rectangular inferior y agregar suplementos.
Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C105 TORNILLO CENTRAL, facilita el ajuste de los platos de compresión de tamaño grande.
Detalles técnicos: ver pág. 210
C111-27
C111-23
C111-28
C111-08
SUPLEMENTO RANURADO, 20 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 50 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 76 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 126 mm de altura, para el tornillo central
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C121-01 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C107-10
C121-51 INTERRUPTOR DE PARO de
seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore A 60
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para fijar en la máquina de ensayo, para obtener mayor espacio libre
vertical de la cámara de ensayo y cumplir con las
C110-30
Normativas ASTM C39 y AASHTO T22.
Dimensiones del plato:
diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
C097-01 GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa
con “transductor de presión adecuado”. Rango recomendado
0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”. Detalles
técnicos: ver pág. 210
sección C
ACCESORIOS PARA MÁQUINAS DE BLOQUES DE 2000 kN:
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
159
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo a
TRACCIÓN INDIRECTA para
adoquines y probetas cúbicas de
dimensiones máx. 300x500mm, fijados directamente
en los platos de compresión de gran tamaño. EN 1338, 12390-6
Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de Tracción
Indirecta. Detalles técnicos. Ver pág. 14
C103-01
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:
118 / NF P18-407 / UNI 6133.
C106
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos
de flexión en probetas prismáticas
de hormigón. Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
Para ensayar probetas cúbicas de hasta 200 mm de lado y probetas cilíndricas de
hasta Ø 160x320 mm
sección C
NORMAS: UNI 6686, parte 1 y 2 / ASTM C39 / AASHTO T22
NF P18-411 / BS 1610 / UNE 83304
160
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 287 mm de diámetro
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 3000 kN con divisiones de
10 kN - 600 kN con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados): 230V monofásica 50Hz 750W
- Dimensiones: 860x470x1450 mm
- Peso: 1050 ÷ 1200 kg
C070D + C127N + C111-05
C071A + C127N + C111-05
C068 + C111-05 + C121-07
COMPRESIÓN 3000 kN de capacidad
Modelo
Manual
C066
C067
C068
C069
C070 D
C071 A
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-07 SUPLEMENTOS, 50 + 50 mm de
alto para probetas cilíndricas
Ø 110x220 mm
C111-07 + C111-31
C110-20
SUPLEMENTOS, 50 + 50 + 20 mm de
alto para probetas cilíndricas Ø 100x200 mm
C111-22 SUPLEMENTO, 50 mm de alto
C110-20 PLATO INFERIOR DE COMPRESION, de dureza superior a 55
HRC, Ø 165x50 mm para el ensayo de
probetas cúbicas de 100 mm de lado (como una alternativa al
suplemento de 50 mm de alto)
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C112-10 CONJUNTO DE PLATOS SUPERIOR + INFERIOR GRANDES
DE COMPRESIÓN 245x510x55 mm CON ROTULA para
realizar “también” ensayos con bloques
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119-05 SISTEMAS DE PROTECCIÓN ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-07 SISTEMAS DE PROTECCIÓN ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
C107-10
cilíndricas de 150 mm y 6”
C107-12 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 160 mm de diámetro
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas de Ø 150 mm dureza
Shore A 60
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 160 mm 60 shore A
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para
C110-30
fijar en la máquina de ensayo, en sustitución del plato+rotula
estándar, y obtener un mayor espacio libre vertical
de la cámara de ensayo y cumplir con las Normas
ASTM C39 y AASHTO T22.
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox. Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo de
la máquina para activar una segunda prensa. Detalles técnicos: ver pág. 215
C097-01 GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con
“transductor de presión adecuado”, solo para maquinas digitales.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de
esfuerzo”, solo para maquinas digitales
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C107-01
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
sección C
ACCESORIOS PARA MÁQUINAS DE 3000 kN:
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
C109-12
SOFTWARE para ensayos de
Tracción Indirecta con maquinas
digitales.
Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón.
EN 12390-5 / ASTM C78, C293
AASHTO T97 / BS 1881:118
C106
NF P18-407 / UNI 6133
Detalles técnicos:
ver pág. 212
C109-11
SOFTWARE para ensayos de flexión en probetas prismáticas de hormigón con maquinas digitales.
Detalles técnicos: ver pág. 14
E170
E170
DISPOSITIVO DE COMPRESIÓN para
ensayar probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de
sustentación para
prensas.
Ver pág. 214
C097-02
C115-01
instrumentos para ensayos de materiales
161
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000
Para ensayar probetas cúbicas de hasta 200 mm de lado y probetas
cilíndricas de hasta Ø. 160x320 mm
kN
sección C
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
NORMAS: UNI 6686, parte 1 e 2 / ASTM C39 / AASHTO T22
NF P18-411 / BS 1610 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 287 mm de diámetro
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 860x470x1450 mm
- Peso: 1050 ÷ 1200 kg
162
C071N + C127N + C111-05
C070N + C127N + C111-05 + C121-07
C071N + C127N +
C111-05 + C121-07
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
C104-10
La máquina cuenta con una conexión a Internet a través del cual el servicio de Atención al Cliente Matest
ofrece soporte en tiempo real para analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
COMPRESIÓN 3000 kN de capacidad
Modelo
Motorizado
C070 N
C071 N
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-07 SUPLEMENTOS, 50 + 50 mm de alto
para probetas cilíndricas
Ø 110x220 mm
C111-07 + C111-31
SUPLEMENTOS, 50 + 50 + 20 mm de
alto para probetas cilíndricas Ø 100x200 mm
C110-20
C111-22 SUPLEMENTO, 50 mm de alto
C110-20 PLATO INFERIOR DE COMPRESION, de dureza superior a 55
HRC, Ø 165x50 mm para el ensayo de
probetas cúbicas de 100 mm de lado (como una alternativa al
suplemento de 50 mm de alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C112-10 CONJUNTO DE PLATOS SUPERIOR + INFERIOR GRANDES
DE COMPRESIÓN 245x510x55 mm CON ROTULA para
realizar “también” ensayos con bloques.
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C119-05 SISTEMAS DE PROTECCION ANTIIMPACTOS, según Directiva
de la CE. Ver pág. 214
C121-07 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO (dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-12 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 160 mm de diámetro
C107-10
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-25 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas de Ø 160 mm 60 shore A
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA,
para fijar en la máquina de ensayo, en sustitución
del plato+rotula estándar, y obtener un mayor
espacio libre vertical de la cámara de ensayo y
cumplir con las normas ASTM C39 y
AASHTO T22.
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C110-30
C115-01
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01 GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa
con “transductor de presión adecuado”. Rango recomendado
0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”. Detalles
técnicos: ver pág. 210
C097-05 CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de calibración especial hace posible la concesión de
la clase 1 en prácticamente toda la gama de las máquinas de
compresión.
sección C
ACCESORIOS PARA MÁQUINAS DE 3000 kN:
C107-01
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN
para probetas prismáticas de hormigón. EN 12390-5 / ASTM C78, C293
AASHTO T97 / BS 1881:118 NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349. Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación para prensas.
Ver pág. 214
C097-02
C097-01
instrumentos para ensayos de materiales
163
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
Para ensayar bloques máx. 500x300 mm, probetas cúbicas de hasta 300 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
sección C
NORMAS: EN 772-1 / UNI 6686, parte 1 e 2 / ASTM C39, E447
AASHTO T22 / NF P18-411 / BS 1610, 6073 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión: 510x320x55 mm
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas 150 y
160 mm de diámetro
- Graduación de manómetros: 3000 kN con divisiones
de 10 kN - 600 kN con divisiones de 2 kN
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación (modelos motorizados): 230V monofásica 50Hz 750W
- Dimensiones: 900x600x1500 mm
- Peso: 1150 ÷ 1220 kg
164
C079-05D + C127N + C111-22
C079-06A + C127N + C111-22
C079-04 + C111-22
COMPRESIÓN 3000 kN de capacidad
Modelo
C079-01
C079-02
C079-03
C079-04
C079-05 D
C079-06 A
Manual
•
•
instrumentos para ensayos de materiales
Motorizado
1
Manómetro
•
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-22 SUPLEMENTO, 50 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
SUPLEMENTO, Se elimina el complicado
C111-50
procedimiento para levantar el plato
rectangular inferior y agregar suplementos.
Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
C112-05
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C105 TORNILLO CENTRAL, facilita el ajuste de los platos de compresión de tamaño grande. Detalles técnicos: ver pág. 210
C111-27 SUPLEMENTO RANURADO, 20 mm de altura, para el tornillo central
C111-23 SUPLEMENTO RANURADO, 50 mm de altura, para el tornillo central
C111-28 SUPLEMENTO RANURADO, 76 mm de altura, para el tornillo central
C111-08 SUPLEMENTO RANURADO, 126 mm de altura, para el tornillo central
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C121-08 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO
de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-10
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para fijar en la máquina de ensayo, en sustitución del plato+rotula estándar,
y obtener un mayor espacio libre vertical de la cámar
C110-30
de ensayo y cumplir con las normas
ASTM C39 y AASHTO T22.
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C097-01 GAMA DIGITAL DUAL DE BAJA
C115-01
CAPACIDAD, completa con
“transductor de presión adecuado”,
sólo para las máquinas digitales. Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”, sólo
para las máquinas digitales. Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
sección C
ACCESORIOS PARA MÁQUINAS DE BLOQUES DE 3000 kN:
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
165
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo
a TRACCIÓN INDIRECTA para
adoquines y probetas cúbicas de
dimensiones máx. 300x500mm, fijados directamente en
los platos de compresión de gran tamaño. EN 1338, 12390-6
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de Tracción Indirecta
en máquinas digitales.
Detalles técnicos. Ver pág. 14
C103-01
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C106
C109-11
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón con máquinas
digitales. Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349. Detalles técnicos
y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
Para ensayar bloques máx. 500x300 mm, probetas cúbicas de hasta 300 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
sección C
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
NORMAS: EN 772-1 / UNI 6686, parte 1 e 2 / ASTM C39, E447 / AASHTO T22 / NF P18-411
BS 1610, 6073 / UNE 83304
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 510x320xh 55 mm
- Sistema hidráulico de retorno automático del aceite al llegar
al final de su recorrido máximo y así evitar la salida del pistón
fuera del cilindro.
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 55 mm aprox.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 900x600x1500 mm - Peso: 1150 ÷ 1220 kg
166
C079-06N + C127N + C111-22
C079-06N + C104-10 + C127N + C111-22
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para mejorar el
diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el servicio
de Atención al Cliente Matest ofrece soporte en tiempo real para analizar
el problema, para encontrar una solución posible y efectuar la ejecución del
ensayo.
COMPRESIÓN 3000 kN de capacidad
Modelo
C079-05 N
C079-06 N
instrumentos para ensayos de materiales
Motorizado
•
•
C079-05N + C127N + C111-22
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-31 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-04 SUPLEMENTO, 126 mm de alto para probetas cúbicas de lado
200 mm
C111-05 SUPLEMENTOS, 126 + 50 mm de alto para probetas cúbicas
de lado 200 y 150 mm
C111-06 SUPLEMENTOS, 126 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-22 SUPLEMENTO, 50 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
SUPLEMENTO, Se elimina el complicado
C111-50
procedimiento para levantar el plato
rectangular inferior y agregar suplementos.
Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
C112-05
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C105 TORNILLO CENTRAL, facilita el ajuste de los platos de compresión de tamaño grande.
Detalles técnicos: ver pág. 210
C111-27
C111-23
C111-28
C111-08
SUPLEMENTO RANURADO, 20 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 50 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 76 mm de altura, para el tornillo central
SUPLEMENTO RANURADO, 126 mm de altura, para el tornillo central
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C121-08 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO
de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO
(dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas
cilíndricas de Ø 150 mm dureza
Shore A 60
C107-10
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para fijar en la máquina de ensayo, en sustitución del plato+rotula estándar, y
C110-30
obtener un mayor espacio libre vertical de la cámara
de ensayo y cumplir con las normas
ASTM C39 y AASHTO T22.
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01 GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa
con “transductor de presión adecuado”. Rango recomendado
0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-01
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
sección C
ACCESORIOS PARA MÁQUINAS DE BLOQUES DE 3000 kN:
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
167
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA
para adoquines y probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C100
COMO ALTERNATIVA:
C103
C103-01
Dispositivos de ensayo a TRACCIÓN
INDIRECTA para adoquines y
probetas cúbicas de dimensiones
máx. 300x500mm, fijados directamente en
los platos de compresión de gran tamaño. EN 1338, 12390-6
Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C103-01
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:118
NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C106
C109-11N
SOFTWARE para ensayos
de flexión en probetas prismáticas
de hormigón. Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 5000
Para ensayar probetas cúbicas de hasta 300 mm de lado y probetas cilíndricas
de hasta 250x500 mm de diámetro
kN
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: UNI 6686, parte 1 e 2 / BS 1610 / NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 530 mm
- Platos de compresión de 310x310 mm
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite
al llegar al final de su recorrido máximo y así evitar
la salida del pistón fuera del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 1200x900x1900 mm
- Peso: 2800 ÷ 2900 kg
168
C086-02N + C127N + H009-01
ACCESORIOS:
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a
través del cual el servicio de Atención al Cliente Matest
ofrece soporte en tiempo real para analizar el problema, para encontrar una solución posible y efectuar la
ejecución del ensayo.
C086-03N + C127N + C086-10
COMPRESIÓN 5000 kN de capacidad
Modelo
C086-02 N
C086-03 N
instrumentos para ensayos de materiales
Motorizado
•
•
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C086-10 SUPLEMENTO, 50 mm de alto
C086-11 SUPLEMENTO, 25 mm de alto
Nota: la distancia vertical entre los platos de compresión es de 530 mm.
El operador tendrá que comprar los suplementos necesarios para reducir
la distancia entre los platos de compresión a fin de obtener la distancia
correcta de la muestra sometida a ensayo
aproximada de 10 a 15 mm.
C112-11
C100
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas
cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de Tracción Indirecta
con maquinas digitales.
Detalles técnicos. Ver pág. 14
C112-11
CONJUNTO DE PLATOS
SUPERIOR + INFERIOR COMPRESIÓN GRANDES + RÓTULA
310x510x55 mm para ensayar
“también” bloques. Es necesario tener
también el carro deslizante mod. C117
C117
CARRO DESLIZANTE, para facilitar la
extracción del bloque del plato superior.
C100
Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos: ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 5000 kN:
C103
C117
C127N IMPRESORA GRÁFICA de papel térmico incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO
DE FLEXIÓN para probetas
prismáticas de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos de
flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
E170
C121-04 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C106
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349
Detalles técnicos y otros modelos: ver pág. 212
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD,
completa con “transductor de presión adecuado”.
Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
E170
C109-11N Software de Flexión
COMO ALTERNATIVA:
C115-01
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el
recorrido. Con un procedimiento de
C097-01
calibración especial hace posible la concesión de la clase 1
en prácticamente toda la gama de las máquinas de compresión.
C123N
Software “Servonet”
C109-10N Software de compresión
instrumentos para ensayos de materiales
169
sección C
HO RM I G ÓN
170
instrumentos para ensayos de materiales
HO RMIGÓN
Las máquinas de compresión “de alta estabilidad” deben cumplir con los estrictos requisitos de:
EN 12390-4 / BS 1881:115 / DIN 51220. / UNI 6686, parte 3 / NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
Las máquinas se fabrican con las características de calidad específica (procesamiento, tolerancias) de bastidor, del grupo pistón / cilindro, de
la rótula, de los platos de compresión, de los suplementos, etc., conforme y cumpliendo la verificación de alta estabilidad (distribución de la
fuerza).
La conformidad de la estabilidad está certificada con la verificación de la alineación automática (ensayo foot-meter) de los componentes
de las máquinas y la restricción en el movimiento de la rótula/plato superior, mediante el uso de una columna especial de carga de tensión
eléctrica con 5 puntos de medición conectados al registrador de datos adecuado (los detalles técnicos: ver pág. 221).
Una aplicación de carga incorrecta y no uniforme de la muestra provoca un fallo irregular, insuficiente y precoz. La resistencia a la compresión obtenida puede ser sustancialmente menor que la resistencia efectiva.
La característica más importante de las “prensas de alta estabilidad” es su distribución uniforme de la carga aplicada sobre toda la superficie de la muestra sometida a ensayo. La rotura de la muestra es satisfactoria y los resultados de resistencia son correctos, elevados y
verdaderos.
sección C
MÁQUINAS DE ENSAYOS A COMPRESIÓN “DE ALTA ESTABILIDAD”,
BASTIDOR DE CUATRO COLUMNAS PRETENSADAS
• El bastidor de cuatro columnas pretensadas con la sujeción de 8 abrazaderas y verificadas por una llave dinamométrica, permite obtener una rigidez y una estabilidad muy alta en todo el rango de carga y mantener estas características en el tiempo.
• La rótula, en baño de aceite y con juego axial nulo, es estudiada y fabricada para conceder, durante la fase inicial del ensayo, una precisa
alineación automática sin fricciones del plato superior de compresión a la muestra. Mediante la aplicación de la carga, el asiento de la
rotula bloquea y mantiene la posición hasta la rotura de la muestra.
• Pistón y el cilindro se encuentran protegidos con un embalaje de alta calidad.
• Platos de compresión están endurecidos a más de 55 HRC y rectificados.
Disponible en capacidades de: 2000 kN / bloques 2000 kN / 3000 kN / bloques 3000 kN / 5000 kN
Sistema de medición de carga: manómetro de tipo Bourdon
Visualizador gráfico “Digitec” o “Cyber- Plus Evolución”
Sistema automático Servo controlado por “Autotec” o “Servo-Plus Evolution” con la opción de determinación del “módulo de elasticidad”.
Descrito y representado en las siguientes páginas 172 ÷ 191
instrumentos para ensayos de materiales
171
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
“DE ALTA ESTABILIDAD”
Para ensayar probetas cúbicas de hasta 200 mm de lado y probetas cilíndricas de
hasta 160x320 mm de diámetro
sección C
NORMAS: EN 12390-4 / UNI 6686, parte 3 / BS 1881:115 / DIN 51220, 51302 / NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
172
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de diámetro 287x60 mm
- Manómetros de 250 mm de diámetro con escalas de resistencia
específica de probetas cúbicas de 150 mm y probetas cilíndricas 150 y
160 mm de diámetro
- Graduación de manómetros: 2000 kN con divisiones de 5 kN - 600
kN con divisiones de 2 kN
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 690x400x1400 mm
- Peso: 850 ÷ 920 kg
C089-04A + C127N + C121-06 + C111-13
C089-02D + C127N + C121-06 + C111-13
C089 + C111-24
COMPRESIÓN 2000 kN de Alta Estabilidad
Modelo
C089
C089-01
C089-02 D
C089-04 A
instrumentos para ensayos de materiales
Manual
1
Manómetro
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
HO RMIGÓN
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
C110-20
C110-20 PLATO INFERIOR DE COMPRESION, endurecido y rectificado, de
diámetro 165x50 mm para el ensayo de probetas cúbicas de 100
mm de lado (como una alternativa al suplemento de 50 mm de alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de 10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C109-10
Software de compresión
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA,
C110-30
para fijar en la máquina de ensayo en sustitución
de la plata+rótula estándar, para obtener mayor
espacio libre vertical de la cámara de ensayo y
cumplir con las Normativas
ASTM C39 y AASHTO T22.
Dimensiones del plato: diámetro 165 x 30 mm. Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD, completa con “transductor de
presión adecuado”, solo para maquinas
C097-02
digitales. Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD 0-300kN, completa con “células de carga medidoras de
esfuerzo”, solo para maquinas digitales.
Detalles técnicos: ver pág. 210
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C107-01 DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas
de 100 y 150 mm de lado, y probetas cilíndricas de 100 mm de
diámetro. Detalles técnicos: ver pág. 213
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C123
Software “Servonet”
C119-04 SISTEMAS DE PROTECCION
C107-10
ANTIIMPACTOS,
Según Directiva de la CE.
Ver pág. 214
C121-06 SISTEMAS DE PROTECCION
ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según
Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO (dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore A 60
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C109-12 SOFTWARE para ensayos de Tracción Indirecta con maquinas
digitales. Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11 SOFTWARE para ensayos de flexión en probetas prismáticas de
hormigón con maquinas digitales. Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm. EN 196 / ASTM C349. Detalles técnicos
y otros modelos: ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
173
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
“DE ALTA ESTABILIDAD” Para ensayar probetas cúbicas de hasta 200 mm de lado y
probetas cilíndricas de hasta Ø. 160x320 mm
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: EN 12390-4 / UNI 6686, parte 3 / BS 1881:115 / DIN 51220, 51302
NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de 287x60 mm de diámetro
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 690x400x1400 mm
- Peso: 850 ÷ 920 kg
174
C089-02N + C127N + C111-13
C089-04N + C104-04 + C127N + C111-13 + C121-06
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para mejorar el diseño
y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el servicio de
Atención al Cliente Matest ofrece soporte en tiempo real para analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
COMPRESIÓN 2000 kN de alta estabilidad
Modelo
C089-02 N
C089-04 N
instrumentos para ensayos de materiales
Motorizado
•
•
C089-04N + C127N + C111-13
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
C110-20
C110-20 PLATO INFERIOR DE COMPRESION, endurecido y rectificado, de
diámetro 165x50 mm para el ensayo de probetas cúbicas de 100
mm de lado (como una alternativa al suplemento de 50 mm de alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de 10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N
SOFTWARE “Servonet” para
el control remoto a través del
ordenador de la máquina
Servo-Plus Evolution. Ver pág. 14
C104-10N
SERVO-STRAIN
Software Servo-controlado,
sistema de:
C104-10N
- Carga o Resistencia
- Deformación
- Esfuerzo
Este sistema sólo se puede utilizar con maquinas Servo-Plus Evolution
mod. C089-04N. Detalles técnicos, ver pág. 136
C125N
Determinación del MÓDULO SECANTE DE ELASTICIDAD en la compresión del hormigón. Sistema automático del control de la variación de
velocidad incluso cuando se libera la carga, aplicable sólo a las prensas de
alta estabilidad con Servo-Plus Evolution.
UNI 6556, ASTM C469, ISO 6784, DIN 1048.
Detalles técnicos: ver pág. 190
C107-10
C119-04 SISTEMAS DE PROTECCION
ANTIIMPACTOS, Según Directiva
de la CE. Ver pág. 214
C121-06 SISTEMAS DE PROTECCION
ANTIIMPACTOS, de policarbonato,
con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO (dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-21 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore A 70
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA,
para fijar en la máquina de ensayo en sustitución
de la plata rótula estándar, para obtener mayor
espacio libre vertical de la cámara de ensayo y
cumplir con las Normativas
ASTM C39 y AASHTO T22
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C110-30
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
sección C
ACCESORIOS PARA MÁQUINAS DE 2000 kN:
C097-01
C115-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”.
Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD 0-300kN, completa
con “células de carga medidoras
de esfuerzo”.
C097-01
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C107-01 DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas
de 100 y 150 mm de lado, y probetas cilíndricas de 100 mm de
diámetro. Detalles técnicos: ver pág. 213
C100
Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C103 Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y probetas cúbicas. EN 1338, 12390-6. Detalles técnicos: ver
pág. 211
C109-12N SOFTWARE para ensayos de Tracción Indirecta. Detalles
técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11N SOFTWARE para ensayos de flexión en probetas prismáticas
de hormigón con maquinas digitales.
Detalles técnicos: ver pág. 14
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
E170
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
175
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
“DE ALTA ESTABILIDAD”
Para ensayar bloques máx. 500X300 mm, probetas cúbicas de hasta 200 mm de lado y probetas
cilíndricas de hasta 160x320 mm de diámetro
sección C
NORMAS: EN 12390-4 / UNI EN 772-1 / UNI 6686, parte 3
BS 1881:115, 6073 / DIN 51220, 51302 / NF P18-411
UNE 83304 / ASTM C39, E447 / AASHTO T22
176
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos para ensayos con bloques: 283 mm
- Platos de compresión para bloques de 510x320x55 mm
- Distancia máxima entre platos para ensayos con probetas cúbicas y
cilíndricas: 336 mm
- Platos de compresión para ensayos con probetas cúbicas y cilíndricas
de diámetro 287x60 mm.
- Manómetros de 250 mm de diámetro con escalas de resistencia específica para probetas cúbicas de 150 mm y para probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 2000 kN con divisiones de 10 kN
- 600 kN con divisiones de 2 kN
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final
de su recorrido máximo y así evitar la salida del pistón fuera del
cilindro.
C089-21D + C127N
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x520x1500 mm
- Peso: 1000 ÷ 1070 kg
C117
C089-22A + C127N
COMPRESIÓN 2000 kN de alta estabilidad Bloques
Modelo
Motorizado
1
Manómetro
•
•
•
•
•
C089 B
C089-01 B
C089-21 D
C089-22 A
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
ACCESORIOS PARA MÁQUINAS DE 2000 kN BLOQUES:
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
SUPLEMENTO
C111-50
Se elimina el complicado procedimiento
para levantar el plato rectangular inferior y agregar suplementos.
Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
C112-05
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”, solo para maquinas digitales. Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”, solo para maquinas digitales.
Detalles técnicos: ver pág. 210
C100 Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas
cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo A TRACCIÓN
C103-01
INDIRECTA para adoquines y probetas
cúbicas de dimensiones máx. 300x500mm, fijados directamente en los
platos de compresión de gran tamaño. EN 1338, 12390-6
Detalles técnicos: ver pág. 211
sección C
HO RMIGÓN
C109-12 SOFTWARE para ensayos de Tracción Indirecta con maquinas
digitales. Detalles técnicos. Ver pág. 14
C117
CARRO DESLIZANTE, para facilitar la extracción del bloque del plato
superior, para realizar ensayos en bloques o probetas cúbicas y cilíndricas
estándares.
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C109-11
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón con
maquinas digitales. Detalles técnicos:
ver pág. 14
C121-10 Sistemas de protección ANTIIMPACTOS, de policarbonato, con
bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C106
C109-10
Software de compresión
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-05
CLASE 1, a partir del 1% en todo el recorrido.
Con un procedimiento de calibración especial
hace posible la concesión de la
clase 1 en prácticamente toda
la gama de las máquinas de
compresión. Sólo se aplica en
máquinas digitales.
C123
C115-01
C097-01
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349. Detalles técnicos y otros
modelos: ver pág. 212
Software “Servonet”
E170
C126
BANCADA de sustentación para prensas.
Ver pág. 214
instrumentos para ensayos de materiales
177
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 2000 kN
“DE ALTA ESTABILIDAD”
Para ensayar bloques de máx. 500X300 mm, probetas cúbicas de hasta 200 mm de lado y probetas
cilíndricas de hasta Ø 160x320 mm
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: EN 12390-4, EN 772-1 / UNI 6686, parte 3 / BS 1881:115, 6073 / DIN 51220, 51302 / NF P18-411
UNE 83304 / ASTM C39, E447 / AASHTO T22
178
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos para ensayos con bloques: 283 mm
- Platos de compresión para bloques de 510x320x55 mm
- Distancia máxima entre platos para ensayos con probetas cúbicas
y cilíndricas: 336 mm
- Platos de compresión para ensayos con probetas cúbicas y
cilíndricas de diámetro 287x60 mm
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al
final de su recorrido máximo y así evitar la salida del pistón fuera
del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x520x1500 mm
- Peso: 1000 ÷ 1070 kg
C089-21N + C127N
C089-22N + C104-04 + C127N
C117
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS
C089-22N + C127N
EVOLUTION. El conjunto de la
bomba y el sistema digital se encierran para mejorar el diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA. La máquina cuenta con una conexión a Internet
a través del cual el servicio de Atención al Cliente Matest ofrece soporte en tiempo real para
analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
COMPRESIÓN 2000 kN de alta estabilidad Bloques
Modelo
C089-21 N
C089-22 N
instrumentos para ensayos de materiales
Motorizado
•
•
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
ACCESORIOS PARA MÁQUINAS DE 2000 kN DE BLOQUES:
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm de lado
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
SUPLEMENTO,
C111-50
Se elimina el complicado procedimiento
para levantar el plato rectangular inferior y agregar suplementos.
Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
C112-05
por lo que la colocación de suplementos es
más fácil. Detalles técnicos: ver pág. 217
C117
CARRO DESLIZANTE, para facilitar la extracción del bloque del plato superior,
para realizar ensayos en bloques o probetas cúbicas y cilíndricas estándares.
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C104-10N
SERVO-STRAIN
Software Servo-controlado,
sistema de:
- Carga o Resistencia
- Deformación
- Esfuerzo
Este sistema sólo se puede
utilizar con maquinas
Servo-Plus Evolution mod. C089-22N.
Detalles técnicos, ver pág. 136
C097-01
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD, completa con
“transductor de presión adecuado”.
Rango recomendado 0-250kN.
C097-01
Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
sección C
HO RMIGÓN
Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas
cúbicas. EN 1338, 12390-6.
C103-01
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo a TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas de dimensiones máx. 300x500mm.
EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C109-12N
Software para ensayos de Tracción Indirecta. Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C104-10N
C125N
Determinación del MÓDULO SECANTE DE ELASTICIDAD en la compresión en el hormigón. Sistema automático del control de la variación de
velocidad incluso cuando se libera la carga, aplicable sólo a las prensas de
alta estabilidad con Servo-Plus Evolution.
UNI 6556, ASTM C469, ISO 6784, DIN 1048.
Detalles técnicos: ver pág. 190
C121-10 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C109-11N
SOFTWARE para ensayos de
flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de mortero
40,1 x 40 mm. EN 196 / ASTM C349. Detalles técnicos y otros modelos:
ver pág. 212
C126
BANCADA de sustentación para prensas.
Ver pág. 214
E170
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
instrumentos para ensayos de materiales
179
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
“DE ALTA ESTABILIDAD”
Para ensayar probetas cúbicas de hasta 200 mm de lado y probetas cilíndricas de
hasta 160x320 mm de diámetro
sección C
NORMAS: EN 12390-4 / UNI 6686, parte 3 / BS 1881:115 / DIN 51220, 51302
NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
180
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión de diámetro 287x60 mm
- Manómetros de 250 mm de diámetro con escalas de resistencia específica para probetas cúbicas de 150 mm y para probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 3000 kN con divisiones de
10 kN - 600 kN con divisiones de 2 kN
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x450x1500 mm - Peso: 1200 ÷ 1250 kg
C089-08D + C127N + C111-13 + C121-07 + C121-51
C089-10A + C127N + C111-13 + C121-07 + C121-51
COMPRESIÓN 3000 kN de Alta Estabilidad
Modelo
Motorizado
1
Manómetro
•
•
•
•
•
C089-06
C089-07
C089-08 D
C089-10 A
instrumentos para ensayos de materiales
C089-06+C111-13
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros
mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
ACCESORIOS PARA MÁQUINAS DE 3000 kN:
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
C110-20
C110-20 PLATO INFERIOR DE COMPRESION, endurecido y rectificado,
de diámetro 165x50 mm para el ensayo de probetas cúbicas
de 100 mm de lado (como una alternativa al suplemento de 50
mm de alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C119-05 SISTEMAS DE PROTECCIÓN ANTIIMPACTOS, de policarbonato. Según Directiva de la CE. Ver pág. 214
C121-07 SISTEMAS DE PROTECCIÓN ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C107-10 TOPES DE REFRENTADO (dos unidades) para probetas
cilíndricas de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO (dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore A 60
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para fijar en la máquina de ensayo en sustitución del dispositivo estándar, para obtener mayor
espacio libre vertical de la cámara de ensayo y cumplir con las Normativas
ASTM C39 y AASHTO T22
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS,
conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE
BAJA CAPACIDAD, completa
con “transductor de presión
adecuado”, sólo para maquinas
C097-01
digitales. Rango recomendado 0-250kN.
Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”, sólo
para maquinas digitales.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
sección C
HO RMIGÓN
C107-01
DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas de 100 y
150 mm de lado, y probetas cilíndricas de 100 y 150 mm de diámetro.
Detalles técnicos: ver pág. 213
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA
C100
para adoquines y probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12 SOFTWARE para ensayos de Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C109-11
SOFTWARE para ensayos de
flexión en probetas prismáticas
de hormigón con maquinas
digitales.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas
de mortero 40,1 x 40 mm. EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
E170
C126
BANCADA de sustentación para prensas.
Ver pág. 214
C115-01
instrumentos para ensayos de materiales
181
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
“DE ALTA ESTABILIDAD” Para ensayar probetas cúbicas de hasta 200 mm de lado y
probetas cilíndricas de hasta Ø 160x320 mm
3ISTEMADIGITALDEPANTALLATfCTIL #YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: EN 12390-4 / UNI 6686, parte 3 / BS 1881:115 / DIN 51220, 51302
NF P18-411 / UNE 83304 / ASTM C39 / AASHTO T22
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos: 336 mm
- Platos de compresión para ensayos de diámetro 287x60 mm
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final de
su recorrido máximo y así evitar la salida del pistón fuera del cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x540x1500 mm
- Peso: 1200 ÷ 1250 kg
182
C089-10 N + C104-04 + C127N + C111-12 + C121-07
C089-08N + C127N + C111-13 + C121-07 + C121-51
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C104-05
C089-10N + C127N + C111-12 + C121-07
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el servicio de Atención al Cliente Matest ofrece soporte en tiempo real
para analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
COMPRESIÓN 3000 kN de alta estabilidad
Modelo
C089-08 N
C089-10 N
instrumentos para ensayos de materiales
Motorizado
•
•
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
HO RMIGÓN
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
C110-20
C110-20 PLATO INFERIOR DE COMPRESION, endurecido y rectificado, de
diámetro 165x50 mm para el ensayo de probetas cúbicas de 100
mm de lado (como una alternativa al suplemento de 50 mm de alto).
Nota: las probetas cilíndricas de Ø 160x320 mm no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de 10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N
SOFTWARE “Servonet” para el
control remoto a través del
ordenador de la máquina
Servo-Plus Evolution. Ver pág. 14
C104-10N
SERVO-STRAIN
Software Servo controlado,
sistema de:
- Carga o Resistencia
C104-10N
- Desplazamiento
- Esfuerzo
Este sistema sólo se puede utilizar con maquinas Servo-Plus Evolution
mod. C089-10N. Detalles técnicos, ver pág. 136
C125N
Determinación del MÓDULO SECANTE DE ELASTICIDAD a compresión en el hormigón. Sistema automático de control de cambio del ritmo
también cuando se libera la carga, aplicable sólo a las prensas de alta
estabilidad con Servo-Plus Evolution. UNI 6556, ASTM C469, ISO 6784,
DIN 1048. Detalles técnicos: ver pág. 190
C121-07
SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con
bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad.
Ver pág. 214
C107-10 TOPES DE REFRENTADO (dos
unidades) para probetas cilíndricas
C107-10
de 150 mm y 6”
C107-20 ALMOHADILLAS DE NEOPRENO
(dos unidades) para probetas cilíndricas de Ø 150 mm dureza Shore
A 60
C110-30
PLATO SUPERIOR DE COMPRESIÓN + ROTULA, para fijar en la máquina de ensayo en sustitución del dispositivo estándar, para obtener mayor
espacio libre vertical de la cámara de ensayo y cumplir con las Normativas
ASTM C39 y AASHTO T22
Dimensiones del plato: diámetro 165 x 30 mm
Peso: 10 kg aprox.
Detalles técnicos: ver pág. 213
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo de la máquina para
activar una segunda prensa.
Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD,
C115-01
completa con “transductor de presión adecuado”. Rango recomendado 0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02 GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN,
completa con “células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
sección C
ACCESORIOS PARA MÁQUINAS DE 3000 kN:
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C107-01 DISPOSITIVO DE AUTO-CENTRADO para probetas cúbicas
de 100 y 150 mm de lado, y probetas cilíndricas de 100 y 150
mm de diámetro. Detalles técnicos: ver pág. 213
C100 Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C103
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos: ver pág. 12
C106
DISPOSITIVO PARA ENSAY DE FLEXIÓN para probetas prismáticas de
hormigón. EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:118
NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos de
flexión en probetas prismáticas
de hormigón con maquinas
digitales.
Detalles técnicos: ver pág. 14
C106
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349. Detalles técnicos y
otros modelos: ver pág. 212
E170
C126
BANCADA de sustentación para prensas. Ver pág. 214
instrumentos para ensayos de materiales
183
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
“DE ALTA ESTABILIDAD”
Para ensayar bloques máx. 500X300 mm, probetas cúbicas de hasta 200 mm de lado y probetas
cilíndricas de hasta 160x320 mm de diámetro
sección C
NORMAS: EN 12390-4, EN 772-1 / UNI 6686, parte 3 / BS 1881:115, 6073 / DIN 51220, 51302 / NF P18-411 / UNE 83304
ASTM C39, E447 / AASHTO T22
184
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos para ensayos con bloques: 283 mm
- Platos de compresión para bloques de 510x320x55 mm
- Distancia máxima entre platos para ensayos con probetas cúbicas y
cilíndricas: 336 mm
- Platos de compresión para ensayos con probetas cúbicas y cilíndricas
de diámetro 287x60 mm.
- Manómetros de 250 mm de diámetro con escalas de resistencia específica para probetas cúbicas de 150 mm y para probetas cilíndricas
150 y 160 mm de diámetro
- Graduación de manómetros: 3000 kN con divisiones de 10 kN - 600
kN con divisiones de 2 kN
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final
de su recorrido máximo y así evitar la salida del pistón fuera del
cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x520x1500 mm
- Peso: 1350 ÷ 1400 kg
C089-19A + C127N
C117
C089-17D + C127N
COMPRESIÓN 3000 kN de alta estabilidad Bloques
Modelo
Motorizado
1
Manómetro
•
•
•
•
•
C089-15
C089-16
C089-17 D
C089-19 A
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
2
Digitec
Autotec
Manómetros
mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
HO RMIGÓN
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas Ø
150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-15 SUPLEMENTOS, 50 + 50 mm de alto para probetas cilíndricas
Ø 110x220 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
C111-50
SUPLEMENTO
Se elimina el complicado procedimiento para
levantar el plato rectangular inferior y agregar
suplementos. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
C112-05
KIT DE 4 ASAS para levantar el plato inferior, por lo que la colocación de
suplementos es más fácil. Detalles técnicos: ver pág. 217
C117
CARRO DESLIZANTE, para facilitar la extracción del bloque del plato
superior, para realizar ensayos en bloques o probetas cúbicas y cilíndricas
estándares.
C127N IMPRESORA GRÁFICA de papel térmico incorporada para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10 SOFTWARE para ensayos de compresión para máquinas
Digitec. Ver pág. 14
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec. Ver pág. 14
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN INDIRECTA para adoquines y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo a TRACCIÓN
C103-01
INDIRECTA para adoquines y probetas
cúbicas de dimensiones máx. 300x500mm.
EN 1338, 12390-6. Detalles técnicos: ver pág. 211
sección C
ACCESORIOS PARA MÁQUINAS DE 3000 kN BLOQUES:
C109-12 SOFTWARE para ensayos de Tracción Indirecta con maquinas
digitales. Detalles técnicos. Ver pág. 14
C106
DISPOSITIVO PARA ENSAYO DE FLEXIÓN para probetas prismáticas
de hormigón.
EN 12390-5 / ASTM C78, C293 / AASHTO T97 / BS 1881:118
NF P18-407 / UNI 6133. Detalles técnicos: ver pág. 212
C109-11
SOFTWARE para ensayos de
flexión en probetas prismáticas
de hormigón con maquinas
digitales.
Detalles técnicos: ver pág. 14
C106
C109-10
Software de compresión
C121-08 SISTEMAS DE PROTECCION ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
C115-01
VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor de bombeo
de la máquina para activar una segunda
prensa. Detalles técnicos: ver pág. 215
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión
adecuado”, solo para maquinas digitales.
Rango recomendado 0-250kN. Detalles
C115-01
técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE
BAJA CAPACIDAD 0-300kN,
C097-01
completa con “células de carga medidoras de esfuerzo”,
solo para maquinas digitales.
Detalles técnicos: ver pág. 210
C123
Software “Servonet”
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
E170
C126
BANCADA de sustentación para prensas.
Ver pág. 214
instrumentos para ensayos de materiales
185
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN
“DE ALTA ESTABILIDAD”
Para ensayar bloques de máx. 500X300 mm, probetas cúbicas de hasta 200 mm de lado y probetas cilíndricas de hasta Ø 160x320 mm
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORMAS: EN 12390-4, EN 772-1 / UNI 6686, parte 3 / BS 1881:115, 6073 / DIN 51220, 51302 / NF P18-411
UNE 83304 / ASTM C39, E447 / AASHTO T22
186
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima entre platos para ensayos con bloques: 283 mm
- Platos de compresión para bloques de 510x320x55 mm
- Distancia máxima entre platos para ensayos con probetas cúbicas y
cilíndricas: 336 mm
- Platos de compresión para ensayos con probetas cúbicas y cilíndricas
de diámetro 287x60 mm
- Clase de precisión: Clase 1.0
- Recorrido máximo del pistón: 60 mm aprox.
- Sistema hidráulico de retorno automático del aceite al llegar al final
de su recorrido máximo y así evitar la salida del pistón fuera del
cilindro.
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 750x520x1500 mm
- Peso: 1350 ÷ 1400 kg
ACCESORIOS:
C104-04
CÓNSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
C089-19N + C104-04 + C127N
C104-05
PAQUETE DE TELEASISTENCIA EN
LÍNEA
La máquina cuenta con una conexión
a Internet a través del cual el servicio
de Atención al Cliente Matest ofrece
soporte en tiempo real para analizar el
problema, para encontrar una solución
posible y efectuar la ejecución del
ensayo.
C117
C089-17N + C127N
C089-19N + C127N
COMPRESIÓN 3000 kN de alta estabilidad Bloques
Modelo
C089-17 N
C089-19 N
instrumentos para ensayos de materiales
Motorizado
•
•
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
ACCESORIOS PARA MÁQUINAS DE 3000 kN BLOQUES:
C111-32 SUPLEMENTO, 20 mm de alto para probetas cilíndricas
Ø 150x300 mm
C111-12 SUPLEMENTOS, 76 + 50 mm de alto para probetas cúbicas de
lado 200 mm
C111-13 SUPLEMENTOS, 76 + 50 + 50 mm de alto para probetas
cúbicas de lado 200 y 150 mm
C111-14 SUPLEMENTOS, 76 + 50 + 50 + 50 mm de alto para probetas
cúbicas de lado 200, 150 y 100 mm
C111-24 SUPLEMENTO, 50 mm de alto
C111-25 SUPLEMENTO, 76 mm de alto
Nota: las probetas cilíndricas de Ø 160x320 mm
no requieren ningún suplemento.
C111-50
SUPLEMENTO
Se elimina el complicado procedimiento
C111-50
para levantar el plato rectangular inferior
y agregar suplementos. Detalles técnicos: ver pág. 217
COMO ALTERNATIVA:
C112-05
KIT DE 4 ASAS para levantar el plato inferior,
por lo que la colocación de suplementos es
C112-05
más fácil. Detalles técnicos: ver pág. 217
C117
CARRO DESLIZANTE, para facilitar la extracción del bloque del plato
superior, para realizar ensayos en bloques o probetas cúbicas y cilíndricas
estándares.
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Servo-Plus Evolution. Ver pág. 14
C104-10N
SERVO-STRAIN
Software Servo controlado,
sistema de:
- Carga o Resistencia
- Desplazamiento
- Esfuerzo
Este sistema sólo se puede
utilizar con maquinas Servo-Plus Evolution mod. C089-19N. C104-10N
Detalles técnicos, ver Pág. 136
C125N
Determinación del MÓDULO SECANTE DE ELASTICIDAD en la
compresión del hormigón. Sistema automático de control de cambio del
ritmo también cuando se libera la carga, aplicable sólo a las prensas de alta
estabilidad con Servo-Plus Evolution.
UNI 6556, ASTM C469, ISO 6784, DIN 1048.
Detalles técnicos: ver pág. 190
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”. Rango recomendado 0-250kN. Detalles
técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA
CAPACIDAD 0-300kN, completa
C097-01
con “células de carga medidoras de esfuerzo”.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Sólo se aplica en
máquinas digitales.
C100
sección C
HO RMIGÓN
Dispositivo de ensayo de TRACCIÓN INDIRECTA para probetas cilíndricas EN 12390-6 / ASTM C496. Detalles técnicos y
otros modelos: ver pág. 211
C100
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas
cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-01
Dispositivos de ensayo a TRACCIÓN INDIRECTA
para adoquines y probetas cúbicas de dimensiones máx. 300x500mm.
EN 1338, 12390-6. Detalles técnicos: ver pág. 211
C109-12N
SOFTWARE para ensayos de
Tracción Indirecta.
Detalles técnicos. Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO
DE FLEXIÓN para probetas
prismáticas de hormigón
EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón.
Detalles técnicos:
ver pág. 14
C106
C121-08 SISTEMAS DE PROTECCIÓN ANTIIMPACTOS, de policarbonato, con bisagras y cierre, según Directiva de la CE. Ver pág. 214
C121-51 INTERRUPTOR DE PARO de seguridad. Ver pág. 214
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos: ver pág. 212
C115-01 VÁLVULA HIDRÁULICA DE DOS VÍAS, conectada al motor
de bombeo de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C126
BANCADA de sustentación para prensas.
Ver pág. 214
E170
instrumentos para ensayos de materiales
187
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE COMPRESIÓN CAPACIDAD 3000 kN Y 5000 kN
“DE ALTA ESTABILIDAD ”
Bastidor isostático sobredimensionado de elevadas prestaciones, ideal para laboratorios centrales y centros de investigación. Para ensayos de muestras de alta resistencia,
“muestras explosivos”, rocas y cerámicas entre otros.
3ISTEMADIGITALDEPANTALLATfCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección C
NORME: EN 12390-4 / BS 1881:115 / DIN 51220, 51223, 51302 / UNI 6686 parte 3 / NF P18-411
ESPECIFICACIONES TÉCNICAS:
- Bastidor de alta de rigidez: 0,3 mm a carga máx.
- Cuatro columnas cromadas de diámetro. 150 mm
(Ø 180 mm para la versión kN 5000)
- Platos de compresión de diámetro 316 x 60 mm
- Dureza del plato: 60 HRC
- Distancia máxima entre platos: 411 mm
- Distancia máxima entre columnas: 321 mm
- Recorrido máximo del pistón: 100 mm
- La presión hidráulica de trabajo: 360Bar en 3000kN (o 5000 kN)
- Rotula en baño de aceite, con juego axial nulo y hasta 3 º de inclinación
- Protectores de seguridad según la Directiva CE de policarbonato y
aluminio
- Grado de precisión “1”
- Dimensiones de la prensa de 3000 kN: 725 x 710 x 1570h mm
- Dimensiones de la prensa de 5000 kN: 750 x 750 x 1700h mm
- Alimentación: 230V monofásica 50Hz 750W
- El peso de la prensa de 3000 kN: 2500 kg
- El peso de la prensa de 5000 kN: 4000 kg
188
C088-01N
C087-01N
COMPRESIÓN 3000/5000 kN de alta estabilidad
Modelo
Código
3000 kN
3000 kN
5000 kN
5000 kN
C087 N
C087-01 N
C088 N
C088-01 N
instrumentos para ensayos de materiales
Motorizado
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
•
•
ACCESORIOS PARA MÁQUINAS DE 3000 kN y 5000 kN:
C087-11 SUPLEMENTO, 50 mm de alto
C087-12 SUPLEMENTO, 25 mm de alto
Nota: La distancia vertical entre los platos de compresión es de 411 mm.
El operador tendrá que comprar los Suplementos necesarios para reducir
la distancia entre los platos de compresión y la muestra sometida a ensayo
a fin de obtener la distancia correcta aproximada de 10 a 15 mm.
C112-11
CONJUNTO DE PLATOS SUPERIOR + INFERIOR COMPRESIÓN
GRANDES + RÓTULA 310x510x55 mm para ensayar “también” bloques.
Es necesario tener también el carro deslizante mod. C117.
C117
CARRO DESLIZANTE, para facilitar la
extracción del bloque del plato
superior
C112-11
C117
C127N
IMPRESORA GRÁFICA de papel
térmico, incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-10N SOFTWARE para ensayos de compresión para máquinas con
Cyber-Plus Evolution. Ver pág. 14
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina con Servo-Plus Evolution. Ver pág. 14
C104-10N
SERVO-STRAIN
Software servo-controlado,
sistema de:
- Carga o Resistencia
- Desplazamiento
- Esfuerzo
Este sistema sólo se puede
utilizar con los modelos C087-01N y C088-01N
de maquinas Servo-Plus Evolution.
Detalles técnicos, ver pág. 136
C104-10N
C125N
Determinación del MÓDULO SECANTE DE ELASTICIDAD en la
compresión del hormigón. Sistema automático de control de cambio del
gradiente, incluso cuando se libera la carga, aplicable sólo a las prensas de
alta estabilidad con Servo-Plus Evolution.
UNI 6556, ASTM C469, ISO 6784, DIN 1048.
Detalles técnicos: ver pág. 190
C115-01
VÁLVULA HIDRÁULICA DE DOS VIAS, conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C115-01
C097-01
GAMA DIGITAL DUAL DE
BAJA CAPACIDAD, completa
con “transductor de presión
adecuado”. Rango recomendado
C097-01
0-250kN. Detalles técnicos: ver pág. 210
COMO ALTERNATIVA:
C097-02
GAMA DIGITAL DUAL DE BAJA CAPACIDAD 0-300kN, completa con
“células de carga medidoras de esfuerzo”. Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
sección C
HO RMIGÓN
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C103
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para adoquines y probetas
cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
189
C100
C109-12N
SOFTWARE para ensayos de
tracción indirecta.
Detalles técnicos. Ver pág. 14
C103
C106
DISPOSITIVO PARA ENSAYO
DE FLEXIÓN para probetas prismáticas de hormigón.
EN 12390-5 / ASTM C78, C293 / AASHTO T97
BS 1881:118 / NF P18-407 / UNI 6133
Detalles técnicos: ver pág. 212
C109-11N
SOFTWARE para ensayos
de flexión en probetas
prismáticas de hormigón.
Detalles técnicos: ver pág. 14
C106
C123N
Software “Servonet”
E170
E170
DISPOSITIVO DE COMPRESIÓN para
ensayar probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349. Detalles técnicos y otros modelos: ver pág. 212
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
190
C125N
C125N + C089-04N + H009-01
Determinación del MÓDULO ELÁSTICO
secante a compresión del hormigón
Sistema Automático con el control del
cambio de gradiente incluso en la Pantalla
durante un ensayo y
liberación de la carga
NORMAS: UNI 6556 / ASTM C469 / ISO 6784 / DIN 1048
marcadores para indicar cualquier cambio.
Se puede utilizar con una máquina de ensayo MATEST de alta estabilidad,
con capacidad de 2000 o 3000 o 5000 kN acoplado al sistema automático
servo-controlado “Servo-Plus Evolution” (mod. C104N).
El equipo comprende:
• Sistema hidráulico
Se trata de una instalación hidráulica que presenta una válvula de alto
rendimiento controlada directamente por la unidad digital que garantiza
el control automático del gradiente de carga, manteniendo una cierta
carga y el control del gradiente de carga en descenso (al disminuir la
carga).
El control del gradiente de carga se realiza por una válvula muy sensible
accionada por un motor paso a paso y permite una acción micrométrica sobre el gradiente garantizando excelentes resultados.
Un sensor de posición láser permite un posicionamiento rápido del
pistón. Garantizando un suave contacto al inicio del ensayo de alrededor de 0,1 por mil de la capacidad máxima.
• Sistema electrónico de medida
Las elevadas prestaciones del control y de la unidad de procesamiento
de datos, son controlados por un microprocesador de 32 bits, que
puede gestionar hasta 8 canales de alta resolución para el control de
las células de carga o transductores con puente de galgas extensiométricas.
La unidad contiene dos convertidores Analógico/Digital de última de
instrumentos para ensayos de materiales
C125-13
C134
generación con una resolución de 24 bits. El sistema procesa las señales
procedentes de las células de carga y de los extensómetros almacenando todos los resultados necesarios para su posterior procesamiento
según las normas internacionales actualizadas para esta aplicación.
• Software para la adquisición y elaboración de datos UTM2
Licencia para el Módulo Elástico en hormigón.
El software ha sido desarrollado en la línea funcional del ya conocido
software UTM-2 (menú Windows). Contiene los parámetros de las
principales normas utilizadas, pero que el usuario pueda modificar según desee, personalizando el perfil del ensayo, que será luego ejecutado
de forma totalmente automática por la máquina de ensayo.
HO RMIGÓN
El software ofrece la posibilidad de imprimir en una impresora estándar un certificado del ensayo donde se indican todos los datos relativos
al ensayo y el gráfico del ensayo. El software incluye la licencia “Servonet” mod. C123N, mientras que las galgas extensométricas (se proponen dos modelos: A y B) no se incluyen en el suministro estándar y deben solicitarse por separado (ver accesorios).
ACCESORIOS:
C125-01N
SOFTWARE PARA ENSAYOS DE MÓDULO DE ELASTICIDAD
EN ROCAS
NORMAS: ASTM D3148, D2938, D5407, D2664 / UNI 9724-8 - ISRM
NOTA:
El Módulo de Elasticidad en Hormigón mod. C125N se puede
utilizar junto con:
A) GALGAS EXTENSOMÉTRICAS (MEDIDORAS DE ESFUERZO), ELÉCTRICOS, DE UN SOLO USO, disponibles en
diferentes tamaños, mod. C125-10 hasta el C125-13
(ver accesorios).
o:
B) GALGAS EXTENSOMÉTRICAS / COMPRESSOMETROS,
electrónicos, universales, bastidor mecánico, mod. C134
(ver accesorios).
COMO ALTERNATIVA:
B) C134
GALGA EXTENSOMÉTRICA/ COMPRESOMÉTRICA,
ELECTRÓNICA, UNIVERSAL, BASTIDOR MECÁNICO.
Se puede utilizar únicamente con
muestras de con una altura mínima
de 130 mm.
Detalles técnicos: ver pág. 192
sección C
El usuario puede introducir una serie de datos relativos a la muestra que se ensaya y el tipo de ensayo que se desea realizar, por ejemplo: la
forma de la muestra (probeta cilíndrica - probeta cubica-bloque), dimensiones, edad de la muestra, promedio de resistencia de rotura, etc....
El equipo permite la verificación de la lectura corregida de las galgas extensométricas y, si todo está dentro de las tolerancias previstas, se
gestiona el valor de la deformación media indicada en los transductores y se procesa en la unidad digital, que lo transmite por medio de la
comunicación del puerto RJ (conexión de red) a un ordenador personal, que puede ser el del usuario final o suministrado por separado,
todos los datos del ensayo. Estos datos serán procesados por el software y transformados en un gráfico de carga/deformación y carga/
tiempo, según lo indicado en las Normas Internacionales.
191
C134-10
PLANTILLA, para regular y calibrar la
longitud de base de la galga extensométrica C134.
C134
ACCESORIOS:
A) GALGAS EXTENSOMÉTRICAS (MEDIDORAS DE
ESFUERZO), DE UN SOLO
C125-10...C125-13
USO, ELECRICOS
Paquete de 10 unidades
Modelos disponibles:
C125-10 Galga extensométrica eléctrica, longitud de base 10 mm
C125-11 Galga extensométrica eléctrica, longitud de base 20 mm
C125-12 Galga extensométrica eléctrica, longitud de base 30 mm
C125-13 Galga extensométrica eléctrica, longitud de base 60 mm
C125-15
KIT para la aplicación de las galgas extensométricas de un solo uso,
compuesto por: cola, soldador, líquido limpiador, accesorios y todo
contenido en un maletín.
C125-09
MÓDULO DE INTERFAZ, “accesorio necesario” para conectar
hasta 4 galgas extensométricas eléctricas de un solo uso. Este
módulo también permite la
calibración automática de la
tara y del rango de medición
tras una compensación térmica
especial. Esto garantiza una
exactitud cinco veces superior C125-09
a la solicitada por las Normas.
Ensayo con deformaciones longitudinales y transversales
Datos del ensayo
instrumentos para ensayos de materiales
HO RM I G ÓN
ENSAYO DE DETERMINACIÓN DE LA SECANTE DEL MÓDULO ELÁSTICO A
COMPRESIÓN EN MUESTRAS DE HORMIGÓN Y MORTERO
C134
sección C
EXTENSÓMETRO / COMPRESÓMETRO Electrónico Universal
192
NORMAS: ASTM C469 / ISO 6784 / BS 1881:121 / DIN 1048:1
Formado por dos piezas de aluminio anodizado, una fija y otra deslizante y alojando un transductor de desplazamiento que mide con gran
precisión el movimiento de dos puntos cónicos de acero templado, y fijados en ambos extremos del sensor electrónico. Una plantilla de aluminio
(mod opcional C134-10) se utiliza para regular y para calibrar la longitud de la base. Los dos puntos cónicos están acoplados a la superficie de la
muestra con un sistema de fijación rápido y sencillo a través
de dos correas elásticas ajustables. El instrumento está equiJuego de 3 unidades
pado con un mando mecánico para bloquear y desbloquear
fijas a un cilindro
el transductor de desplazamiento, lo que permite mantener
a salvo la longitud de la base seleccionada durante la fijación
del dispositivo a la muestra. Normalmente el ensayo se
realiza en probetas cilíndricas mediante el uso de tres
extensómetros / compresómetros, y en probetas cúbicas o
probetas prismáticas mediante el uso de 2 o 4 instrumentos. El extensómetro es adecuado para ensayo de probetas
cúbicas, cilíndricas y probetas prismáticas, con una altura
mínima de 130 mm. También es posible ensayar prismas de
C134-10
mortero 40x40x160 mm mediante el uso de un bloque
reductor de longitud.
Manómetro de longitud ajustable desde 50 a 160 mm
Alimentación de hasta 10 V
Recorrido: + / - 1,5 mm
Sensibilidad inferior a 0,01 micras
Se suministra completo con el bloque reductor de longitud
para prismas de mortero, correas elásticas, maletín de
Bloque para muestras
transporte. Peso: 1.000 g aprox.
de 40x40x160 mm
ACCESORIOS:
C134-10 PLANTILLA, fabricada con aluminio anodizado, utilizada
para regular y calibrar la longitud de la base.
S337-51 PROCESO DE CALIBRACIÓN con un Extensómetro /
Compresómetro combinado con una unidad digital.
Los Extensómetros / Compresómetros Electrónicos Universales
mod. C134 (así como el Compresómetro C130N y el Compresómetro / Extensómetro C133 conectados a transductores de
esfuerzo lineal, ver página siguiente), pueden ser usados con:
- Máquinas de compresión Matest equipadas con Cyber-Plus
Evolution con pantalla táctil (pág. 130)
- Máquinas de compresión Matest
equipadas con Servo-Plus Evolution
con pantalla táctil (pág. 130)
El cable eléctrico del transductor de
desplazamiento se conecta “directamente” a uno de los ocho canales
disponibles de la unidad digital de
Cyber / Servo-Plus.
A través del software adecuado (mod
accesorios. C134-05) la unidad digital
elabora automáticamente los resultados, facilitando el gráfico de la carga
/ deformación con la impresión del
certificado.
instrumentos para ensayos de materiales
C134-05
SOFTWARE para el ensayo del Módulo Elástico en muestras de
hormigón y mortero.
Adquisición automática de datos y procesamiento, gráfica carga /
deformación e impresión de certificados, con gestión directa de la
máquina de ensayos, o remota a través de PC.
Este software sólo puede ser utilizado con los Sistemas Cyber /
Servo-Plus Evolution.
Todos estos Extensómetros / Compresómetros se pueden
utilizar con otras máquinas de compresión, incluso de otros
fabricantes, mediante la conexión al sistema semiautomático de adquisición de datos:
S335N
CYBER-PLUS EVOLUTION 8 CANALES
UNIDAD DE “PANTALLA TÁCTIL”
Mide las deformaciones del extensómetro y la carga
aplicada a la muestra mediante gráfica simultánea en
pantalla de hasta 3 variables (por ejemplo: carga,
deformación, tiempo, etc.) con todo el almacenamiento de datos y de memoria ilimitada.
Detalles técnicos: ver pág. 427
C134 con maletín
HO RMIGÓN
MÓDULO DE ELASTICIDAD ESTATICO DEL HORMIGÓN
C130N
PROBETAS CILINDRICAS DE Ø 150x300, 160x320 mm Y 6”x12”
NORMA: ASTM C469
Se utiliza para determinar la tensión y deformación característica
en muestras de hormigón. Consta de dos anillos de acero para fijar
la muestra, dos barras para calibrar la longitud, y un dispositivo con
asiento esférico para apoyar el comparador. Suministrados “sin”
reloj comparador o transductor de esfuerzo que deben pedirse
por separado (ver accesorios).
C130N + S375
ACCESORIOS NECESARIOS:
S375 RELOJES COMPARADORES, 5 mm de recorrido con
subdivisiones de 0,001 mm.
COMO ALTERNATIVA:
S336-11 TRANSDUCTOR ELECTRÓNICO DE DESPLAZAMIENTO
LINEAL, 10 mm de recorrido, con cable. Detalles técnicos:
ver pág. 417
NOTA:
El Compresómetro C130N y el Compresómetro / Extensómetro
C133 conectado a los transductores electrónicos de desplazamiento lineal, (accesorios mod. S336-11), se pueden utilizar con
máquinas de compresión Matest equipadas con Cyber / Servo-Plus
Evolution (ver pág. 130). El transductor de desplazamiento está
conectado “directamente” a uno de los ocho canales disponibles en
la unidad digital Cyber / Servo-Plus.
A través del software adecuado (accesorios mod. C134-05) la
unidad digital elabora de forma automática los datos, suministra el
gráfico de carga / deformación con la impresión del certificado.
C130N + C133 + S375 (2)
C130N + S336-11
C133
Compresómetro - Extensómetro
NORMA: ASTM C469
Para medir la deformación axial y la extensión diametral de las
probetas cúbicas de diámetro 150x300mm, 160x320mm, 8”x 12”
sometidas a esfuerzo de compresión, mediante la determinación
del módulo de elasticidad. Se compone de un anillo central para la
medida de la extensión diametral, “que se fija en el compresómetro
C130N”. Suministrados “sin” relojes comparadores o transductores
lineales de deformación (se requieren dos) deben pedirse por
separado (ver accesorios).
C130 N + C133 + S335N + S336-11(2)
sección C
Compresómetro
C134-05
SOFTWARE para el ensayo del Módulo Elástico en muestras de
hormigón y mortero. Procesamiento y adquisición de datos automática, gráfico de carga / deformación e impresión de certificados, con
gestión directa de la máquina de ensayo, o remota a través de PC.
Este software tan sólo puede utilizarse con los Sistemas Cyber /
Servo-Plus Evolution. El Compresómetro C130N y el Compresómetro / Extensómetro C133 se pueden utilizar con otras máquinas
de compresión, incluso de otros fabricantes, mediante la conexión
al sistema semiautomático de adquisición de datos:
S335N
CYBER-PLUS EVOLUTION 8 CANALES
UNIDAD DE “PANTALLA TÁCTIL”
Mide las deformaciones del extensómetro, y si se conecta al transductor de presión de la máquina de compresión mide también la
carga aplicada a la muestra con el gráfico simultáneo en pantalla de
hasta 3 variables (por ejemplo: carga, deformación, tiempo, etc.) con
el almacenamiento de todos los datos y memoria ilimitada. Detalles
técnicos: ver pág. 427
NOTA:
El Ensayo del Módulo de Elasticidad, que cumple plenamente con la
norma ASTM C469, debe llevarse a cabo con una máquina Matest
Servo-Plus equipada con C125N (sistema automático de control
de velocidad en carga y descarga).
instrumentos para ensayos de materiales
193
HO RM I G ÓN
MÁQUINAS DE ENSAYO A FLEXIÓN
- Modelos motorizados o manuales
- Sistema de medida con manómetro de carga
sección C
- “Digitec” o “Cyber-Plus Evolution” unidad de pantalla gráfica
- “Autotec” o “Servo-Plus Evolution” sistema servo-controlado
automático
- Bastidor independiente, o combinado con otra
- Posibilidad de carga en dos puntos según lo prescrito en la
Norma EN 12390-5, o cargar en el punto central simplemente
con la eliminación del un rodillo superior y colocar el otro en
el centro.
PROPONEMOS DIFERENTES PRENSAS A FLEXIÓN:
194
SERIE C090
• Serie C090 con el bastidor para llevar a
cabo los ensayos de flexión en muestras
de probetas prismáticas de hormigón con
dimensiones máx. 150x150x750 mm conforme a las Normas:
EN 12390-5 / UNI 6133 / BS 1881:118
NF P18-407 / UNE 83305
ASTM C78, C293 / AASHTO T97
DIN 51227
Ver pág. 196
• Serie C091 con “bastidor totalmente
SERIE C091
instrumentos para ensayos de materiales
abierto” para realizar los ensayos de flexión
en muestras de probetas prismáticas de hormigón con dimensiones máx. 200x200x800
mm conforme a las Normas mencionadas
anteriormente y de realizar ensayos en:
- Bloques planos (ancho máximo 600 mm)
conforme a la BS 6073-1
- Losas y bordillos conforme a
EN 1340:2004 / BS 7263-1
- Bordillos conforme a la NF P98-302
- Cualquier tipo de viga con tamaño máx.
600xh250 mm (rodillos inferiores de longitud máx. 1325 mm)
Ver pág. 198
• C090-06 Serie con una prensa de elevada
rigidez a la flexión de 200 kN de capacidad,
para realizar ensayos en vigas de hormigón
de dimensiones máx. 150x150x750 mm, y
además, ensayos en:
- Bloques planos, máx. ancho de 600 mm
(BS 6073-1)
- Losas y Bordillos (BS 7263, NF P98-302)
- Cualquier tipo de viga de ancho máx.
de 600 mm y de 150 mm de altura máx.
- Absorción de energía en muestras
de hormigón proyectado
(EN 14488-3, 14488-5, UNI 10834)
Ver pág. 200
sección C
HO RMIGÓN
195
SERIE C090-06
• C093 Serie para realizar ensayos de flexión en muestras de
probetas prismáticas de hormigón con dimensiones máx. de
200x200x800 mm y para realizar ensayos en cualquier otro
tipo de producto de dimensiones máx. 550xh550 mm (distancia ajustable entre rodillos inferiores hasta 1325 mm máx.)
Ver pág. 204
Es también posible, mediante el uso de los accesorios adecuados,
llevar a cabo los siguientes ensayos:
Ductilidad en el hormigón reforzado con fibras (FRC), y del
hormigón con fibras revestidas de polímero (FRP)
Las normas: EN 14651, 11039-2 / ASTM C1018 (ver pág. 202)
Medición de la deflexión en probetas prismáticas de hormigón
de 100x100x400/500 mm y 150x150x600 mm.
Norma: ASTM C1018 (ver pág. 202)
- Ensayo de Compresión en prismas de mortero de 40,1x40x160
SERIE C093
mm rotos a flexión según las especificaciones de EN 196, DIN
1164 (dispositivos de mod. E170, E170-01 - ver pág. 212)
- Ensayos de Compresión en probetas cúbicas de mortero de 50 mm, conforme a la Norma ASTM C109 (dispositivo de compresión mod.
E171 - ver pág. 212)
- Ensayos de Compresión en probetas cúbicas de mortero de 70 mm, conforme a la Norma BS 4550 (dispositivo de compresión mod.
E171-01 - ver pág. 212)
- Ensayo de Tracción Indirecta en probetas cilíndricas de diámetro 100, 150, 160 mm según EN 12390-6 / NF P18-408 / BS 1881:117 /
ASTM C496 / UNI 6135 (dispositivo mod C101-01 - ver pág. 211)
- Ensayo de Tracción Indirecta en probetas cubicas de mortero y adoquines de hormigón, según EN 12390-6, 1338
(dispositivo mod C103 - ver pág. 211)
instrumentos para ensayos de materiales
HO RM I G ÓN
PRENSAS PARA ENSAYOS DE FLEXIÓN 150 kN CAPACIDAD
Para ensayos de flexión en muestras de probetas prismáticas de hormigón de dimensiones
máx. 150x150x600 (750) mm
sección C
NORMAS: EN 12390-5 / UNI 6133 / BS 1881:118 / NF P18-407 / UNE 83305 / AASHTO T97 / ASTM C78, C293 / DIN 51227
196
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima vertical entre los rodillos superior / inferior: 160 mm
- Dimensiones de los Rodillos: diámetro 40x160 mm
- Completo con 4 rodillos ajustables y articulados para la carga en dos puntos
- Distancia entre los rodillos inferiores ajustables de 100 hasta 455 mm
- Distancia entre los rodillos superiores ajustables de 40 hasta 155 mm
- Posibilidad de colocar fácilmente en el centro un rodillo superior para la carga
en el punto central
- Los rodillos están endurecidos, pulidos y rectificados
- Escalas graduadas para un fácil ajuste de los rodillos
- Manómetro de diámetro de 250 mm y con divisiones cada 0.5 kN
- Recorrido máx. del pistón de 50 mm aproximadamente
- Clase de precisión: Clase 1.0
- Dispositivo hidráulico para detener la carrera del pistón en su máximo recorrido, para evitar el bombeo del pistón fuera del cilindro.
- Alimentación (modelos motorizados): 230V monofásica, 50Hz 750W
- Dimensiones: 540x460x960 mm
- Peso: 180 ÷ 240 kg
C090-03N + C104-04 + C127N
C090-02D + C127N
C090-02N + C127N
C090-01 + C111-16
FLEXIÓN 150 kN de capacidad
Modelo
C090
C090-01
C090-02 N
C090-03 N
C090-02 D
C090-03 A
Manual
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Motorizado Manómetro Cyber-Plus Evolution Servo-Plus Evolution
Digitec
mod. C109N
mod. C104N
mod. C108N
(pág. 130)
(pág. 130)
(pág. 127)
•
•
•
•
•
•
•
•
•
•
Autotec
mod. C098N
(pág. 127)
•
HO RMIGÓN
C111-16 SUPLEMENTO, de 50 mm de altura para ensayos de vigas
100x100x400/500 mm
C127N IMPRESORA GRÁFICA de papel térmico, incorporada
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora
(paquete de 10 rollos)
C109-11N SOFTWARE para ensayos flexión con la máquina Cyber-Plus
Evolution (ver pág. 14)
C109-11 SOFTWARE para ensayos flexión con la máquina Digitec
(ver pág. 14)
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina Autotec (ver pág. 14)
C123N SOFTWARE “Servonet” para el control remoto a través del
ordenador de la máquina de Servo-Plus Evolution (ver pág. 14)
C093-11
DISPOSITIVO para los ensayos de flexión en
bloques de arcilla.
NORMA: UNI 9730-3
Detalles técnicos: ver pág. 219
C103
Dispositivo para ensayo de
TRACCIÓN INDIRECTA en
adoquines de auto bloqueo y
probetas cúbicas.
EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C093-11
sección C
ACCESORIOS PARA MÁQUINAS DE FLEXIÓN DE 150 kN:
C103
C109-12
SOFTWARE para ensayos de tracción indirecta con máquinas
Digitec. Detalles técnicos: ver pág. 14
C109-12N SOFTWARE para ensayos de tracción indirecta con la máquina de Cyber-Plus Evolution. Detalles técnicos: ver pág. 14
197
C123
Software “Servonet”
C109-11 Software de Flexión
C115-01
VÁLVULA HIDRÁULICA DE DOS VIAS, conectada al motor de bombeo de la máquina
para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C109-12 Gráfico de la ejecución del ensayo de tracción indirecta
C104-04
TORRE DE SERVO-PLUS EVOLUTION, el
conjunto de la bomba está encajado, para
mejorar el diseño de la máquina.
C115-01
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado” sólo
para las máquinas digitales. Rango
de selección de 10kN a 100 kN.
Detalles técnicos: ver pág. 210
C097-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
Aplicable sólo a máquinas digitales.
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
E170
E172-01
DISPOSITIVO DE FLEXIÓN para prismas de mortero 40,1 x40x160 mm.
EN 196 / EN ISO 679 (tan sólo puede utilizarse con la GAMA DIGITAL
DUAL DE BAJA CAPACIDAD de rango 0-15kN).
Detalles técnicos y otros modelos: ver pág. 322
E172-01
C126
BANCADA de sustentación para prensas.
Detalles técnicos: ver pág. 214
C126
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
PRENSAS PARA ENSAYOS DE FLEXIÓN 150 kN CAPACIDAD “BASTIDOR
TOTALMENTE ABIERTO”
Para ensayos de flexión en la probetas prismáticas de hormigón de dimensiones máximas
200x200x800mm, bloques planos, losas de piedra, bordillos, azulejos, losas, unidades de albañilería, y cualquier tipo de material que tenga de tamaño máx. 600x250 mm (longitud máxima
de los rodillos inferiores 1325 mm)
198
NORMAS: EN 12390-5 / EN 1340:4 / UNI 9730-3 / UNI 6133
BS1881:118, BS 6073-1, BS 7263 / NF P18-407, P98-302
UNE 83305 / AASHTO T97 / ASTM C78, C293 / DIN 51227
ESPECIFICACIONES TÉCNICAS:
- “Bastidor totalmente abierto” para un posicionamiento fácil y rápido de la
muestra entre los rodillos
- Distancia máxima vertical entre los rodillos superior / inferior: 260 mm, con
posibilidad de seleccionar las posiciones intermedias de 210, 160, 110 y 60 mm
- Dimensiones de los Rodillos: diámetro 40 x 610 mm
- Posibilidad de colocar fácilmente un rodillo superior en el centro, para
aplicar la carga en el punto central
- Escalas graduadas para un fácil ajuste de los rodillos
- Manómetro de diámetro de 250 mm y con divisiones cada 0,5 kN
- Recorrido del pistón de 110 mm aproximadamente
- Clase de precisión: Clase 1,0
- Pistón de acción simple con
contrapesos para optimizar
las fricciones
- Alimentación:
230V monofásica, 50Hz 750W
- Dimensiones:
1400x1200xh 1430 mm
- Peso: 350 kg
C091-02D + C127N + C091-12
C091-02N
+ C127N + C091-12
EL BASTIDOR SE PROPORCIONA “SIN” EL GRUPO DE RODILLOS SUPERIOR / INFERIORES, QUE DEBEN PEDIRSE POR SEPARADO (Posibilidad de
elegir entre diferentes tipos de grupos de rodillos. Vea accesorios).
C091-03N + C127N + C091-12
FLEXIÓN 150 kN de capacidad
Modelo
Motorizado
C091-01
C091-02 N
C091-03 N
C091-02 D
C091-03 A
instrumentos para ensayos de materiales
•
•
•
•
•
SISTEMA DE MEDICIÓN DE CARGA
Manómetro Cyber-Plus Evolution Servo-Plus Evolution
Digitec
mod. C109N
mod. C104N
mod. C108N
(pág. 130)
(pág. 130)
(pág. 127)
•
•
•
•
Autotec
mod. C098N
(pág. 127)
•
HO RMIGÓN
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD,
completa con “transductor de presión adecuado” sólo para las máquinas digitales. Rango
de selección de 10kN a 100 kN.
Detalles técnicos: ver pág. 210
ACCESORIOS PARA LA FLEXIÓN 150 kN
“BASTIDOR TOTALMENTE ABIERTO”:
C091-13
C091-13
PISÓN SUPERIOR (hecho de acero),
para los ensayos en BORDILLOS de
hormigón. El pisón está montado sobre
un acoplamiento giratorio y fijado a
la parte superior de la máquina para
aplicar el esfuerzo a la flexión en tres
puntos del bordillo, sin ningún tipo de
esfuerzo de torsión.
NORMA: EN 1340, 1339
C090-15
ENSAYO DE LA MEDIDA DE LA DEFLEXIÓN en vigas de hormigón
reforzado con fibras de 100x100x400 (500) mm y 150x150x500 (600) mm
NORMAS: ASTM C1018 / EN 11039-03, 14651-05, 14487-1, 14488-1
El ensayo se realiza con el equipo específico (dispositivo medición de la
desviación, transductores de desplazamiento) descrito en la pág. 202 y el
sistema automático servo controlado de carga y de desplazamiento Servo
Strain (ver pág. 136)
C097-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión. Aplicable sólo para
máquinas digitales.
C100
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
199
C103
Dispositivo para ensayo de
C103
TRACCIÓN INDIRECTA en
adoquines de auto bloqueo y
probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-02
Dispositivo para TRACCIÓN INDIRECTA en adoquines de auto bloqueo
y probetas cúbicas de dimensiones
máx. 300x500 mm.
EN 1338, 12390-6
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de
tracción indirecta con máquinas
digitales.
Detalles técnicos: ver pág. 14
C090-15
C093-11
DISPOSITIVO para los ensayos de
flexión en bloques de arcilla.
NORMA: UNI 9730-3
C115-01
sección C
C091-10 GRUPO DE RODILLOS: inferiores ajustables desde 75 hasta
525 mm, y “sólo un” rodillo superior central para el método
de un solo punto.
C091-11 GRUPO DE RODILLOS: inferiores ajustables desde 75 hasta
525 mm, y la parte superior ajustable desde 75 hasta 180 mm
para método de dos puntos.
C091-12 GRUPO DE RODILLOS: inferiores ajustables desde 75 hasta
1325 mm, y la parte superior ajustable desde 75 hasta 575 mm
para método de dos puntos.
C091-14 GRUPO DE RODILLOS: inferiores ajustables desde 75 hasta
1325 mm, y “sólo un” rodillo superior central para el método
de un solo punto.
C103-02
E170
C093-11
C127N IMPRESORA GRÁFICA incorporada, de papel térmico, para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-11 SOFTWARE para ensayos flexión con las máquinas Digitec y
Ciber-Plus Evolution (ver pág. 14)
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de las máquinas Autotec y Servo-Plus Evolution
(ver pág. 14)
C115-01
VÁLVULA HIDRÁULICA DE DOS VIAS, conectada al motor de bombeo
de la máquina para activar una segunda prensa.
Detalles técnicos: ver pág. 215
E170
DISPOSITIVO DE COMPRESIÓN para ensayar
probetas de mortero 40,1 x 40 mm.
EN 196 / ASTM C349.
Detalles técnicos y otros modelos:
ver pág. 212
E172-01
DISPOSITIVO DE FLEXIÓN para prismas
de mortero 40,1x40x160 mm.
EN 196 / EN ISO 679 (tan sólo puede
utilizarse con la GAMA DIGITAL DUAL
DE BAJA CAPACIDAD de rango 0-15kN).
Detalles técnicos y otros modelos:
ver pág. 322
E172-01
instrumentos para ensayos de materiales
HO RM I G ÓN
BASTIDOR A FLEXIÓN CON ESTABILIDAD DE “ALTA RIGIDEZ” CAPACIDAD 200 kN
Para ensayos de flexión en la probetas prismáticas de hormigón de dimensiones máximas
150x150x600/750 mm, bloques planos, losas de piedra, bordillos, azulejos, losas, unidades de albañilería, y cualquier tipo de material que tenga de tamaño máx. 600 mm y máx. altura 250 mm.
sección C
NORMAS: EN 12390-5 / EN 1340:4 / UNI 6133, 9730-3 / BS 1881:118, 6073-1, 7263 / ASTM C78, C293 / NF P18-407, P98-302
UNE 83305 / AASHTO T97 / DIN 51227
200
ESPECIFICACIONES TÉCNICAS:
- Bastidor de alta rigidez con una deflexión
mínima a la carga máxima (0,9 mm).
- Capacidad de carga: 200 kN.
- Distancia máxima vertical entre rodillos
superior / inferior: 160 mm.
- Distancia horizontal de la cámara de ensayo:
720 mm.
- Escalas graduadas para un fácil ajuste de los
rodillos
- Recorrido del pistón de 110 mm aproximadamente
- Pistón de acción simple con contrapesos para
optimizar fricciones.
- Alimentación: 230V 50Hz 750W monofásica.
- Dimensiones: 990x97 xh 1105 mm.
- Peso: 190-250 kg
EL BASTIDOR SE PROPORCIONA “SIN” EL GRUPO DE
RODILLOS SUPERIOR / INFERIORES, PISÓN, SOPORTE
BASE, ETC. QUE DEBEN PEDIRSE POR SEPARADO
(vea accesorios).
C090-07N + C127N + C104-04 + C090-13
C090-06N + C127N + C090-13
C090-07A + C127N + C090-13
FLEXIÓN 200 kN de capacidad Alta Rigidez
Modelo
C090-06 N
C090-07 N
C090-06 D
C090-07 A
Capacidad kN
Cyber-Plus Evolution
mod. C109N
(pág. 130)
200
200
200
200
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Servo-Plus Evolution
Digitec
mod. C104N
mod. C108N
(pág. 130)
(pág. 127)
•
•
Autotec
mod. C098N
(pág. 127)
•
HO RMIGÓN
cadmio contra la corrosión.
Los rodillos inferiores tienen la distancia ajustable desde 75 hasta 900 mm,
y los rodillos superiores tienen la distancia ajustable desde 75 hasta 180
mm para ensayo en dos puntos de carga.
Posibilidad de colocar fácilmente un rodillo central superior para el ensayo
del punto de carga central.
Modelos:
C090-12 GRUPO DE RODILLOS superior e inferior, 160 mm de largo.
C127N IMPRESORA GRÁFICA incorporada, de papel térmico, para
modelos digitales.
C127-11 ROLLOS DE PAPEL TÉRMICO para la impresora (paquete de
10 rollos)
C109-11 SOFTWARE para ensayos flexión con las máquinas Digitec y
Ciber-Plus Evolution (ver pág. 14)
C123 SOFTWARE “Servonet” para el control remoto a través del
ordenador de las máquinas Autotec y Servo-Plus Evolution
(ver pág. 14)
C115-01 VÁLVULA HIDRÁULICA DE DOS
VIAS, conectada al motor de bombeo
de la máquina para activar una segunda
prensa. Detalles técnicos: ver pág. 215
C090-13 GRUPO DE RODILLOS superior e inferior, 613 mm de largo.
C090-14
ENSAYO DE ABSORCIÓN DE ENERGÍA en probetas de hormigón
proyectado.
NORMAS: EN 10834, 14488-3, 14488-5
El ensayo se realiza con el equipo específico (base cuadrada 700x700 mm,
elemento de carga, transductores de desplazamiento) descrito en la pág.
203 y el sistema de Software /
Firmware automático de carga
y de desplazamiento Servo
Strain (pág. 136)
C090-15
ENSAYO DE LA MEDIDA DE
LA DEFLEXIÓN en vigas de
hormigón reforzado con fibras
de 100x100x400 (500) mm y
C090-14
150x150x500 (600) mm
NORMAS: ASTM C1018
EN 11039-03, 14651-05, 14487-1, 14488-1
El ensayo se realiza con el equipo específico
(dispositivo medición de la
desviación, transductores de
desplazamiento) descrito en la
pág. 202 y el sistema automático
servo controlado de carga y de
desplazamiento Servo Strain
(ver pág. 136)
C091-13
PISÓN SUPERIOR (hecho de acero), para los
ensayos en BORDILLOS de hormigón.
El pisón está montado sobre un acoplamiento giratorio y fijo a la parte superior de la
máquina para aplicar el esfuerzo
a la flexión en tres puntos del bordillo,
sin ningún tipo de esfuerzo de torsión.
NORMA: EN 1340, 1339
C115-01
sección C
ACCESORIOS PARA LA FLEXIÓN 200 kN “ALTA RIGIDEZ”:
Rodillos de diámetro. 40 mm, templados y rectificados, revestidos de
C097-01
C097-01
GAMA DIGITAL DUAL DE BAJA CAPACIDAD, completa con “transductor de presión adecuado”. Rango de selección de 10kN a 100 kN.
Detalles técnicos: ver pág. 210
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de
calibración especial hace posible la concesión de la clase 1 en prácticamente toda la gama de las máquinas de compresión.
C100
Dispositivo de ensayo de TRACCIÓN
INDIRECTA para probetas cilíndricas
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos:
ver pág. 211
C100
C090-15
C103
Dispositivo para ensayo de TRACCIÓN INDIRECTA en adoquines de
auto bloqueo y probetas cúbicas. EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
COMO ALTERNATIVA:
C103-02
C103
Dispositivo para TRACCIÓN
INDIRECTA en adoquines de
auto bloqueo y probetas cúbicas
de dimensiones máx. 300x500 mm.
EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
C109-12
SOFTWARE para ensayos de tracción indirecta.
Detalles técnicos: ver pág. 14
C091-13
C093-11
DISPOSITIVO para los ensayos de flexión
en bloques de arcilla.
NORMA: UNI 9730-3
C093-11
E170
DISPOSITIVO DE COMPRESIÓN
para ensayar probetas de mortero
40,1 x 40 mm.
EN 196 / ASTM C349
Detalles técnicos y otros modelos:
ver pág. 212
C103-02
E172-01
DISPOSITIVO DE FLEXIÓN para
prismas de mortero 40,1 x40x160 mm. EN 196 / EN ISO 679 (tan sólo
puede utilizarse con la GAMA DIGITAL DUAL DE BAJA CAPACIDAD
de rango 0-15kN). Detalles técnicos y otros modelos: ver pág. 322
instrumentos para ensayos de materiales
201
HO RM I G ÓN
Medición de la deflexión en probetas prismáticas de hormigón reforzado con fibras de
100x100x400 (500) mm y 150x150x500 (600) mm durante el ensayo a flexión. NORMA: ASTM C1018
Determinación de la dureza, esfuerzo de la primera grieta (grieta de abertura) y la ductilidad
en el hormigón reforzado con fibras. NORMA: EN 11039-2
sección C
El equipo “sólo” se puede utilizar en el ensayo a flexión con
maquinas Servo-Plus Evolution mod:
202
- C091-03N Máquina a flexión de “cara-abierta”, de capacidad 150kN
- C090-07N Prensa a flexión de “alta rigidez” de capacidad 200kN
conectado con el Software / Firmware “Servo-Strain”
mod. C104-10N (ver pág. 136) para la gestión automática
de la carga y el desplazamiento.
El equipo consta de:
C090-15
DISPOSITIVO DE MEDICIÓN DE LA DESVIACIÓN
NORMA: ASTM C1018
Este dispositivo se fija directamente en las probetas prismáticas de
hormigón reforzado con fibras sometida a ensayo.
El dispositivo se coloca entre los soportes de carga de una prensa
a flexión para ser seleccionados entre los modelos mencionados
anteriormente. El ensayo se realiza mediante la aplicación de una
carga de flexión de la probeta prismática de hormigón con el control de la carga y los desplazamientos y con la medición automática
de la deflexión en la muestra sometida a carga.
Es posible ensayar probetas prismáticas de hormigón reforzado con
fibras de dimensiones 100x100x400 o 500 mm y 150x150x500
o 600 mm. El dispositivo de deflexión es de acero con acabado
cromado, este se suministra completo con los soportes del transductor, fijados verticalmente en los dos lados opuestos de la viga,
pero “sin” los dos transductores, para la medición de la deflexión
(mod. S336-11), y “sin” el transductor en forma de tenedor (mod.
C090-16) que se piden por separado.
Dimensiones: 300x450x300 mm. Peso: 8 kg
S336-11
TRANSDUCTOR DE DESPLAZAMIENTO, de alta precisión.
NORMA: ASTM C1018
Fijado en el dispositivo C090-15 para la medición de la deflexión y
la determinación de la dureza en vigas de hormigón
reforzado con fibras.
Recorrido: 10 mm
Completo con
cable y conector.
Se requieren dos
transductores.
C090-20
PUNTOS DE REFERÉNCIA
DE DATOS, ángulos, para
ser pegados en la superficie
de viga de hormigón para la
medición de la deflexión en los dos lados
opuestos (CTOD). Paquete de 24 piezas.
C090-18
C090-15
C090-16
TRANSDUCTOR EN FORMA DE HORCA
NORMA: UNI EN 11039-2
Para la medición del Desplazamiento de la Apertura de la Boca de
la Grieta (CMOD) y la Grieta de Base, Medianas y Desplazamiento
de Apertura de su Punta (CTOD)
Rango de medición: 5 mm
Completo con cable y conector
C090-18
C090-16
C090-18 PUNTO DE REFERÉNCIA DE
DATOS, para ser pegado en la cara
inferior de la viga de hormigón
para el ensayo de esfuerzo de la
primera grieta (CMOD).
Paquete de 24 piezas.
C104-10N
Gráfico del ensayo
C090-20
C090-07N + C090-13 + C104-10N + C090-15 + S336-11
instrumentos para ensayos de materiales
HO RMIGÓN
Ensayo de absorción energía en probetas de hormigón proyectado,
de acuerdo con las Normas: EN 10834, 14488-3, 14488-05
El equipo se puede utilizar “sólo” con la máquina de ensayos a flexión de Servo-Plus Evolution mod:
sección C
- C090-07N Prensa a flexión de “alta rigidez” 200kN de capacidad
conectado con el sistema automático servo controlado de carga y desplazamiento Servo-Strain mod C104-10N (ver pág. 136)
El equipo consta de:
C104-10N
Gráfico del ensayo
C127N
203
S336-14
C090-19
C090-07N + C104-10N + C090-14 + S336-14 + C090-19
C090-14
BASTIDOR DE BASE CUADRADA, dimensiones 700 x 700 mm,
completo con elemento superior de carga, para los ensayos de
absorción de energía en probetas de hormigón proyectado.
S336-12
TRANSDUCTOR DE DESPLAZAMIENTO, de alta precisión.
Se fija a la prensa de alta rigidez equipado con la base cuadrada.
Recorrido: 50 mm
Puente completo a 350 Ohm
Linealidad independiente: <0,1%
Estándar de sensibilidad: 2 mV / V
C090-19
SOPORTE para el transductor, que se fija a la prensa de alta rigidez
con base cuadrada
C104-10N Gráfico del ensayo
instrumentos para ensayos de materiales
HO RM I G ÓN
MÁQUINA UNIVERSAL TRANSVERSAL DE FLEXIÓN CAPACIDAD 150 kN
Para ensayos de flexión en muestras de probetas prismáticas de hormigón de tamaño
máximo 200x200x800 mm, bloques planos, losas de piedra, bordillos, azulejos, losas, bloques
de albañilería, tuberías y todo tipo de material que tenga de tamaño máx. 550xh550 mm
(rodillos inferiores longitud máx. 1300 mm)
sección C
NORMAS: EN 12390-5 / EN 1340:4 / UNI 6133 / BS 1881:118, 6073-1, 7263 / NF P18-407, P98-302 / UNE 83305
AASHTO T97 / ASTM C78, C293 / DIN 51227
204
ESPECIFICACIONES TÉCNICAS:
- Distancia máxima vertical entre rodillos superior / inferior:
máx. 825 - min. 65 mm ajustable cada 76 mm por polea manual
con contrapesos
- Dimensiones de los Rodillos: diámetro: 40x550 mm
- Completo con 4 rodillos ajustables y articulados para la carga en
dos puntos
- Distancia ajustable entre los rodillos inferiores desde 75 hasta
1325 mm
- Distancia ajustable entre los rodillos superiores desde 75 hasta
575 mm
- Posibilidad de colocar fácilmente en el centro un rodillo superior
para la carga en el punto central
- Escalas graduadas para un fácil ajuste de los rodillos
- Recorrido del pistón de 110 mm aproximadamente
- Pistón de acción simple con contrapesos para optimizar las
fricciones
- Alimentación: 230V monofásica, 50Hz 750W
- Dimensiones: 970x1400x2000 mm
- Peso: 800 ÷ 850 kg
C093-02N + C127N
C093-03N + C127N + H009-01
FLEXIÓN UNIVERSAL 150 kN de capacidad
Modelo
C093-02 N
C093-03 N
C093-02 D
C093-03 A
Motorizado
Cyber-Plus Evolution
mod. C109N
(pág. 130)
•
•
•
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE CARGA
Servo-Plus Evolution
Digitec
mod. C104N
mod. C108N
(pág. 130)
(pág. 127)
•
•
Autotec
mod. C098N
(pag. 127)
•
HO RMIGÓN
C097-01
GAMA DIGITAL DUAL DE
BAJA CAPACIDAD, completa
con “transductor de presión
adecuado”. Rango de selección de 10kN a 100 kN.
Detalles técnicos: ver pág. 210
C091-13
C093-11
DISPOSITIVO para los ensayos de flexión en bloques de arcilla.
NORMA: UNI 9730-3
C127N
IMPRESORA GRÁFICA de papel
térmico, incorporada.
C127-11
ROLLOS DE PAPEL TÉRMICO
para la impresora (paquete de 10 rollos)
C093-11
C109-11 SOFTWARE para ensayos flexión con las máquinas
Digitec y Ciber-Plus Evolution (ver pág. 14)
C123
SOFTWARE “Servonet” para el control remoto a
través del ordenador de las máquinas Autotec y ServoPlus Evolution (ver pág. 14)
C097-01
C097-05
CLASE 1, a partir del 1% en todo el recorrido. Con un procedimiento de calibración especial hace posible la concesión de la clase
1 en prácticamente toda la gama de
las máquinas de compresión.
C100
C100
Dispositivo de ensayo de
TRACCIÓN INDIRECTA para
probetas cilíndricas.
EN 12390-6 / ASTM C496.
Detalles técnicos y otros modelos: ver pág. 211
C103
Dispositivo para ensayo de
TRACCIÓN INDIRECTA en
adoquines de auto bloqueo
y probetas cúbicas.
EN 1338, 12390-6.
Detalles técnicos: ver pág. 211
sección C
C091-13
PISÓN SUPERIOR (hecho de acero),
para los ensayos en BORDILLOS de
hormigón. El pisón está montado sobre
un acoplamiento giratorio y fijo a la parte
superior de la máquina para aplicar el
esfuerzo a la flexión en tres puntos del
bordillo, sin ningún tipo de esfuerzo de
torsión.
NORMA: EN 1340, 1339
205
C103
C109-12
SOFTWARE para ensayos de tracción indirecta. Detalles técnicos:
ver pág. 14.
C109-12 Gráfico del ensayo
C123
Software “Servonet”
C109-11 Software de Flexión
C115-01
VÁLVULA HIDRÁULICA DE DOS VIAS, conectada al motor de
bombeo de la máquina para activar una segunda prensa. Detalles
técnicos: ver pág. 215
C115-01
E170
DISPOSITIVO DE COMPRESIÓN para ensayar probetas de
mortero 40,1 x 40 mm.
EN 196 / ASTM C349
Detalles técnicos y otros modelos: ver pág. 212
E170
E172-01
E172-01
DISPOSITIVO DE FLEXIÓN para prismas
de mortero 40,1 x40x160 mm.
EN 196 / EN ISO 679 (tan sólo puede utilizarse con la GAMA DIGITAL DUAL DE
BAJA CAPACIDAD de rango 0-15kN).
Detalles técnicos y otros modelos: ver
pág. 322
instrumentos para ensayos de materiales
HO RM I G ÓN
MÁQUINA DE ENSAYO DE TUBOS DE HORMIGÓN, CAPACIDAD DE CARGA 1000 kN
sección C
Diseñada para ensayar tubos de hormigón y tuberías de drenaje utilizados en obras de drenaje, agua y suministro de sistemas de riego, etc.
NORMA: EN 1916 comparable con la norma ASTM C301, C497
BS 5911 / DIN 4035
La máquina se compone de dos partes:
C109-09N Sistema Electro-Hidráulico de carga y control.
C093-05 Bastidor de acero para ensayos.
206
C109-09N
Sistema Electro-Hidráulico de carga y
control
Consiste en:
- Pistón de doble acción de aleación de acero + cilindro. El pistón
desciende.
máx. capacidad de carga: 1.000 kN
máx. recorrido del pistón: 400 mm aprox.
inserción en el bastidor superior de acero el acoplamiento de
media-cruz.
rótula fija en el pistón para una carga uniforme.
C109-09 N
- Cuadro de mandos Hydro-Plus Evolution de carga y control,
completo con grupo hidráulica multipistón, válvula de seguridad
de presión máxima, válvula de descompresión, control del flujo de
la válvula de aceite garantizando una velocidad de carga suave
y precisa.
- Unidad de Pantalla gráfica computerizada “Cyber-Plus Evolution”,
mod C109N (detalles técnicos: ver pág. 130) para la adquisición,
visualización, procesamiento, impresión y almacenamiento de los
datos de ensayos y certificados.
- Célula de carga eléctrica, capacidad de 1000 kN, para la medición
exacta de la carga del pistón.
- Dos mangueras de alta presión, 8 metros de largo para conectar
el cilindro a la bomba hidráulica.
Alimentación: 220V 50Hz 1000W
Dimensiones: 500 x 530 xh 1300 mm
Peso: 70 kg
C093-05
- Dos travesaños superiores, ascienden y descienden por un motor
de dos velocidades operado con el cabrestante.
El travesaño superior del bastidor está bloqueado en su posición
por pasadores introducidos a través de las columnas
- Dos soportes inferiores de 2500 mm de largo, sostienen el tubo
- Viga de carga superior, 2500 mm de largo, flotando en una rótula.
Dimensiones: 3200 x 2500 x 5800h mm aprox.
Peso: 4000 kg aprox.
C093-05
Bastidor de ensayo de acero
Para ensayar tubos con dimensiones:
- Diámetro mínimo de 450 mm / máximo de 2600 mm
- La longitud máxima. 2500 mm
Consiste en:
- Bastidor estructural de acero, atornillado con pernos de alta resistencia por lo que puede ser fácilmente montado / desmontado
para su entrega o cambio de sitio.
El bastidor tiene que ser anclado a una base de hormigón que
será preparada por el cliente.
- Capacidad de carga: 1000 kN
instrumentos para ensayos de materiales
NOTA:
El bastidor de ensayos se entrega desmontado y tiene que ser
montado en el sitio siguiendo las
instrucciones.
A petición del cliente se pueden
fabricar prensas de ensayos con
diferentes características.
El Cliente también se puede
fabricar localmente el bastidor de
ensayos, y comprar solamente el
sistema de carga / control.
C109-09N Detalles
sección C
HO RMIGÓN
207
Los sistemas “Cyber-Plus” y “Servo-Plus”
Evolution pueden gestionar hasta “ocho”
prensas diferentes para los ensayos
de compresión y flexión en: hormigón,
cemento, morteros, bloques, losas de
piedra, bordillos, módulo elástico automático del hormigón, cemento y piedras,
mediante el uso de prensas Matest, y
también las prensas existentes de otros
productores.
Nuestro departamento técnico está a
su disposición para resolver cualquier
exigencia específica.
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
OPCIÓN DE ACTUALIZACIÓN: SISTEMA DE ENSAYOS COMBINADOS DE DOS
PRENSAS
208
Todas las máquinas de ensayo de compresión motorizadas que figuran en las páginas anteriores se pueden actualizar con una válvula
hidráulica de dos vías para conexión y control (alternativas, y no simultáneas) a un segundo bastidor, como por ejemplo Prensa de flexión o
Prensa de compresión de cemento, con evidente funcionalidad y ventajas económicas (sobre todo en las soluciones digitales).
Una válvula de distribución hidráulica de dos vías, puede activar la prensa estándar o la segunda prensa combinada mediante la utilización
de una sola fuente de presión hidráulica.
La carga de la segunda prensa combinada se mide:
- Por el grupo de manómetros mediante un manómetro específico adicional en la segunda prensa.
- Por el grupo digital mediante la utilización de uno de los canales previstos en la unidad de lectura conectada al transductor de presión
específico fijado en la segunda prensa.
La prensa combinada adicional se suministra completa, con válvula hidráulica de distribución de dos vías, transductor de presión específico conectado a un canal de la unidad de lectura digital (o un manómetro específico), tubos, conectores, accesorios y certificado de calibración Matest.
El grupo de dos prensas se puede combinar con muchas soluciones
diferentes, de acuerdo con las exigencias específicas del cliente, con
la posibilidad de realizar:
- ENSAYOS DE COMPRESIÓN EN MUESTRAS DE PROBETAS
CÚBICAS Y CILÍNDRICAS Y BLOQUES DE HORMIGÓN,
eligiendo la máquina de compresión estándar entre los diferentes
modelos disponibles de 1300kN a 5000kN de capacidad
- ENSAYOS A FLEXIÓN EN PROBETAS PRISMÁTICAS DE HORMIGÓN, BLOQUES PLANOS, LOSAS DE PIEDRA, BORDILLOS,
LOSAS, BALDOSAS, etc.
- ENSAYOS DE COMPRESIÓN Y FLEXIÓN EN LAS MUESTRAS
DE MORTERO
- ENSAYOS DE TRACCIÓN INDIRECTA EN PROBETAS CILÍNDRICAS, ADOQUINES, PROBETAS CÚBICAS DE CEMENTO, etc.
La composición del grupo combinado se obtiene:
C053
C092
C092
Prensa a flexión de capacidad 150 kN,
(detalles técnicos y accesorios específicos en pág. 196) completo
con manómetro comparador, se utiliza junto con la lectura del
manómetro comparador de la máquina de ensayos a compresión.
C092-11
Prensa de flexión totalmente abierto de
150 kN de capacidad (detalles técnicos y accesorios
específicos en pág. 198) completo con el transductor de presión,
se utiliza junto con una máquina de compresión digital (Digitec,
Autotec, Cyber-Plus / Servo-Plus Evolution).
C055N
C092-01
C092-01
Prensa a flexión de capacidad 150 kN,
(detalles técnicos y accesorios específicos en pág. 196) completo con el transductor de presión, se utiliza junto con una
máquina de compresión digital (Digitec, Autotec, Cyber-Plus
Servo-Plus Evolution).
instrumentos para ensayos de materiales
C092-11 + C091-12
C055N + C126
HO RMIGÓN
C092-15
pág. 200) completa con transductor de presión, se utiliza junto con
una máquina de compresión digital (Digitec, Autotec, Cyber-Plus
Servo-Plus Evolution).
Este grupo de dos prensas ofrece la ventaja considerable para llevar
a cabo ensayos de compresión en muestras de probetas cúbicas,
cilíndricas y bloques de hormigón; ensayos a flexión en las probetas
prismáticas de hormigón, y con los accesorios adecuados, para llevar
a cabo también las siguientes pruebas:
- De compresión de fragmentos de probetas de mortero de
C092-15 + C090-12
40,1x40x160 mm rotos a flexión según las Normas EN 196, DIN 1164
C055N
(dispositivos mod E170, E170-01 - ver pág. 212).
- De compresión en probetas cúbicas de mortero de 50 mm, conforme a la ASTM C109 (dispositivo mod. E171- ver pág. 212)
- De compresión en probetas cúbicas de mortero de 70 mm, conforme a la BS 4550 (dispositivo mod. E171-01 - ver pág. 212).
- De tracción indirecta en probetas cilíndricas de diámetro 100, 150, 160 mm según las EN 12390-6 - NF P18: 408 - ASTM C496 - UNI
6135 - BS 1881:117 (dispositivo mod. C101-01 - ver pág. 211.)
- De tracción indirecta en probetas cúbicas de hormigón y adoquines de hormigón, conforme a las EN 12390-6, 1338
(dispositivo mod. C103 - ver pág. 211.)
sección C
Prensa de flexión de alta rigidez de capacidad 200 kN (detalles técnicos y accesorios específicos en
209
GRUPO COMBINADO DE DOS PRENSAS
Opción de actualización:
- ENSAYOS DE COMPRESIÓN EN MUESTRAS DE PROBETAS CÚBICAS, CILÍNDRICAS Y BLOQUES DE HORMIGÓN, ELIGIENDO
LA MÁQUINA DE COMPRESION ESTANDAR DE ENTRE NUESTROS DIFERENTES MODELOS DISPONIBLES DE 1300 KN A 5000
KN DE CAPACIDAD
- ENSAYO DE COMPRESIÓN Y FLEXIÓN EN MUESTRAS DE MORTERO
La composición del grupo combinado se obtiene:
C092-05
C092-06
Prensa de compresión en muestras de
mortero, 250 kN o 500 kN de capacidad, (mod. E159D, E159N,
Prensa de Compresión / Flexión en las
muestras de mortero, doble rango:
E159-01D, E159-01N, E161A, E161N, E161-02A, E161-02N detalles
técnicos y accesorios específicos en las pág. 312 ÷ 315), completa
con el transductor de presión utilizado junto con una máquina digital
de compresión en hormigón (Digitec, Autotec, Cyber-Plus
Servo-Plus Evolution).
0-250 kN (o 500 kN) para ensayos de compresión 0-15 kN para
ensayos a flexión (mod. E160N, E160-01N, E161-01N, E161-03N
detalles técnicos y accesorios específicos en las
pág. 316 ÷ 319) completa con dos transductores de presión utilizados junto con una máquina digital de compresión de hormigón
(sólo Cyber-Plus / Servo-Plus Evolution).
Además de los grupos propuestos, es posible componer muchos
otros grupos de ensayo alternativos, con el sistema de visualización
digital de medición, como por ejemplo:
- Grupo formado por dos prensas de compresión de hormigón.
- Grupo formado por una prensa a flexión de hormigón y una
prensa de compresión de mortero.
C055N
C092-05 / C092-06
GRUPO EJEMPLO
instrumentos para ensayos de materiales
HO RM I G ÓN
ACCESORIOS PARA MAQUINAS DE ENSAYOS A COMPRESIÓN Y FLEXIÓN
C097-01*
sección C
Gama digital dual de baja capacidad, (de 1/3 a
1/20 del rango nominal), completa con “transductor de presión
adecuado”, instalación hidráulica y grifo (válvula solenoide con
Cyber-Plus y Servo-Plus), instalada en las máquinas de ensayo equipadas con la unidad de medición con pantalla digital.
Esta solución ofrece una precisión muy alta también para mediciones de bajo esfuerzo, que es necesario para realizar ensayos de
compresión en muestras de mortero, ensayos a flexión en probetas
prismáticas de hormigón, ensayo de tracción indirecta en muestras
de probetas cilíndricas y cúbicas, ensayos en bordillos, losas, etc.,
mediante la utilización de una máquina de compresión de hormigón.
C097-01
C097-02*
Gama digital dual de baja capacidad, rango
0-300 kN, completa con la “célula de carga medidora de
210
esfuerzo”, suplemento, cables, instalada en máquinas de ensayos
de compresión en hormigón equipada con sistema de medición
con pantalla digital.
Esta solución elimina el peso del pistón y de plato de compresión
inferior, disminuyendo el conjunto de fricciones, etc., garantizando
una alta precisión (Clase 1. error máx. del ± 0,5%) en el rango de
medición de 30 ÷ 300 kN.
C097-02
H009-01
ORDENADOR PERSONAL,
completo con monitor LCD,
teclado, ratón, cables de
conexión. Se puede utilizar
en todas las máquinas de
ensayos Matest equipadas con
el sistema digital medición de
visualización. El suministro de
ordenador incluye la instalación y puesta en marcha del
software adquirido
(ver pág. 14)
C097-05
Clase 1, a partir del 1% en todo el recorrido
Aplicable únicamente a las máquinas digitales. Siguiendo un
procedimiento de calibración especial, Matest es capaz de otorgar
la Clase 1 prácticamente en la totalidad del rango, actualizando las
máquinas para que sean utilizadas para un número considerable de
aplicaciones en las que se espera un valor de baja resistencia, que
incluyen:
- Hormigón ligero, o resistencia inicial del hormigón
- Las muestras de pequeño tamaño, las mezclas de suelo cemento
- Ensayos a flexión y tracción, losas, bordillos, etc.
* NOTA:
Las máquinas con sistema Cyber-Plus Evolution (C109N) o ServoPlus Evolution (C104N) se pueden equipar de una tercera escala
de medida al mismo coste de la segunda serie.
C105
H009-01
C128
IMPRESORA LASER de sobremesa, para el gráfico y la impresión
del certificado del ensayo, aplicable en todas las máquinas ensayos
Matest con el sistema de medición con pantalla digital.
La conexión es directa por
puerto paralelo también
sin necesidad del
ordenador.
C128
C105
Dispositivo con tornillo central
Muy práctico para ajustar la distancia entre los platos de compresión de la máquina, de acuerdo a la altura de la muestra a analizar.
Solución recomendada para máquinas equipadas con platos de
gran tamaño. Este dispositivo puede ser previsto en todos los
modelos de máquinas de compresión de hormigón, a excepción de
los modelos de “Alta estabilidad”.
instrumentos para ensayos de materiales
HO RMIGÓN
ACCESORIOS PARA MAQUINAS DE ENSAYOS A COMPRESIÓN y FLEXIÓN
Dispositivos de ensayo a tracción indirecta
Modelo
Probetas cilíndricas diámetro x altura mm
Peso kg
C100*
C101*
C102*
150x300, 160x320, 6”x 12”
100x200, 110x220, 4”x 8”
40 x 80
30
15
1
C103-01*
Dispositivo de ensayo a tracción indirecta,
C100
C101
C102
C101-01*
Dispositivo de ensayo a tracción indirecta,
para muestras de probetas cilíndricas desde diámetro 100x200
mm (4”x 8”) hasta diámetro 160x320 mm (6”x 12”). La base está
equipada con muelles planos de centrado, manteniendo la posición
de la muestra. Dos columnas con altura ajustable para sostener la
placa superior con dos muelles.
Este artículo es una solución alternativa al mod. C100 + C101
Peso: 17 kg
C101-01
C103*
Dispositivo de ensayo a tracción indirecta
para realizar ensayos en probetas cúbicas de hormigón de 100 y
150 mm y en adoquines de hormigón.
NORMAS: EN 1338 / EN 12390-6
Dimensiones: 350x250x264 mm. Peso: 17 kg
* NOTA: Para realizar el ensayo, estos dispositivos tienen que ser
utilizados con una máquina de compresión de hormigón
equipada con la gama de baja capacidad de medición (ver
la gama dual baja, pág. 210), o con una prensa de flexión.
mismo mod. C103 pero
para realizar ensayos en
adoquines de hormigón
con dimensiones max.
de 300 x 500 mm, y para
ensayos sobre muestras
de probetas cúbicas de
hormigón de 100, 150,
200 mm, y cualquier tipo
de muestra de bloque y
prisma. Este dispositivo de
tracción indirecta se fija directamente en los platos de
compresión de los bloques
de ensayo con capacidades de
entre 2000 kN y 3000 kN.
Peso: 10 kg
sección C
C103
Para probetas cilíndricas.
NORMAS: EN 12390-6 / ASTM C496 / NF P18-408
UNI 6135 / BS 1881:117
211
C103-01
C103-02
Dispositivos de
tracción indirecta,
mismo mod. C103-01, pero para
ser fijado a la prensa de flexión
serie C091-01 (pág.198) y
C090-06 (pág. 200)
C103-02
ACCESORIOS:
C100-01 NORMA: EN 12390-6
TIRAS PARA COMPRESIÓN, dimensiones 4x10x350 mm,
utilizadas para ensayos tracción indirecta con los mod.
C100, C101, C101-01, C103. Paquete de 100 piezas.
C100-02 NORMAS: EN 1338 / BS 1881
TIRAS PARA COMPRESIÓN, dimensiones 4x15x350
mm, utilizadas para ensayos tracción indirecta con el
mod. C103. Paquete de 100 piezas.
C100-03 TIRAS PARA COMPRESIÓN, dimensiones 4x15x540
mm, utilizadas para ensayos tracción indirecta con el
dispositivo mod. C103-01. Paquete de 100 piezas.
C109-12(N) SOFTWARE UTM2 (Máquina de Ensayo Universal 2)
Licencia para ENSAYOS DE TRACCIÓN INDIRECTA
en probetas cilíndricas, cúbicas y bloques de hormigón. NORMAS: EN 12390-6, EN 1338 / UNI 6135
Detalles generales y descripción técnica: ver UTM2 pág. 14
instrumentos para ensayos de materiales
HO RM I G ÓN
ACCESORIOS PARA MAQUINAS DE ENSAYOS A COMPRESIÓN y FLEXIÓN
C106
sección C
Dispositivo de ensayos a flexión para dos
puntos y punto central en probetas prismáticas de hormigón de 100x100x400/500 mm
150x150x600/750 mm
NORMAS: EN 12390-5 / UNI 6133 / NF P18-407 / UNE 83305
ASTM C78, C293 / AASHTO T97 / BS 1881:118
Equipado con dos rodillos inferiores, uno de ellos articulado, y dos
rodillos superiores para las pruebas de tercer punto.
Es posible colocar en el centro solo un rodillo superior para los
ensayos de punto central. Para realizar el ensayo a flexión, este
dispositivo tiene que ser usado con las máquinas de compresión de
hormigón previstas para rangos de medida para bajas cargas rangos
de medida de cargas pequeñas (mod. C097-01, C097-02 pág. 210).
Dimensiones: 610x200xh320 mm. Peso 27 kg
E170
212
Dispositivo de compresión para ensayar probetas cúbicas de mortero 40,1x40x160 mm
rotas a flexión
NORMAS: EN 196-1 / ASTM C349 / NF P15-451
Para ser utilizado con una máquina de compresión de hormigón
prevista para gamas de baja
capacidad de medición,
(mod. C097-01, C097-02)
o con una prensa a flexión.
Dimensiones:
diámetro 153xh182 mm.
Peso: 12 kg
E170
C106
Dispositivo de compresión para ensayar
probetas cúbicas de mortero de 70,7 mm
NORMA: BS 4550
Es posible ensayar también muestras cilíndricas de diámetro 70x70 mm.
Para ser utilizado con una máquina de compresión de hormigón
prevista para rangos de medida de cargas pequeñas (mod. C09701, C097-02) o con una prensa a flexión.
Peso: 12 kg
E171-01
C091-13
Dispositivo para bordillos y losas de hormigón
E171
Dispositivo de compresión para ensayar
probetas cúbicas de mortero 50 mm (2”)
NORMA: ASTM C109
Es posible ensayar también muestras cilíndricas de diámetro
50xh50 mm. Para ser utilizado con una máquina de compresión
de hormigón prevista para rangos de medida de cargas pequeñas
(mod. C097-01, C097-02) o con
una prensa a flexión.
Peso: 12 kg
E171
instrumentos para ensayos de materiales
MEDICIONES DE ESFUERZO A FLEXIÓN
NORMAS: EN 1340:2004, EN 1339
El equipo consta de un pisón de acero montado sobre un
acoplamiento giratorio fijado a la parte superior de la máquina de
ensayo a flexión (a elegir entre serie mod. C090-06, C091 y C093)
para aplicar un esfuerzo de flexión en tres puntos del bordillo de
hormigón, sin
ningún tipo de
esfuerzo de torsión.
C091-13
HO RMIGÓN
ACCESORIOS PARA MAQUINAS DE ENSAYOS A COMPRESIÓN
NORMA: ASTM C1231
Se utiliza para ensayos de compresión en muestras de probetas cilíndricas de hormigón, como un método alternativo al refrentado de
azufre y a la rectificadora.
Dos topes de refrentado de acero son aplicados sobre las dos superficies planas del cilindro.
Dos almohadillas de neopreno son colocadas entre ellos, para una mejor distribución de la carga.
Las almohadillas de neopreno están disponibles en dos modelos:
- almohadillas de dureza Shore 60 para un esfuerzo estimado de 10 a 48 MPa
- almohadillas de dureza Shore 70 para un esfuerzo estimado de más de 48 MPa
El sistema no es aplicable a esfuerzos estimados inferiores a 10 MPa
Modelos:
C107-09 Topes de refrentado (pareja) para probetas cilíndricas
de diámetro 100x200mm.
C107-10 Topes de refrentado (pareja) para probetas cilíndricas
de diámetro 150x300mm y de 6x12”.
C107-12 Topes de refrentado (pareja) para probetas cilíndricas
de diámetro 160x320 mm.
C107-18 Almohadillas de neopreno (pareja) Shore A 60 para
probetas cilíndricas de diámetro 100x200mm.
C107-19 Almohadillas de neopreno (pareja) Shore A 70 para
probetas cilíndricas de diámetro 100x200mm.
C107-20 Almohadillas de neopreno (pareja) Shore A 60 para
probetas cilíndricas de diámetro 150x300mm y 6 “x 12”
C107-21 Almohadillas de neopreno (pareja) Shore A 70 para
probetas cilíndricas de diámetro 150x300mm y 6 “x 12”
C107-29
C107-10
213
C107-20
EJEMPLO DE UTILIZACIÓN
Dispositivo de Auto-Centrado
C107-25 Almohadillas de neopreno (pareja) Shore A 60 para
probetas cilíndricas de diámetro 160x320mm
C107-26 Almohadillas de neopreno (pareja) Shore A 70 para
probetas cilíndricas de diámetro 160x320mm
C107-29 Lámina de neopreno (pareja) Shore A 60.
Dimensión: 600x400x12mm
Para los ensayos en bloques.
Para las probetas cúbicas de 100 y 150 mm de lado y de las cilíndricas de diámetro 100 y 150 mm.
El plato de compresión inferior de la máquina de ensayo está
marcado con una serie de círculos concéntricos para facilitar el
correcto centrado de las muestras. Sin embargo, para garantizar un
rápido y preciso centrado de la muestra de probetas cúbicas y de
cilíndricas de hormigón, es siempre aconsejable este dispositivo de
“Auto-Centrado”.
Nota:
Los topes de refrentado sólo se pueden utilizar con los equipos de
medida de compresión que tienen un mayor espacio libre vertical
de la cámara de ensayo, respectivamente a un mínimo de 356 mm
para las probetas cilíndricas de diámetro 150x300mm ó 6 “x 12”,
y un mínimo de 376 mm para las probetas cilíndricas de diámetro
160x320 mm.
MODELOS:
C107
Dispositivo de Auto-Centrado, para ser utilizado con máquina de compresión con diámetro del rodillo de 216 mm
(1300, 1500 y 2000 kN)
C107-01 Dispositivo de Auto-Centrado, para ser utilizado con máquina de compresión con diámetro del rodillo de 287 mm
(3000 kN y máquinas de alta estabilidad).
C110-30
PLATO SUPERIOR DE COMPRESIÓN + RÓTULA, para
los ensayos sobre las muestras de diámetro de probetas
cilíndricas 100x200, 150x300, 160x320 mm y de
4”x 8”, 6”x 12” (fijado en la máquina de ensayo,
en sustitución del estándar cuando se requiera),
para cumplir con las especificaciones de las
Normas ASTM C39, AASHTO T22.
Dimensiones del plato: diámetro 165x30 mm
Peso: 10 kg aprox.
C110-30
sección C
Almohadillas de nivelación no adheridas y topes de refrentado
C107
instrumentos para ensayos de materiales
HO RM I G ÓN
ACCESORIOS PARA MAQUINAS DE ENSAYOS A COMPRESIÓN
Sistemas de protección según la Directiva CE de
seguridad, fabricadas con policarbonato transparente de alta resistencia, con bisagras y cierre.
La protección se encuentra en la cara delantera y en la trasera.
Sistemas de protección según Directiva CE de seguridad, están fabricados con policarbonato transparente de alta resistencia. Las protecciones están en el frente, parte trasera y lateral, y
son fácilmente / rápidamente fijados a la máquina con ganchos.
sección C
MODELOS:
C119
Máquinas 1200 kN, 1300 kN y
1500 kN
C119-03
Máquinas 2000 kN (mod. C051 a
C058-05N)
C119
C119-04
Máquinas de alta estabilidad, 2000
kN (mod. C089 a C089-04N)
C121
C119-05
Máquinas 3000 kN (mod. C066 a C071N) y máquinas de alta
estabilidad 3000 kN (mod. C089-06 a C089-10N)
214
C121-51
MODELOS:
C121
Máquinas 1200 kN, 1300 kN y 1500 kN
Interruptor de seguridad de la puerta
C121-05
Máquinas 2000 kN (mod. C051 a C058-05N)
C121-01
Máquinas con platos en forma de bloque 2000 kN (mod. C073 a
C078N)
Interruptor eléctrico de bloqueo de la puerta fijado en la puerta
delantera y trasera de la máquina de compresión como dispositivo
de seguridad. Se corta la corriente y se detiene la máquina cuando
una de las dos puertas está abierta.
Este interruptor de bloqueo sólo se puede instalar en las máquinas
de compresión digital equipada con dispositivos de seguridad con
bisagras y cierre según la Directiva CE, serie C121
C121-06
Máquinas de alta estabilidad 2000 kN(mod. C089 a C089-04N)
C121-10
Máquinas de alta estabilidad con platos en forma de bloque de
2000 kN de capacidad (mod. C089B a C089-22N)
C121-51
C121-07
Máquinas 3000 kN (mod. C066 a C071N) y alta estabilidad 3000 kN
(mod. C089-06 a C089-10N)
C121-08
Máquinas con platos en forma de bloque de 3000 kN (mod C079-01
a C079-06N) y máquinas de gran estabilidad con platos en forma
de bloque de 3000 kN (C089-C089-15 a C089-19N).
C121-04
Máquinas 5000 kN (mod. C086-02 a C086-03N)
C126
instrumentos para ensayos de materiales
C126
Bancada, se utiliza para mantener la prensa de compresión (o
flexión) a una altura adecuada para su utilización.
Solución alternativa a la colocación de una base de hormigón.
Fabricado en acero duro soldado, “que puede ser movido en
el laboratorio, tanto frontalmente como lateralmente por una
carretilla elevadora”.
Al hacer el pedido, por favor especificar el modelo de la bancada
de la máquina de ensayo para el que se va a diseñar.
Peso: 55 kg. aprox.
HO RMIGÓN
ACCESORIOS Y REPUESTOS PARA MAQUINAS DE ENSAYOS
sección C
C109-03N
Hydro-Plus Evolution
Consola de control independiente. Conectada a una prensa de ensayos, proporciona resultados
durante todas las fases: adquisición de datos, visualización, procesamiento, almacenamiento de las
fechas de los ensayos, software para la impresión de los resultados y del certificado.
Para actualizar o completar su máquina de ensayo de compresión y flexión de hormigón o mortero
(aunque no la fabrique Matest).
El “Hydro-Plus Evolution consta de:
C109N Cyber-Plus Evolution, con pantalla táctil digital, con 8 entradas analógicas
(datos técnicos: ver pág. 130).
C114
Unidad hidráulica con motor de bombeo y con selector de velocidad
(datos técnicos: ver pág. 125).
Prensa con soporte, con una manguera hidráulica flexible, conectores, accesorios.
C109-04N
Hydro-Plus Evolution para dos prensas
Al igual que en mod. C109-03N, pero provisto de una válvula hidráulica para activar, de forma
alternativa, dos prensas de ensayo.
215
C109-03N
C113
C115-01
La unidad de bombeo, de accionamiento
manual, con tanque, accesorios y conectores. Piezas de repues-
Válvula hidráulica de dos vías, instalada en la
to para las máquinas de compresión y flexión.
Peso: 20 kg
unidad de bombeo mod. C114, para activar alternativamente, dos
prensas de ensayo mediante el uso de la misma unidad de bombeo.
Completo con caja de protección.
C114
Unidad de bombeo, motorizada, con tanque,
selector de velocidad, llave hidráulica, accesorios y conectores.
Piezas de repuesto para las máquinas de compresión y flexión.
Presión hidráulica: 0 ÷ 700 bar
El suministro de aceite de 0,05 a 0,7 litros / min.
Alimentación: 230V monofásica 50Hz 750W
Peso: 40 kg
C115-01
con caja
C115-01
C114
Unidad de bombeo,
motorizada, con tanque,
selector de velocidad, llave
hidráulica, accesorios y
conectores.
Piezas de repuesto para
las máquinas de compresión
y flexión.
Presión hidráulica:
0 ÷ 700 bar
El suministro de aceite
de 0,05 a 0,7 litros / min.
Alimentación:
230V monofásica 50Hz 750W
Peso: 40 kg
C114-01
C114
C113
instrumentos para ensayos de materiales
HO RM I G ÓN
REPUESTOS PARA MAQUINAS DE ENSAYOS
Manómetro, diámetro de 250 mm provisto con puntero indicador de carga máx., ajuste de cero y fondo con espejo. Piezas de
repuesto para las máquinas de compresión y flexión. Suministrado previamente calibrado con certificado de calibración.
Transductor de presión
sección C
Utilizado junto con las unidades digitales Cyber-Plus C109N, ServoPlus C104N, Digitec C108N, Autotec C098N.
Se suministra completo con cable y certificado de calibración.
Sensibilidad nominal: 2 mV / V. Precisión: ± 0,5%
216
C118-05
Modelos
Manómetro
C118-14
C118-03
C118-04
C118-05
C118-06
C118-07
C118-08
C118-09
C118-10
C118-11
C118-12
C118-13
Rango de 0 a 1300 kN
Rango de 0 - 1500 kN
Rango de 0 - 600 kN para máquina 1300-1500 kN
Rango de 0 - 2000 kN
Rango de 0 - 600 kN para máquina 2000 kN
Rango de 0 - 3000 kN
Rango de 0 - 600 kN para máquina 3000 kN
Rango de 0 - 150 kN para prensa de flexión de la serie C090
Rango de 0 - 150 kN para prensa de flexión de las series C091, C093
Rango de 0 - 1500 kN la prensa de tracción de H010
Rango de 0 - 300 kN para máquina de cemento
Rango de 0 - 50 kN para máquina de cemento
MODELOS DISPONIBLES:
C116-01N Transductor de presión rango: 0 - 10 bar
C116-02N Transductor de presión rango: 0 - 20 bar
C116-03N Transductor de presión rango: 0 - 35 bar
C116-04N Transductor de presión rango: 0 - 50 bar
C116-05N Transductor de presión rango: 0 - 100 bar
C116-06N Transductor de presión rango: 0 - 200 bar
C116-07N Transductor de presión rango: 0 - 350 bar
C116-08N Transductor de presión rango: 0 - 500 bar
C116-09N Transductor de presión rango: 0 - 700 bar
C116-10N Transductor de presión rango: 0 - 400 bar
C116-11N Transductor de presión rango: 0 - 600 bar
C116-12N Transductor de presión rango: 0 - 160 bar
C116-13N Transductor de presión rango: 0 - 60 bar
Juntas, de tres elementos, para acoplamiento de
pistón / cilindro
MODELOS:
C122
Para máquinas de compresión de 1200 kN de capacidad.
C122-01 Para máquinas de compresión de 1300-1500 kN de
capacidad
C122-02 Para máquinas de compresión de 2000 kN de capacidad
C122-03 Para máquinas de compresión de 3000 kN de capacidad
C122-04 Para máquinas de flexión de 150 kN de capacidad, serie
C090
C122-06 Para máquinas de flexión de 150kN de capacidad, series
C091, C093
C122-07 Para máquinas de flexión de 200 kN de capacidad,
series C090-06 y C090-07
C122-05 Conjunto de juntas para la bomba manual de las máquinas de ensayo
E161-15 Para máquinas de ensayos de cemento mod. E151 a E161
E183-11 Para máquinas de cemento mod. E181, E183, pistón 250 kN
E183-12 Para máquinas de cemento mod. E181, E183, pistón 15 kN
instrumentos para ensayos de materiales
C116-01N÷C116-13N
C122 ÷ E183-12
HO RMIGÓN
Superficie endurecida de más de 55 HRC y acabado rectificado.
PLATO SUPERIOR:
Modelo
Diámetro mm
Máquina
C110
C110-01
C110-02
C110-03
165x30
216x30
287x51
287x60
1200 kN
1300 kN, 1500 kN y 2000 kN
3000 kN y 2000 kN serie C058
2000 kN y 3000 kN de alta
estabilidad completa con “rótula”
MODELOS:
Suplementos de diámetro 140 mm para las máquinas: 1200 kN,
1300 kN, 1500 kN, 2000 kN (C051 a C056N)
C111-30 de alto 20 mm
C111-21 de alto 50 mm
C111-03 de alto 100 mm
C111
de alto 176 mm
C111-02 de alto 226 mm
Suplementos de diámetro 200 mm para las máquinas: 2000 kN
(C058 a C058-05N), 3000 kN (C066 a C071N), 2000 kN bloques
(C073 a C078N), 3000 kN bloques (C079-01 a C079-06N)
C111-31 de alto 20 mm
C111-22 de alto 50 mm
C111-26 de alto 76 mm
C111-04 de alto 126 mm
Modelo
Diámetro mm
Máquina
Suplemento “Ranurado” de diámetro 150 mm para las máquinas
con tornillo central:
2000 kN (C073 a C078N), 3000 kN (C079-01 a C079-06N)
C111-27 de alto 20 mm
C111-23 de alto 50 mm
C111-28 de alto 76 mm
C111-08 de alto 126 mm
C110-11
C110-12
C110-13
C110-14
165x30
216x30
287x51
287x60
1200 kN
1300 kN, 1500 kN y 2000 kN
3000 kN y 2000 kN serie C058
2000 kN y 3000 kN alta estabilidad
Suplementos de diámetro 210 mm, acabado pulido, para maquinas
de “alta estabilidad”:
2000kN, 3000kN, 2000kN bloques y 3000kN bloques.
C111-32 de alto 20 mm
C111-24 de alto 50 mm
C111-25 de alto 76 mm
PLATO INFERIOR:
C112-10 PLATOS SUPERIOR Y INFERIOR DE COMPRESIÓN,
completo con “rótula”, dimensiones de 510x245x55
mm para los ensayos sobre bloques.
C112-11 PLATOS SUPERIOR Y INFERIOR DE COMPRESIÓN,
completo con “rótula”, dimensiones de 510x320x55
mm para los ensayos sobre bloques.
C112-05 Kit de 4 asas para levantar el plato inferior, para una fácil
colocación de suplementos.
COMO ALTERNATIVA
C111-50
sección C
Platos de compresión
C111-16 Suplemento, de 50 mm alto para las máquinas de
flexión serie C090
C112-11
Suplemento
Para ser utilizado con los equipos de medida de compresión equipado con platos rectangulares de 510 x 320 mm para ensayo de
bloques. Este dispositivo elimina el complicado procedimiento para
levantar el plato inferior rectangular y agregar suplementos para
realizar ensayos de compresión también en muestras de probetas
cúbicas. Estos suplementos se fijan sobre la placa inferior rectangular mediante cuatro acoples ajustables que permiten una fijación
rápida, correcta y estable.
En el suplemento, ahora es posible colocar el plato de compresión
redondo de diámetro 216 o 287 mm previstos por la máquina
específica.
Este suplemento está acabado y rectificado (adecuado también
para los equipos de alta estabilidad), con un diámetro de 210 mm,
altura 20 mm. Peso: 3 kg aprox.
C111 Serie
C110 Serie
C111-50
Suplementos
Se utilizan para reducir el espacio vertical entre los platos de
compresión, de acuerdo a la altura de la muestra a ensayar, evitando que el pistón realice su máximo recorrido (aprox. 50-55 mm)
sin tener que comprimir la muestra.
Los suplementos se colocan entre el pistón y el plato de compresión inferior.
C112-11
C112-05
instrumentos para ensayos de materiales
217
HO RM I G ÓN
S205
sección C
UNITRONIC 50 kN, PRENSA UNIVERSAL POLIVALENTE DE COMPRESIÓN / FLEXIÓN Y TRACCIÓN PARA:
218
- ENSAYOS DE COMPRESIÓN / FLEXIÓN, DE 50 kN MAX. CAPACIDAD DE CARGA
CON CARGA AUTOMÁTICA O CONTROL DE DESPLAZAMIENTO / DEFORMACIÓN, para ensayar:
Hormigón:
- FLEXIÓN DE VIGAS
- FLEXIÓN DE AZULEJOS
Bloques de Arcilla,Tejas:
- PUNZONADO
Cemento, Asfalto, Metal, Alambres, Cuerdas, Plásticos, Papeles, Textiles, etc.,
Rocas y piedras, Suelo
Unitronic detalles técnicos y ensayos adicionales específicos son descritos en la pág. 384.
APLICACIONES ESPECÍFICAS:
Ensayo a flexión con el punto central de las probetas prismáticas de hormigón y tejas de arcilla
Normas: EN 12390-5, 491, 538 / ASTM C78, C293
UNI 6133 / BS 1881:118 / NF P18-407 / UNE 83305
Desarrollo del ensayo con control de carga.
Accesorios necesarios:
S337-34 Célula de carga medidora de esfuerzo, capacidad de 50 kN
S205-18
Dispositivo a flexión para carga en el punto central del ensayo de
tejas de arcilla y probetas prismáticas de hormigón de dimensiones
100x100x400 (500) y 150x150x600mm. Consiste en colocar la vigueta en los dos soportes inferiores ajustables (uno articulado) de
100 a 315 mm, y en el soporte superior central articulado fijada la
célula de carga. Dimensiones de los soportes: 38 mm de diámetro
por 300 mm de largo. Peso: 20 kg aprox.
C109-11 Software para los ensayos a flexión en probetas prismáticas de hormigón
Ensayos de punzonamiento en
los bloques de arcilla
S206
Norma: UNI 9739-3
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-32 Célula de carga medidora de
esfuerzo de 10 kN.
C093-11 Dispositivo de punzonamiento a
la flexión.
S205-15 Soporte de vigueta para el
dispositivo de punzonamiento
S205
con célula
de carga
Multi-Ensayo de 200 kN
Prensa universal polivalente de compresión, a flexión y tracción con carga automática o control
de desplazamiento / deformación. Características técnicas: similar a Unitronic 50 kN, pero con una
capacidad máx. de 200 kN. Detalles técnicos: ver pág. 390
C095-05
Ensayo a flexión en tiras bloques de arcilla
NORMAS: UNI 8942-3, 9730-3
El aparato consta de:
- Balanza de carga digital de 16 kg de capacidad x 0,1 g de
precisión, con un software para visualizar y mantener la
carga de rotura
- Dispositivo de flexión instalado en la balanza, con el mando central rotatorio para aplicar la carga. La tira de la muestra se obtiene
de una pared interna del bloque de arcilla. La carga se obtiene
simplemente girando el mando que aplica una presión de flexión a
la tira de la muestra hasta la rotura. La balanza muestra y mantiene
la carga de rotura. Peso: 14 kg aprox.
instrumentos para ensayos de materiales
C095-05
S206
C094
C095
Prensa digital portátil de 56 kN
de capacidad
Máquina de ensayos a flexión de 50 kN de
capacidad
Se utiliza para ensayos de compresión en pequeñas probetas cilíndricas y muestras de testigos de diámetro hasta 60x100 mm.
La carga se aplica mediante una bomba manual, y es medida con
una precisa pantalla digital de rango 0-56 kN, precisión de ± 1%, la
resolución de 65.000 puntos.
Los platos de compresión tienen 65 mm de diámetro, el plato
superior con rótula y máxima luz vertical de 110 mm.
Completo con funda de madera para transporte, accesorios.
Dimensiones 370x320x710 mm.
Peso 25 kg
DISEÑADA PARA ENSAYAR:
- BALDOSAS DE HORMIGÓN: EN 491
- TEJAS DE ARCILLA: EN 538
- BLOQUES PLANOS: BS 6073:1 apéndice C
- BALDOSAS HUECAS: UNI 2107
- BLOQUES DE ARCILLA PARA PISOS: UNI 9730-3
- ADOQUINES, TEJAS, BALDOSAS, BALDOSAS DE TERRAZO,
CERÁMICA,
LADRILLOS, etc.
La máquina se compone
de:
Prensa de acero, un apoyo
superior y dos apoyos
inferiores ajustables, gato
mecánico de accionamiento manual y un anillo
dinamométrico de 10 kN
de capacidad para medir
la carga aplicada.
C094
sección C
HO RMIGÓN
C095
ACCESORIOS PARA C094:
A125-01
Juego de dos puntas cónicas cementadas para
modificar la prensa mod. C094 en el “Ensayo
de Carga Puntual” (véase la sección de Áridos
modelos A125 pág. 60), para el ensayo del índice
de resistencia en rocas.
ACCESORIOS PARA C095:
A125-01
C093-11
DISPOSITIVO para los ensayos a flexión en bloques de arcilla.
NORMA: UNI 9730-3
Se compone de dos apoyos inferiores de
diámetro 20x300 mm y punzón superior
de sección cuadrada de
madera.
C093-11
DETALLES TÉCNICOS:
- La capacidad del anillo dinamométrico de 10 kN, con certificado
de calibración (anillos dinamométricos con capacidades superiores de hasta 50 kN bajo pedido - pág. 430)
- Luz vertical entre los apoyos, ajustable de 50 a 300 mm.
- Distancia entre los apoyos inferiores, ajustable de 50 a 500 mm.
- Dimensiones de los apoyos: diámetro 25x500 mm
- Precisión: 1% de la carga aplicada
- Dimensiones: 710x610x1520 mm
- Peso: 120 kg
C096
Ensayo de impacto sobre baldosas y
materiales de pavimentación
NORMA: ART. 3 nº 2234-1939
Se utiliza para verificar la calidad de los materiales de pavimentación como baldosas,
cerámica, ladrillos, terrazo etc., por el método de impacto. La muestra se sitúa en la
base del dispositivo, el cual previamente se
ha llenado con arena. A continuación, una
bola esférica de aprox. 1000 g se deja
caer en el azulejo desde una altura
conocida, midiendo la altura a
partir de la cual se rompe la
muestra.
Dimensiones:
810x810x1300 mm. Peso: 70 kg
C096
instrumentos para ensayos de materiales
219
HO RM I G ÓN
MEDICIÓN DE LA ABRASIÓN EN BASE A BÖHME
C129
Ensayo de Abrasión Böhme
sección C
NORMAS: EN 1338:2004 / EN 1339, 1340, 13892-3 / EN 14157 / DIN 52108
C129
220
El instrumento mide la pérdida de volumen de una muestra bajo el
ensayo de abrasión y se usa en los ensayos, tales como:
- Piedras del pavimento
- Losas de hormigón
- Losas fabricadas con rocas naturales
- Losas de piedra natural
El ensayo se realiza mediante la colocación de una muestra verificada en el dispositivo de abrasión Böhme en el ensayo de pista
donde se han extendido abrasivos normalizados; se hace girar la
muela abrasiva y la muestra se somete a la carga abrasiva de 294 N
para un determinado número de ciclos.
Antes de realizar el ensayo, se debe establecer la densidad aparente
de la muestra mediante la medida de peso y grosor.
Realizar el ensayo durante 16 ciclos a su vez compuestos de 22
cada uno, calculando al final un desgaste como una pérdida promedio de volumen y peso.
El aparato se compone básicamente de:
- disco horizontal de hierro con una velocidad de 30 rpm y un
diámetro de 750 mm equipado con una pista de ensayos de 200
mm para colocar la muestra
- panel de control independiente con contador de revoluciones
digital y parada automática después de las revoluciones preestablecidas
- soporte para la muestra
- cargador ajustable para producir una fuerza de 294 N ± 3 N en
una muestra
Alimentación: 230V 50Hz monofásica 800W
Dimensiones: 1500x1000x h 850 mm
Peso: 250 kg
ACCESORIOS:
C129-01 MATERIAL ABRASIVO compuesto de alúmina fundida
(corindón artificial)
Paquete de 25 kg.
instrumentos para ensayos de materiales
C129-02
MEDIDOR DE REDUCCIÓN DEL GROSOR,
compuesto de un comparador con una superficie
de contacto anular, con un
diámetro entre 5-8 mm y
tabla de medición.
C129-02
A113
Péndulo de medida de la resistencia al deslizamiento
NORMAS: EN 1338, EN 1341, 1342, EN 1339
Se utiliza en ensayos sobre adoquines de hormigón, piedras naturales, y ensayos de deslizamiento en suelos de madera.
Detalles técnicos: ver pág. 53
A113
ACCESORIOS:
A110-11 Placa base de metal.
A110-13 Dispositivo de sujeción para ensayos sobre adoquines
de hormigón (EN 1338), piedras
naturales (EN 1341, 1342); ensayos de deslizamiento en
suelos de madera (EN 1339).
HO RMIGÓN
NORMAS: EN 12390-4 / BS 1881:115 / DIN 51302
El equipo para realizar este ensayo se compone de:
C154
Célula de carga eléctrica de 3000 kN de
capacidad
Consiste en un cilindro de acero de carga donde cuatro extensómetros de puente completo, se centran en medir la deformación
en 4 generatrices relativas a dos diámetros, ortogonales entre si,
por lo que se pueden medir las deformaciones axiales y circunferenciales.
La célula incorpora un quinto extensómetro utilizado para la
calibración de los ensayos de carga.
Se suministra completo con conectores, cables, certificado de
calibración.
Dimensiones: diámetro 100 por 200 mm de altura
Peso: 18 kg
un quinto canal digital de lectura que permite realizar ensayos de
calibración de carga en las máquinas de compresión de hasta 3000
kN de capacidad.
Se suministra completo con kit de 5 cables y conectores para el
acoplamiento de la célula de carga, accesorios, caja de transporte.
Alimentación: 230V monofásica 50Hz
Dimensiones: 450x350x160 mm
Peso: 8 kg
C155-05
Proceso de calibración de la célula de
carga para el equipo de medida digital,
completo con certificado de calibración Matest.
ACCESORIO (recomendado):
C155-10N Software
Para descargar al ordenador los resultados con posibilidad de impresión del certificado. Disponible en CD
ROM para la instalación en el ordenador.
sección C
VERIFICACIÓN DE LA TRANSFERENCIA DE FUERZA
221
C154-01
Dispositivo de posicionamiento, construido con
acero especial, endurecido y rectificado.
Permite colocar correctamente la célula de carga sobre el plato
inferior de la prensa de compresión, para realizar el ensayo de
verificación (Foot Meter Test) como se describe en las Normas.
C155N
Equipo de medida digital Cyber-Plus
Evolution con “pantalla táctil”
Esta unidad lee simultáneamente los cuatro valores proporcionados por la célula de carga eléctrica. Los valores se memorizan,
automáticamente se procesan y se visualizan, para proporcionar
directamente los diferentes coeficientes resultantes de los cálculos,
y se imprimen en la impresora láser (accesorio C128) conectada
directamente a través de USB al equipo de ensayo.
La unidad, a través de la amplia pantalla, muestra al usuario los
diferentes procedimientos de ensayo, previamente
seleccionados conforme a lo solicitado por la especificación (EN, BS, DIN).
Al final del ensayo, la pantalla muestra automáticaC154
mente los resultados, informando además si la prensa analizada, está cumpliendo con los requisitos de la
especificación seleccionada en cuanto a la estabilidad
(transmisión axial de las cargas, auto-alineación de la
rótula, etc.)
La unidad digital de lectura también está prevista de
C154-01
EJEMPLO DE CERTIFICADO
C155N
instrumentos para ensayos de materiales
HO RM I G ÓN
C138N
sección C
Equipo de medida digital universal con
microprocesador para células de carga
Cyber-Plus 8 Evolution con
“Pantalla táctil”
222
NORMAS: EN 10002-3 / EN ISO 376:2002
ASTM E74 / UNI 6326 / DIN 51220
NF P18-411 / BS 1610
C140-08
C142-06
C138N
Este menú fácil de usar manejado con pantalla digital, conectada a
las células de carga (mod. C140 a C140-10 y mod. C142 a C14208) permite realizar una verificación de precisión de las cargas
medidas en máquinas bajo control y permite originar el pertinente
certificado.
El instrumento permite memorizar tres ciclos de verificación compuestos por diez mediciones cada uno.
Al final del ensayo la unidad elabora automáticamente el valor
almacenado y muestra:
- La carga efectiva aplicada
- Medidas de carga (sobre tres ciclos de verificación)
- Carga media medida
- Precisión en %
- Repetitividad
- Lectura relativa
- Error máx.
La precisión del ensayo es de ± 0,5% de la carga indicada.
ESPECIFICACIONES TÉCNICAS:
•
-
HARDWARE:
Conversor de alta resolución de hasta 24 bits.
Señal a 5Vcc
Las señales estándar: alimentación + alimentación - (0 V) señal +
señal - y malla
Conexión al ordenador
Pulsador remoto para facilitar la confirmación de las lecturas
durante la calibración y la ejecución del ciclo de verificación
C140-01
•
FUNCIONES:
- Ejecución ilimitada de ensayos de verificación
- Código del dispositivo en fase de verificación
- Ejecución del ciclo de verificación de acuerdo con las Normas
europeas EN
- Cálculo de los parámetros fundamentales requeridos: porcentaje
de error de repetitividad y de precisión, el error residual en el
punto de retorno a 0, resolución máxima relativa y clase del
dispositivo en fase de verificación
- Envío de todos los datos de los ensayos al ordenador, importable en Excel
- Conexión directa USB de la impresora
- Organización de ensayos mediante software Matcal (accesorio).
•
PÁGINA PRINCIPAL:
- Visualización de todos los datos del dispositivo de la célula
seleccionada
- Fecha y hora
- Idiomas disponibles: Italiano, Inglés, Francés, Alemán, Español y
Polaco (otros idiomas bajo petición).
•
SOFTWARE:
Compatible con Matcal y Microsoft HyperTerminal.
•
FIRMWARE:
- Software de gestión de un máximo de diez células de carga. Se
puede usar una célula a la vez, seleccionable entre los correctamente configurados e instalados
- Gama de medidas de carga: N, daN, kN, g, kg, t, lb, y oz
- Fecha del ensayo y / o calibración
- Pasos de calibración y linealización
- Filtro digital de primer orden programable que es capaz de
filtrar y resolver el valor adquirido por la célula eléctrica.
instrumentos para ensayos de materiales
Detalles técnicos de hardware: ver pág. 24
El aparato, y todos los accesorios, están contenidos en una maleta
resistente y práctica, resistente a la inmersión con una válvula de
despresurización.
Alimentación: 230V monofásica 50/60Hz
Dimensiones: 360x300x200 mm
Peso: 5 kg
HO RMIGÓN
ACCESORIO
(recomendado):
C155-10N
Software
Para descargar al
ordenador los resultados con posibilidad
de impresión del
certificado.
EJEMPLO DE CERTIFICADO CON
EL SOFTWARE C155-10N
A UTILIZAR CON EL INDICADOR DIGITAL C138N PARA LA
CALIBRACIÓN DE MÁQUINAS DE ENSAYOS
NORMAS: EN 10002-3, Classe 2 / ASTM E74 Classe A
Estas células de carga son adecuadas para la calibración de máquinas
de ensayo de compresión. Se componen de un bloque de acero de
alta calidad, llamado elemento sensible, donde se han aplicado algunas
tensiones: el conjunto se encuentra revestido. Mientras se aplica la carga,
los esfuerzos se transmiten a un amplificador (mod C138N) que da una
lectura digital de carga. Otras ventajas son la posibilidad de conectar a
las diferentes células de carga en el mismo equipo de medición y por lo
tanto comprobar todas las capacidades de carga. Se suministra completo con certificado de calibración Matest. (accesorio C138-05).
C140
C140-01
C140-02
C140-03
C140-04
C140-05
C140-06
C140-07
C140-08
C140-09
C140-10
Capacidad
kN
25
50
75
100
300
600
1000
2000
3000
5000
500
(1)
(2)
Células de carga estándar
Modelo
EJEMPLOS DE PANTALLA:
Dimensiones
diámetro x altura mm.
82x59
82x59
82x59
82x59
135x200
135x200
135x200
135x200
135x200
180x200
para ensayo de tracción
ESPECIFICACIONES TÉCNICAS
- Escala completa de salida nominal: 2 mV / V
- Linealidad + Histéresis: +/- 0,1% de la escala completa
- Repetitividad: +/- 0,03% de la escala
completa
- CLASE: A
C140-12
Dispositivo para la célula de carga de tracción C140-10
sección C
C138-05
Proceso de calibración de una célula de carga por el equipo de
medida digital, con certificado de calibración Matest.
(1) Ventana
principal
(2) Calibración
de célula
223
Células de carga “alto rendimiento”
A UTILIZAR CON EL INDICADOR DIGITAL C138N PARA LA
CALIBRACIÓN DE MÁQUINAS DE ENSAYO
NORMAS: EN 10002-3, Classe 1 / ASTM E74 Classe AA
Estas células eléctricas de carga de alta precisión y estabilidad, se
proponen como una alternativa a las células de carga estándar,
para la verificación y calibración de alta precisión, repetitividad, y se
recomiendan para un uso profesional, laboratorios de Metrología,
centros SIT. Para ser utilizado con el Indicador Digital mod. C138N.
Cada célula se suministra completa con certificado de calibración
Matest (Accesorio C138-05).
Modelo
C142
C142-01
C142-02
C142-03
C142-04
C142-05
C142-06
C142-07
C142-08
Capacidad
kN
30
100
300
600
1000
2000
3000
5000
600
Dimensiones
diámetro x altura mm.
100x127
105x164
140x160
140x170
150x180
135x200
135x200
158x258
tracción / compresión
ESPECIFICACIONES TÉCNICAS
- Escala completa de salida nominal: 2 mV / V
- Linealidad + Histéresis: +/- 0,1% de la
escala completa
- Repetitividad: +/- 0,03% de la escala completa
- CLASE: AA
C140 ÷ C142-07
C138-10
CERTIFICADO DE CALIBRACIÓN, emitido por el Instituto Oficial de Calibración (Centro SIT) para una célula de
carga conectada al equipo de medida digital mod. C138N.
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
HORMIGONERA TURBO FORZADA DE EJE VERTICAL
224
NORMA: EN 12390-2
Se utiliza para preparar las muestras de hormigón o mezclas, estas mezcladoras garantizan
una uniforme, eficiente y rápida acción de mezcla. Son de fácil y práctica utilización,
absorben menos aire durante la mezcla y son adecuadas para fines de laboratorio y en obra.
Especificaciones técnicas:
- Caja de cambios de ejes paralelos (mod. C163, C165)
- Caja de cambios epicicloide en baño de aceite (mod. C164, C164-01)
- Cuba de acero resistente al desgaste (mod. C163, C165)
- Cuba y partes principales en acero anti desgaste (mod. C164, C164-01)
- Rejilla de seguridad con interruptor automático
- Palas de mezcla ajustables
- Desembocadura de descarga manual en la parte inferior
- Ruedas + barra de remolque (mod. C163, C165)
- Eje con ruedas de goma y barra de remolque (mod. C164, C164-01)
- Control eléctrico con magneto térmico para corte por sobrecarga
- Alimentación: 230V monofásica 50Hz (mod C165)
- Alimentación: 400V trifásica 50 Hz (mod C163, C164, C164-01)
Nota: mod. C163 disponibles bajo pedido con alimentación de 230V monofásica.
Modelos
Rendimiento por mezcla
Capacidad cuba (volumen)
Dimensiones cuba (diá.x h)
Potencia del motor
Dimensiones (diá. x h)
Peso
Litros
Litros
cm
HP
cm
kg
C164
C165
C163
C164
C164-01
55
100
70x30
1
71x115
115
70/80
150
70x43
2
71x150
130
130
200
80x40
5,5
110x115
250
220
300
110x40
7,5
130x135
420
C163
C162
C162
C165
Hormigonera de 56 litros de capacidad
NORMA: EN 12390-2
Este mezclador multiflujo absorbe menos aire durante la mezcla,
requiere un menor tiempo de mezclado y otorga una perfecta homogeneidad de las mezclas que tienen una relación agua cemento
baja. La cuba es fácilmente extraíble por medio de una carretilla
(accesorio).
Las palas se han endurecido contra el desgaste.
Cuba de mezcla: 640 mm. diá. x 330 mm de profundidad
No se vende en los mercados de la CE sin cabina de seguridad
(ver mod. C162-02)
Alimentación: 230V monofásica 50Hz 2Hp
Peso: 250 kg
instrumentos para ensayos de materiales
C162-01
ACCESORIOS PARA MOD. C162:
C162-01 CARRETILLA para una rápida y sencilla descarga de la
cuba de mezclas de la hormigonera
C162-02 CABINA DE SEGURIDAD, fabricada en chapa de acero,
conforme a la Directiva de Seguridad de la CE.
HO RMIGÓN
NORMA: EN 12390-2
Se utiliza para preparar las muestras o mezclas de hormigón, estos mezcladores tipo cuba garantizan una uniforme, eficaz y rápida acción de
mezcla.
Son de fácil y práctico manejo, adecuado para fines de laboratorio y en obra.
Los mezcladores están equipados con una abertura de descarga de accionamiento manual situada en la parte inferior de la cuba, para la
descarga directa de la mezcla en una carretilla o un contenedor adecuado.
Las palas y una paleta de mezcla, se pueden ajustar en altura, fabricados en acero templado de calidad especial para resistir el desgaste.
La cuba y los engranajes de mezcla tienen un grosor considerable, siendo los engranajes de acero templado y rectificado, el moto-reductor
está en baño de aceite con acople cónico tipo Gleason.
Controles mediante interruptor magneto-térmico y bobina de descarga automática incluidos en caja IP67.
sección C
HORMIGONERA CON VELOCIDAD FORZADA
225
C166-02
C166
C166-01
Modelos
Rendimiento por mezcla
Capacidad cuba (volumen)
Diámetro cuba
Alimentación
Potencia absorbida
Dimensiones
Peso
Litros
Litros
mm
HP
cm
kg
C166
C166-01
C166-02
200
350
960
400V 3F 50Hz
7,5
140x100x150
350
110
200
800
400V 3F 50Hz
4
120x100x130
260
60
100
550
230V 1F 50Hz
2
90x70x90
140
NOTA: La mezcladora tipo cuba de 60 litros mod. C166-02 se suministra completa con dos ruedas y barra de tiro.
ACCESORIOS:
C166-10
Juego de dos ruedas con barra de remolque para las hormigoneras
de 200 litros mod. C166 y de 110 litros mod. C166-01
C161
Hormigonera tipo tambor
C161
Adecuado para las mezclas de hormigón de baja/media resistencia.
Volumen del tambor: 130 litros
Rendimiento: 75 litros de hormigón
Alimentación: 230V monofásica 50Hz - 0,3HP
Dimensiones: 720x1320x1280 mm
Peso: 60 kg
instrumentos para ensayos de materiales
HO RM I G ÓN
Ensayos de HORMIGÓN FRESCO AUTOCOMPACTABLE (SCC)
Directrices Europeas ERMCO / EFNARC.
C181
sección C
Determinación del Escurrimiento y del
Tiempo de escurrimiento. “Spray-Test”
NORMAS: EN 12350-8 / SCC / RILEM N. 23
Para evaluar la deformabilidad del hormigón fresco a través del flujo
libre, y el tiempo necesario para extenderse un diámetro de 500 mm.
Aplicables a hormigones con áridos de tamaño máximo de 25 mm.
C181
CONO DE ABRAMS, de acero galvanizado, según la
norma EN 12350-2.
C170-01 PLACA, hecha de acero galvanizado, dimensiones 905
x 905 mm, con dos círculos grabados que tienen 210 y
500 mm de diámetro y en el centro la cruz X.
Determinación del tiempo de flujo
“Ensayo del embudo V”
226
NORMAS: EN 12350-9 / SCC / ERMCO-EFNARC
RILEM N. 23 / comparable a la UNI 11042
Para evaluar la resistencia a la segregación de mezcla de hormigón fresco autocompactable a través de la velocidad de flujo en un embudo.
Aplicables a hormigones con áridos de tamaño máximo de 25 mm.
C171
“V-EMBUDO”, hecho de “acero inoxidable”, montado en el soporte. El borde superior del embudo es liso y reforzado, y el orificio de
salida está provisto de una válvula de apertura.
Dimensiones: 640x340x1050 mm. Peso: 40 kg aprox.
CAJA, hecha de polietileno, para recoger el hormigón.
V127
C171-11 Tolva de llenado hecha de acero inoxidable, para verter
el hormigón en el embudo en una sola operación,
según lo especificado por la norma.
C262
Regla de enrasar de 460 mm, para nivelar el hormigón.
C170-01
Determinación de la fluencia confinada.
“Caja en forma de - L”
NORMAS: EN 12350-10 / SCC / ERMCO-EFNARC
RILEM N. 23 / comparabile alla UNI 11043
Para determinar la fluencia confinada de la mezcla de hormigón
autocompactable fresco, y para evaluar la capacidad de llenado así
como la resistencia a la segregación.
Aplicables a hormigones con áridos de tamaño máximo de 25 mm.
C172
Caja en forma de - L, hecha de “acero inoxidable”, que consiste en:
- Recipiente con las superficies internas rígidas,
- Obstáculos formados por dos juegos de rejillas intercambiables
- Conjunto de tres barras verticales con dia. 12 mm y luz libre
de 41 mm
- Conjunto de dos barras verticales con dia. 12 mm y luz libre de
59 mm
- Compuerta en forma de guillotina
Dimensiones: 712x280x682 mm
Peso: 40 kg aprox.
S200-11 REGLA DE ENRASAR, de 300 mm de longitud, de
acero galvanizado, para nivelar el hormigón.
Determinación de fluencia confinada.
“Caja en forma de - U”
NORMAS: UNI 11044 / RILEM N. 23
Para evaluar la velocidad de llenado y la altura de la muestra de hormigón bajo su propio peso en la caja de llenado
en forma de U, y determinar la autocompactabilidad. El
ensayo se realiza con hormigón fresco de alta fluidez con
súper plastificante. Aplicables a hormigones con áridos de
tamaño máximo de 25 mm.
C171
C173
C172
S200-11
V127
instrumentos para ensayos de materiales
“Caja en forma de - U” de “acero inoxidable”,
con paredes lisas en el interior, equipado de un
obstáculo de flujo formado por cuatro barras
verticales reforzadas. Las barras tienen un
dia.10 mm y una separación entre ellas de
35 mm. Una compuerta en forma de
guillotina divide la parte vertical
de la caja, de la parte horizontal.
Dimensiones: 480x250x680 mm
Peso: 20 kg aprox.
S200-11
REGLA DE ENRASAR, de 300 mm de longitud,
de acero galvanizado, para nivelar el hormigón.
HO RMIGÓN
Determinación de la fluidez confinada.
“Ensayo del anillo Japonés (J-ring)”
NORMAS: EN 12350-12 / comparable con la: UNI 11045 / ASTM C1621
Para determinar la fluencia, es decir, el tiempo de flujo y la capacidad del hormigón
autocompactable para pasar a través de obstáculos.
C170
CONO DE ABRAMS, de acero galvanizado,
conforme a la Norma EN 12350-2.
C170-01
PLACA, de acero galvanizado,
dimensiones 905 x 905 mm, con
dos círculos grabados que tienen
210 y 500 mm de diámetro y en
el centro la cruz X.
C170-01
sección C
C174 N
Anillo Japonés, hecho de acero galvanizado, con sección rectangular de 30 x 15 mm y
C173
diámetro medio de 300 mm.
En la parte media de la circunferencia del anillo se encuentran una serie de perforaciones,
con 16 barras cilíndricas de diámetro 18 x 140 mm fijadas en dichos agujeros.
Las barras tienen 41 mm de distancia entre ellas.
C170
C174 N
S200-11
227
C183
C184
Consistómetro Vebe
Mesa vibratoria
NORMAS: EN 12350-3 / BS 1881:104 / UNI 9419
El método consistómetro Vebé se basa en el mismo principio del
método que el ensayo de asentamiento del cono de Abrams, para
la determinación de la trabajabilidad del hormigón, pero tiene la
ventaja que está motorizado. Después de retirar el cono de asentamiento, el hormigón se somete a una vibración para determinar su
asentamiento. Se suministra completo.
Alimentación: 230V monofásica 50Hz 250W
Dimensiones: 260x380x700 mm.
Peso: 90 kg
(Consistómetro Vebe)
NORMA: ASTM C1170-92
Para determinar la consistencia y la densidad del
hormigón compactado a rodillo.
Al igual que en mod. C183, pero para la
normativa ASTM C1170-92.
Con un peso móvil de 22’68 Kg
(50 lbs)
* Alimentación:
230V monofásica 50Hz 180W
Dimensiones: 280x400x900mm
Peso: 110 kg
* NOTA: La mesa vibratoria está
disponible también en:
230V 60Hz y 110V 60Hz
C184
C183
ACCESORIO para la mesa C184:
C184-10
PESO MÓVIL DE 9’07 KG (20 LBS) que sustituye al estándar de
22’68 Kg (50 lbs) + base para fijar un molde cilíndrico de diámetro
6” x 12” (opcional mod. C258-03) conforme a la Norma de la
mesa vibratoria ASTM C1176-92.
C258-03
C184-10
instrumentos para ensayos de materiales
HO RM I G ÓN
CONJUNTO DE ENSAYO CONO DE ABRAMS
sección C
NORMAS: EN 12350-2 / pr EN 12350-8:2009 / ASTM C143 / BS 1881:102 / AASHTO T119
NF P18-305, P18-451 / UNE 7103 / UNI 9418
CONJUNTO COMPLETO DEL ENSAYO CONO DE ABRAMS. Matest propone diferentes versiones:
C180-KIT CONO DE ABRAMS, JUEGO COMPLETO, ideal para
ensayos de laboratorio, incluyendo:
C180-01 Cono de Abrams, de “acero inoxidable”
C180-02 Varilla de picado, acero galvanizado, de diámetro
16 x 600 mm
C180-03 Tolva de llenado, de acero galvanizado
C180-06 Barra graduada, con incrementos “grabados cada 0,5
cm” para el desplazamiento de la varilla de medición
C180-07 Base, de acero galvanizado, completa
V184
Recogedor de aluminio, 500 cc
V178-01 Cepillo de alambre fino
Peso: 10 kg aprox.
C181
228
C180-04
V178-01
V176-01
V184
C178-KIT CONJUNTO DE ENSAYO CONO DE ABRAMS
PORTÁTIL, incluye:
C181
Cono de Abrams, “de acero galvanizado”
C179-02 Varilla de picado “graduada” de acero galvanizado,
Ø16 x 600 mm
C179-01 Base, fabricado en acero galvanizado de alta resistencia,
con pinzas y puente de medición que se
utiliza también como asa para el transporte.
El desplome se mide usando la varilla de
picado que tiene una escala graduada
C179-02
grabada en incrementos de 1 cm. Los
componentes del conjunto
están juntos para facilitar
C178-KIT
su transporte.
Muy práctico, robusto,
ideal para el uso in
C181
situ. Peso: 8 kg aprox.
C179-01
instrumentos para ensayos de materiales
C180-03
C180-06
C180-KIT
C180-01
C180-07
V178-01
C182-KIT
C180-02
C180-02
V184
C182-KIT CONO DE ABRAMS, CONJUNTO COMPLETO, incluye:
C181
Cono de Abrams, “de acero
galvanizado”
C180-02 Varilla de picado, acero galvanizado, de diámetro 16 x 600 mm
C180-04 Placa Base, de acero galvanizado
V176-01 Regla de acero, 300 mm de largo
V184
Recogedor de aluminio, 500 cc
V178-01 Cepillo de alambre fino
Peso: 5 kg aprox.
C179-02
C179-KIT
C180-01
C179-01
C179-KIT CONJUNTO DE ENSAYO CONO DE ABRAMS PORTÁTIL, incluye:
C180-01 Cono de Abrams, hecho “de acero inoxidable”
C179-02 Varilla de picado “graduada” de acero galvanizado, Ø16 x 600 mm
C179-01 Base, fabricado en acero galvanizado, completa con pinzas y
el puente de medición, como se describió anteriormente.
Peso: 8 kg aprox.
C179-02 DETALLE
NOTA:
Cada componente de los conjuntos se pueden pedir por separado.
El usuario puede personalizar la composición del conjunto para el
ensayo del Cono de Abrams.
HO RMIGÓN
C180-01
Cono de Abrams sólo, hecho de “acero inoxidable”, de diámetro
100/200mm, altura 300 mm, el grosor de 1,5 mm.
Peso: 2 kg aprox.
C180-01
V185-03
Recogedor, de acero inoxidable
NORMAS: EN 12350-1 / UNI 9416 / BS 1881:101
Se utiliza para tomar muestras de hormigón fresco
Capacidad: 5 kg de hormigón
Dimensiones: diámetro 125x250 mm
sección C
C181
Cono de Abrams sólo, de acero galvanizado, de diámetro
100/200mm, altura 300 mm, el grosor de 1,5 mm.
Peso: 2 kg aprox.
V185-03
C181
229
C185
Equipo Factor de
Compactación
NORMAS: BS 1881:103 / BS 5075
Diseñado para llevar a cabo un procedimiento de ensayo más preciso y
sensible que el ensayo del cono de
Abrams.
El aparato consta de dos tolvas
cónicas montadas sobre un cilindro.
Cada tolva tiene una chapa de cierre, con bisagras de cierre rápido y
todo ello está montado sobre un
bastidor rígido de acero soldado.
El factor de compactación es
la relación entre el peso del
hormigón parcialmente compactado y el peso del hormigón
completamente compactado.
Se suministra completo con
barra de picado de diámetro
16x600 mm de largo.
Dimensiones: 500x400x1510 mm.
Peso: 55 kg
C192 KIT
Mesa de fluidez
NORMAS: EN 12350-5 / BS 1881:105 / DIN 1048 / UNI 8020
El aparato consta de un molde de acero galvanizado en forma
cónica, de diámetro 130/200 xh 200 mm, mesa doble de fluidez de
acero con la cara superior galvanizada, dispositivo de guía y pisón
de madera.
Se utiliza para determinar la trabajabilidad del hormigón. La tabla
superior tiene una superficie cuadrada de 700x700 mm, con
bisagras en un lado.
Peso: 30 kg
RECAMBIOS:
C192-01 Molde cónico, hecho de acero galvanizado,
dia. 130/200 xh 200 mm
C192-02 Pisón de Madera
C185
C192-01
C192-02
C192 KIT
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
C187
C186
Medidor K-slump
Penetrómetro de esfera Kelly
NORMA: ASTM C1362
Para determinar el grado de compactación y la trabajabilidad del
hormigón fresco. Se utiliza para mediciones in situ o con los moldes
de ensayo. Los resultados se pueden correlacionar con los valores
del cono de Abrams. Peso: 500 g
NORMA: ASTM C360
Consiste en un cilindro con terminación esférica, un armazón guía
y una manilla graduada en pulgadas, que se utiliza para determinar
la trabajabilidad del hormigón fresco. La bola se introduce en el
hormigón y se mide la penetración.
Se puede utilizar en obra o en el laboratorio.
Cadmiado para evitar la corrosión.
Peso: 15 kg
C187
C186
C190
230
C188
C188
Consistómetro de Walz
NORMAS: UNI EN 12350-4 / UNI 9420 / DIN 1048
Para medir la consistencia del hormigón fresco.
Se compone de una caja de metal con asas de 200x200 mm y
400 mm de altura, pintada para evitar la corrosión.
Peso: 6 kg
C189
Trabajabilidad del hormigón
NORMA: NF P18-452
El medidor de la trabajabilidad del hormigón (conocido también
como plastímetro) está diseñado para medir la manejabilidad
dinámica del hormigón.
Es adecuado para controlar en los ensayos de campo y de laboratorio:
- la consistencia de la mezcla de hormigón, especialmente el
contenido de agua
- la óptima proporción de los componentes de hormigón (arena,
grava, agua, cemento)
- la posible mejora al añadir plastificantes
- la comparación de dos tipos de hormigones
La unidad consta de un recipiente prismático dividido en dos partes de diferentes volúmenes mediante un partidor extraíble,
y un vibrador eléctrico.
El hormigón fresco se vierte en el espacio de mayor
volumen, el separador se retira, y el vibrador
comienza automáticamente a funcionar.
El ensayo consiste en medir el tiempo
necesario para que el hormigón alcance una
distribución uniforme en los dos recipientes
Alimentación: 230V monofásica 50Hz 300W
Dimensiones: 820x420x410 mm
Peso: 80 kg
instrumentos para ensayos de materiales
Plastímetro
Se utiliza para mediciones rápidas y sencillas de la plasticidad de las
mezclas, especialmente en hormigón, y así detectar rápidamente
cualquier exceso de agua.
El sistema de medida se relaciona con la fuerza de cizalladura
aplicada por un cabezal de tres hojas a la mezcla que se ensaya.
Es posible medir la plasticidad en diferentes puntos, y directamente
en la mezcla, con control múltiple, y los valores obtenidos se pueden comparar fácilmente con los valores obtenidos en el ensayo de
asentamiento del cono de Abrams.
Dimensiones: diámetro 130x180 mm
Peso: 2 kg
C190
C189
HO RMIGÓN
TIEMPO DE FRAGUADO DEL HORMIGÓN POR PENETRACIÓN
NORMAS: ASTM C403 / AASHTO T197 / UNI 7123
C213
C211
Utilizado para determinar el tiempo de fraguado de la fracción de
mortero en mezclas de hormigón con cono de Abrams superior a
cero, ensayando mortero tamizado de la muestra de hormigón. El
aparato consta de un penetrómetro de muelle (capacidad 100 kgf,
precisión 1 kgf) y seis punteros intercambiables con punta de acero
inoxidable de 16-32-65-160-325-650 mm2 de área. Un anillo con
ranuras indica la carga alcanzada en el mango del penetrómetro. Se
suministra completo con maletín.
Dimensiones: 450x160x70 mm. Peso: 5 kg
Aparato Joisel de Ø 140x220 mm de
altura
NORMA: Método del LCPC francés
Utilizado para separar los diversos elementos del hormigón fresco
como cemento, arena, áridos etc. Fabricado completamente en
acero inoxidable.
Peso: 2 kg
C213
sección C
Penetrómetro para hormigón
231
C211
C220
Equipo de análisis del agua del hormigón
en masa
C194
Penetrómetro de bolsillo para hormigón
Utilizado para la evaluación del fraguado inicial del mortero de
hormigón. El extremo del pistón de penetración tiene un área de
32 mm2. Se sumerge dentro del mortero hasta una profundidad
de 25,4 mm que se indica en el embolo. La resistencia, expresada
en KPa y lbf/sq.in. se muestra en la escala de lectura directa.
Dimensiones: dia. 25x210 mm
Peso: 400 g
NORMAS: EN 1008 / EN 206 / DIN 4030
Este conjunto, utilizado para el análisis del agua de la mezcla de
hormigón, se compone de diferentes frascos, cuentagotas, escala de
colores resistente al agua, tiras de ensayo. Es adecuado para realizar
más de 50 análisis de: pH total o momentáneo, magnesio, amonio,
cloruros, olores, sulfatos, CO2 disuelto, la dureza de carbonatos,
dureza total.
Incluido en estuches portátiles.
Peso: 2 kg
C194
C194-01
Penetrómetro de bolsillo
para hormigón con reloj comparador
Para evaluar el fraguado inicial
de hormigón, y el efecto de los
retardantes en el tiempo de
fraguado.
El émbolo tiene de diámetro
1/4 “(32,3 mm2.), el reloj
tiene la doble escala: 000700 psi y 00-50 kg/cm2.
Se suministra completo
con caja de plástico.
Peso: 300 g aprox.
C220
C194-01
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
C195
C196
Medidor de aire ocluido de 5 litros de
capacidad, tipo columna de agua
Medidor de aire ocluido de 8 litros de
capacidad, tipo manómetro de presión
NORMAS: EN 12350-7 / BS 1881:106 / UNI 6395
ASTM C231 type A / NF P18-353 / UNE 7141
Fabricado con aleación de aluminio fundido, funciona según el
principio de la presión de aire dando directamente el porcentaje
de aire ocluido en una masa de hormigón fresco. El instrumento
se suministra completo con un indicador para presión, barra de
picado y una bomba de mano.
Rango de medida: 0÷8% - div. 0,1%
Dimensiones: dia. 250x700 mm. Peso: 13 kg
ACCESSORIO:
C195-01 CILINDRO DE CALIBRACIÓN, para comprobar y
calibrar el medidor de aire mod. C195
NORMAS: EN 12350-7 / DIN 1048
ASTM C231 type B
Consta de un recipiente de aluminio, con
una bomba de presión manual conectada a un manómetro que muestra
directamente el contenido en aire en
porcentaje.
Rango de medida: 0÷10%
div. 0,1 % hasta 8% y 0,5% por
encima.
Dimensiones: dia. 250x450 mm
Peso: 12 kg
C197
C195
232
C196
Medidor de aire ocluido de 8 litros de capacidad, tipo manómetro de presión
Idéntico al mod. C196 pero con un compresor de aire eléctrico
automático para proporcionar presión de aire, y para mantenerla
constante a lo largo de todo el ensayo.
Alimentación: 230V monofásica 50/60Hz
Dimensiones: dia. 250x450 mm
Peso: 14 kg
ACCESORIO:
C197-01
Tolva de llenado para los
medidores de aire ocluido
C196 y C197.
C197
C195-01
C198
Medidor de aire ocluido de 5 litros de
capacidad, tipo manómetro de presión
NORMAS: EN 12350-7 / ASTM C231 type B / AASHTO T152
Consiste en un recipiente de aluminio cilíndrico con tapa de cubierta hermética que incorpora una bomba de aire, un manómetro
de precisión 90 mm de diámetro y válvulas.
Capacidad: 7 litros.
Rango de medida: 0 - 100%
Graduaciones de manómetros: 0,1% hasta un 6% de la escala, un
0,2% del 6% al 10% de la escala. Ligero, compacto y resistente, este
equipo con un sistema de sujeción rápido permite la realización del
ensayo con pocos movimientos de bomba. No se ve afectado por
el cambio en la presión atmosférica. El contenedor puede ser utilizado también para las medidas densidad de los hormigones frescos
y áridos. Se suministra completo con kit de calibración, accesorios,
robusto maletín de plástico.
Dimensiones: diámetro. 250 por 500 mm aprox. Peso: 10 kg
instrumentos para ensayos de materiales
C198
HO RMIGÓN
DENSIDAD DEL HORMIGÓN FRESCO
C199
Recipiente
volumétrico, 10
litros de capacidad
NORMAS: EN 12350-6
EN 1097-3 / BS 1881:107
ASTM C29, C138
Utilizado para determinar la
masa volumétrica del hormigón
fresco y compactado. Fabricado
C199
en acero de 4 mm de espesor,
con radios internos entre la pared y la base de 20 mm, borde
superior y base mecanizados.
Diámetro interno: 200 mm por 320 mm de altura
Peso: 9 kg
NORMA: EN 480-4
C199-10
CONTENEDOR, con 250 mm de diámetro por 280 mm de altura,
completo con tapa.
“Fabricado en acero inoxidable”, usado para la determinación
de la exudación relativa de una muestra de hormigón fresco, con
áridos de 50 mm de tamaño máx.
Peso: 5 kg aprox.
sección C
Aditivos para hormigones, morteros y
pastas.
Determinación de la exudación del hormigón
ACCESORIO:
C199-11
Pisón, hecho “de acero inoxidable”, de 100 mm de diámetro.
Recipientes volumétricos
233
NORMAS: ASTM C29, C138 / AASHTO T19 / UNI 6394 / UNE 7286
BS 812, 1881, comparable con la EN 1097-3
Construidos con robustas chapas de acero, se utilizan para determinar el peso por metro cúbico del hormigón fresco y compactado, y
según la Norma ASTM también el contenido de aire del hormigón
fresco.
C199-10
C200 ÷ C205-01
C199-11
Modelos
Capacidad
Litros
Diámetro
interno mm
Altura
útil mm
Espesor
chapa mm
Peso
kg
C200
C201
C201-01
C202
C202-01
C203
C204
C204-01
C205
C205-01
1
2
3
5
7
10
14
15
28
30
108,3
108,3
160
187,7
187,7
265
265
265
345,6
345,6
108,6
217,1
149,2
180,7
253
181,3
253,8
272
298,5
319,8
3
3
3
3
3
4
4
4
5
5
2
3
3,5
4
5
7
9
12
14
15
instrumentos para ensayos de materiales
HO RM I G ÓN
MESA DE SACUDIDAS PARA HORMIGÓN
NORMAS: ASTM C124 / equiparable a las UNI 8020-A / AASHTO T120 / UNE 7102
Utilizada para determinar la fluidez del hormigón fresco. El aparato consta de una mesa de sacudidas, un molde de flujo de acero inoxidable y una barra de picado.
C208
sección C
C208 + C208-01
234
MODELOS:
MESA DE SACUDIDAS
C208
Funcionamiento manual mediante una manivela.
Diámetro de la mesa: 762 mm
Peso: 100 kg
C208-01 KIT DE MOTORIZADO para ser conectado a la mesa
de sacudidas mod. C208 y conseguir una realización
automática.
Completo con un contador digital automático de
sacudidas.
Alimentación: 230V monofásica 50Hz 750W
Peso: 15 kg
C214
Cementómetro
Para la determinación rápida del contenido de humedad en el
cemento y el hormigón.
Rápido y fácil de usar, basta con insertar las puntas en el material
que se ensaya,
Lecturas precisas e instantáneas, medidor portátil digital.
Rango de relación: 0,35 a 0,70 de agua / cemento.
La unidad puede almacenar más de 150 lecturas.
Los datos se pueden recuperar a través de puerto RS-232 usando
WIN98 o superior.
Alimentación: baterías 4AA
Peso: 2 kg aprox.
C214-01
Cementómetro
Mismo mod. C214, pero con un rango de relación: 0,25 a 0,5 para
relaciones bajas de agua cemento
Densidad del hormigón endurecido
NORMAS: EN 12390-7 / BS 812, 1881 :114 / UNI 6394
V085
Bastidor de peso específico. Detalles técnicos: ver pág. 438
V085-01
Recipiente de sujeción de las muestras
C214
V072-06
V041
Diámetro de cesta de densidad 200 por 200 mm,
acero inoxidable, 3,35 mm de tamaño de malla.
Nota:
Balanzas específicas del ensayo de la densidad:
ver pág. 437
V041
instrumentos para ensayos de materiales
V085
HO RMIGÓN
C303
Utilizado para medir de forma automática, almacenar e imprimir, la temperatura en diferentes posiciones en unidades pre encastadas para
determinar el curado del hormigón. Rango de medición: -200,0 a +999,9 °C, Resolución: 0,1 °C.
El termómetro puede medir y almacenar hasta 4 puntos simultáneos en diferentes intervalos seleccionables de:
1, 2, 5, 10, 30, 60, 120, 180 minutos. Posibilidad de almacenar hasta 16.000 lecturas de temperatura.
Funciona con pilas, 500 horas de autonomía, toma de corriente de 12V CC de suministro, apagado automático.
Se suministra completo con: bobina termopar tipo K de 50 metros, juego de 4 conectores macho, 5 rollos de papel, cartuchos de tinta,
maletín de transporte.
Dimensiones: 220x82x66 mm
Peso: 600 g aprox.
C303-10
Termómetro, puerto de infrarrojos,
cuatro canales, sonda tipo K, registro e
impresión
sección C
Termómetro, de cuatro canales, sonda tipo K, registro e impresión
Mismo mod. C303, pero también preestablecido para la puerto de
infrarrojos y la utilización de Windows (ver accesorios).
ACCESORIOS sólo para mod. C303-10:
C303-06 Transmisores infrarrojos de 9 clavijas para ordenador y
conexión de la impresora
C303-05 Compatible con software de Windows para conexión a
ordenador
RECAMBIOS para mod. C303 y C303-10:
C303-01 Sonda tipo K, bobina de 50 metros
C303-02 Rollos de papel, paquete de 10
C303-03 Cartucho de tinta, paquete de 2
C303-11 Juego de 4 conectores macho
C225
Molde cúbico de plástico de 150 mm lado,
“Dos partes”
CONJUNTO DE 6 MOLDES
El molde está compuesto por dos elementos especulares sujetos
por dos inserciones laterales.
Este molde ofrece muy buenas tolerancias de planeidad y perpendicularidad, es resistente (hasta 20 usos, con las condiciones normales de mantenimiento), ligero, rápido y práctico para ser utilizado.
Se suministra completo con dispositivo de apisonar-enrasar y dos
inserciones laterales de repuesto.
Conjunto de 6 moldes en caja de cartón.
Dimensiones del embalaje:
400x300x220mm
C205
235
C303 CON ACCESORIOS Y MALETA
C215
RAM – Máquina para Análisis Rápido
NORMA: BS 1881:128
Utilizada para la determinación rápida del contenido de cemento
en el hormigón fresco, áridos gruesos y finos, cenizas volantes y
contenido de escorias GGBF que también se pueden determinar.
Procedimiento totalmente automatizado con resultados de ensayo
rápidos y precisos (errores máximos 5 kg/m3).
Un ensayo completo dura aproximadamente 10 minutos.
Se requieren aproximadamente 80 litros de agua
para cada ensayo por lo
que se necesita conexión
a la red de suministro
de agua. El peso de la
muestra de hormigón
necesario para cada
ensayo es de 8 kg.
Se suministra completa.
Alimentación: 230V monofásica 50Hz
Dimensiones:
780x660x1500 mm
Peso: 150 kg
C215
instrumentos para ensayos de materiales
HO RM I G ÓN
MOLDES CUBICOS, CILINDRICOS Y DE PROBETAS PRISMÁTICAS
sección C
Estos moldes de una sola pieza, muy apreciados por el usuario, están hechos de plástico duro, fuerte, ligero, indeformable; resistente a los
golpes, las vibraciones y el desgaste. No requieren operaciones de montaje y desmontaje, con el consiguiente ahorro de tiempo y trabajo.
Sólo necesitan una simple limpieza y lubricación en el desmolde antes de estar listo para volver a utilizarse numerosas veces.
La muestra es expulsada del molde con aire comprimido o agua.
Los moldes: C223, C224, C230N, C232N, C228, C229 son fabricados por Matest y tienen precios competitivos.
MOLDES CÚBICOS DE 150 MM DE LADO
El molde cúbico de 150 mm de lado “Fabricados por Matest” se puede suministrar en tres modelos diferentes, cada uno con diferentes características y peso.
Los tres modelos tienen una banda reforzada en las paredes y las superficies interiores son muy lisas haciendo más fácil la expulsión de la
muestra.
Los modelos C223 y C224, realizados por Matest, también presentan “esquinas reforzadas”, garantizando una resistencia adicional, y se prevé una banda reforzada en la base en forma de “X”, mejorando la resistencia del molde, y permitiendo al usuario dar pequeños golpes con
un mazo de goma (mod. V195) facilitando la expulsión de dicha muestra. Todos los moldes se suministran con el grabado del logo Matest.
Todos los moldes están disponibles sin marca, y bajo pedido se pueden suministrar con el gravado del “logo del cliente”
MODELOS:
Esquinas reforzadas
C223 “Fabricado por Matest”
MOLDE CUBICO, 150 mm de lado, con “X” banda reforzada
en la base, y esquinas reforzadas. Peso: 1300 g aprox.
236
C224 “Fabricado por Matest”
MOLDE CUBICO, 150 mm de lado, de “ALTA DENSIDAD”,
con “X” banda reforzada en la base y esquinas reforzadas.
El mismo molde para mod. C223 se fabrica a partir de “mezcla de
alta densidad”, con un total de 1600 g de peso, obteniendo una
mayor dureza y resistencia del material plástico.
- Aumenta la resistencia a la abrasión, al reducir la acción del
desgaste.
- Mejora la resistencia a la presión durante la eyección de la muestra, reduciendo la rotura del molde.
- Se asegura un mayor número de utilizaciones (con mantenimiento).
Peso: 1600 g aprox.
C223 / C224
C232N “Fabricado por Matest”
MOLDE CÚBICO, 100 mm de lado de DOS PLAZAS
con banda reforzada en la base en forma de “X”. Las
paredes interiores tienen una superficie lisa y suave,
por lo que es más fácil de moldear la muestra.
Peso: 1030 g aprox.
Detalle de la banda reforzada en la base en forma
de “X” de los modelos
C223, C224, C232N,
C235, C237, C238
C232N
C223
C232N
C230-01
C230-03
C230N
“Fabricado por Matest”
MOLDE CÚBICO, estándar,
banda reforzada, 150 mm
de lado
Peso: 1250 g aprox.
instrumentos para ensayos de materiales
C230N
C230
MOLDE CÚBICO, estándar,
banda reforzada, 150 mm de lado.
Peso: 1260 g aprox.
C230
HO RMIGÓN
C235
MOLDE CÚBICO, 200 mm
de lado, con “X” banda reforzada en la base y paredes y
esquinas superiores doblemente
reforzadas.
Peso: 2550 g aprox.
C235
C237
MOLDE DE PROBETA PRISMÁTICA, 100x100x500 mm de lados,
con “X” bandas reforzadas en la base y paredes y esquinas superiores doblemente reforzadas. Peso: 2100 g aprox.
C237
C230-05
PISTOLA, para conectarse a aire o agua a presión, para extraer la
muestra del molde.
C238
MOLDE DE PROBETA PRISMÁTICA, 150x150x600 mm de lados,
con “X” bandas reforzadas en la base y paredes y esquinas superiores doblemente reforzadas. Peso: 4400 g aprox.
C228 “Fabricado por Matest”
MOLDE CILÍNDRICO, dia. 150 x 300 mm con las bandas superior
e inferior reforzadas. Peso: 2150 g aprox.
sección C
C238
C229
237
C228
C229 “Fabricado por Matest”
MOLDE CILÍNDRICO, dia. 160 x 320 mm con las bandas superior
e inferior reforzadas. Peso: 2200 g aprox.
C230-05
ACCESORIOS:
C223-01 CUBIERTA, de plástico para moldes C223, C224.
Útil para los transportes. Paquete de 10 unidades.
C234-02 CUBIERTA, de plástico para moldes C230N y C230.
Útil para los transportes. Paquete de 10 unidades.
C234-03 TOPE de plástico, para tapar el agujero de los moldes
C223, C224, C228, C230N, C229. Paquete de 10
unidades.
C230-04 TOPE de plástico, para tapar el agujero del molde C230.
Paquete de 10 unidades.
C232-01 TOPE de plástico, para tapar el agujero del molde C232N
Paquete de 10 unidades.
C235-01 TOPE de plástico, para tapar el agujero de los moldes
C235, C237, C238. Paquete de 10 unidades.
C230-01 TOLVA DE LLENADO de acero inoxidable, para un
fácil llenado del hormigón fresco en los moldes: C223,
C224, C230, C230N
Se suministra completo con sujeciones elásticas.
C230-03 PINZAS DE SUJECIÓN para moldes C230N y C230,
para facilitar el transporte.
C223-05
ETIQUETA
DE IDENTIFICACIÓN
Conjunto de 250 etiquetas
C223-05
C234-02
C234-03
Moldes cúbicos de poliestireno
Estos moldes cúbicos, hechos de poliestireno, se utilizan para un
solo ensayo, ya que se rompe en el desmoldado de la muestra.
Ofrece diferentes ventajas:
- está provisto de cubierta superior para el mantenimiento
constante de calor y la humedad constante actuando como una
cámara de curado
- protege la muestra como un embalaje durante el transporte
- es muy ligera
- para cualquier fallo relativo a la limpieza, al desmolde y al mantenimiento del molde se eliminan.
C231
Molde cúbico de poliestireno,
150 mm de lado, un puesto.
Paquete de 40 piezas.
C231-01
Molde cúbico de poliestireno,
200 mm de lado, un puesto.
Paquete de 20 piezas.
C231
instrumentos para ensayos de materiales
HO RM I G ÓN
sección C
MOLDES DE ACERO CÚBICOS, CILÍNDRICOS Y PARA PROBETAS PRISMÁTICAS
238
Moldes de dimensiones nominales para satisfacer las necesidades de las
NORMAS: EN 12390-1 / BS 1881:108 / ASTM C192, C39 / AASHTO T23, T126 / NF P18-400 / UNI 6130 / UNE 7240
C230-01
C230-01 EMBUDO (TOLVA DE LLENADO)
Moldes de acero, cúbicos y para probetas
para facilitar el llenado con hormigón fresco
prismáticas
en los moldes cúbicos C247-01, C253-01,
Estos modelos de moldes de acero, cúbicos y prismáticos son robustos y las superficies interiores están perfectamente mecanizadas. C253-03. Fabricado en chapa de acero
inoxidable.
Las dimensiones nominales encuetran lor requisitos de la Norma
EN 12390-1.
Moldes de acero para probetas cilíndricas
MODELOS:
NORMAS: EN 12390-1 / ASTM C39, C192
Molde para probeta cúbica, de 100 mm de lado, 1 puesto. Peso: 6 kg
C247
AASHTO T23, T126 / NF P18-400 / UNE 7240
C247-01 Molde para probeta cúbica, de 150 mm de lado, 1 puesto. Peso: 13 kg La superficie interna, base, parte superior e inferior están perfectaC247-02 Molde para probeta cúbica, de 200 mm de lado, 1 puesto. Peso: 25 kg mente mecanizadas.
C247-03 Molde para probeta cúbica, de 300 mm de lado, 1 puesto. Peso: 90 kg
Modelos
Dimensiones
Peso
C248
Molde para probeta cúbica, de 100 mm de lado, 2 puestos. Peso: 11 kg
diámetro x altura
kg
C248-01 Molde para probeta cúbica, de 150 mm de lado, 2 puestos. Peso: 30 kg
C258
100x200 mm
8
C248-02 Molde para probeta cúbica, de 200 mm de lado, 2 puestos. Peso: 45 kg
C258-01
112,8x220 mm
8
C248-03 Molde para probeta cúbica, de 100 mm de lado, 3 puestos. Peso: 17 kg
C258-02
150x300 mm
15
C248-04 Molde para probeta cúbica, de 140 mm de lado, 3 puestos. Peso: 30 kg
C258-03
6” x 12”
15
C248-05 Molde para probeta cúbica, de 150 mm de lado, 3 puestos. Peso: 38 kg
C258-04
159,6x320 mm
17
C249
Molde para probeta cúbica, de 100 mm de lado, 4 puestos. Peso: 20kg
C258-05
250x500 mm
80
C249-01 Molde para probeta cúbica, de 150 mm de lado, 4 puestos. Peso: 45 kg
C258-06
150x150 mm
10
C258-04 CO
159,6x320 mm sujeción rápida
18
C247 ÷ C249-01
C254
C254-01
C254-02
C254-03
C254-04
C254-05
Molde para probeta prismática, de 100x100x400 mm. Peso: 20 kg
Molde para probeta prismática, de 100x100x500 mm. Peso: 23 kg
Molde para probeta prismática, de 150x150x600 mm. Peso: 44 kg
Molde para probeta prismática, de 150x150x750 mm. Peso: 47 kg
Molde para probeta prismática, de 200x200x800 mm. Peso: 86 kg
Molde para probeta prismática, de 140x140x560 mm. Peso: 38 kg
C258 ÷ C258-06
C254 ÷ C254-05
C258-04CO
instrumentos para ensayos de materiales
HO RMIGÓN
Moldes cilíndricos partidos
Hechos de acero galvanizado con acabado contra la corrosión.
Provistos de bisagras laterales de total apertura y sistema de sujeción rápida con rosca giratoria incorporada. Completo con base.
Son fáciles de utilizar con un rápido y práctico desencofrado;
Recomendado para uso en obra.
Dimensiones
diámetro x altura
C259
C259-01
150x300 mm
160x320 mm
Peso
kg
8,5
11
C259
Moldes cúbicos de Hierro fundido, un puesto
C259-01
sección C
Modelo
NORMAS: EN 12390-1 / BS 1881:108 / UNI 6127 / DIN 51229
Éstos moldes cúbicos cumplen con los requisitos de la Norma EN 12390-1.
Son revisados en la forma, dimensiones y la tolerancia con los instrumentos certificados por el Instituto Oficial SIT (o equivalente), y tienen
un Número de Serie marcado en cada lado.
Las muestras cúbicas producidas cumplen con las Normas, evitando la costosa verificación dimensional para el usuario final.
Completo con placa base, tipo abrazadera.
Hay dos modelos disponibles:
- diseño de cuatro paredes iguales
- dos paredes en forma de “V”, ofreciendo
un uso más práctico y rápido.
C253
C253-01
MODELOS:
MOLDE CÚBICO de 100 mm de
C253
hierro fundido, “diseño cuatro piezas”
Peso: 8,3 kg
C253-01 MOLDE CÚBICO de 150 mm de
hierro fundido, “diseño cuatro piezas”
Peso: 15,5 kg
C253-03 DESENSAMBLADO
C253-02 MOLDE CÚBICO de 100 mm de
hierro fundido, “diseño de dos piezas
en forma de V”. Peso: 8,3 kg
ACCESORIOS PARA MOLDES:
C253-03 MOLDE CÚBICO de 150 mm de
C253 DESENSAMBLADO
hierro fundido, “diseño de dos piezas
C180-02 BARRA DE PICADO, de 16 mm
en forma de V”. Peso: 15,5 kg
de diámetro x 610 mm de longitud.
C261
BARRA DE PICADO, 25 mm. sección cuadrada x 380 mm
de longitud.
C262
REGLA DE ENRASAR, longitud 460 mm.
V178-01 CEPILLO DE ALAMBRES, se utiliza para limpiar moldes.
C265
ACEITE DE DESMOLDEO. Lata de 25 litros
V184-01 LIBRADOR DE ALUMINIO DE FONDO REDONDO 1000
ml de capacidad
V187
LLANA DE ACERO INOXIDABLE 120x260 mm
V195
MAZO DE GOMA, diámetro de la cabeza 55 mm
C180-02 ÷ V195
V182
BANDEJA DE MEZCLA, 600x600x80 mm galvanizada
instrumentos para ensayos de materiales
239
HO RM I G ÓN
Verificación de la planeidad, perpendicularidad, rectitud y dimensiones de los moldes y
muestras. NORMAS: EN 12390-1 / ISO 1101
sección C
El apéndice de la Norma EN 12390-1 exige un conjunto de instrumentos que se utilizarán para la verificación de las tolerancias dimensionales del molde y de las muestras.
240
V175-03
CALIBRE PIE DE REY, digital, 153x0,01 mm, para mediciones
dimensionales.
C250-12
GALGA DE ESPESOR, que comprende un conjunto de tiras desde
0,05 a 0,50 mm, con una hoja de 100 mm de largo.
V175-03CER
CALIBRE PIE DE REY, digital, 153x0,01 mm, para mediciones
dimensionales. Completo con Certificado de Calibración emitido
por el Laboratorio Acreditado (SIT).
C250-14
REGLA (regla de enrasar), de 300 mm de largo.
Como alternativa:
C250-16
GALGA PASA-NO PASA para moldes cúbicos de 100 mm.
C250-16CER
GALGA PASA-NO PASA para moldes cúbicos de 100 mm, completo con Certificado de Calibración emitido por el Laboratorio
Acreditado (SIT).
V175-02
CALIBRE PIE DE REY, digital, 200 x 0,01 mm, para mediciones
dimensionales.
C250-17
GALGA PASA-NO PASA para moldes cúbicos de 150 mm.
V175-02CER
CALIBRE PIE DE REY, digital, 200 x 0,01 mm, para mediciones
dimensionales, completo con Certificado de Calibración emitido
por el Laboratorio Acreditado (SIT).
C250-17CER
GALGA PASA-NO PASA para moldes cúbicos de 150 mm, con
Certificado de Calibración emitido por el Laboratorio Acreditado
(SIT).
C250-10
REGLA CON ÁNGULO RECTO (escuadra), hecho de acero,
150x100 mm de sección rectangular.
C250-17
V175-02
C250-16
C250-14
C250-10
C250-12
Verificación dimensional
instrumentos para ensayos de materiales
Verificación de planitud
Verificación de pasa-no pasa
HO RMIGÓN
Ensayos de hormigón endurecido
Determinación de la retracción hidráulica
C366-12
Clavija de referencia para ser pegado en la intersección del eje
longitudinal de la muestra con sus bases. Paquete de 10.
EQUIPO SEGÚN LA NORMA UNI 6555 (comparable con la
Norma ASTM C426):
C365
Molde de contracción, hecho de acero, completo con inserciones,
para preparar una muestra de PROBETA PRISMÁTICA de hormigón 100x100x500 mm. Peso: 23 kg
C366-12
C366-11
INSERCIONES, de acero inoxidable,
piezas de repuesto para el molde C365.
Paquete de 10
ACCESORIOS “necesarios”, conforme a:
UNI 11307:2008 y UNI 6555
C364
Aparatos de medida, muestras de 100x100x500, completo con
las barras de referencia, pero “sin” comparador que se piden por
separado. Peso: 23 kg
RELOJ COMPARADOR, 5 mm de recorrido con una
precisión de 0,001 mm
COMO ALTERNATIVA:
S376
RELOJ COMPARADOR, 10 mm de recorrido con una
precisión de 0,001 mm.
COMO ALTERNATIVA:
C254-01
C365
S375
C364
sección C
Para medir la contracción dimensional axial y / o superficial
en probetas de hormigón durante el proceso de endurecimiento en una sala de curado.
NORMAS: UNI 11307:2008 / UNI 6555
(comparable con la Norma ASTM C426)
La muestra se prepara en un molde de dimensiones
100x100x500 mm, con áridos de hasta un máximo de 30 mm de
diámetro, y después de que sea alojada en el aparato de medida se
determina la contracción axial.
Las dos Normas UNI requieren dos sistemas diferentes de
preparar las muestras:
- La UNI 11307 requiere de clavijas de referencia para ser
adheridas a la muestra.
- La UNI 6555 requiere de inserciones fijas en el molde y para
dejarlas en la muestra.
EQUIPO SEGÚN LA NORMA UNI 11307:2008:
C254-01
Molde de probeta prismática hecha de acero, para preparar una
muestra de hormigón de 100x100x500 mm. Peso: 23 kg
Determinación de la expansión contenida
en una muestra de hormigón o mortero
que contiene agente expansivo, y el efecto
de los áridos en la retracción por secado del
hormigón. El molde, hecho de acero, se suministra completo
con 3 varillas roscadas y 6 placas de contención.
MODELOS:
MOLDE PRISMÁTICO DE TRES PUESTOS, para proE114
ducir muestras de 80x80x240 mm. NORMA: UNI 8148.
Peso: 15 kg
E114-02 Placa de contención final de 80x80 mm; repuesto para
el molde E114.
MOLDE PRISMÁTICO DE TRES PUESTOS, para proE115
ducir muestras de 50x50x250 mm. NORMA: UNI 8147.
Peso: 10 kg
E115-02 Placa de contención final de 50x50 mm; repuesto para
el molde E115.
E115-01 Barra de acero atornillada de 280 mm de largo;
repuesto para los moldes E114 y E115.
E114
E114-02
S375
S382-01 COMPARADOR DIGITAL con indicador, lecturas en
mm (0,001 mm de precisión) y en pulgadas (0,0001
“ de precisión), alimentada con batería. Completo con
conector RS-232 para la batería y para ordenador.
S382-11 CABLE para conectar el manómetro digital al ordenador.
S382-10 Adaptador USB para el cable S382-11.
E115-01
E115-02
E115
ACCESORIOS:
E077 KIT COMPARADOR LONGITUDINAL, con dial analógico para
medir las variaciones lineales. Detalles técnicos: ver pág. 291
COMO ALTERNATIVA:
E078 KIT
COMPARADOR LONGITUDINAL, con dial analógico para medir
las variaciones lineales. Detalles técnicos: ver pág. 291
E078-05 VARILLA DE REFERENCIA, 280 mm de largo.
instrumentos para ensayos de materiales
241
HO RM I G ÓN
sección C
MESAS VIBRADORAS
242
NORMAS: EN 12390-2 / BS 1881:108 / UNI 6127
Utilizadas para la compactación de probetas de hormigón en
laboratorio, fabricadas a partir de robustas chapas de acero.
Equipadas con un motor-vibrador eléctrico de 3000 vibraciones/minuto, es posible variar la intensidad de vibración actuando sobre las
masas excéntricas. La mesa tiene una altura de 410 mm aprox.
Todas las mesas vibradoras aceptan el dispositivo de sujeción,
el pedal del interruptor o el panel de control (ver accesorios).
Alimentación: 230V monofásica 50Hz
Modelos
C278
C278-01
C278-02
C279
Dimensiones Potencia
de la mesa mm
W
600x400
800x400
800x800
1100x550
180
180
180
180
Peso
kg
*Dispositivo
de Sujeción
60
85
115
145
C281-01
C281-02
C281-03
C281-04
C279-02
C281-01
C278 CON MOLDES C253-01
* El dispositivo de sujeción se utiliza para fijar los moldes a la mesa
durante la acción vibratoria.
C279-04
C279
C278-02
MESAS VIBRATORIAS PORTÁTILES
Al igual que en las mesas vibradoras anteriores, adecuadas el uso en obra y en
laboratorio, aceptan moldes cúbicos de una única probeta (máx. 200 mm de lado) o
moldes cilíndricos de 160x320mm, hechos de plástico y de metal.
Se suministra completo con bandas elásticas para fijar el molde a la mesa.
Dimensiones de la mesa: 400x300mm, 200mm de altura
Peso: 16 kg
C281N
MODELOS:
C281N
Mesa vibratoria, portátil, 12 V CC
Apto para el uso en obra, donde no se dispone de suministro
eléctrico.
Ligera y de pequeño tamaño, que puede ser manejada por una
persona y almacenar fácilmente en el maletero del coche.
Se suministra completo con interruptor On / Off y conector para
el encendedor de cigarros del vehículo.
C282
C281-05
C279-04
Mesa vibratoria
Al igual que en mod. C281N,
pero para uso en laboratorio.
Alimentación:
230V monofásica 50Hz 110W
instrumentos para ensayos de materiales
C282
C282
C279-02
HO RMIGÓN
C279-04
PEDAL INTERRUPTOR, resistente al agua. Se puede fijar a la mesa
“sólo como una alternativa” al Panel de control mod. C279-02.
C279-02
PANEL DE CONTROL, separado, con interruptor on / off y el
temporizador, consiguiendo también las tablas de la Directiva de
Seguridad de la CE.
No se puede utilizar con la mesa mod. C281N
C281-05
DISPOSITIVO DE SUJECIÓN, para fijar el molde a la mesa, adecuada “sólo” para mesas mod. C281N y C282.
Solución alternativa a las bandas elásticas.
Recomendado para la mesa de laboratorio C282.
C271
VIBRADOR DE AGUJA, portátil, funciona con un motor de gasolina
de 0,75 HP.
Dimensiones de la punta: 22 mm de diámetro por 250 mm de largo.
Tubo de goma flexible de 2 metros de largo.
Frecuencia: 12000 vibraciones / min.
Dimensiones: 300x300x400 mm
Peso: 9 kg aprox.
C271
sección C
ACCESORIOS PARA MESAS VIBRADORAS:
C279-01
MOTOR-VIBRADOR, adicional, (sólo para mesa mod. C279) para
obtener una vibración unidireccional y una potencia de vibración
de 300 kg de masa.
VIBRADORES DE AGUJA
NORMAS: EN 12390-2 / ASTM C31, C192
AASHTO T23, T126 / BS 1881:108 / UNI 6137
Adecuado para la compactación interna de probetas de hormigón,
tanto en laboratorio como en obra.
El diámetro de la aguja no debe superar el 25% de la menor
dimensión de la muestra.
Diferentes modelos disponibles: eléctrico, de gasolina, con pilas.
C270
VIBRADOR DE AGUJA, DE ALTA RESISTÉNCIA, portátil, eléctrico.
Dimensiones de la punta: 25 mm de diámetro por 290 mm de
largo.
Tubo de goma flexible de 2 metros de largo.
Frecuencia: 12000 vibr. / minuto.
Amplitud: 0,65 mm
Fuerza centrífuga: 0,8 kN (80 kg)
Alimentación: 230V monofásica 50/60Hz 2300W
Dimensiones: 200x300x350 mm aprox.
Peso: 10 kg aprox.
C270
C274
VIBRADOR DE AGUJA, portátiles, funciona con batería 12 V CC
Completo con el conector para encendedor del coche.
Dimensiones de la punta: 22 mm de diámetro por 250 mm de
largo.
Tubo de goma flexible de 2 metros de largo
Frecuencia: 12.000 vibraciones / min.
Peso: 10 kg aprox.
C274
RECAMBIOS:
C270-10
PUNTA, de 25 mm de diámetro por 290 mm de largo y tubo de
goma flexible de 2 metros de largo, para el vibrador mod. C270.
C271-10
PUNTA, de 22 mm de diámetro por 250 mm de largo y tubo de
goma flexible de 2 metros de largo, para los vibradores mod. C271
y C274.
C270-10
instrumentos para ensayos de materiales
243
HO RM I G ÓN
TANQUES DE CURADO PARA MUESTRAS DE HORMIGÓN
C304
NORMAS: EN 12390-2 / ASTM C31, C192, C511 / AASHTO T23
UNE 7240 / NF P18-404 / UNI 6127, 6128, 6129
BS 1881:111
C302 KIT
Fabricado de chapa de acero galvanizado para evitar la corrosión.
Se suministra completo con rejilla estante en el fondo y un tapón
para un fácil vaciado del agua.
Se suministra “sin” termostato con resistencia de calentamiento
que debe pedirse aparte (ver accesorios).
El tanque puede albergar hasta 64 cubos de 150 mm de lado; o
hasta 48 cubos de 200 mm de lado.
Dimensiones internas: 1500x750x750 mm
Peso: 120 kg
C306-01
sección C
Tanque de curado de 650 litros de capacidad, de plástico duro
Fabricado de polietileno robusto y muy estable, completo con una
rejilla estante en el fondo.
Se suministra “sin” termostato con resistencia de calentamiento
que debe pedirse aparte (ver accesorios).
Dimensiones internas: 1040x1040x605 mm
Peso: 60 kg
Tanque de curado de 1000 litros de capacidad
C304-02
C306-03
C302-01
244
C304
ACCESORIOS “NECESARIOS”
Disponible en dos versiones:
C302 KIT
C302-10 KIT
Tanque de curado, 550 litros de capacidad,
de plástico duro
Mismo mod C302, pero con:
“Grifo de descarga del agua, incorporado en el tanque”
Dimensiones internas: 1100x710xh 690 mm
Dimensiones máximas: 1200x800xh 850 mm
Peso: 55 kg
C304-01
C302-11
C304-01
SISTEMA DE CALENTAMIENTO
CON TERMOSTATO ANALÓGICO,
para los tanques mod. C302-10 KIT y C304
230V monofásico 50/60Hz 2000W
COMO ALTERNATIVA:
C302-10 KIT
instrumentos para ensayos de materiales
GRIFO DE
DESCARGA
C304-02
C302-01
SISTEMA DE CALENTAMIENTO CON
TERMOSTATO ANALÓGICO,
para el tanque Mod. C302 KIT
230V monofásico 50/60Hz 2000W
C302-01
C304-01
C304-02
SISTEMA DE CALENTAMIENTO CON TERMOSTATO DIGITAL
para los tanques mod.
C304-02 DETALLE
C302 KIT, C302-10 KIT
y C304, para “asegurar
una mayor precisión de la
temperatura”
230V monofásico 50/60Hz
2000W
HO RMIGÓN
ACCESORIOS PARA TANQUES
MOD. C302 KIT, C302-10 KIT, C304:
Cubierta de plástico para el tanque C302 KIT
Cubierta de plástico para el tanque C302-10 KIT
Cubierta de zinc para el tanque C304
Estantería de rejilla superior para el tanque C304 para
almacenar cubos de máx. 150 mm y máx. 8 estanterías
de rejilla por tanque.
C306-02 Bomba sumergible de recirculación del agua, utilizada
también para facilitar el vaciado
del agua del tanque.
230V monofásico 50/60Hz
C306-03
Cuadro separado de comandos, completo
con interruptor y protecciones eléctricas,
según Norma de Seguridad CE.
C306-03
Cámara climática:
- Temperatura: -20 a +60 °C, precisión de 0,5 °C
- Humedad: de 10 a 90%, precisión de +/- 5%
Capacidad: 520 litros
NORMAS: EN 196-1, 1367-1, 12390-2
Diseñada para cualquier laboratorio de investigación y control
dónde se necesitan temperaturas de enfriamiento y/o calentamiento conocidas y humedad controlada en cualquier tipo de ensayo de
hielo-deshielo, ensayos de curado acelerados, y ensayo de calentamiento y enfriamiento en general. También utilizada para controlar
el comportamiento de los áridos durante los ensayos cíclicos de
congelación y descongelación.
Estructura exterior e interior: todo de acero inoxidable.
Visualizador digital de temperatura instantánea y la programada.
Ventilación interna: a circulación forzada.
Capacidad interior útil: 520 litros.
Dimensiones internas: 620x630x1390 mm
Dimensiones externas: 730x860x2090 mm
Completa con tres bandejas ajustables, puerto RS 485.
Alimentación:
230V monofásica 50Hz
1000W
Peso: 150 kg
sección C
C305-01
C302-11
C306-04
C306-01
C314
C314-01
C306-02
Cámara de control climático
Igual que C314,
pero equipada con
microprocesador de
programación de la
temperatura para la
ejecución automática
de los ciclos establecidos.
C306-05
C306-05
Termostato analógico
Completo con resistencia de calentamiento. Se utiliza para calentar
el agua de tanques de 300 a 1000
litros de capacidad.
Alimentación: 230V monofásica
50/60Hz 2000W
E141
C314-01
C315
Cámara climática, similar al mod. C314, pero con:
Capacidad interna útil: 1200 litros
Puerta de entrada doble
Dimensiones internas: 1240x730x1390 mm
Dimensiones externas: 1460x860x2090 mm
Completa con 4 bandejas regulables. Peso: 230 kg
C315-05 Cabina de control climático
Similar a C315, pero equipada con microprocesador
de programación de la temperatura para la ejecución
automática de los ciclos establecidos.
E141
REFRIGERADOR DE AGUA
Enfría el agua desde la temperatura ambiente
hasta +10 °C. Se conecta al tanque donde se
requiere una temperatura inferior a la de la
habitación.
Vea la sección “E” de cemento, pág. 305.
ACCESORIOS:
C315-03 Software para la regulación remota de la temperatura
exterior y la humedad, registro e impresión para los
modelos C314 y C315.
C315-04 Software para la regulación remota de la temperatura
exterior y la humedad, registro e impresión para los
modelos C314-01 y C315-05.
instrumentos para ensayos de materiales
245
HO RM I G ÓN
C307
sección C
Tanque para el fraguado acelerado
246
NORMAS: ASTM C684 / BS 1881:112
Este tanque ha sido diseñado para el fraguado acelerado de la
resistencia del hormigón. Se compone de un tanque completamente aislado de doble pared con tapa, internamente de acero
inoxidable, externamente en chapa de acero pintada con una capa
intermedia de aislamiento de lana roca. Puede contener hasta 16
probetas cúbicas de 150 mm de lado, o bien 16 probetas cilíndricas
de 150 mm de diámetro o bien 8 probetas cúbicas de 200 mm de
lado. El ensayo consiste esencialmente en el fraguado acelerado de
las probetas de hormigón, calentando el agua con tres resistencias
eléctricas de 1500 W cada una.
Rango de temperatura: desde ambiente a + 100 °C
El cuadro de comando eléctrico separado comprende: termostato,
temporizador, lámpara piloto, interruptor general.
Dimensiones internas: 910x660x680 mm
Dimensiones externas: 970x720x900 mm
Alimentación: 230V monofásica 50/60Hz 4500W
Peso: 130 kg
C307
MUESTRAS DE FRAGUADO
Equipo de preparación con sala de temperatura y humedad controladas.
El siguiente equipo se sugiere como alternativa a los diferentes tanques de curado y cámaras climáticas indicadas en este catálogo o como
necesidad de una amplia zona para el fraguado de una gran cantidad de muestras. Son adecuados para preparar una sala / caja ya existente
o realizada por el cliente, tener una solución prefabricada con la posibilidad de controlar la temperatura y la humedad. La temperatura de la
sala puede ser mayor en comparación con la temperatura exterior, pero no inferior.
Dispositivos necesarios:
C309-10
PANEL DE CONTROL de temperatura y humedad.
Por lo general se coloca al exterior de la sala, y permite configurar,
visualizar y controlar los parámetros deseados de temperatura y
humedad.
Alimentación: 230V monofásica 50/60Hz
Dimensiones: aprox. 240x130x310 mm
Peso: 5 kg
C309-12
RESISTENCIA DE CALENTAMIENTO en el bastidor tubular, con
aletas.
Fabricado con cobre blindado en conformidad con las Normas de
Seguridad de la CE, integrada en la sala de fraguado y conectada al
panel de control. Normalmente, una resistencia de calentamiento
es suficiente para su propósito, siempre que el intervalo entre
la temperatura exterior e interior de la sala (en todo caso bien
aislada) se mantenga dentro de los 15 °C.
Dimensiones: diámetro 40x1100 mm. Peso: 2000 g aprox.
C309-14
C309-10
C311-01
C309-12
Ejemplo de cómo preparar una sala de fraguado
instrumentos para ensayos de materiales
C309-14
SONDA SENSOR para medir la
temperatura y la humedad.
Rango de medición de la temperatura
de -10 a +90 °C y la humedad de
hasta el 100%.
Fijada dentro de la habitación y
conectada al panel de control.
C311-01
VAPORIZADOR
Se utiliza para humidificar la sala de
fraguado de hasta 150 metros cúbicos.
Completo con regulador de nivel,
permite la conexión directa a la red
de agua para un uso continuo.
Datos técnicos: ver pág. 247
Insertado en la sala de fraguado y
conectado al panel de control.
HO RMIGÓN
NORMA: ASTM C1231
Se utilizan para ensayos de compresión en probetas cilíndricas de hormigón, como un método alternativo al refrentado
de azufre y a la rectificadora.
Dos recubrimientos de acero aplicados sobre las dos superficies planas de la probeta cilíndrica.
Dos almohadillas de neopreno colocadas entre ellos, para una mejor distribución de carga.
Las almohadillas de neopreno están disponibles en dos modelos:
Configuración
- almohadillas de dureza 60 Shore para una resistencia esperada desde 10 a 48 MPa
Almohadillas +
- almohadillas de dureza 70 Shore para una resistencia esperada de más de 48 MPa
Topes de refrenEl sistema no es aplicable para resistencias esperadas inferiores de 10 MPa
tado + Muestra
Nota:
La pareja de topes de refrentado + almohadillas de neopreno tienes un
espesor total de 46 mm. Por lo tanto, la cámara de ensayos de la prensa
debe tener una distancia vertical de + 46 mm que la altura de la probeta.
C107-10
sección C
ALMOHADILLAS DE RECUBRIMIENTO NO ADHERENTES Y TOPES DE REFRENTADO
C107-12
MODELOS:
C107-10 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de diámetro 150x300 mm y 6”x12 “
C107-12 TOPES DE REFRENTADO(dos unidades) para probetas cilíndricas de diámetro 160x320 mm
C107-20
C107-20 ALMOHADILLAS DE NEOPRENO (dos unidades) de
dureza Shore 60 para probetas cilíndricas de diámetro
150x300 mm y 6”x12 “
C107-21 ALMOHADILLAS DE NEOPRENO (dos unidades) de
dureza Shore 70 para probetas cilíndricas de diámetro
150x300 mm y 6”x12 “
C107-25 ALMOHADILLAS DE NEOPRENO (dos unidades) de
C107-29
dureza Shore 60 para probetas cilíndricas de diámetro
C312-02
160x320 mm.
Vaporizador para salas de curado hasta 500 m3
C107-26 ALMOHADILLAS DE NEOPRENO (dos unidades) de
dureza Shore 70 para probetas cilíndricas de diámetro
Similar al mod. C311-01, pero más potente para salas de hasta 500
160x320 mm.
metros cúbicos de capacidad.
C107-29 HOJA DE NEOPRENO (dos unidades) de dureza
Se suministra completo de “regulador de nivel” con anti desbordaShore A 60
miento, que permite la conexión directa a la red de agua, para un
Dimensiones: 600x400x12mm para ensayos en bloques. uso continuo del vaporizador.
Alimentación:
C311-01
230V monofásica 50Hz
Vaporizador para salas de curado hasta 150 m3
C312-02
Dimensiones:
Se utiliza para humidificar salas de curado de probetas de mortero
diámetro 420x350 mm
y hormigón. Capacidad máxima de la sala: 150 m3
Peso: 8 kg
Se suministra completo de “regulador de nivel” con anti desbordamiento, que permite la conexión directa a la red de agua, para un
uso continuo del vaporizador.
Alimentación: 230V monofásica 50Hz
Dimensiones: diámetro 360x230 mm. Peso: 3,5 kg
C311-01
ACCESORIO PARA MOD. C311-01, C312-02:
C312-10
HUMIDIFICADOR para controlar automáticamente la humedad
de la sala, rango de 30 ÷ 100%
C312-10
RECAMBIO:
C312-11
REGULADOR DEL NIVEL, completo anti desbordamiento.
instrumentos para ensayos de materiales
247
HO RM I G ÓN
EQUIPO PARA EL REFRENTADO DE PROBETAS CILÍNDRICAS
Método del azufre
sección C
NORMAS: EN 12390-3 / ASTM C617, C31, C192 / AASHTO T23, T126 / NF P18-416 / UNI 6132 / UNE 7240, 83303
Las Normas mencionadas requieren que las dos caras de la probeta de hormigón o de la muestra cilíndrica queden perfectamente planas y
paralelas, utilizando un equipo para refrentado con azufre.
C290-02
C290-01
Refrentadores cilíndricos
Para obtener superficies planas y perpendiculares al eje del cilindro.
248
C290-06
MEZCLA DE REFRENTADO, del tipo escamas ultra fuertes.
Este compuesto es una mezcla de azufre y relleno mineral, con una
resistencia a la compresión de 8000 - 9000 Psi (a las dos horas)
sobre una muestra cúbica de 2”, según lo solicitado por la Norma
ASTM C617.
Para una probeta cilíndrica de dia 150 mm. La resistencia a la
compresión es 16.000 Psi.
Punto de fusión es de 115 a 143 °C. (ideal: 130 °C)
Bolsa de 22,5 kg (50 lbs)
C290-07
COMPUESTO PARA REFRENTADO, de azufre y mezcla de polvo
mineral, con una resistencia mínima de 55 MPa.
Bolsa de 20 kg
V186-01 CUCHARA de acero inoxidable.
Modelo
Probeta cilíndrica diá. x h
C290-01
C291-01
C292-01
150x300mm, 6”x12”
160x320 mm
100x200 mm
Peso kg
6,3
6,2
4,4
C290-06
C290-07
C290-02
PORTADOR DE PROBETAS CILÍNDRICAS, para dia. 150x300mm,
160x320mm y 6”x 12”. Para un fácil manejo de las muestras.
Peso: 1,4 kg
RECIPIENTE DE FUSIÓN para la mezcla del refrentado.
Utilizado para fundir compuesto de azufre de refrentado. Completo con termoregulador. Apto también para propósitos generales de
laboratorio.
MODELOS DISPONIBLES:
C290-03 KIT RECIPIENTE DE FUSIÓN, capacidad: 4 litros. Modelo
de bajo costo. 230V monofásica 50/60Hz 1500W
A106
RECIPIENTE DE FUSIÓN, capacidad: 5 litros
Rango de temperatura: +50 a +350 °C, precisión: +/- 1,5 °C.
Completo con lámpara piloto, totalmente aislada según la Directiva
de Seguridad de la CE. Dimensiones internas: Ø. 200 mm x 160 mm
Alimentación: 230V monofásica 50/60Hz 800W. Peso: 3 kg
C290-03 KIT
OTROS MODELOS:
C294-01 Refrentador cilíndrico vertical de diámetro 250x500 mm
C294-02 Portador de probetas cilíndricas de diámetro 250x500 mm
C294-05 Refrentador cilíndrico vertical
de diámetro 60x120 mm
C294-05
C296
Placa de refrentado de acero, utilizada para tapar
los bloques de hormigón de hasta 500x300 mm
La superficie de la placa está mecanizada.
Dimensiones: 500x300x20 mm. Peso: 30 kg
A106
V186-01
instrumentos para ensayos de materiales
C296
HO RMIGÓN
MÁQUINA PARA PULIR PROBETAS
NORMAS: EN 12390-2 / UNI 6132 / ASTM D4543
Diseñada para pulir y rectificar probetas cilíndricas y cúbicas de
hormigón, rocas, piedras naturales, etc.
Las muestras se fijan fácilmente a la mesa con los estribos de
fijación adecuados (ver accesorios) permitiendo pulir simultáneamente:
- 3 probetas cúbicas de 100 mm de lado o
- 3 probetas cúbicas de 150 mm de lado o
- 2 probetas cúbicas de 200 mm de lado o
- 2 probetas cilíndricas de dia. 100x200 mm, 110x220 mm,
150x300 mm, 160x320 mm, o
- 1 bloque con dimensiones máx. 390x250mm
El cabezal giratorio es radial y se mueve alternativamente
en los dos sentidos por medio de un motor eléctrico
accionado por un pulsador.
La columna está completamente protegida contra el polvo
abrasivo.
El movimiento vertical del cabezal abrasivo se logra con
ajustes infinitesimales al operar la manivela superior con graduaciones de 0,05 mm.
La máquina, fabricada con chapa robusta, se suministra completa
con panel de control, con un tanque refrigerante / decantador (por
el agua y el aceite emulsionante), motor de la bomba, un conjunto
de sectores abrasivos, interruptor de seguridad que cuando es
retirada, la máquina se detiene automáticamente.
El suministro estándar “no incluye”:
- los estribos de bloqueo,
- los sectores de diamantes (8 piezas)
que deben pedirse por separado (ver accesorios).
C299
MAQUINA DE PULIR AUTOMÁTICA
Similar al mod. C298, pero con el movimiento radial del cabezal
equipado con sistema de fin de carrera, garantizando el desplazamiento totalmente automático en ambas direcciones sin necesidad
de activar el pulsador eléctrico.
ACCESORIOS “NECESARIOS”:
C300-06N
ESTRIBOS DE BLOQUEO para muestras de probetas cúbicas de lado
100, 150, 200 mm completo con suplemento de 60 mm de altura.
COMO ALTERNATIVA:
C299-10
DISPOSITIVO DE BLOQUEO RÁPIDO,
para: probetas cúbicas de 150 y 200 mm;
probetas cilíndricas de diámetro 100 a
160 mm Cada dispositivo admite una sola
muestra. Es posible pulir simultáneamente:
1 probeta cúbica de 200 mm, 2 probetas C299-10
cúbicas de 150 mm; 3 probetas cilíndricas.
C300-02
SECTORES DE DIAMANTES DE
PULIDO (8 piezas necesarias) “especialmente recomendable” por su larga
duración y una buena acción de pulido.
C300-02
Especificaciones técnicas:
Superficie de la mesa de trabajo: 775x280mm (útil: 750x250mm)
Diámetro del cabezal de pulido: 330mm
Luces verticales: min. 70 mm, máx. 350 mm
Recorrido del cabezal abrasivo: 205 mm
Velocidad del cabezal abrasivo: 1400 rpm.
Alimentación: 220-400V trifásica 50Hz 2200W
Dimensiones: 1220x1080x (h) 1730mm
Peso: 410 kg aprox.
sección C
C298
249
C298 / C299
con C300-06N
ACCESORIOS:
C300-03
ESTRIBOS DE BLOQUEO para muestras de probetas cilíndricas
de diámetro 100, 110, 150, 160 mm. Se pueden utilizar sólo en
combinación con los estribos C300-06N.
C300-07N
ESTRIBOS DE BLOQUEO para pulir bloques de diferentes tamaños, pero con dimensiones
máx. de 390x250mm
C300-08
C300-07N
Dispositivo básico
para la preparación de las caras
Para la preparación de las caras paralelas y en testigos o muestras
de rocas.
El dispositivo admite hasta cuatro
testigos de 20 a 55 mm de
diámetro y se puede montar
C300-08
en la mayoría de las máquinas
de pulido.
Peso: 7 kg aprox.
C300-01
SECTORES ABRASIVOS DE PULIDO,
repuestos, conjunto de 8 piezas.
instrumentos para ensayos de materiales
HO RM I G ÓN
MÁQUINAS DE PERFORACIÓN PARA LA OBTENCIÓN DE TESTIGOS
“LIGERAS y PORTÁTILES”
sección C
Descripción general
Estas máquinas de perforación son extremadamente prácticas, ligeras, de fácil manejo. La base es de una aleación de aluminio, la columna
de acero se puede inclinar hasta 60÷75º respecto de la base, el soporte del motor está fijo sobre unos cojinetes de bolas.
El motor incorpora un serpentín de agua para refrigerar la broca de diamantes. La máquina se suministra completa “exceptuando”: broca
de diamante, barra de extensión y llave de desbloqueo de la broca
C318
(ver los accesorios en pág. 217) que deben pedirse por separado.
Máquina de perforación para la obtención
de testigos, motor eléctrico
C318-01
Motor eléctrico de tres velocidades: 670, 1140, 1580 rpm, provisto
de un reductor de velocidad, embrague y interruptor conforme
con la Directiva de Seguridad de la CE.
La máquina acepta brocas de 50 a 150 mm de diámetro.
Alimentación: 230V monofásica 50Hz 2200W
Dimensiones: 450x290x860 mm. Peso: 35 kg
C318
C318-01
Máquina de perforación para la obtención de testigos, motor de gasolina
Motor de gasolina de 2500W de potencia.
Velocidad: 390 a 920 rpm La máquina acepta brocas de
50 a 200 mm de diámetro.
C318-01
Dimensiones: 450x290x1060 mm
Peso: 40 kg
250
C318-05
Carretilla
ACCESORIOS:
C318-10
ANILLO DE RECUPERACIÓN DEL AGUA, confinando las aguas
residuales en la superficie, para mod. C318. Tiene que estar conectado a una bomba eléctrica adecuada.
C318-11
ANILLO DE RECUPERACIÓN
DEL AGUA, como el anterior,
pero para la máquina
mod. C318-01
C324
C318-10
C324
Máquina eléctrica de perforación para la
obtención de testigos con dispositivo de vacío
El bastidor y el motor eléctrico son el mismo modelo que mod. C318.
La máquina se suministra completa con bomba de vacío lubricada
de 4 m3/h, y el depósito de acumulación de presión, que es muy
útil, ya que mantiene durante un momento el nivel de vacío, valido
también con apagón eléctrico, evitando la caída o la desconexión
de la unidad de la pared.
La bomba está conectada a la herramienta a través de una válvula
de bola a la que está instalado un medidor de vacío, que constantemente indica la presión dentro del tanque.
Ángulo de perforación: de 0 a 360° bajo la condición de que la
superficie sea lo suficientemente plana y no porosa, para permitir la
fijación al vacío.
Alimentación: 230V monofásica 50Hz 2200W
Dimensiones: 870x290x1100 mm. Peso: 38 kg + bomba de 15 kg
instrumentos para ensayos de materiales
Accesorio para las máquinas
modernas de perforación de
testigos C318 y C318-01, muy
útil para mejorar la estabilidad
de la máquina durante la
extracción de muestras en el
pavimento.
Dimensiones: 800x700 mm.
Peso: 25 kg aprox.
C341-07
C318-05
HO RMIGÓN
Descripción general:
Estas máquinas de perforación son extremadamente robustas, compactas, fiables y de altas prestaciones.
El grupo de perforación de la máquina esta rectificado para asegurar movimientos de perforación suaves y precisos.
El recorrido de perforación es de 550 mm y la máquina puede extraer testigos de hasta 200 mm de diámetro.
Sistema con serpentín de agua para refrigerar la broca de diamante.
La base de acero robusto está equipada con ruedas para desplazamientos sencillos, junto con cuatro pies para nivelar y estabilizar.
Todas las partes están recubiertas de cadmio para protegerlas contra la corrosión.
La máquina se suministra completa “exceptuando”: la broca diamantada, la barra de
extensión y la llave de desbloqueo de la broca (ver los accesorios en pág. 217) que
deben pedirse por separado.
MODELOS:
C319
Máquina de perforación para testigos en pavimentos con motor de gasolina de 4 tiempos 5 HP
sección C
MÁQUINAS DE PERFORACIÓN PARA LA OBTENCIÓN DE TESTIGOS “ALTA
PRESTACIÓN”
Esta máquina portátil, compacta y robusta con avance por tornillo vertical,
se utiliza para la toma de testigos de pavimento cuando no es sencillo
conseguir alimentación por corriente eléctrica.
Motor de gasolina de 5 HP de potencia, modelo Briggs&Stratton de 4
tiempos. Dimensiones: 850x580x1230 mm. Peso: 135 kg
- Motor original de Briggs & Stratton
- Se pueden perforar testigos de hasta 200 mm de
diámetro.
- Avance por tornillo vertical rectificado
- Construida con espiral de agua para refrigerar la broca
- Robusta, compacta y con ruedas montadas
251
C319
C319-02
Máquina de perforación para testigos en
pavimentos con motor 12,5 HP de gasolina de 4 tiempos
Similar al mod. C319, pero activada por un motor de gasolina de
potencia 12,5 HP modelo Briggs & Stratton de 4 tiempos.
Peso: 150 kg
RECAMBIOS:
C331
MOTOR DE GASOLINA, para la maquina C319 de 5
HP de potencia, modelo Briggs & Stratton de 4 tiempos.
Se suministra completo con tanque, accesorios.
Peso: 20 kg
C319-02
C331-02 MOTOR DE GASOLINA para la máquina de perforación C319-02. 12,5 HP de potencia, modelo Briggs &
Stratton de 4 tiempos.
Se suministra completo con tanque y accesorios.
Peso: 25 kg
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
252
C322 KIT
C321 KIT
Máquina universal eléctrica de perforación para la obtención de testigos
Máquina universal eléctrica de perforación para la obtención de testigos, motor
de gasolina
que comprende:
C321-10 BASTIDOR UNIVERSAL DE PERFORACIÓN COMPLETO, pero sin motor eléctrico
C330
MOTOR ELECTRICO COMPLETO
Ángulo de perforación de testigos: de 0 a 360°
El grupo de perforación de la máquina esta rectificado para
asegurar movimientos de perforación suaves y precisos, el
recorrido de perforación es de 550 mm. El motor eléctrico es de
tres velocidades: 670, 1140, 1580 rpm, con reductor de velocidad,
provisto siempre de embrague y interruptor según la Directiva de
Seguridad de la CE. La altura de la columna vertical es de 1000 mm
y está preparada para la conexión de una extensión de la columna
(accesorios mod C322-01).
Alimentación: 230V monofásica 50Hz 2200W
Dimensiones: 440x750x1300 mm. Peso: 85 kg
- Tres velocidades del motor eléctrico con embrague
- Conexión a la red de agua de refrigeración
- Grupo de perforación rectificado
- Ángulo perforación de testigos: de 0 a 360°
- Robusta, compacta y con ruedas montadas
que comprende:
C321-10 BASTIDOR UNIVERSAL DE PERFORACIÓN COMPLETO, pero sin motor de gasolina
C321-11 MOTOR DE GASOLINA COMPLETO DE 3,3 HP
Ángulo de perforación de testigos: de 0 a 360°
El grupo de perforación de la máquina esta rectificado para asegurar movimientos de perforación suaves y precisos, el recorrido de
perforación es de 550 mm.
Motor de gasolina, de 3,3 HP a dos velocidades: 300 y 600 rpm,
con reductor de velocidad, completo con dispositivo de fricción.
La altura de la columna vertical es de 1000 mm y está preparada
para la conexión de una extensión de la columna
(accesorios mod. C322-01).
Dimensiones:
750x440x1300 mm
Peso: 90 kg
C321 KIT
C322 KIT
ACCESORIOS:
C322-01
Columna de extensión, 1.000 mm de largo, para conectar a los
mod. C321 KIT y C322 KIT para perforaciones de más de 1 metro
del suelo.
Se suministra completo con dispositivos de fijación.
Recubierta de cadmio para la protección contra la oxidación.
instrumentos para ensayos de materiales
RECAMBIOS:
C330
MOTOR ELECTRICO, para modelos C318, C322 KIT
y C324
2200 vatios de potencia, tres velocidades de 670
- 1140 - 1580 rpm completa con un embrague, y la
conexión a suministro de agua de refrigeración. Doble
aislamiento extremadamente seguro y interruptor
según a la Directiva de Seguridad de la CE.
Conexión al eje 1 ¼”.
Alimentación: 230V monofásica 50Hz 2200W
Peso: 9 kg
C321-11
MOTOR DE GASOLINA, 3,3 HP de potencia, con dos
velocidades: 300 y 600 rpm, con reductor de velocidad,
embrague y depósito de gasolina.
HO RMIGÓN
ACCESORIOS Y BROCAS DIAMANTADAS
C340-05 ÷ C341-09
sección C
Brocas diamantadas de perforación, diseñadas para
hacer agujeros y conseguir testigos de materiales duros como hormigón, hormigón armado, rocas, piedras,
materiales bituminosos.
El diamante utilizado en estas brocas es de la calidad
del tipo sinterizado impregnado. El sector del diamante es “8 mm de altura” (8 mm de altura, es importante para la vida de la broca, porque el diamante es de
aproximadamente el 90% del valor).
Todas las brocas son de 510 mm de largo.
El acoplamiento entre la broca y la máquina perforadora requiere un extensor de acoplamiento adecuado
(ver tabla).
Disponibles dos modelos básicos de brocas de
diamante:
- Para testigos de hormigón, rocas, piedras,
materiales duros.
- Para testigos de materiales bituminosos.
253
C343 ÷ C343-04
Brocas para
betunes
Brocas para
hormigón
Diámetro
externo mm
Diámetro
interno mm
Extensor de
acoplamiento
Extractor de
testigos
Diámetro
interno mm
C340-05
C340-06
C340-07
C340-08
C340-09
C341-05
C341-06
C341-07
C341-08
C341-09
57
83
108
160
210
50
75
100
152
200
C343
C343-01
C343-02
C343-03
C343-04
C346
C346-01
C346-02
C346-03
C346-04
50
75
100
152
200
La pinza permite una fácil extracción del testigo del centro del
agujero.
C332
GENERADOR ELÉCTRICO PORTÁTIL
Para el uso con máquinas de accionamiento eléctrico, donde la
energía eléctrica no está disponible. El generador tiene una potencia de 4000 vatios y suministra: 230V monofásica 50Hz
Completo con tanque y accesorios.
Peso: 60 kg
C346 ÷ C346-04
C345
C332
C344
C344
Llave para el desbloqueo de las brocas.
C345
Barra de extensión de 300 mm de largo (utilizada para los agujeros
profundos)
instrumentos para ensayos de materiales
sección C
HO RM I G ÓN
C348 N
C350-01
Máquina cortadora de probetas, modelo con
Máquina cortadora de probetas
patas desmontables.
La máquina acepta discos de hasta 400 mm de diámetro.
Altura de corte útil: 115 mm. Los discos se pueden orientar para
cortes a 45º. Dimensiones del tablero móvil: 550 x 410 mm
Velocidad de rotación del disco: 2800 r.p.m.
Se suministra “sin” disco (ver accesorios)
Alimentación:
230V monofásica 50Hz 3HP
Dimensiones:
700x1100x680 mm
Peso: 80 kg
Idéntica al mod. C350 pero con:
Alimentación: 230V monofásica 50Hz 3HP
C352
C348 N
254
C350
Máquina cortadora de probetas
Utilizada para cortar muestras de hormigón y de cualquier tipo de
material de construcción como bloques, baldosas, tuberías, testigos
de roca, etc. La máquina está equipada con una bomba eléctrica
para el agua de refrigeración, un pedal guía para el corte vertical y
un dispositivo de seguridad contra la rotura del disco.
La máquina acepta discos de hasta 450 mm de diámetro.
Se suministra “sin” disco (ver accesorios).
Alimentación: 400V trifásica 50Hz 3HP
Dimensiones: 1220x700x1360 mm
Peso: 125 kg
C352
C350
instrumentos para ensayos de materiales
C349
Máquina cortadora de probetas
Básicamente similar al mod. C350 pero puede aceptar discos hasta
un diámetro máximo de 500 mm. Alimentación: 400V trifásica
50Hz 4Hp.
C351
Máquina cortadora de probetas
La máquina acepta discos de hasta 350 mm de diámetro.
Capacidad de corte: 120 mm
Velocidad de rotación del disco: 3900 r.p.m.
Se suministra completa con disco abrasivo de 350 mm de diámetro.
Alimentación: 230V monofásica 50Hz 2000W
Dimensiones: 560x460x390 mm
Peso: 20 kg
ACCESORIOS:
C350-10 DISCO ABRASIVO dia. 350 mm
C350-11 DISCO ABRASIVO dia. 400 mm
C350-12 DISCO DIAMANTADO dia. 450 mm, tiene una vida
larga para una operación de corte más rápida y
precisa.
C350-13 DISCO DIAMANTADO dia. 350 mm
C350-14 DISCO DIAMANTADO dia. 400 mm
C350-15 DISCO DIAMANTADO dia. 500 mm
C351
C352
DISPOSITIVO PARA PROBETAS
CILÍNDRICAS Y TESTIGOS.
Para sujetar y cortar probetas cilíndricas y testigos. El dispositivo
está fijo al tablero de las máquinas cortadoras mod. C348N, C350,
C350-01, C349. Peso: 10 kg
C353
DISPOSITIVO PARA FORMAS IRREGULARES.
Para sujetar y cortar muestras de formas irregulares
como rocas, piedras, etc.
El dispositivo está fijo al
tablero de las máquinas
cortadoras mod. C348N,
C350, C350-01, C349.
Peso: 5 kg
C353
C377
Equipo de extracción de Micro-testigos
NORMA: UNI 10766
La extracción de un micro-testigo de una estructura de hormigón
o mampostería es un método no destructivo altamente válido,
ya que permite el análisis y la precisión de las evaluaciones de la
fabricación (resistencia a la compresión, etc.) sin causar ningún daño
a la estructura, considerando que la dimensión del eventual agujero
puede ser tapado con mortero.
El sistema de extracción de micro-testigos es altamente válido y
fiable si se combina con el equipo de medida de ultrasonidos y un
martillo de hormigón.
La extracción de micro-testigos es fácil, y requiere la presencia de
un único operador.
El equipo consta de:
- Taladro eléctrico adecuado. 230V monofásico 50Hz
- Guía de montaje con brida
- Mascara perforada
- Broca con diamantes impregnados para los testigos de Ø 28 x 100 mm
- Broca con diamantes impregnados para los testigos de Ø 28 x 200 mm
- 2 pinzas autoblocante para adaptarse la guía de montaje con
brida a la superficie
El conjunto de accesorios incluye: anclaje, brocas, llaves de tuercas,
tornillos.
Maletín de transporte.
Dimensiones: 550x400x200 mm aprox. Peso: 10 kg aprox.
C377-05
MÁQUINA DE REFINADO / CORTE DE TESTIGOS.
Adecuado para cortar y retocar los testigos preparados para las
pruebas de compresión, donde la planeidad de ambas superficies es
una condición básica para obtener resultados correctos.
El equipo está fabricado de acero inoxidable y aluminio, y se suministra completo con disco de diamante de 180 mm de diámetro.
Para ello se debe utilizar el taladro mod. C377-10 (incluido en el
equipo de extracción de micro-testigos) y el depósito de agua con
bomba de pie mod. C377-01.
C377-05
sección C
HO RMIGÓN
255
C377
Nota:
Los valores máximos previstos para ensayos de
compresión en micro-testigos suelen ser inferiores
a 60 kN.
La máquina de compresión portátil mod. C094 (ver
pág. 219), o un equipo de medida de compresión de
cemento (ver pág. 312) deben ser usados convenientemente. El refinado de los testigos debe realizarse
con la máquina de pulir mod. C298 + dispositivo
mod. C300-08 (ver pág. 249)
C377-02
C377-01
ACCESORIOS:
C377-01
TANQUE DE AGUA CON BOMBA DE PIE, permite tener las
manos de los operadores libres para la perforación.
COMO ALTERNATIVA:
C377-02
TANQUE DE AIRE-AGUA A PRESIÓN, 10 litros de capacidad.
RECAMBIOS:
C377-10 TALADRO ELECTRICO, adecuado para micro-testigos.
C377-15 BROCA DE DIAMANTES, de diámetro 28 x 100 mm
C377-16 BROCA DE DIAMANTES, de diámetro 28 x 200 mm
instrumentos para ensayos de materiales
HO RM I G ÓN
PISTÓNES HIDRÁULICOS PLANOS. Ensayos en paredes de ladrillos
Determinación de la resistencia y la deformación bajo carga
Evaluación de la resistencia a la tensión
Medición del módulo de elasticidad y la carga de rotura
sección C
El ensayo completo se desarrolla en dos etapas:
256
DETERMINACIÓN DE LA CARGA ESTÁTICA (ESTADO DE TENSIÓN)
Se utiliza un pistón hidráulico plano.
Dos puntos de referencia se fijan a través de una junta de mortero y se mide la distancia entre los puntos.
Sucesivamente se lleva a cabo un corte horizontal con la herramienta adecuada (taladro, sierra de corte) a nivel de la capa de mortero, y
se mide la variación de los dos puntos de referencia.
Se introduce el pistón hidráulico plano, este es presionado en diferentes fases de crecimiento y se mide la variación entre los puntos de
referencia, mediante la determinación de la carga estática.
DETERMINACIÓN DE LA RESISTENCIA Y DEFORMACIÓN (RESISTENCIA IN-SITU)
Se utilizan dos pistones hidráulicos planos.
Se debe hacer un segundo corte, paralelo al primero, a nivel de la capa de mortero, con una distancia de aproximadamente 50 cm desde el
primer corte.
Se introduce otro pistón hidráulico plano.
Tres pares de puntos de referencia se colocan en la porción de ladrillo entre los dos cortes.
Se empieza a presionar los dos pistones hidráulicos planos en las fases de crecimiento.
La variación de las distancias entre los puntos de referencia a las diferentes medidas de presión permite trazar una curva esfuerzo-deformación, obteniendo el módulo de elasticidad, de Poisson y el valor del punto de rotura.
C358-01
PISTÓN HIDRÁULICO PLANO RECTANGULAR de alta deformabilidad, presión máx. 50 bar, dimensiones de 400x200x4 mm.
Chapa de acero de 0,8 mm de espesor.
Completa con tuercas y espigones.
C358-05
LLAVE DE PARO (válvula) de alta presión completo con accesorios, para cerrar el flujo de aceite en el pistón hidráulico y detener
la presión.
Aplicación de la carga:
C358-06
BOMBA HIDRÁULICA MANUAL, con depósito integrado con aceite, para aplicar presión a
los pistones hidráulicos.
C358-02
C358-01
C358-05
C358-15
TUBO flexible de goma, 3 metros de longitud, para la conexión a
un pistón hidráulico.
C358-08
C358-11
6 láminas de acero, dimensiones de 400x200 mm, tres piezas de
1 mm de espesor, tres piezas de 1,5 mm de espesor.
C358-11
C358-12
C358-02
PISTÓN HIDRÁULICO PLANO SEMI-OVALADO de alta deformabilidad, presión máx. 50 bar, dimensiones de 350x260x4 mm.
Chapa de acero de 0,8 mm de espesor.
Completa con tuercas y espigones.
C358-12
6 láminas de acero, dimensiones de 350x260 mm, tres piezas de
1 mm de espesor, tres piezas de 1,5 mm de espesor.
instrumentos para ensayos de materiales
C358-06
C358-15
o:
C358-23N
C358-16 TUBO DOBLE flexible de goma, 2 y 3 metros de
longitud, para la conexión de dos pistones hidráulicos.
C358-08 MANÓMETRO de alta precisión de rango 0-60 bar,
con una conexión rápida, fijado a la bomba para leer la
presión aplicada.
HO RMIGÓN
C361 KIT
EXTENSÓMETRO con comparador de deformaciones mecánico
de 300 mm de longitud.
o:
C363 KIT
EXTENSÓMETRO con comparador de deformaciones digital, 300
mm de longitud.
Otros modelos de comparadores de deformación con sus accesorios quedan descritos con detalle en la pág. 258.
C361 KIT
C358-23N
TRANSDUCTOR DE PRESIÓN, capacidad de 50 bar, instalado en
la bomba manual (como alternativa al manómetro). Completo con
conector rápido para la bomba, cable eléctrico y conector.
C405-15N
CYBER-PLUS 8 EVOLUTION “PANTALLA TÁCTIL”
8 canales de adquisición y procesamiento de datos,
24 bits de resolución. Tecnología electrónica avanzada, “pantalla
táctil a color” ¼VGA, altas prestaciones gráficas, la unidad realiza
el ensayo y el procesamiento de datos automáticamente. Se puede
imprimir un certificado a través de una impresora (opcional)
conectada directamente a la unidad a través del puerto USB. La
unidad Cyber-Plus está equipada con ranuras para pendrive o tarjeta de memoria infinita SD, que pueden ser conectados directamente a un ordenador. Contenida en un estuche hermético práctico
y robusto, puede ser alimentada por una red eléctrica 90-270 V
o usando la batería interna y el cargador, garantizando de un día
completo de uso in-situ. Detalles técnicos de hardware: ver pág. 24.
sección C
Medida de deformaciones:
S337-51
Proceso de CALIBRACIÓN entre el extensómetro electrónico
o el transductor de presión a la unidad de adquisición de datos
C405-15N.
Como alternativa al comparador de deformación, la adquisición de
datos y el sistema de procesamiento, puede utilizarse el siguiente
equipo:
C358-21
EXTENSÓMETRO ELECTRÓNICO, se suministra con transductor
de desplazamiento lineal que tiene 10 mm de carrera y el 0,1% de
linealidad, montado en un bastidor tubular de aluminio anodizado,
con cable eléctrico y conector.
Envergadura: 300 mm
Peso: aprox. 300 g
C405-15N
C358-21
Ejemplos de aplicación
instrumentos para ensayos de materiales
257
HO RM I G ÓN
Extensómetros de deformación mecánicos
sección C
NORMAS: ASTM C426 / BS 1881:206
Se utiliza para determinar la deformación (cambios de longitud) en las muestras y estructuras de hormigón, estratos de roca, diferentes
partes de una estructura, en áreas remotas y en condiciones adversas, utilizando un solo instrumento. Los diferentes modelos están disponibles con manómetro analógico o digital, de longitud de medida de 100, 200, 300 mm, dependiendo de la longitud estándar de medida. El
instrumento también puede ser utilizado para otras estructuras, como el acero y la madera.
258
El equipo estándar incluye:
- Comparador de deformación (extensómetro) completo con
indicador analógico o digital, graduaciones cada 0,001 mm (ver
modelos disponibles)
- Barra de calibración utilizado también para fijar el disco de referencia sobre la estructura.
- 50 discos de referencia.
- Adhesivo compuesto para los discos de referencia.
El conjunto va encerrado en un estuche.
C361 KIT
MODELOS CON “comparador analógico” graduaciones cada 0,001 mm:
C360 KIT
COMPARADOR DE DEFORMACIÓN, 100 mm
de longitud de medida, completo.
C360-01 KIT COMPARADOR DE DEFORMACIÓN, 200 mm
de longitud de medida, completo.
C361 KIT
COMPARADOR DE DEFORMACIÓN, 300 mm
de longitud de medida, completo.
MODELOS CON “comparador digital”, alimentado con batería,
con la lectura de los valores en mm (precisión de 0,001 mm) y en
pulgadas (precisión de 0,0001”).
Completo con batería y conector RS 232 para ordenador.
C363 KIT
COMPARADOR DE DEFORMACIÓN, 300 mm
de longitud de medida, completo.
C363-01 KIT COMPARADOR DE DEFORMACIÓN, 100 mm
de longitud de medida, completo.
C363-02 KIT COMPARADOR DE DEFORMACIÓN, 200 mm
de longitud de medida, completo.
C363 KIT
C363-01 KIT
C399
Microscopio de detección de grietas
Se utiliza para medir la anchura de la fisura en estructuras de hormigón, operando a través de una fuente de luz ajustable.
Unidad de alta definición, proporcionada por la potencia de las
baterías, caja de transporte. La escala del ocular se puede girar 360°
para alinearse con la dirección de la grieta detectada.
Rango de medición: 4 mm
y divisiones cada 0,02 mm.
Aumentos: x35
Peso: 600 g
ACCESORIOS para el comparador digital:
S382-11 CABLE para conectar el comparador de deformación
digital al ordenador
S382-10 Adaptador USB para cable S382-11
RECAMBIOS:
C362-01 DISCO DE REFERÉNCIA (paquete de 50)
C362-02 COMPUESTO ADHESIVO.
instrumentos para ensayos de materiales
C399
HO RMIGÓN
C376N
Equipo para la determinación de la fuerza de arrancamiento, ensayo Pull-Out
NORMAS: EN 12504-3 / UNI 9536 / ASTM C900 / BS 1881 part 207
sección C
Utilizado para medir la resistencia del hormigón aplicando
una fuerza de extracción sobre un bulón embebido en el
hormigón todavía fresco. El equipo estándar según la Norma
EN 12504-3 se compone de una unidad de extracción
hidráulica de 100 kN de capacidad con bomba, manómetro
de precisión 0-100kN, anillo de soporte, 10 discos de acero
de diámetro 25 mm (EN 12504-3), caja de transporte.
Peso: 18 kg aprox.
ACCESORIO:
C376-01
BULONES de diámetro 30 mm (UNI 9536) para embeber
en el hormigón.
Conjunto de 25 piezas.
C376N
259
C376-01
RECAMBIO:
C376-03 DISCOS, 25 mm de diámetro (EN 12504-3) para
embeber en el hormigón.
Lote de 25 piezas.
C376-15
C376-11
C376-10
DETERMINACIÓN DE LA ENERGÍA DE EXTRACCIÓN
MEDIANTE BULONES INTRODUCIDOS CON POSTERIORIDAD CON FUERZA Y EXPANSIÓN GEOMÉTRICA.
NORMA: EN 10157
Se utiliza para determinar la potencia necesaria para extraer del
hormigón un taco metálico introducido en la estructura mediante
perforación.
Esta potencia de extracción se utiliza:
a) para investigar sobre las propiedades mecánicas de hormigón
in-situ
b) para estimar in-situ la resistencia a compresión del hormigón en
el caso de una curva de calibración específica
El equipo se compone de:
C376N Equipo de ensayo Pull-Out
C376-10 Barra de conexión provista de arandelas, para ser usada
con el instrumento de pull-out para conectar con el
taco de inserción C376-11.
C376-11 Taco metálico de expansión geométrica pull-out de
diámetro 18x80 mm. Paquete de 10 tacos.
C376-12 Broca endurecida para realizar un agujero como se
requiere en la norma UNI y poner el taco.
C376-12
C376-14
E142
Ensayo de adherencia a tracción “pulloff ” digital. Capacidad: 16 kN
NORMAS: EN 1542, EN 1348, EN 1015-12, EN 13687-2
NF P18-858 / BS 1881:207 / ISO 4624 / EN 13963, 14496
Este dinamómetro mide la fuerza de adherencia y la resistencia a la
tracción de dos capas de materiales (hormigón, revestimientos de
yesos, morteros, yesos de construcción,
cal, etc.) y es particularmente adecuado
para aplicaciones relativas a los ensayos de reparación de cualquier
E142
estructura en la que la fuerza
de unión entre las dos capas
sea un factor esencial.
Detalles técnicos, descripción más precisa y
accesorios: ver pág. 300.
C376-13 Taladro con mandril SDS
C376-14 Punzón para introducir el taco en el orificio.
C376-15 Bomba de aspiración para limpiar el agujero de suciedad y polvo
instrumentos para ensayos de materiales
HO RM I G ÓN
C374
sección C
Humidímetro “Surveymaster”
C374-06
Utilizado para medir las condiciones de humedad en estructuras
de hormigón, mampostería, yeso, tanto en la superficie como en
profundidad con un método no destructivo.
Rango de medición: desde 6% hasta el valor nominal del 100% con
+/- 0,1% de precisión.
Lectura digital de los valores, alarma audible.
Funciona con pilas.
Dimensiones: 170x54x42 mm
Peso: 200 g aprox.
A028
C374
Medidor de carburo para la determinación de la humedad superficial
Para la determinación rápida y precisa del contenido de humedad.
La superficie de la muestra se perfora o se raspa y se introduce en
la botella con el reactivo de carburo.
El equipo es adecuado para los ensayos de humedad en la arena,
áridos, suelo, etc. Es posible variar el peso de la muestra desde 3 a
100 g para la reacción completa entre la muestra y el carburo con
las precisas mediciones de la humedad desde 0 a más del 20%.
Una vez cerrada la botella, se agita esta, rompiendo la ampolla de
cristal que contiene el carburo de calcio, garantizando una mayor
precisión en el ensayo. El instrumento consta de una botella de
ensayos con manómetro, una pequeña balanza, 20 ampollas de
reactivo, accesorios, estuche. Dimensiones: 520x340x140 mm.
Peso: 6 kg aprox.
A028
260
C374-06
Higrómetro, medidor universal de humedad
Este instrumento electrónico de bolsillo mide la cantidad de agua
en diversos materiales sólidos como: hormigón, mampostería, yeso,
ladrillos, maderas, morteros, etc.
Usando un sensor capacitivo de alta frecuencia, en un gran volumen
de material (aprox. 50x75x25 mm) se muestrea de forma instantánea.
Características y beneficios:
- Lectura directa del contenido de humedad, sin necesidad de gráficos o tablas
- Resolución: +/- 0,1%
- Precisión: +/- 0,2% a temperatura constante
- Campo del volumen de detección: aprox. 90 cm3
- Modo programable para hormigón, mampostería, yeso, ladrillo, la
mayoría de las maderas disponibles para la máxima precisión, con
modo de calibración especial del usuario y de función promedio.
- No se perforan con puntas, sondas o agujeros
Aplicaciones típicas:
- Localizar fugas en tuberías en paredes y pisos
- Localizar filtraciones de agua en los sótanos y tanques de mampostería
- Comprobar el nivel de humedad de los materiales antes de
aplicar recubrimientos o adhesivos
- Condiciones de curado de la madera, el estuco y otros materiales
de construcción
Fuente de alimentación: batería de 9 V
Dimensiones: 110x70x50 mm. Peso: 250 g aprox.
instrumentos para ensayos de materiales
RECAMBIOS:
A028-11
Ampollas de carburo
(paquete de 100)
C375-02
Profundidad de carbonatación
NORMAS: EN ISO 14630 :2005 / pr EN 14630 :1997
Este ensayo permite medir la profundidad de carbonatación a
través de la superficie del hormigón.
El conjunto se compone de:
- dos botellas de lavado de 500 cc de capacidad que contiene una
solución de fenolftaleína y agua destilada,
- calibre de medida de la profundidad.
La superficie de la muestra de hormigón a ensayo se rocía con una
solución de fenolftaleína para detectar la pérdida de alcalinidad
asociada a la carbonaC375-02
tación. El riesgo de
corrosión inducida
por carbonatación
se puede medir, si
se correlaciona con
el recubrimiento de
hormigón de refuerzo. Peso: 1,5 kg
C375-01
C375-10 KIT
Determinación de cloruros en el campo
Permeabilidad de aire y de agua en el
hormigón
NORMA: ASTM C114, compatible con la AASHTO T260
La determinación de la concentración de iones de cloruro en el
hormigón es esencial para evaluar la necesidad de mantenimiento,
por ejemplo, tableros de puentes y estructuras de estacionamiento.
El ensayo también se puede utilizar para asegurar que los materiales utilizados en las nuevas construcciones estén libres de los
niveles de iones de cloruro potencialmente dañinos.
Con este método, se mide la concentración de cloruros solubles en
ácido. En la mayoría de los casos este es equivalente a la concentración de cloruros totales.
Características y beneficios:
- Resultados rápidos y en cuestión de minutos in-situ
- Bajo coste por muestra en comparación con los ensayos de
laboratorio
- Resultados precisos son comparables con los ensayos de laboratorio
- Cubre una amplia gama desde 0,002% a 2% de cloruro en peso
- Compensación automática de cambios en la temperatura ambiente
- Visualización digital para la lectura directa de lbs / cu.yd. y el
porcentaje de cloruro en peso
TÉCNICA FIGG
La entrada de aire y la humedad en el hormigón puede causar
corrosión de la armadura de acero y conducir a un deterioro de la
resistencia del hormigón.
Por lo tanto, la facilidad de medida del movimiento de líquidos y gases a través de la capa superficial del hormigón es el mejor método
para evaluar la solidez y la vida útil de la resistencia del hormigón.
La permeabilidad es reconocida como el parámetro más importante en la evaluación de la durabilidad del hormigón.
El ensayo en profundidad se realiza mediante la perforación de un
agujero de 10 mm de diámetro x 40 mm de profundidad y tapado
con un tapón de goma de silicona. Una aguja hipodérmica se pasa
por el tapón, el ensayo de permeabilidad al agua se realiza mediante
la medición del tiempo de absorción necesario para que el agua se
introduzca en el vacío por la presión.
Para el ensayo de permeabilidad al aire, se crea una presión de
vacío en el hueco, y se mide el tiempo necesario para aumentar
la presión. Los ensayos de permeabilidad en superficie se pueden
llevar a cabo por la unión de una cámara de acero inoxidable sobre
la superficie lisa del hormigón.
sección C
HO RMIGÓN
C375-10 KIT
El sistema de ensayo incluye:
- Medidor electrónico, de alta impedancia con
compensación de temperatura y un microprocesador para la conversión directa con el
porcentaje de cloruro. Funciona con pilas.
- Electrodo combinado de cloruro con sensor de
temperatura
- 12 frascos cada uno de 20 ml con líquido de
extracción
- 5 frascos de líquido de color para calibración
- Escala para muestras de 3 g de peso, accesorios, estuche de transporte
Peso: 5 kg aprox.
C375-01
El equipo consta de: bomba de
vacío manual, sistema de medición
digital de presión, cámara de acero
inoxidable para mediciones en
superficie, 25 tapones de goma de
silicona, pinzas de sujeción, brocas,
anclajes, accesorios.
El conjunto va encerrado en un
estuche.
Dimensiones: 430x300x150 mm
Peso: 6 kg aprox.
RECAMBIO:
C375-11
Tapones de goma de silicona.
Paquete de 25 piezas.
instrumentos para ensayos de materiales
261
HO RM I G ÓN
ESCLERÓMETRO PARA HORMIGÓN
C390
NORMAS: EN 12504:2 / ASTM C805 / UNI 9189 / DIN 1048
BS 1881:202 / NF P18-417 / UNE 83307
Diseñado para realizar ensayos no destructivos en las estructuras
de hormigón, da una indicación inmediata de la resistencia a la
compresión del hormigón con la curva de calibración suministrada.
Yunque de tarado
sección C
MODELOS:
C380
262
Esclerómetro para hormigón, modelo Matest
La energía de percusión es de 0,225 mkg (2207 Joule o Nm)
Apto para estructuras de hormigón y acabado de edificios con
resistencias desde 10 a 70 N/mm2. Este esclerómetro para
hormigón, producido totalmente por Matest, tiene el bastidor
de aluminio, y gracias a su preciso proceso de fabricación y a
determinados componentes garantiza una alta precisión de los
resultados de ensayos en el tiempo. El modelo Matest es el esclerómetro de más alta calidad disponible en el mercado.
Se suministra completo con los valores del diagrama de la curva de
calibración en N/mm2 (MPa), piedra abrasiva, maletín de transporte.
Dimensiones con el maletín: 330x100x100 mm
Peso: 2 kg
C380
NORMA: EN 12504:2
Se utiliza para la verificación del
calibrado de los esclerómetros.
Fabricado con aleación de acero
especial.
Dimensiones:
diámetro 150 por 320 mm.
Peso: 16 kg
C380
NOTA:
C390
La Norma EN 12504:2
requiere obligatoriamente
el uso del yunque para los
esclerómetros.
La norma especifica:
- antes de una secuencia
de ensayos en la superficie de hormigón, se deben tomar y registrar lecturas con el acero de referencia del yunque y asegurarse
de que están dentro del rango recomendado por el fabricante.
Si no es así, limpiar y / o ajustar el esclerómetro.
- después del ensayo, tomar las lecturas
con el acero del yunque, luego grabarlas
y así poder compararlas con las tomadas antes del ensayo. Si los resultados
difieren, limpiar y / o ajustar el esclerómetro y repita el ensayo.
Esclerómetro Original “Schmidt”
C382
Modelo estándar tipo “N” para las coladas de hormigón
normal. Energía de impacto 2,207 Nm
C383
Modelo “NR”, igual que el modelo C382, pero con un
dispositivo automático incorporado que registra sobre
un diagrama los valores de impacto.
C383-01 Rollo de papel de impresión de recambio para el
esclerómetro C383 (paquete de 5)
C380 CON MALETÍN
C380-01
Esclerómetro para hormigón, modelo
Matest
C383-10
Igual al mod. C380, pero con el diagrama de la curva de calibración
en Psi como indica la Norma ASTM.
Esclerómetro digital para hormigón. Energía de impacto: 2,207 Nm.
“Silver” Schmidt
C381
Esclerómetro para hormigón, modelo
Matest
Similar al mod. C380, pero con una energía de percusión de 0,735
Joule (Nm). Ideal para ensayar materiales de pequeñas dimensiones,
sensibles y finos. Adecuado para ensayar también muestras de
rocas.
C382
C383
C381
instrumentos para ensayos de materiales
C383-10
HO RMIGÓN
C386N
Esclerómetro digital de hormigón con microprocesador, modelo MATEST
Este esclerómetro digital de hormigón, operado con microprocesadores, totalmente diseñado y fabricado por Matest con tecnología avanzada, lleva a cabo ensayos básicos en el hormigón con
la grabación continua y automática de todos los parámetros de
acuerdo con la norma EN 12504-2, registra y procesa los datos y
transferirlos a un ordenador.
La unidad consiste en el modelo mecánico estándar C380, pero
equipado con un transductor electrónico, que mide los valores
de rebote y suministra de forma automática los resultados en una
pantalla gráfica.
Durante la realización del ensayo:
- Muestra el valor del índice
- Muestra el valor del índice promedio
- Permite seleccionar el sistema de medición en MPa o Psi
- Muestra el número de rebotes realizado
- Muestra la fecha y la hora
- Identifica los elementos ensayados
- Identifica de forma automática y muestra el ángulo de rebote
- Muestra la vida de la batería
Características principales:
- Posibilidad de almacenar, pantalla gráfica LCD 64x124 y descarga
de datos al ordenador sobre los 15.000 ensayos
- Procesamiento de lecturas de forma automática y estadística
- Conversión automática del índice de rebote a la resistencia de
compresión equivalente en psi, N/mm2, kg/cm2
- Alta precisión y resolución
Especificaciones técnicas:
- Energía de impacto: 2,207 Joule (Nm)
- Rango de medición: 10 hasta 120 N/mm2
- Puerto: USB
- Alimentación: 6 pilas recargables AA NiMH 2400mA/hora
- Duración de la batería: 60 horas con apagado automático
- Temperatura de funcionamiento: -10 °C +60 °C
Se suministra completo con el software de transferencia de datos,
cable USB de transferencia de datos, cargador de batería, piedra
abrasiva, maletín.
Dimensiones con caja:
330x180x120 mm
Peso: 3 kg
sección C
NORMAS: EN 12504: Part 2 / ASTM C805 / BS 1881:202 / NF P18-417 / DIN 1048 / UNI 9189 / UNE 83307
263
C386N CON MALETÍN
C386N
Nota:
El yunque de calibración es el mismo
(mod. C390) de los esclerómetros estándares.
El esclerómetro digital Matest es adecuado para
ser conectado al equipo de medida Ultrasónico
de “alto rendimiento” mod. C372N (ver pág. 266)
para “ensayos combinados de ultrasonidos y de
rebote con la adquisición, procesamiento y
grabación automático de los resultados”
C386N + C372N
instrumentos para ensayos de materiales
HO RM I G ÓN
C373-10
sección C
Sistema de ensayo ultrasónico “cross-hole”, DOS canales, para pilotes y cimentaciones
264
Sistema completo para inspecciones estructurales no destructivas a través de ultra-sonidos sobre pilotes, cimentaciones profundas, obras
de infraestructura o edificios. El equipo consta de una unidad central informatizada a la que es posible conectar, de acuerdo con el tipo de
estudio, sondas para ensayos estándar de contacto directo, o bobinas motorizadas controladas electrónicamente, en las cuales las sondas se
montan con la ayuda de la perforación, para estudios Cross-Hole.
El sistema de microprocesador es capaz de garantizar la alineación constante entre los tubos de bajada de las sondas cuando se toma la
medición. Los datos adquiridos en cada impulso se muestran en tiempo real en la pantalla grande a color, lo que permite una visualización
inmediata de posibles imperfecciones en la estructura inspeccionada.
El estudio cross-hole se gestiona de modo automático; solo se requiere un operador en la posición de los codificadores para la lectura de
la posición de los tubos de sondeo motorizados y la alineación inicial en la cabeza del pilote.
Una vez se concluye el ensayo, es posible imprimir el informe del ensayo con los datos en el lugar de construcción.
ESPECIFICACIONES:
- Menú fácil de usar para el control del ensayo y elaboración de datos.
- Visualización gráfica y numérica de los valores del ensayo.
- Pantalla: LCD de 7 “con pantalla táctil.
- Rango de medición: 100 mV - 20 V
- Campo de medida mínima: 10 mm
- Alimentación: 12V CC con baterías internas recargables 24Ah y cargador
de baterías.
- Sistema Operativo: Windows XP, Embedded, licencia incluida.
- Bobinas motorizadas: 2 unidades con 60 metros de cable graduado.
- Codificador de posición: 2 unidades con una precisión de 3,6°
- La velocidad y la alineación: administrados automáticamente.
- A través de eco-test: geófonos verticales con 4.5Hz de frecuencia de resonancia
- Frecuencia máxima de emisión de impulso: 1 por segundo.
- Voltaje máximo de excitación: 500 (normal), 2000V (alto)
- Sondeos:
a través del contacto y ensayo del esclerómetro: frecuencia de resonancia
53 kHz, diámetro de 48 mm desde el agujero: la frecuencia de resonancia
de 40 kHz, 35 mm de diámetro.
El equipo está compuesto por:
- Unidad de control de pantalla táctil digital con ordenador industrial
contenidos en un resistente maletín anti-shock.
- Dos tambores motorizados con 60 m de cables graduados, sensores de
posición y soportes de cable fijados en la cabeza de tubo de ensayo.
- Dos sondas de contacto para los ensayos estándar de contactos.
- Dos sondas radiales para los ensayos de cross-hole ultrasónico.
Dimensiones de la unidad digital: 280x220x170mm. Peso: 3 kg
C373-10 unidad de control
C373-11
Sistema de ensayo ultrasónico “cross-hole”,TRES canales, para pilotes y cimentaciones
Similar al mod. C373-10 (dos canales), que, además,
permite realizar el ensayo con la
reducción del tiempo de estudio
a 1/3.
En sólo un descenso / elevación
de las sondas del estudio dentro
de los tubos del pilote bajo investigación, mide las tres secciones
relevantes.
El pilote debe estar preparado
con tres tubos de inspección.
C373-10 equipo completo.
C373-10 attrezzatura completa
instrumentos para ensayos de materiales
HO RMIGÓN
EQUIPOS DE MEDIDA DE VELOCIDAD DE IMPULSO ULTRASONICO
NORMAS: EN 12504 part. 4 / ASTM C597 / BS 1881:203 / UNI 9524 / NF P18-418 / UNE 83308
Se utiliza para determinar la presencia de defectos, huecos, grietas, etc., in-situ o en prefabricados de hormigón y para el seguimiento a
largo plazo de estructuras sometidas a condiciones ambientales.
Suministra los datos relativos a la homogeneidad del hormigón, mediante la generación de impulsos ultrasónicos en el interior del hormigón y midiendo el tiempo para que el sonido viaja desde la sonda transmisor a la sonda receptor a través del material. Además, es posible
tener datos indicativos sobre el módulo de elasticidad dinámica, y la resistencia del hormigón.
sección C
MODELOS DISPONIBLES:
C369N
Equipo de medida de la velocidad de impulso
ultrasónico “Alta tecnología”
- Rango de medición: 0 a 4500 μs - Precisión +/- 0,1 μs
- Selección de la amplitud del impulso ultrasónico ajustable
desde 250 hasta 1000 V
- Medición del tiempo requerido por el impulso ultrasónico
para atravesar el material ensayado.
- Adquisición individual o continua del modo automático o
manual.
- Calibración del cero con la depuración del tiempo del
impulso en atravesar las sondas.
- Calibración de un valor de tiempo definido.
- Capacidad de adquisición, procesamiento y
presentación de los datos del ensayo de hasta
30.000 muestras.
- Puerto mini USB para conexión al ordenador.
- Dos tomas para la conexión del osciloscopio.
- Idiomas: Inglés, Francés, Alemán, Español, Italiano.
- Medición del Módulo de Young (conociendo la
distancia entre las sondas, y la densidad del material de
ensayo).
- El uso del instrumento es muy sencillo porque se basa en un sistema
fácil de usar.
El aparato estándar incluye:
- Configuración básica del instrumento en una práctica consola de mano.
- Dos sondas de 55kHz con cables de conexión.
- Cilindro calibrado y pega de contacto.
- Conjunto de batería recargable de NiMH de 4,8 V> 2000mA con alarma de nivel bajo
de la batería.
- Maletín anti shock para la unidad y los accesorios.
- Alimentación externa de 230V y cargador de batería de 12 V 500mA.
Dimensiones del maletín: 400x340x110mm. Peso: 2 kg aprox.
C369N
ACCESORIOS:
C370-08 SONDAS DE TRANSMISIÓN / RECEPCIÓN EXPONENCIAL (dos unidades), 55 kHz de frecuencia
nominal.
C372-10 SONDAS DE TRANSMISIÓN / RECEPCIÓN (dos
unidades), 150 kHz de frecuencia nominal, indicado para
hormigón homogéneo, compacto, de alta densidad.
C372-11 SONDAS DE TRANSMISIÓN / RECEPCIÓN (dos
unidades), 24 kHz de frecuencia nominal, indicado para
el hormigón heterogéneo, de baja densidad.
C370-10 PAREJA DE CABLES (cada uno de 10 m. de largo) para
conectar las sondas al equipo de medida. Se utiliza para
ensayar las estructuras voluminosas / grandes.
265
C369N
con maletín
RECAMBIOS:
C370-02 SONDAS DE TRANSMISIÓN / RECEPCIÓN
(dos unidades), 55 kHz
C370-06 PAREJA DE CABLES (cada uno de 3,5 m de largo) para
conectar las sondas al equipo de medida.
C370-07 Tubo de grasa para un mejor acoplamiento de las
sondas en el material sometido a ensayo.
instrumentos para ensayos de materiales
HO RM I G ÓN
C372N
Equipo de medida de velocidad de impulso ultrasónico, “alto rendimiento” con microprocesador
para la adquisición de datos y procesamiento con la combinación de ultrasonidos y esclerómetros.
sección C
NORMAS: EN 12504: part 4 / BS 1881:203 / ASTM C597 / UNI 7997, 9189, 9524 / NF P18-418 / UNE 83308
266
Este es un instrumento que usa las más modernas tecnologías, presenta
una pantalla táctil en color de 1/4 VGA, 64 MB, puerto de Compact
Flash, tarjeta SD, USB, RS 232, RS 485, sistema de trabajo Windows CE,
con la posibilidad de gestionar archivos Excel, Word, PPT, etc.
Las pruebas de ultrasonidos:
El aparato permite medir la velocidad de los impulsos ultrasónicos
en el interior del material (al conocer la distancia entre las sondas).
El aparato mide la distancia entre las sondas (al conocer la velocidad
de los impulsos ultrasónicos para atravesar el material de ensayo).
Mide el tiempo requerido por el impulso ultrasónico que atraviesa
el material ensayado.
Se mide también el Módulo de Young (al conocer la distancia entre
las sondas y la densidad del material de ensayo).
Cálculo de la profundidad de la grieta.
Calibración del cero con la depuración del tiempo para el impulso
viaje a través de las sondas.
Calibración de un valor de tiempo definido.
Funciones avanzadas con fines de investigación:
- Selección de la frecuencia de transmisión de los impulsos.
- Selección de la amplitud de los impulsos.
Capacidad de archivar infinita de las fechas de ensayo y del gráfico
de seguimiento de los ensayos en una tarjeta SD o Compact Flash
extraíble y ampliable.
Puerto RS 232 o RS 485 o USB para la conexión del ordenador o
la conexión de la impresora.
Tiempo de medición de 0 a 9999,9 μS
Resolución: 0,1 μS
Posibilidad de utilizar el instrumento con dos sondas exponenciales,
o con una sonda estándar y una sonda exponencial.
El uso del aparato es muy sencillo porque se basa en el
sistema de trabajo PC Palmer y Windows CE, que permite
al usuario utilizar el conocimiento del ordenador personal
clásico y su software.
Posibilidad de conectar el instrumento a Internet para
consultas o extracciones, como un ordenador común.
Posibilidad de visualizar la forma de la onda de
transmisión, mientras atraviesa por el material a
ensayo, mediante la transformación del instrumento a un osciloscopio real con la opción de
modo “Scope”.
Determinación combinada de ultrasonidos y un
esclerómetro (método sonreb):
El equipo de medida de ultrasonidos C372N
presenta un registrador de datos integral para la adquisición, procesamiento y almacenamiento de datos de los
valores del esclerómetro.
La adquisición de los valores del esclerómetro se lleva a
cabo con el modo manual o automático.
a) Modo manual:
Mide los valores del esclerómetro estándar de hormigón que se registran manualmente en el equipo de medida de
ultrasonidos.
instrumentos para ensayos de materiales
b) Modo automático:
El esclerómetro digital Matest mod C386N está conectado
directamente con el equipo de medida de ultrasonidos a través
de un cable. Los valores del esclerómetro se transmiten automáticamente al equipo de medida C372N.
Las medidas de la velocidad de los impulsos ultrasónicos y los
valores del esclerómetro son automáticamente almacenados y procesados, estimando el módulo dinámico de elasticidad y coeficiente
de Poisson, y proporcionan información sobre los posibles huecos,
las grietas y resistencia de la estructura.
A través de fórmulas matemáticas, es posible evaluar la resistencia
a la compresión del hormigón, utilizada para estimar los tiempos de
encofrado.
El ensayo combinado permite rectificar distintos errores, que son
típicos del esclerómetro simple, y obteniendo las estimaciones de la
resistencia a la compresión del hormigón, que no se puede obtener
con el ensayo de ultrasonido, garantizando una alta precisión y
fiabilidad de los resultados.
El dispositivo estándar incluye:
• El instrumento en la configuración básica (x-scale 400 MHz,
64 MB de Memoria Flash, 64 MB de RAM) en una práctica y
elegante consola de mano.
• Dos sondas de 55 kHz con cables de conexión.
• Cilindro calibrado y pega de contacto
• Maletín resistente anti shock para el instrumento y los accesorios.
• Batería Li-Ion 11,1 V 3000mA.h
• Alimentación externa 230V/24Ve y cargador de batería
Dimensiones: 400x300x180 mm.
Peso: 3 kg
C372 N
sección C
HO RMIGÓN
Pantalla de función gráfica
C386 N + C372 N
C372 N con maletín
ACCESORIOS:
C370-08 SONDAS DE TRANSMISIÓN / RECEPCIÓN
EXPONENCIAL (dos unidades), 55 kHz de
frecuencia nominal.
C372-10 SONDAS DE TRANSMISIÓN / RECEPCIÓN (dos unidades), 150 kHz de
frecuencia nominal, indicado para hormigón
homogéneo, compacto, de alta densidad.
C372-11 SONDAS DE TRANSMISIÓN / RECEPCIÓN
(dos unidades), 24 kHz de frecuencia nominal, indicado para el hormigón heterogéneo,
de baja densidad.
C370-09 PAREJA DE CABLES (cada uno de 10 m de
largo) para conectar las sondas al equipo
de medida. Se utiliza para ensayar las
estructuras voluminosas / grandes.
C372-10
Pantalla de función internet
Tarjeta electrónica: detalle
RECAMBIOS:
C370-02 SONDAS DE TRANSMISIÓN / RECEPCIÓN (dos
unidades), 55 kHz
C370-06 PAREJA DE CABLES (cada uno de 3,5 m de largo) para
conectar las sondas al equipo de medida.
C370-07 Tubo de grasa para un mejor acoplamiento de las
sondas en el material sometido a ensayo.
C370-02
C370-08
instrumentos para ensayos de materiales
267
HO RM I G ÓN
C393
sección C
Equipo de medida de la frecuencia de resonancia
268
PARA LA DETERMINACIÓN DE LA FRECUENCIA DE RESONANCIA DEL HORMIGÓN
NORMAS: ASTM C215, C666 / BS 1881:209 / NF P18-414 / UNI 9771
La unidad mide las frecuencias de resonancia de tres diferentes
modos de vibración:
- longitudinal, transversal (flexión) y de torsión.
A partir de estos y de las características del material, se puede
calcular por medio de ensayo no destructivo:
- Módulo de elasticidad de Young,
- Módulo de rigidez, y
- Coeficiente de Poisson.
Disponible para tamaños de muestra de hasta 150 mm de dimensión de sección transversal, y de 45 mm a 700 mm de longitud.
Identificación automática de la frecuencia de resonancia. Gran pantalla de fácil visualización para el análisis de los datos de dominio
del tiempo y las señales del espectro de frecuencias.
Los datos pueden ser almacenados y enviados a un ordenador para
su posterior análisis e inclusión en el informe.
Rápido y fácil de usar.
El principio utilizado en este medidor se basa en la determinación
de la frecuencia de resonancia fundamental de las vibraciones de
una muestra generada por un impacto y detectada por un acele-
rómetro. El espectro de frecuencias se calcula y se muestra por el
equipo.
Durabilidad del hormigón:
La determinación de la resonancia a la flexión es muy importante en
el estudio de la degradación del hormigón bajo los ciclos acelerados
de congelación y deshielo y los ambientes agresivos en muestras de
hormigón. Las ventajas de los métodos de resonancia son:
- El ensayo puede ser repetido en un largo período en la misma
muestra, por lo tanto el número de muestras de ensayo requeridas es muy reducido.
- Los resultados obtenidos con el método de resonancia en la
misma muestra son más reproducibles que los obtenidos con
ensayos no destructivos y en grupos de muestras.
Especificaciones:
- Rango de frecuencia: 10 Hz a 20 kHz
- Frecuencia de muestreo: 20 kHz o 40 kHz
- Sensibilidad del acelerómetro: 9,60 mV/g (0.979 mV/ms2)
- Batería de 12V, 4-10 horas de uso continuo.
- Pantalla: 320 por 240, con retro iluminación para su uso a la luz
del día.
- Almacenamiento: más de 200 lecturas.
- Software: Windows compatible 9x/me 32 MB de RAM.
- Impactadores: conjunto de 6 bolas de acero endurecido.
C393
El suministro estándar incluye:
- Unidad principal electrónica.
- Bancada estándar con sus
accesorios.
- Acelerómetro con cable.
- Conjunto de bolas de acero
endurecido.
Peso: 30 kg aprox.
instrumentos para ensayos de materiales
BARRAS DE ARMADURA
C396
Para determinar la presencia, posición, dirección, profundidad y el diámetro de las barras de acero de refuerzo en estructuras de hormigón.
NORMAS: BS 1881:204 / DIN 1045
Profometer 5+, “ modelo S”
C403-01
Profoscope
Versátil, totalmente integrado detector de barras de refuerzo y
medidor de recubrimiento con una visualización única de barras
de refuerzo en tiempo real, permitiendo que el usuario “VEA”
realmente la ubicación de la barra de refuerzo bajo la superficie del
hormigón a una profundidad máxima de 180 mm.
A esto se suman los indicadores de proximidad de las barras de
refuerzo y ayuda de localización óptica y acústica.
El diámetro de las barras de refuerzo puede ser también estimado
en el rango de ensayo especificado.
El Profoscope combina estas características únicas en un dispositivo
compacto y ligero que permite a los usuarios utilizar este detector
de barras de refuerzo con una mano haciendo la tarea de localizar
barras de refuerzo un proceso simple y eficiente.
Para determinar la presencia y posición de barras de acero, dirección y el diámetro con una precisión de ± 1 mm.
Medición de recubrimientos de hormigón. Almacenamiento de datos. Procesamiento de datos a través de la impresora u ordenador.
Disquete con instrucciones para la transferencia de datos.
Dispositivo de visualización no volátil con 1 MB de memoria para
40.000 mediciones y subdivisiones en 72 objetos. Pantalla gráfica
LCD de 128x128.
Puerto RS 232 C. Suministro de batería de 60 horas, rango de temperatura de -10 A +60 °C.
Se suministra completo con sonda universal para las medidas
puntuales, de diámetro y de profundidad, con cable y maletín de
transporte.
Dimensiones: 320x285x105mm.
Peso: 2 kg
sección C
HO RMIGÓN
C396
Además, la unidad convence a través de su interfaz de usuario
intuitivo que hace una detección fácil de barras de refuerzo.
C403-01
C397
Profometer 5+ “modelo Scanlog” para requisitos de rendimiento elevado. Presenta las mismas características que
el modelo S, además de:
Función de “CyberScan” para mostrar la armadura en la pantalla
Función de “medición de la malla” para visualizar la cobertura de
hormigón en escala de gris.
Sonda ScanCar con dispositivo de medición de distancia integrado
y cable.
Transferencia por cable.
C403-02
CARACTERÍSTICAS:
- Indicación visual de barras de refuerzo en las proximidades.
- Capacidad para identificar el punto medio entre las barras de
refuerzo, así como la orientación de las mismas.
- Indicación óptica y acústica de la ubicación de las barras de
refuerzo y alerta de recubrimiento mínimo.
- Rectificación de barras cercanas.
- Inalámbrico y operado con una mano.
- Menús independientes con lenguaje de iconos básicos.
- La puesta en marcha del equipo de ensayo permite al usuario
familiarizarse con todas las funciones en un ambiente confortable,
sin perder el tiempo en el sitio.
C403-02
Profoscope+ (plus)
Presenta las mismas características del mod. C403-01, pero, además,
ofrece la función innovadora de memoria para la adquisición
automática de datos, mediante la eliminación de las mediciones
manuales de una serie de ensayos, ahorrando tiempo y una fuente
innecesaria de errores.
instrumentos para ensayos de materiales
269
sección C
HO RM I G ÓN
C411
C412-01
Canin
Medidor digital de la resistividad del
hormigón con 2 sondas.
INSTRUMENTO DE ANALISIS DE LA CORROSION
NORMAS: UNI 9535 / ASTM C876 / BS 1881:201
Para la detección no destructiva de la corrosión en las barras de
refuerzo de elementos de construcción de hormigón.
Una gran pantalla y 9 teclas para una operación sencilla mediante el
menú técnico y memoria inteligente hacen de Canin un instrumento único en todo el mundo.
120.000 mediciones pueden ser guardadas en la memoria
inteligente y recuperadas con las teclas del cursor. Una superficie
de medición de más de 4000 m2 puede ser manejada con la gran
capacidad de memoria. El suministro estándar incluye un electrodo
de barra, RS 232, software integrado para la impresora, cables,
sulfato de cobre, maletín de transporte.
Dimensiones: 300x330x100 mm
Peso: 5 kg
270
Utilizados para evaluar la tasa probable de la corrosión en las
barras de refuerzo con el método de medición de la resistividad eléctrica. Un hormigón de alta permeabilidad tiene elevada
conductividad con resistencia eléctrica reducida. El conocimiento
de la resistencia eléctrica de un hormigón permite medir la posible
tasa de corrosión de barras de acero reforzado embebidas en
el hormigón. El ensayo es sencillo de realizar y requiere sólo dos
agujeros de 6,5 mm de diámetro perforados a una profundidad de
8 mm. Se inyecta una pequeña cantidad de gel conductor en cada
agujero y se inserta la sonda. El valor de la resistividad se muestra
inmediatamente.
- Rango de medición: 0,5 a 20 kΩ cm, con una resolución de 0,1 kΩ.
- Distancia conjunto 2-sondas: 5 cm
- Pantalla: LCD de 4 ¼ dígital
- Funciona con pilas, con 100 horas de tiempo de funcionamiento
El instrumento se suministra completo con broca, gel, plantillas,
accesorios, maletín de transporte.
Dimensiones: 400x270x130mm. Peso total: 4 kg
RECAMBIO:
C412-11 Tubo de gel conductor.
C412-01
C411
EXTENSIONES:
C411-05
ELECTRODO DE UNA RUEDA, para el escaneo rápido de
grandes superficies.
C411-06
ELECTRODOS DE CUATRO RUEDAS, para medición de la
velocidad máxima en zonas de gran tamaño.
C411-07
SONDA WENNER DE CUATRO-PUNTOS, para medir la resistencia eléctrica del hormigón.
Canin también puede almacenar hasta 5.800 valores de resistividad y los datos pueden ser transferidos a un ordenador para su
posterior análisis.
C411-05
instrumentos para ensayos de materiales
C411-07
C411-06
C410
C410-10
Sistema de sonda digital Windsor HP
Penetrómetro clavo Windsor
NORMAS: ASTM C803 / BS 1881:207 / ACI 347
Para evaluar la resistencia a la compresión del hormigón in situ con
el método de penetración. Ensayo no destructivo. Rápido, preciso
y fácil de realizar. El ensayo dura cinco minutos y no debilita la
estructura. Comparando entre los resultados del ensayo con este
método y ensayos destructivos se muestra una variación normal
dentro del 3% de los demás. El método requiere un dispositivo
parecido a una pistola que se carga con una pequeña carga explosiva y la sonda de metal. La carga se mide con precisión para una
potencia de tiro consistente. Al apretar el gatillo la sonda se dispara
dentro del hormigón.
RESISTENCIA A LA PENETRACIÓN
NORMA: ASTM C803
Este instrumento portátil es adecuado para evaluar la resistencia
del hormigón y las juntas de mortero de las estructuras existentes
de hasta 37 MPa. La unidad puede ensayar también los hormigones
con polímeros y parches de hormigón.
El ensayo se realiza al penetrar un clavo de acero en el hormigón. El
clavo se puede reutilizar.
Uso seguro: no se requiere carga explosiva.
Ideal para el control de calidad de elementos prefabricados, tuberías, losas de ladrillo, etc.
El ensayo se basa en el principio de la profundidad de penetración,
que es inversamente proporcional a la resistencia a la compresión.
El sistema de amortiguación de la unidad introduce el clavo de
acero en el hormigón, y el micrómetro (suministrado) mide la
profundidad de penetración alcanzada.
Este valor se compara con la tabla previamente preparada, o con
tablas típicas proporcionadas para hormigón y mortero.
El penetrómetro se suministra completo con accesorios, maletín de
transporte portátil.
Dimensiones: 420x310x150mm. Peso: 8 kg aprox.
sección C
HO RMIGÓN
C410
C410-10
El equipo estándar consiste en:
- unidad de impulsión
- unidad digital de medida con memoria para el almacenamiento de
datos y descarga al ordenador
- accesorios y maletín de transporte.
Las sondas y las cargas
de potencia “no están
incluidas”, y deben pedirse
por separado.
Dimensiones:
500x400x200 mm
Peso: 16 kg
C403-10
Detector metálico de hasta 150 mm de
profundidad de escaneo
ACCESORIO:
C410 con maletín y accesorios
C410-01
KIT SONDA DE COLOR PLATA
Para los áridos naturales con sondas
y cargas de potencia.
Paquete de 75 Kit sonda.
C403-10
Este localizador busca y escanea, a través de hormigón sólido,
barras de refuerzo de acero y materiales metálicos como tuberías,
cables eléctricos, cajas de empalme, clavos de metal y marcos de
hasta 150 mm de profundidad.
Analiza y diferencia desde barras de refuerzo de acero hasta otros
materiales metálicos como tuberías de cobre.
Diferencia entre los metales magnéticos y los no magnéticos.
Este detector es un dispositivo esencial para los constructores,
remodeladores, electricistas, fontaneros.
Precisión: barras de refuerzo o tubos de 14 mm de diámetro con
un espacio mínimo de malla de 152 mm se escanean dentro de la
tolerancia de 13 mm.
Profundidad: 152 +/- 25 mm
1 pila alcalina de 9V (no incluida) para un año de uso.
Dimensiones: 250x110x62mm
Peso: 300 g aprox.
instrumentos para ensayos de materiales
271
HO RM I G ÓN
EJEMPLO DE
USO
sección C
C405-15N
C405-10
C405-10
Deflectómetro con transductor
tubular telescópico de desplazamiento.
272
Se utiliza para determinar la deflexión bajo cargas conocidas en los
puentes, techos o cualquier estructura suspendida.
Este instrumento garantiza resultados muy precisos y fiables con la adquisición de datos a través de Cyber-Plus 8 Evolution mod. C405-15N.
El deflectómetro telescópico se compone de:
- Tubos telescópicos con estructura de aluminio anodizado de
1080 mm de altura mínima y 3120 mm de extensión máxima.
- Transductor de desplazamiento potenciométrico lineal con
sistema de muelles, fijados en la base de la estructura tubular
telescópica, con las mediciones ya sean en compresión o tensión,
+/- 50 mm de recorrido y 0,01 mm de resolución.
- Cadena de acero inoxidable, 10 m de largo para las mediciones
de más de 3 m.
- Base de acero inoxidable para el anclaje de los tubos con el lastre,
gancho, accesorios.
- Maletín de transporte.
Peso: 2 kg
NOTA: Se recomiendan tres deflectómetros para realizar correctamente el ensayo.
ACCESORIOS:
Cisternas para ensayos de carga
Fabricadas con poliestireno flexible recubierto de PVC, se utilizan
para cargar la estructura y medir su desviación.
Se suministra con conector, tubo flexible y válvula esférica.
Disponible en distintas capacidades:
Modelo
C405-24
C405-25
C405-26
C405-27
Capacidad litros Dimensiones cm
1000
2500
5000
10000
Peso kg
240 x 145
280 x 240
400 x 240
490 x 340
10
16
25
40
C405-15N
Cyber-Plus 8 Evolution “Pantalla Táctil”
8 canales de adquisición y procesamiento de datos, 24 bits de resolución. Tecnología electrónica avanzada, “pantalla táctil a color” ¼
VGA, gráficos de alta resolución, la unidad realiza automáticamente
el ensayo y el procesamiento de los datos. El certificado puede ser
impreso a través de una impresora (opcional) conectada directamente a la unidad a través del puerto USB. La unidad Cyber-Plus
está equipada con una ranura para soportes externos pendrive o
tarjeta de memoria SD infinita, y puede ser conectada directamente
a un PC. Contenida en un estuche práctico, robusto y hermético,
puede ser alimentada por una red eléctrica de 90-270V o usar la
batería interna y el cargador garantizando un día completo de uso
in situ. Detalles técnicos de Hardware: ver pág. 24
S337-51
Proceso de CALIBRACIÓN de un deflectómetro con unidad de
adquisición de los datos C405-15N.
instrumentos para ensayos de materiales
C405-24
C405-30
Contador de litros, electrónico, para cisternas.
Mide y muestra la cantidad de agua.
Precisión: +/- 1%
Alimentación. Pilas AAA estándar
Peso: 2 kg
C405-30
RECAMBIO:
C405-20 CADENA de 10 m de largo de acero inoxidable, para
las mediciones de más de 3 m.
HO RMIGÓN
Usados para determinar la deflexión en los puentes, techos o cualquier estructura suspendida. Posibilidad de utilizar el flexímetro en
presión o en tracción, y la lectura es directa en el reloj comparador.
Disponible en conjuntos de “uno” o “tres”, que se completará con
reloj comparador de recorrido desde 10 a 50 mm.
Un conjunto de deflexiones comprende:
basculante con la abrazadera para la orientación completa en
cualquier posición, la bobina de alambre inextensible 20 metros de
largo, plomada, maletín de transporte.
Suministrados “sin” reloj comparador que debe pedirse por
separado (ver accesorios).
C408 ÷ C408-03
sección C
Deflectómetros, modelo basculante
MODELOS:
C405N Juego de 1 flexímetro (sin reloj comparador)
C406N Juego de 3 flexímetros (sin relojes comparadores)
ACCESORIOS:
Reloj comparador de 10 mm de carrera x 0,01 mm sens.
S376
S377
Reloj comparador de 25 mm de carrera x 0,01 mm sens.
S378
Reloj comparador de 30 mm de carrera x 0,01 mm sens.
S379
Reloj comparador de 50 mm de carrera x 0,01 mm sens.
MODELOS:
C408
Fisurómetro para paredes, para controlar movimientos
verticales y horizontales, también simultáneos, sobre
superficies planas. Conjunto de 5 unidades.
RECAMBIO:
C407-02 Bobina de alambre inextensible, 20 metros de largo.
C408-01 Fisurómetro para ángulos, para controlar fisuras en
esquinas con movimientos bidireccionales, también
simultáneos. Conjunto de 5 unidades.
C405N + S377
C408-02 Fisurómetro para suelos, para controlar los asentamientos del suelo respecto a paredes, columnas, etc.
Conjunto de 5 unidades.
C408-03 Fisurómetro para desniveles, para controlar la pérdida
de nivel de cualquier superficie agrietada.
Conjunto de 5 unidades.
C406N
+ S376
FISURÓMETROS
Utilizados para el control, medida y registro del ancho de las fisuras
o grietas de la estructura del edificio.
Uso interior o exterior, fabricado en una banda de policarbonato
resistente, completo con tarjeta de registro de la grieta en cada
medidor para simplificar el control, adecuados para las mediciones
de movimientos verticales y horizontales.
C408
C408-01
C408-02
C408-03
instrumentos para ensayos de materiales
273
HO RM I G ÓN
C430
sección C
Permeabilímetro para ensayos de permeabilidad del hormigón de 4 puestos
Este aparato totalmente automático se diseña para realizar ensayos
de permeabilidad de agua en probetas cúbicas de hormigón de
longitud de lado máxima de 150 mm y probetas cilíndricas de
diámetro máximo 160 mm. Las probetas se someten a presión
hidrostática durante un período de tiempo prefijado. El agua que
penetra en la probeta se recoge directamente en un cilindro
graduado y se mide la cantidad recogida.
De esta forma es posible calcular el coeficiente de permeabilidad
en cm/s (Coeficiente de Darcy) mediante la siguiente fórmula:
Se suministra completo con cuatro células, cuatro cilindros
graduados, resina epoxi y accesorios. Los “dispositivos de sellado
no están incluidos” en el paquete estándar y debe pedirse por
separado.
Alimentación: 230V monofásica, 50Hz
Dimensiones: 2500x500x1300 mm
Peso: 240 kg
C430
274
ccxh
K =
AxtxP
donde:
cc = volumen de agua que ha penetrado en cm3
h = altura de la probeta (cm)
A = área de la superficie de la probeta (cm2)
t = tiempo de penetración (s)
P = presión hidrostática en cm de columna de agua.
El equipo consta de un resistente bastidor metálico, donde se
sostienen cuatro células galvanizadas en caliente para protegerlas
contra la corrosión.
Manómetro de control de presión para cada célula.
Una cámara de compensación recargable se incluye como parte
del ensayo.
La presión es regulable de 0 a 30 bar y se suministra mediante una
bomba automática de caudal variable, para optimizar la instalación
más adecuada en función de la probeta a ensayar.
La alimentación de agua es directa a partir de la entrada de agua.
El sellado de presión se obtiene mediante dispositivos de sellado especial y prácticos que mantienen y simplifican el uso de la
máquina.
Es posible utilizar una o más células a la vez, y también probetas de
diferentes tamaños (cúbicas / cilíndricas).
El sistema de sellado de la probeta se logra mediante un dispositivo
práctico y rápido, apreciado por el usuario.
instrumentos para ensayos de materiales
ACCESORIOS “NECESARIOS”:
Dispositivo de sellado, completo con junta de látex que se instala
entre los dos collares de acero galvanizado en caliente.
Completo con tornillos.
MODELOS:
C432-01 Dispositivo de sellado para probetas cúbicas de
100 mm de lado
C432-02 Dispositivo de sellado para probetas cúbicas de
150 mm de lado
C432-04 Dispositivo de sellado para probetas cilíndricas de
diámetro 100 mm
C432-05 Dispositivo de sellado para probetas cilíndricas de
diámetro 150 mm
C432-06 Dispositivo de sellado para probetas cilíndricas de
diámetro 160 mm
C432-02
C432-05
RECAMBIO:
C433
RESINA EPOXI, para aislar las superficies laterales de la probeta de
hormigón. Recipiente de 5 kg
HO RMIGÓN
EQUIPO DE MEDIDA DE IMPERMEABILIDAD AL AGUA
DETERMINACIÓN DE LA PROFUNDIDAD DE PENETRACIÓN DEL AGUA BAJO PRESIÓN.
NORMAS: EN 12390-8 / DIN 1048 / ISO 7031 / UNI 9533
sección C
Este aparato se utiliza para determinar la profundidad
de la penetración del agua en el hormigón (impermeabilidad) con el tiempo y la presión conocidos.
La unidad acepta probetas cúbicas, cilíndricas o
prismáticas de hormigón con “dimensiones máx.” de
200x200x200 mm.
La muestra se coloca en la cámara de ensayo, sujetada
con “bridas adecuadas con tornillo central” y juntas
circulares.
Una presión conocida del agua se aplica sobre la
superficie de la muestra por un tiempo conocido,
según lo solicitado por la Norma, con un compresor
de aire adecuado (ver accesorios) con al menos 5 bar
de presión.
Un manómetro comprueba constantemente la presión
del agua aplicada.
El aparato se suministra “completo con buretas
graduadas” fijadas en el panel frontal.
El agua penetrada se mide al romper la probeta,
o leyendo el agua penetrada a través de la bureta
graduada.
Dos modelos disponibles: versiones de tres y seis
plazas. Las plazas se pueden utilizar todas juntas, al
mismo tiempo, o uno por uno de forma independiente.
275
C435-01
MODELOS:
C435
Aparato de impermeabilidad
del agua en hormigón, tres
plazas con buretas de medición de agua.
Dimensiones: 1400x750x1700 mm
Peso: 280 kg aprox.
C435-01
Aparato de impermeabilidad
del agua en hormigón, seis
plazas con buretas de medición de agua.
Dimensiones: 1400x750x1850 mm
Peso: 430 kg aprox.
ACCESORIOS:
V206
COMPRESOR DE AIRE, 70 litros de capacidad.
230V 50Hz monofásico.
C435
E138-11
TUBOS y accesorios para conectar el aparato
de impermeabilidad al compresor de aire.
instrumentos para ensayos de materiales
HO RM I G ÓN
MATEST fabrica una gama completa de Laboratorios Móviles tales como:
sección C
- Laboratorio móvil tipo Tráiler.
- Laboratorio móvil montado en camioneta.
- Laboratorio montado en contenedor.
Dimensiones pequeñas o grandes; Matest puede suministrar también estructura móvil, muebles, generadores, aire acondicionado, instalación
eléctrica y fontanería, etc., o simplemente fijar los equipos de ensayo sobre la estructura móvil suministrada por el cliente.
276
El personal técnico de Matest está a completa disposición del cliente para
estudiar cualquier necesidad específica y aceptar propuestas detalladas para
satisfacer las necesidades del usuario final.
instrumentos para ensayos de materiales
sección E
Sección E
CEMENTOS – MORTEROS
C EMENTO S – MO RTE ROS
Las materias primas tales como: piedra calcárea, yeso, pizarras,
arcilla, etc. son trituradas, molidas y mezcladas con agua. La
mezcla obtenida se somete a un proceso químico en un horno
rotatorio hasta que se convierte en clinker. Del clinker oportunamente mezclado con yeso, las cementeras obtienen el moderno
cemento Portland, que pueden ser modificados en conglomerantes cada vez más sofisticados, como morteros expansivos,
cementos pre-mezclados, etc.
En la Sección “Cementos y Morteros” Matest propone una completa gama de instrumentos para ensayos de:
finura, consistencia, curado, trabajabilidad, deformación, expansión,
cenizas volantes, cales vivas y apagadas, ensayos químicos, etc. y
también para el mezclado, moldeado, curado y ensayos de resistencia, para satisfacer todas las variables de calidad, en cumplimiento de las Normas EN, ASTM y las más importantes Normas
Internacionales reconocidas.
instrumentos para ensayos de materiales
277
CEM E N TOS – M O RT E RO S
PERMEABILIMETRO DE BLAINE
E011
PARA DETERMINAR LA FINURA DEL CEMENTO
NORMAS: EN 196-6, comparable a:
ASTM C204 / AASHTO T153 / BS 4359:2
UNI 7374 / NF P15-442 / UNE 80106 / DIN 1164
Permeabilímetro Blaine Electrónico
Modelos disponibles:
E009 KIT
sección E
Permeabilímetro de Blaine (finura)
Utilizado para determinar la finura del cemento Portland en
términos de superficie específica, expresada como área total en
centímetros cuadrados por gramo de cemento.
El aparato se entrega con un manómetro de tubo en “U” con
válvula, soporte de acero, célula de ensayo con disco y pistón todo
ello en acero inoxidable, con aspirador de goma, 1000 discos de
papel de filtro, líquido manométrico, grasa de vaselina para un
mejor acoplamiento entre célula y tubo, embudo y escobilla.
Dimensiones: 220x180x470 mm. Peso: 12 kg
Este permeabilímetro Blaine electrónico, consta de un módulo
con un manómetro de columna i con una célula de medida de 3
componentes. El procedimiento de ensayo se inicia pulsando el
botón START. El procedimiento del ensayo se ejecuta de forma
automática mostrándose el tiempo de ejecución.
La definición del valor final de Blaine se debe hacer manualmente
por el usuario final.
Se suministra completo con termómetro
digital, lleno de aceite, cono de grasa,
embudo, papel de filtro, escobilla, cable
de alimentación con dos polos y clavija
de toma de tierra.
Clase de protección: IP-55
Alimentación:
230V monofásica 50/60Hz 10W
Dimensiones: 170x290x450 mm
Peso: 3,5 kg
E009 KIT + E055-08
278
E011
E011-01
Permeabilímetro Blaine Automático
ACCESORIOS:
E010-02 Cemento de referencia normalizado 114q ASTM/SRM/
EN para calibrar el Blaine.
E055-08 Termómetro de vidrio -10 a +50 ºC.
RECAMBIOS:
E010-01 Manómetro completo de vidrio en “U”
E010-03 Botella de 250 ml de líquido manométrico
E010-04 Papel de filtro, poro de 2 micras
(paquete de 1000 piezas)
E010-08 Célula de ensayo, completa (tres piezas)
E010-05 Cuerpo de la célula en acero inoxidable
E010-06 Pistón de acero inoxidable para la célula
E010-07 Discos perforados de acero inoxidable para la célula
instrumentos para ensayos de materiales
Este equipo electrónico automatizado con microprocesador está
equipado con un dispositivo automático de hermeticidad.
El aparato consiste en módulo con un manómetro de columna y
con cuatro células de medida en acero inoxidable.
Dependiendo de la porosidad del cemento y de su densidad, el
equipo calcula automáticamente la masa que tiene que ensayar,
determina la constante K de acuerdo con la normativa del cemento, registra los resultados del ensayo con la
posibilidad de elaborar un valor medio de los
diferentes ensayos. Puerto RS 232.
La definición de valor final de Blaine
la realiza el equipo de
manera automática.
Se suministra completo
con accesorios.
Alimentación: 230 V
monofásica 50Hz
Dimensiones:
280x325x410mm
Peso: 10 kg
E011-01
C EMENTO S – MO RTE ROS
Densímetro Le Chatelier
E014
NORMAS: EN 196-6 / ASTM C188
AASHTO T133 / UNE 83453
Usado para determinar la densidad relativa
(peso específico) del cemento hidráulico y
de la cal viva. Capacidad 250 ml. El cuello
está graduado entre 0-1m. y de 18-24 ml
con divisiones de 0,1ml.
Peso: 500 g
V192-08
ACCESORIO:
V192-08
ESPÁTULA CHATTAWAY, 120 mm de largo.
E016
Dispositivo para determinar
la finura por tamizado vía húmeda
NORMA: D.M. 3/6/68
Utilizado para determinar la finura del cemento. Consiste en un
inyector pulverizador con llave de alimentación y manómetro;
bastidor de tamiz de latón de 85 mm de diámetro y 95 mm de alto
con dos discos de malla de acero inoxidable con aperturas de 0,18
y 0,09 mm. Una muestra de cemento de 25 g se coloca dentro del
tamiz y se lava durante dos minutos por medio del pulverizador colocado en la parte alta del tamiz. El residuo retenido del cemento
se obtiene por secado del tamiz a 110 ºC. Peso: 3 kg
RECAMBIOS:
E016-01 Disco de malla de acero inoxidable con apertura de 0,18 mm
E016-02 Disco de malla de acero inoxidable con apertura de 0,09 mm
E016
E029
Medidor de 400 ml de capacidad
NORMAS: ASTM C185-85 / AASHTO T137
Para determinar el contenido de aire de los morteros recientemente mezclados por el método de densidad.
Hecho de acero, diámetro interior 76,2 x 88,1 mm de altura.
ACCESSORIOS:
E087-06
PISÓN DE MADERA DURA
E087-06
sección E
E014
E029
E055-07
PLACA DE VIDRIO, 120
mm de diámetro nominal.
V192-08
Espátula CHATTAWAY
V192-08
E020
E055-07
Recogedor de muestras de cemento a granel
NORMAS: EN 196-7 / ASTM C183 / AASHTO T127
Usado para recoger muestras de cemento a granel en almacenes o
transportes.
Construido de latón, consiste en dos tubos concéntricos con ranuras. El volumen interior del tubo es aproximadamente de 3 litros.
Dimensiones: diámetro 40x1500 mm. Peso: 5 kg
E021
Recogedor de muestras de cemento
empaquetado
NORMAS: EN 196-7 / ASTM C183 / AASHTO T127
Usado para recoger muestras de forma homogénea, de sacos de
cemento. Dimensiones: diámetro 32x1050 mm. Peso: 3 kg
E020
E021
E025
E017
Determinación de la finura de cenizas
volantes por tamizado vía húmeda
NORMAS: EN 451-2 / ASTM C430
El conjunto construido de latón consiste en: tamiz de 50 mm de
diámetro con apertura de la malla de 0,045 mm boquilla pulverizadora de 17,5 mm ID con 17 agujeros de diámetro 0,5 mm,
manómetro de 80 mm de diámetro
con escala de 0-160
kPa, divisiones de
5kPa, conexiones y
conectores.
Peso: 3 kg
E017
Aparato para medir
la densidad aparente
del cemento
Este equipo se utiliza para
medir la densidad aparente
del polvo y de materiales no
cohesivos.
Compuesto por: embudo con
tamiz y trípode de apoyo, unidad de medida del peso de 1 l
de capacidad, espátula de borde
recto, librador de aluminio.
Orificio de descarga del embudo de 8 mm de diámetro.
Dimensiones diá.: 350x520mm
Peso: 6 kg
E025
instrumentos para ensayos de materiales
279
sección E
CEM E N TOS – M O RT E RO S
E027
E034
Porosímetro de 1 litro de capacidad
Aparatos para ensayos de reactividad de
la cal
NORMA: EN 459-2 / EN 1015-7
Diseñado para determinar el contenido de aire en los morteros de
cemento, el cemento de pasta y el mortero de cal.
Hecho de aluminio fundido, el recipiente de ensayos es de un
litro de capacidad y la parte superior se sella herméticamente por
medio de dos abrazaderas rápidas con muelle. El conjunto está
conectado a un manómetro que indica directamente la entrada de
aire en porcentaje, con rango de 0 - 50%. Se incluye una bomba de
aire incorporada. Los botones de ENSAYO y CORRECCIÓN están
dispuestos para hacer del ensayo un sistema sencillo y rápido.
Dimensiones: diámetro 200 por 320 mm
Peso: 3,5 kg
E027-01
Porosímetro de 0,75 litros de capacidad
NORMA: EN 413-2
Idéntico al mod. E027, pero con el recipiente que tiene la capacidad
de 0,75 litros, según especificaciones de la EN 413-2.
280
E028
Porosímetro eléctrico de 1 litro de capacidad
NORMAS: EN 459-2 / NF P98-102
Este aparato se utiliza para determinar la curva de apagado en la
reactividad de la cal viva.
El equipo consta de un frasco Dewar de 1000 ml de capacidad
con tapa, agitador eléctrico de 300 rpm completo con agitador de
paletas (hélice), base con soporte, termómetro digital de -50 +200
°C. subdivisiones de 0,1 °C, accesorios.
Alimentación: 230V 50Hz monofásica
Dimensiones: 400x250x750 mm
Peso: 10 kg aprox.
ACCESORIO:
E034-05
Perfil de pesado y llenado
RECAMBIOS:
E034-11 Vaso Dewar
E034-12 Agitador de paletas
(hélice)
NORMA: EN 459-2
Igual que el mod. E027, pero incorpora un mini-compresor eléctrico para dar aire a presión y mantenerlo constante a lo largo del
ensayo.
Alimentación: 230V 50/60Hz monofásica
E034-12
E028-02
E034
Porosímetro eléctrico de 0,75 litros de
capacidad
NORMA: EN 413-2
Idéntico al mod. E028, pero con el recipiente que tiene la capacidad
de 0,75 litros, según especificaciones de la Norma EN 413-2.
ACCESORIO:
E028-01 Tolva de llenado (anillo) para los porosímetros E027,
E027-01, E028, E028-02.
E034-05
E035
Recipiente de apagado
CALES DE CONSTRUCCIÓN - RENDIMIENTO DE LA CAL
NORMA: EN 459-2
Este recipiente aislante se utiliza para determinar
el rendimiento de cal, dejando dentro la muestra
de cal para apagar. Fabricado en acero inoxidable,
de doble pared con aislamiento a base de fibras de
vidrio, el cilindro tiene dimensiones interiores 113
de diámetro por 140 mm de profundidad.
Se suministra completo con tapa.
Peso: 4 kg aprox.
E035
E027
instrumentos para ensayos de materiales
E028
E091
E039N
Densidad aparente
de la cal
Equipo para medir la retención de agua
en el cemento
NORMAS: EN 459-2 / DIN 1060
El equipo permite dejar caer libremente
una muestra de cal desde una altura conocida a un recipiente volumétrico.
Consiste en una tolva, un contenedor cilíndrico de un litro y trampilla con muelle.
Peso: 5 kg
NORMAS: ASTM C91, C110
Se utiliza para determinar el valor de la retención de agua en
masillas de cal y cemento. La unidad consta de: aspirador de agua,
manómetro de columna de mercurio, llave de tres vías, disco
metálico perforado, embudo de vidrio, válvula de mercurio, paquete
de filtros de papel, accesorios, todo montado sobre un soporte.
La bomba de vacío
con sus accesorios no
están incluidos en la
oferta y tienen que
pedirse por separado,
mientras que el mercurio (es necesario
1 kg) no puede ser
suministrado por problemas de seguridad
en el envío.
Dimensiones:
400x300x600 mm
Peso: 8 kg aprox.
E031
Aparato de caída de bola
E091
NORMA: BS 4551-1, 6463-4
Utilizado para medir la consistencia de morteros de cemento, este
instrumento permite a una bola de plástico acrílico de 25 mm de
diámetro, caer libremente desde una altura estándar de 250 mm,
dentro de una muestra de mortero contenido en un molde en
anillo de latón, y cuya superficie ha sido cuidadosamente preparada.
La profundidad de penetración de la bola en el mortero indica la
consistencia de la muestra. El instrumento comprende un dispositivo de liberación montado en un soporte vertical, bola acrílica,
molde de diá. 100x25 mm.
La base del soporte está mecanizada. Acabado cromado.
Peso: 8 kg
ACCESORIO:
E031-01
DISPOSITIVO DE MEDIDA DE PENETRACIÓN DE LA BOLA,
formado por un trípode con un reloj comparador de
25x0,01 mm montado sobre él. Se incluye un dispositivo para
ajustar la altura del comparador en relación al trípode.
Acabado cromado.
Peso: 1 kg
E031
sección E
C EMENTO S – MO RTE ROS
E039N
ACCESORIOS:
V205 + V205-10 + V230-03
Bomba de vacío con accesorios.
Alimentación: 230V 50Hz monofásica
Ver pág. 453
E036 KIT
Variación del volumen en lechadas
Método de los contenedores.
NORMA: EN 445, comparable a la Norma DIN 4227 / UNI 8996, 8998
El equipo consta de:
E036-10 Contenedores, de acero inoxidable (3 piezas).
E036-11 Tapa, hermético, lastre, de acero inoxidable (3 piezas).
E036-12 Discos de plexiglás (3 piezas).
E036-13 Puente de medición.
V175
Calibre Vernier.
V102-02 Medida de llenado graduada.
Peso total: 4 kg aprox.
E036 KIT
E031-01
instrumentos para ensayos de materiales
281
sección E
CEM E N TOS – M O RT E RO S
282
E038
E037-01
Cono para ensayos de fluidez
Balanza Baroid para lodos
NORMAS: EN 445 / NF P18-358, P18-507
Usado para determinar la fluidez y viscosidad de los morteros,
lodos, lechadas, materiales fluidos, etc. El diámetro de la parte
superior del cono es de 155 mm, la longitud total de 290 mm y
la capacidad de 1700 cc. La fluidez del mortero se considera adecuada cuando el tiempo de fluencia de 1000 cc de mortero está
comprendido entre 17 y 25 segundos. Enteramente construido en
latón. Se entrega completo
con cuatro boquillas intercambiables de diámetros 8-9E038-02
10-11 mm. Base ajustable en
altura y recipiente graduado
de plástico.
Peso: 10 kg
Proporciona un método sencillo para la determinación precisa de
la densidad de los lodos.
La balanza consiste en una base y un brazo graduado con recipiente, tapa, peso corredera, nivel de burbuja, contra-peso y maletín de
transporte. El recipiente de volumen constante está fijado a un extremo del brazo graduado y el contrapeso en el extremo opuesto.
Peso: 5 kg
ACCESORIOS:
E038-01
Boquillas intercambiables
dia.12,5 mm.
E037-01
E038
E037-05
Filtro de prensa para lodos
E038-02
Tamiz de 150 mm de diá.
y 1,5 mm de apertura de
malla que encaja en la parte
superior del cono.
E037
E038-01
Viscosímetro de
Marsh
Utilizado para determinar la
viscosidad de lodos de perforación y materiales fluidos en
general.
El orificio tiene una apertura
de 4,7 mm.
En la mitad de la boca del
embudo hay una malla filtrante de 2 mm de apertura.
Realizado en plástico robusto
resistente a la rotura.
Se entrega completo con un
recipiente graduado.
Peso: 1 kg
NORMA: API (American Petroleum Institute), práctica recomendada 13B-1 y 2
Este filtro-prensa es el medio más eficaz para determinar la las
propiedades de filtración de los lodos de perforación y lechadas de
cemento.
El filtro-prensa consta de un depósito de barro montado en un
bastidor, una fuente de presión, un medio de filtrado, y una probeta
graduada para medir el
filtrado recogido, paquete
E037-05
de 100 filtros de papel,
cartuchos de nitrógeno a
presión.
Dimensiones:
210x240x500 mm aprox.
Peso: 12 kg
E037
E037-10
Contenido de arena de los lodos de perforación
El Kit de contenido de arena es un sencillo tamiz, equipo de análisis
preciso y de bajo coste, para determinar el contenido de arena de
los lodos de perforación. El kit consiste en un tamiz especial de 200
de diámetro de 2,5 “de malla sujeta dentro de un collar en el que
un pequeño embudo se coloca en cada extremo. Este se utiliza
con un tubo de 10 ml de vidrio, graduado para leer de 0 a 20% del
porcentaje de arena en volumen. El cuello y el embudo son de polietileno y la rejilla está hecha de bronce. Incluye un frasco lavador
de 500 ml y maletín de transporte. Peso: 1500 g
instrumentos para ensayos de materiales
E037-10
E055N
Aparato Vicat
DETERMINACIÓN DE LA CONSISTÉNCIA DEL CEMENTO Y
DEL TIEMPO DE FRAGUADO
NORMAS: EN 196-3:2005 / EN 13279-2 (yeso)
EN 480-2 / ASTM C187, C191
AASHTO T131 / DIN 1196, 1168 / BS 4550
NF P15-414, P15-431 / UNE 80102
El instrumento consiste en una estructura metálica, escala graduada
con índice, una sonda deslizante de 300 g, émbolo para medir la
consistencia de 10 mm diámetro, placa base de vidrio.
La aguja y el molde cónico, no están incluidos y tienen que pedirse
por separado de acuerdo a la Norma seleccionada (ver accesorios).
Dimensiones: 160x200x300 mm.
Peso: 5 kg
ACCESORIOS:
E055-06 Pesa de 700 g adicionales a la sonda de deslizamiento
(EN- NF)
Aguja final diá 1,13 mm (EN - NF - BS - DIN - UNI - UNE)
E042N
E042-01N Aguja final diá 1 mm (Normas: ASTM - AASHTO)
E055-08 Termómetro de vidrio -10 a +50 °C.
E044-40N Aguja cónica de penetración de 8 mm de diámetro por
50 mm de largo para los ensayos de yeso.
Normas: EN 13279-2 / DIN 1168
E055-15
Sonda de 100 g para las ensayos sobre yeso,
EN 13279-2, DIN 1168
sección E
C EMENTO S – MO RTE ROS
E055-06
283
ACCESORIOS Y RECAMBIOS PARA E055N
RECAMBIOS:
E055-07 Placa base de vidrio de 120 mm de diámetro.
E044-48N Lengüeta para fijar la aguja con la sonda
E042-02N Embolo de consistencia de diámetro 10x50 mm
E058
Aparato de Gillmore
E055N
CON ACCESORIOS
ACCESORIOS “NECESARIOS”:
E046N
Aguja, endurecida diá. 1,13 mm EN 196-3:2005
E046-01N Aguja, endurecida dia.1 mm ASTM – AASHTO
E055-10
E055-05
NORMAS: ASTM C91, C141, C266 / AASHTO T154
Usado para determinar el tiempo de fraguado del cemento.
Soporte de eje vertical con un dispositivo para mantener alineados
los dos brazos horizontales. La posición del conjunto de soporte
puede ser regulada. El peso de las dos agujas de acero inoxidable
está calibrado para cumplir con las Normas. Las puntas de las agujas son de acero inoxidable. La aguja de inicio de fraguado tiene un
diá. de 2,12 mm y un peso de 113 g mientras que la aguja de final
de fraguado tiene un diá. de 1,06 mm y un peso de 453,6 g.
Peso: 3 kg
Molde cónico de plástico de diámetro 70/80 h 40 mm
(EN - NF)
Molde cónico de plástico de diámetro 60/70 h 40 mm
(ASTM - AASHTO)
MOLDES CONICOS SEGÚN ESPECIFICACIONES BS, DIN, UNI
E055-04 Molde cónico de plástico de diámetro 80/90 h 40 mm
(UNI)
E055-13 Molde cónico de plástico de diámetro 65/75 h 40 mm
(DIN)
E055-11 Molde cónico de bronce de diámetro 80/90 h 40 mm
(BS)
E058
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
E044N
sección E
VICATRONIC • APARATO VICAT AUTOMÁTICO INFORMÁTIZADO DE
GRABACIÓN AUTOMÁTICA Y TROPICALIZADO
NORMAS: EN 196-3:2005 / EN 13279-2 (yeso) / EN 480-2 / ASTM C187, C191 / DIN 1168, 1196 / BS 4550 / UNE 80102
NF P15-414, P15-431 / AASHTO T129, T131
El aparato Vicatronic que está diseñado y fabricado utilizando la tecnología más reciente y sofisticada, se utiliza para la determinación del
tiempo inicial y final de fraguado en los cementos y pastas de mortero.
La unidad se fabrica con componentes “anticorrosión y tropicalizados” para ser utilizados en lugares con humedad no inferior al 90% y
20ºC de temperatura controlada como requieren las especificaciones EN.
Toda el ensayo se realiza de forma totalmente automática y dando un resultado muy preciso y repetible.
Los resultados se imprimen en la impresora incorporada y esto elimina las operaciones manuales de la instalación y puesta a cero del papel
cuadriculado en el tambor.
El uso del aparato está muy simplificado mediante un menú de opciones que está disponible en italiano, inglés, francés, español, alemán,
polaco.
E044-45
284
PANTALLA
La gran pantalla LCD de alto contraste (en negativo azul) tiene una alta resolución y muestra
los datos del ensayo, junto con las funciones
generales del aparato. Se visualiza por primera
vez en tiempo real la gráfica del ensayo (ver
foto), que sustituye y simula la antigua pluma con
el seguimiento en el papel. El aparato dispone de
un reloj calendario que se utiliza para programar
los ciclos de ensayo.
FIRMWARE
E044N
El Vicatronic se suministra con los programas estándar
para realizar de forma automática, todos los ensayos de
acuerdo a las siguientes normas:
EN 196-3:2005 / EN 13279-2 yeso / ASTM C191
DIN 1164 / DIN 1168 yeso / NF P15/431 / BS 4550 / AASHTO T131
El operador puede desarrollar nuevos programas utilizando el menú específico “ensayos libres”, disponible en la base de firmware, el usuario tiene la posibilidad de establecer cinco perfiles de ensayo totalmente libres, definiendo el número de penetraciones y las coordenadas
de cada penetración (raya en mm del círculo en el que tienen que ser distribuidos un número de penetraciones) y el número de círculos.
Esta posibilidad es particularmente útil cuando se ensayan nuevos morteros, aditivos y para realizar ensayos de investigación que requieren
aplicaciones flexibles y sofisticadas.
Perfil 90 penetraciones
instrumentos para ensayos de materiales
ASTM
EN
C EMENTO S – MO RTE ROS
SONDAS
La sonda móvil pesa 300 g (1000 g siguiendo las Normas EN y
NF), la aguja de penetración tiene 1,13 mm de diámetro (1 mm
siguiendo la Norma ASTM) y su caída puede ser programada en
caída libre o en caída guiada. Totalmente flexible en cuanto al tiempo se refiere, el tiempo de penetración se puede seleccionar entre
0,5 minutos y 999 minutos (intervalo fijo entre dos penetraciones
del ensayo) o pueden cambiarse durante el ensayo hasta 5 fases
diferentes, con diferentes intervalos de tiempo; incluso pueden cambiar de forma automática durante el tiempo de fraguado fijando
la profundidad de penetración. Las dos opciones descritas aquí se
pueden combinar entre sí.
La medida de la penetración es leída por un codificador de gran
precisión que una resolución de 0,1 mm.
El Vicatronic también calcula, visualiza e imprime:
- El tiempo transcurrido desde el momento de la preparación de la
muestra (establecido por el operador).
- El tiempo que empiezan los ensayos.
- El tiempo restante para la siguiente penetración.
- El tiempo restante hasta el final del ensayo
- El número de penetraciones realizadas y las penetraciones pendientes.
sección E
TEMPORIZADOR DE 0-999 MINUTOS
El Firmware permite activar un retardo para el inicio del ensayo.
Este programa es particularmente útil cuando el tiempo aproximado de fraguado del mortero es conocido y el operador desea
iniciar el trabajo del “Vicatronic” después de un cierto tiempo
para poder concentrar las penetraciones en un corto intervalo de
tiempo entre ellas y obtener
mejores valores de medida.
RESULTADOS DEL ENSAYO
El Vicatronic puede memorizar
todos los parámetros y resultados de ensayos manteniendo
un archivo con una capacidad de más de 50 ensayos
completos.
En el caso de un corte de
suministro eléctrico, incluso
uno de corta durada, durante
la ejecución del ensayo, este
último se invalida y el equipo
se detendrá automáticamente
manteniendo el conjunto de
datos.
Al final del ensayo el equipo
imprimirá automáticamente,
con la impresora incorporada, un informe con todos
los datos relativos al último
ensayo, incluyendo un gráfico
de seguimiento de cada
penetración con los valores
de tiempo y del número de
penetración (véase el ejemplo
de impresión).
285
EJEMPLO DE IMPRESIÓN
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
sección E
CONEXIONES A PC Y OPCIONES DE RED
Además del funcionamiento totalmente independiente de la
máquina que incorpora una impresora, el Vicatronic está diseñado para ser conectado a un PC (RS232) con la posibilidad de
descargar los datos de ensayo usando un programa general (Hyper
Terminal de Microsoft) que se incorpora habitualmente con el
paquete Windows del PC. En este caso el procesamiento de los
datos debe ser realizado por el operador.
El programa “Vicat-Win” (accesorio mod. E044-11) permite recibir,
gestionar, procesar y completar los datos de ensayo; puede trazar
automáticamente los gráficos, así como personalizar e imprimir el
informe del ensayo.
El Vicatronic ofrece la posibilidad, comprando el Kit “Vicat-Net”
(accesorio E044-12) de conectar hasta 20 equipos en una red, gestionada por un PC a través de dos conectores RJ45 con protocolo
RS485. Esto permite obtener un completo control remoto desde el
PC para cada Vicatronic en particular.
286
Las posibilidades son las siguientes:
- transferir cada control o función del Vicatronic al PC
- verificar en tiempo real cada fase del ensayo en curso
- descargar automáticamente los resultados finales al término del
ensayo de todos los Vicatronics conectados
- procesar y archivar al mismo tiempo todos los ensayos sin necesidad de que el operador se mueva de su sitio de trabajo.
Adicionalmente el Firmware tiene muchas otras funciones detalladas en la documentación técnica que puede facilitarse al usuario
interesado en conocer más sobre ello.
El Vicatronic se entrega completo con impresora incorporada, dos
agujas (una de 1mm de diámetro y la otra de 1,13 mm de diámetro), dos moldes cónicos EN y ASTM, y una pletina de vidrio para
sostener los moldes cónicos.
Alimentación: 230 monofásica 50Hz, 50W
Dimensiones: 400x200x altura 470 mm
Peso: 13 kg
E044-03N
VICATRONIC, idéntico al mod. E044N, pero con posibilidad de
penetraciones continuas cada 15 segundos.
ACCESORIOS:
E044-11 Programa “VICAT-WIN” completo con cable de
conexión de 3 metros que permite a través del puerto
RS232 la descarga, procesamiento, impresión y gestión
de todos los datos directamente desde el PC.
E044-12 Kit “VICAT-NET” para conectar hasta 20 Vicatronic en una
red por medio de dos conectores RS 485 gestionados por
un PC. El kit incluye: el software, el convertidor RS232/485
y el cable para la conexión de “un dispositivo” para la
conexión a la red de Vicatronics adicionales (hasta máx. 20);
ver el accesorio más abajo mod E044-13.
E044-13
Kit completo con el cable serie para la conexión RS 485 de 5
metros de largo, para conectar un Vicatronic al PC y en red (cables
de distintas longitudes pueden estar disponibles bajo demanda).
instrumentos para ensayos de materiales
C EMENTO S – MO RTE ROS
La unidad E044-25 es también un baño de agua de uso general en
el laboratorio con rango de temperatura de la habitación a
35 ºC ±1 ºC.
Alimentación: 230V 50Hz 1050W monofásica
Dimensiones: 375x335x420 mm
Peso: 12 kg
sección E
E043
E043
TANQUE DE MOLDE para
ensayar las muestras sumergidas
en agua. El ensayo debe llevarse a
cabo en una sala con una temperatura controlada de 20 °C ± 1 °C.
La humedad saturada se obtiene
mediante la inmersión en el agua
de la muestra según requerimientos de la Norma EN 196-3.
E044-20 + E044N + E043
E044-25 + E044 N + E043
Ensayo de yeso: EN 13279-2 / DIN 1168
E044-20
SISTEMA DE ENFRIAMIENTO Y
CALEFACCION CONTROLADO TERMOSTATICAMENTE
El dispositivo produce agua a una temperatura controlada de 20 ºC
±1 ºC que es recirculada en el tanque E043 para realizar el ensayo
a temperatura y humedad controladas, según lo requerido por la
Norma EN 196-3. Puede utilizarse con un único Vicatronic.
Alimentación: 230V 50Hz 1150W monofásica
Dimensiones: 300x440x650 mm. Peso: 31 kg
E044-21
SISTEMA DE ENFRIAMIENTO Y CALEFACCION CONTROLADO TERMOSTATICAMENTE
Igual que el mod. E044-20 pero que puede ser usado simultáneamente por “DOS” Vicatronics.
E044-30
E044-30
DISPOSITIVO DE LIMPIEZA DE
AGUJAS
Elimina las partículas residuales de
cemento de las agujas manteniéndolas constantemente lubricadas.
E044-25
SISTEMA DE CALEFACCIÓN CONTROLADO TÉRMICAMENTE
CON SERPENTÍN DE REFRIGERACIÓN
El aparato calienta el agua desde la temperatura ambiente
hasta los 20 ± 0,1 °C.
La unidad consta de un baño de agua de acero inoxidable de10
litros de capacidad con aislamiento de lana, calentador eléctrico con
termostato digital, bomba motorizada, entrada / salida del sistema
para hacer circular el agua en el tanque E043, un dispositivo de
refrigeración que funciona con circulación de agua corriente, para
mantener una temperatura constante en el baño de 20 °C cuando
la temperatura ambiente es ligeramente superior.
E044-40 N
AGUJA DE PENETRACIÓN CÓNICA, de
8 mm de diámetro y 50 mm de largo, para
hacer ensayos de yeso de acuerdo con las
especificaciones EN, DIN.
E044-41 N
SONDA 100 g, para hacer ensayos en yeso
siguiendo las especificaciones EN, DIN.
287
E044-40 N
E042-02N Émbolo de consistencia de diámetro 10x50 mm
E042N
Aguja para el final del fraguado de 1,13 mm de diámetro,
BS, EN 196-3:2005
E042-01N Aguja para el final del fraguado de 1 mm diámetro, ASTM.
E044-45 Pesa adicional de 700 g de peso (EN, NF)
E055-04 Molde de plástico de Ø 80/90 x 40 mm de alto según UNI
E055-11 Molde de bronce de Ø 80/90 x 40 mm de alto según BS
E055-13 Molde de plástico de Ø 65/75 x 40 mm de alto según DIN
ACCESORIOS Y RECAMBIOS PARA E044N
RECAMBIOS:
E046N
Aguja endurecida de 1,13 mm Ø (EN 196-3:2005)
E046-01N Aguja endurecida de 1 mm Ø (ASTM)
E055-05 Molde de plástico de Ø 60/70 x 40 mm de alto según ASTM
E055-07 Placa base de cristal
E055-10 Molde de plástico Ø 70/80 x 40 mm de alto según EN, NF
E042-06N Sonda de 300 g con la norma EN 196-3:2005
E044-48N Lengüeta para fijar la aguja a la sonda
C127-11 Rollo de papel térmico para impresora (paquete de 10rollos)
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
TIEMPO DE FRAGUADO
Y CONSISTENCIA DEL CEMENTO
E050
sección E
Penetrómetro automático con registro
“modelo Italcementi”*
288
Usado para determinar los tiempos inicial y final de fraguado de los
conglomerantes hidráulicos.
El instrumento mide y registra automáticamente el tiempo que
necesita una pasta de cemento para alcanzar un grado de consistencia preestablecido.
El fraguado de la muestra se mide en condiciones estáticas de
forma automática y continuamente registrado en un diagrama,
permitiendo la determinación precisa y uniforme de los tiempos
inicial, intermedio y final del proceso de endurecimiento.
El operador obtiene un gráfico con los resultados de cada muestra
ensayada, mostrando con precisión el incremento de la relación
consistencia-tiempo (consistograma).
El instrumento para automáticamente al final del ensayo.
* NOTA:
El penetrómetro se ha fabricado expresamente por una petición
específica de las fábricas de cemento del “Grupo Italcementi”.
PÉRDIDAS DURANTE LA IGNICIÓN DEL CEMENTO Y LA
CAL DE EDIFICACIÓN Y CONTENIDO DE CLORUROS
DIÓXIDO DE CARBONO Y ALCALIS EN EL CEMENTO
NORMAS: EN 196-2 / EN 196-21 / EN 459-2
Se utiliza un horno de mufla para
oxidar la muestra en aire
a 975 ± 25 ºC.
Detalles técnicos:
ver mod. A024, pág. 28
sección Áridos.
E059
Embudo con canaleta
A024
CONSISTÉNCIA DE LECHADAS
NORMAS: EN 13395-2 / UNI 8997
Se utiliza para determinar la consistencia de morteros de cemento
expansivos premezclados para anclajes, mezclados con agua, clasificados como tipo superfluido. Se suministra completo.
Peso: 20 kg
E059
EL PENETRÓMETRO SE ENTREGA COMPLETO CON:
• dos agujas de penetración
• dos moldes de plástico de diá. 70/80 y 40 mm de altura completos con su base y collar de humedad
• dos plumas de escritura
• 100 impresos/diagrama para registro
Alimentación: 230V 50 Hz 100W monofásica
Dimensiones: 450x185x370 mm
Peso: 22 kg
E060
E060-01
E060-03
E050
instrumentos para ensayos de materiales
DETERMINACION DE LA EXPANSION
LIBRE EN EL PERIODO PLASTICO,
Y DE LA CANTIDAD DE AGUA DE
MEZCLA EXUDADA durante la expansión
de los morteros premezclados para anclaje,
mezclas con agua.
NORMAS: UNI 8996, 8998
El equipo consiste en:
E060
Puente de doble medida, formado
por una regla de acero de sección
cuadrada con dos tornillos de
medida ajustables.
E060-01 Calibre fijo con dos posiciones con
altura de 100 y 107 mm.
E060-03 Recipiente metálico diá. 99x120 mm
de altura con 3 tapas herméticas.
C EMENTO S – MO RTE ROS
E061N
CALORÍMETRO
ACCESORIOS “NECESARIOS”:
E062-02
TERMÓMETRO DE MERCURIO BECKMAN, centesimal en vidrio, o:
E062-04
TERMÓMETRO DIGITAL. Resolución: 0,01 °C
Completo con sonda, o bien:
E062-04N
TERMÓMETRO DIGITAL. Resolución: 0,001 °C
- Memoria para 10.000 lecturas
- Muestra, almacena e imprime: min, máx., valores
medios, incrementos de T
- Alarma si se sobrepasan los valores límite
- Funciona con pilas
E062-04N
E061-11
Hélice, conforme a ASTM C186
Especificaciones, o:
E061-12
Hélice, conforme a EN 196-8
Especificaciones.
ACCESORIOS:
V300-19
Cera de parafina con punto
de fusión 55 °C para cubrir las
piezas de vidrio que están en
contacto con el ácido fluorhídrico.
Paquete de 5000g
E061-12
E062-02
E061N ABIERTO
sección E
CALOR DE HIDRATACIÓN DEL CEMENTO
NORMAS: EN 196-8 / ASTM C186
Comparable a : UNI 7208 / DIN 1164,
UNE 80102, 7105 / BS 4550, 1370
Se utiliza para determinar el calor de hidratación del Portland de
bajo calor y del cemento hidráulico.
El aparato consiste en un frasco Dewar incluido en un material
aislante y alojado en una caja de madera articulada para que el
frasco pueda ser fácilmente removido o sustituido.
Una “segunda” caja de madera con bisagras contiene a la primera,
garantizando un mejor aislamiento, como solicita de forma explícita
por las normativas aplicables.
El calorímetro se suministra completo con un agitador eléctrico de
velocidad constante, embudo de llenado de vidrio.
El suministro estándar “no incluye”:
- el termómetro (a elegir entre Beckman o modelo digital; ver
accesorios)
- la hélice (seleccionándolo de la norma específica; ver accesorios)
que deben pedirse por separado.
Alimentación: 230V 50Hz 150W monofásica
Dimensiones: 350x250xh 680 mm
Peso: 12 kg aprox.
289
RECAMBIOS:
E062-01 Frasco Dewar
E062-03 Embudo de cristal para rellenar
E062-10
Calorímetro Langavant
NORMA: EN 196-9
Se utiliza para medir el calor de hidratación de los cementos
mediante un método semi-adiabático.
El equipo consta de:
Equipo de medida de la calorimetría, calibrado, de diámetro 160 x
320 mm
Calorímetro de referencia (igual que el de medida)
50 cajas de mortero y 20 sacos de arena.
Sistema de medición completo con dos sondas de temperatura, un
módem, software para grabar la temperatura, analizar y mostrar los
datos mediante modem de transmisión inalámbrica.
Para realizar el ensayo se requiere un PC.
E062-10
E061-11
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
E070
sección E
Autoclave
PARA EL ENSAYO ESTABILIDAD DE VOLUMEN (EXPANSIÓN)
DEL CEMENTO PORTLAND
NORMAS: ASTM C151, C490 / UNE 7207
Se compone de una caldera de alta presión de una aleación
especial de acero, con un diámetro interno de 154 mm x 430 mm
de alto, capaz de albergar 10 muestras de cemento. El sistema de
calefacción se consigue mediante resistencias eléctricas.
El panel de control separado incluye un “termómetro digital”
para visualizar la temperatura de la caldera, manómetro con escala
0-600 psi con función de regulador de presión e interruptores de
potencia.
Se suministra completo con bastidor para alojar las muestras y
válvula de seguridad con certificado de calibración ISPEL. No vendibles en el mercado de la CE.
TERMÓMETRO DIGITAL
Alimentación:
230V monofásica 50Hz 3500W 295 psi
Dimensiones: 450x475x1080 mm
Peso: 75 kg
MOLDES DE ESTABILIDAD DE VOLUMEN (EXPANSIÓN) Y ENSAYOS DE
RETRACCIÓN (con el comparador de longitud E077 KIT)
Modelos disponibles:
E072
NORMA: ASTM C490
CONJUNTO DE DOS MOLDES PRISMÁTICOS para
realizar probetas de 25x25x250 mm para los ensayos
de expansión en autoclave. Completo con cuatro
inserciones de acero. Peso: 6 kg
E073
NORMA: BS 1881, 6073
CONJUNTO DE DOS MOLDES PRISMÁTICOS para
realizar probetas de 75x75x254 mm. Completo con
cuatro inserciones de acero. Peso: 9 kg
E072-01 PUNTOS DE CONTACTO de acero inoxidable, de
repuesto para los moldes E072 y E073. Paquete de 10
piezas.
E073
290
E072
E075
E072-01
Conjunto de tres moldes prismáticos,
para realizar probetas de mortero de
40,1x40x160 mm
Cesto para alojar
las muestras
E070
NORMA: EN 12617-4
Comparable a: ASTM C348, NF P15-433
Se utiliza para la determinación de la retracción lineal del mortero
de cemento. Fabricado en acero con una dureza de más de 200 HV.
Todas las superficies están esmeriladas y todas las partes están marcadas, con un número de identificación para un correcto montaje.
Un número de serie está grabado en cada molde y junto con él se
suministra un Certificado de Conformidad.
Completo con 6 inserciones de acero y tornillos de fijación.
Peso: 8,600 kg
RECAMBIO:
E075-01 PUNTOS DE CONTACTO acero inoxidable, con
tornillo de fijación. Paquete de 12 piezas.
ACCESORIOS:
E075-10
NORMA: EN 12808-4
ESPACIADORES de teflón, las dimensiones de
15x40x160mm para ponerlos en la cámara del
molde E075, para confeccionar muestras de
10x40x160 mm para los ensayos de retracción.
Paquete de 6 piezas.
E075
E075-01
instrumentos para ensayos de materiales
E075-11
INSERCIONES, para las muestras de 10x40x160 mm.
NORMA: EN 12808-4
Paquete de 12 inserciones.
C EMENTO S – MO RTE ROS
E107
E075 con E075-10
sección E
E113
E107-01
E107
NORMAS: NF P15-433 / DIN 1164
CONJUNTO DE TRES MOLDES PRISMÁTICOS para confeccionar
muestras de 40x40x160 mm. Hecho en acero de dureza 55 HRB.
Completo con 6 inserciones. Peso: 8 kg
E113
NORMA: NF P18-427
CONJUNTO DE TRES MOLDES PRISMÁTICOS para confeccionar
muestras de 70x70x280 mm. Hecho en acero de dureza 55 HRB.
Completo con 6 inserciones. Peso: 17 kg
E075-10
E078 KIT + E078-04
E077 KIT + E078-01
E107-01
Puntos de contacto, de repuesto para E107 y E113 moldes.
Paquete de 12 piezas.
Comparador de Longitud
NORMAS: EN 12617-4, 1367-4, 12808-4 / ASTM C151, C490,
NF P15-433, P18-427 / BS 1881:5, 6073 / DIN 1164
Se utiliza para medir las variaciones de longitud de las muestras de
mortero después de los ensayos de expansión en autoclave. La viga
superior se puede ajustar para adaptarse a la longitud de la muestra. También mide la retracción lineal de muestras con diferentes
dimensiones como:
40x40x160 mm UNI EN 12617-4, UNI EN 12808-4, ASTM C348,
UNI 6687, NF P15-433, DIN 1164
25x25x250 mm
ASTM C490
70,7x70,7x282,8 mm NF P18-427
75x75x254 mm
BS 1881, 6073
50x50x200 mm
EN 1367-04
Suministrados “sin varilla de calibración” (ver accesorios)
Dimensiones: diámetro 180 x 450 mm
Peso: 10 kg
MODELOS DISPONIBLES:
E077 KIT
COMPARADOR DE LONGITUD con reloj indicador analógico, 5
mm de recorrido por 0,001 mm divisiones, mod. S375
Como alternativa:
E078 KIT
COMPARADOR DE LONGITUD con indicador digital de 12 mm
de desplazamiento por 0,001 mm mod. S382-01, con batería y
conexión RS232 a PC.
ACCESORIOS para E078KIT:
S382-11 Cable de conexión mod. S382-01 para PC
S382-12 SOFTWARE para S382-01
E078-04
E078-01
ACCESORIOS para E077 KIT y E078 KIT:
E078-04 Varilla de calibración, Invar, para probetas de 40x40x160mm
Normas: EN 12617-4, EN 12808-4, NF P15-433
E078-01 Varilla de calibración, Invar, para probetas de
25x25x250mm y 75x75x254mm.
Normas: ASTM C490, BS 1881, UNI 8520
E078-03 Varilla de calibración, Invar, para probetas de 70x70x280 mm.
Norma: NF P18-427
E078-06 Varilla de calibración, Invar, para probetas de 50x50x200 mm
Norma: EN 1367-04
instrumentos para ensayos de materiales
291
CEM E N TOS – M O RT E RO S
ESTABILIDAD DE VOLUMEN EN
CEMENTOS Y CALES
E065
NORMAS: EN 196-3 / EN ISO 9597 / BS 6463 / NF P15-432
UNE 80102
E064
Similar al mod. E066 pero con los punteros mayores garantizando
un mayor número de utilizaciones del ensayo (alrededor de 10
veces más) dentro de la tolerancias pedidas por la Norma EN.
“Acabado Cromado”
Las pinzas se comprueban de una en una y llevan grabadas su
número de serie, para una fácil identificación de cada pinza, y
cumplen perfectamente la Norma EN.
Pinza Le Chatelier verificada individualmente
sección E
Baño de agua de le Chatelier
Cámara construida de acero inoxidable y carcasa exterior en chapa
de acero pintado, con capacidad para 12 moldes de Le Chatelier
(a pedir por separado) en el chasis extraíble, suministrado con el
baño.
El baño alcanza el punto de ebullición en aprox. 30 minutos. Ahora,
un dispositivo original mantiene la temperatura del baño en el
punto de ebullición, al evitar la evaporación del agua y asegurar que
los moldes de Le Chatelier quedan cubiertos por el agua durante
toda la ejecución del ensayo.
Alimentación: 230V monofásica 50/60Hz 1800W
Dimensiones: 405x265x205 mm
Peso: 7 kg
E066-01
Platinas de vidrio de 50x50 mm para cubrir la pinza. Paquete de
dos piezas. Se necesitan 2 platinas cada molde..
E066-02
Peso de 100 g para ser colocado sobre la platina de vidrio que se
apoya sobre la cabeza cilindrica del molde.
E066-03
Medidor de la extensibilidad de la pinza Le Chatelier.
E066-04
VARILLA DE COMPACTACIÓN 17 mm de diámetro.
Peso: 70 g.
292
E064 junto
con E065
Detalle: chasis con E065
E066-03
E066
Pinza Le Chatelier
Construida en latón elástico como un cilindro partido de día. interno 30 mm y 30 mm de alto, con dos punteros de 150 mm de largo.
“Acabado Cromado”
Usada para determinar la expansión (estabilidad del volumen) del
cemento tanto en agua fría como hirviendo.
Peso: 30 g
E066-02
E066-04
E066-01
E082
Patrones de ensayo
E065
E066
instrumentos para ensayos de materiales
EXPANSIÓN DE CALES HIDRATADAS Y YESOS
NORMAS: EN 459-1 / BS 890, 1191
Utilizados para la determinación de la expansión de la cal hidratada,
yeso y escayolas de construcción. Consiste en un molde en forma
de anillo de bronce de 100
mm diámetro por 5 mm
de profundidad.
El molde tiene una inclinación interior de 5°.
Se suministra completo
E082
con placa base de vidrio.
Para llevar a cabo un ensayo son necesarios tres moldes.
C EMENTO S – MO RTE ROS
E083
Penetrómetro de consistencia
CONSISTENCIA DEL CEMENTO DE ALBAÑILERÍA Y CALES PARA LA EDIFICACIÓN
NORMAS: EN 413-2, 459-2, 1015-4
DIN 4211
Se utiliza para determinar la consistencia de mortero fresco, cal y cemento
de albañilería. La base está provista de
un dispositivo para ubicar el recipiente
de ensayo.
La altura de caída puede ajustarse
exactamente a 100 mm.
Se suministra completo con el recipiente de ensayos y el pisón, ambos
realizados en aluminio anodizado.
Dimensiones: 200x200x700 mm
Peso: 8 kg
E082-11
RECIPIENTE DE ENSAYO CIRCULAR
NORMA: EN 1015-19
Se utiliza para determinar la permeabilidad al vapor de agua del
revoco endurecido y morteros de revestimiento.
Fabricado en material de PVC, resistente a la corrosión, tiene una
apertura de aprox. 0,02 m2, en el que se encierra la muestra.
Dimensiones: diá. 240 mm por 60 mm
Peso: 1 kg aprox.
E082-11
sección E
Métodos de ensayo de los morteros para
albañilería
E081-10
Baño de vapor
E083
E081
Aparato para medir
la trabajabilidad de los morteros
NORMAS: EN 413-2 / NF P18-452
Diseñado para probar la trabajabilidad dinámica en morteros de
cemento y también para asegurar la dosificación óptima de los
componentes de mortero (arena, agua, cemento, así como ratios
de cemento/arena y agua/cemento) compatible con una aplicación
dada. Apto también para el control de posibles mejoras en mezclar
un plastificante, o para comparar dos tipos de mortero. La unidad
consta de un receptor prismático dividido en dos volúmenes desiguales por una separación extraíble, y por un vibrador eléctrico.
El mortero fresco se vierte en el habitáculo de mayor volumen, el
separador se extrae y el vibrador arranca automáticamente. Como
resultado de las vibraciones, el mortero fluye del volumen grande al
volumen pequeño, en un tiempo que es función de la trabajabilidad
del mortero. Alimentación: 230V monofásica 50Hz 110W
Dimensiones: 400x200x200 mm
Peso: 18 kg
ESTABILIDAD DE VOLUMEN EN CALES DE EDIFICACIÓN
NORMA: EN 459-2
Este baño se utiliza para determinar la solidez de la construcción de
cales sometidas a la acción de vapor a presión atmosférica durante
un tiempo de 180 minutos. El baño de vapor está realizado todo
de acero inoxidable, con capacidad para 12 moldes Le Chatelier,
aproximadamente 50 mm sobre el nivel del agua. Dos resistencias
de 1200W y 200W permiten alcanzar el punto de ebullición del
agua en 30 minutos, y posteriormente un temporizador desconecta
la resistencia de 1200W, y la temperatura del agua se mantiene por
el segundo elemento, según lo solicitado por la Norma.
La cubierta cuenta con un dispositivo para evitar que el agua
condensada caiga sobre las muestras.
Alimentación: 230V 50/60Hz monofásica 1400W
Dimensiones exteriores: 455x215xh350 mm
Dimensiones interiores: 300x150xh260 mm
Peso: 9 kg aprox.
ACCESORIOS:
E066
MOLDE LE CHATELIER detalles técnicos: ver pág. 292
E066-01 PLACAS DE VIDRIO de 50x50 mm. Paquete de 2 piezas.
E066-02 PESO 100 g.
E066-03 EQUIPO para la medida de la extensibilidad del molde
Le Chatelier.
E066-04 VARILLA DE COMPACTACIÓN, 17 mm de diámetro x
70 g de peso.
E081
E082-01
Retención de agua
NORMAS: EN 413-2
Molde de latón cromado con
dia.100 mm por 25 mm de
profundidad, se utiliza para determinar la retención de agua en los
cementos de albañilería.
Peso: 300 g aprox.
E082-01
E081-10
instrumentos para ensayos de materiales
293
CEM E N TOS – M O RT E RO S
Productos y sistemas para la protección y
reparación de estructuras de hormigón.
Determinación del tiempo de endurecimiento
NORMA: EN 13294
sección E
Métodos de ensayo de los morteros para
albañilería. Determinación del tiempo de
trabajabilidad y corrección del tiempo en el
mortero fresco
NORMA: EN 1015-9
E083-10
E067-05
Conteiner de barras de mortero
NORME: UNI 8520:22 / ASTM C227
Este método de ensayo trata sobre la determinación de la potencial reactividad a los álcalis de los áridos con sílice para establecer si
pueden ser utilizados en la preparación del
hormigón. El dispositivo está compuesto
por un recipiente cilíndrico acrílico con
una rejilla de acero inoxidable.
Dimensiones: 170 mm de diá. x 450 mm
Peso: 3 kg aprox.
Soporte de palanca (tipo soporte de taladro), con
arandela y varilla de latón para penetración,
pinza y soporte de bloqueo.
Se utiliza para la determinación del tiempo
de endurecimiento en sistemas y productos
para la protección y reparación de estructuras
de hormigón. Completo con envase.
Dimensiones: 380x300xh 500 mm
Peso: 12 kg aprox.
MUESTRAS
E067-05
AGUA
E080
Extensómetro para expansión de yesos
294
RECAMBIO:
E083-11
RECIPIENTE, de aluminio rígido,
día. 90 por 60 mm de altura,
completo con tapa.
E083-11
E083-10
ACCESORIOS:
V075-12
BALANZA DIGITAL, 15
kg de capacidad y 0,5 g
división, con tara.
V075-12
E080
E083-10
E083-11
E067
Molde para ensayo de fisuración
NORMA: NF P15-434
Se utiliza para medir el tiempo
de formación de una grieta
en la probeta de conglomerantes
hidráulicos.
E067
Peso: 8 kg
instrumentos para ensayos de materiales
NORMAS: UNI 6782 / BS 1191
Utilizado para medir la expansión lineal de una pasta de consistencia estándar.
El extensómetro comprende un contenedor horizontal en “V” de
100 mm de largo por 60 mm de ancho por 25mm de profundidad,
cerrado por un lado y abierto por el otro.
El lado abierto está en contacto con la punta de un comparador
de modo que puede medirse la expansión lateral de la muestra. El
comparador tiene 10 mm de carrera y graduaciones de 0,01mm.
Dimensiones: 250x80x80mm
Peso: 3 kg
A105
Calcímetro (Gasómetro) de Dietrich-Frühling
CONTENIDO DE CARBONATOS CaCo3 EN LAS CALIZAS Y MARGAS
Consiste principalmente en un recipiente de vidrio en el que
tiene lugar la reacción entre el
carbonato de calcio presente
en el producto y una solución
de ácido clorhídrico.
El producto resultante se recoge en forma de gas y se mide
por un dispositivo conectado
en el contenedor.
Debido a que el volumen de
gas (CO2) producido está en
relación directa a la cantidad de
CaCo2 presente en el material,
es posible calcular el porcentaje
de CaCo3.
Dimensiones: 400x200x1100 mm.
Peso: 13 kg
A105
C EMENTO S – MO RTE ROS
PARA LOS ENSAYOS DE FLUJO Y TRABAJABILIDAD EN MORTEROS Y CALES
NORMAS: EN 459-2, EN 1015-3 / ASTM C230 / BS 4551-1
Para realizar este ensayo, la muestra contenida en un molde cónico, se coloca en una superficie metálica que se levanta y se deja caer desde
una altura conocida, después del desmoldar la muestra.
El equipo consta de una mesa circular con husillo, trípode, molde de flujo de bronce y pisón. Los equipos de las normas EN están también
provistos de una tolva de llenado. Los modelos motorizados poseen un contador automático digital.
Las mesas de sacudidas mod. E090 KIT y E090-01 KIT cumplen las especificaciones de las Normas EN 459-2 y EN 1015-3.
Alimentación (modelos con motor): 230V monofásica 50Hz 150W
Peso: 25 ÷ 60 kg
E090-01 KIT
sección E
MESA DE SACUDIDAS
E090 KIT
295
ACCESORIOS:
E087-01
CALIBRE según normas ASTM y BS, para
medir el diámetro de la muestra. Hecho de
latón.
Peso: 450 g.
E087 KIT
E086 KIT
E087-01
E090-08
RECAMBIO:
E090-08
CALIBRE según especificaciones de las normas EN 459-2 y
EN 1015-3.
Modelo
Norma
E086 KIT
ASTM C230
BS4551
E087 KIT
ASTM C230
BS 4551
E090 KIT
EN 459-2
EN 1015-3
E090-01 KIT EN 459-2
EN 1015-3
Accionamiento
Manual Motorizado
•
•
•
•
E085-07
TOLVA DE LLENADO de los moldes.
Norma: EN 459-2.
Mesa
diá. mm
Altura
de caída mm
Molde de
repuesto
Pisón de
repuesto
254
12,7
E087-05
E087-06
254
12,7
E087-05
E087-06
300
10
E085-05
E085-06
300
10
E085-05
E085-06
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
E094
NORMAS: EN 196-1, EN 196-3:2005, EN 413-2, EN 459-2, EN 480-1
EN-ISO 679 / NF P15-314 / DIN 1164-5
UNE 80801, 83258 / ASTM C305
AASHTO T162
Amasadora de mortero
sección E
AMASADORAS DE MORTEROS
Básicamente similar al mod. E093 pero no está equipada con el
programa automático, dispensador de arena ni puerta de seguridad.
Esta amasadora puede ser suministrada únicamente a mercados
externos a la CE.
Pueden seleccionarse dos velocidades. Entregada completa con
recipiente de acero inoxidable, pero “sin pala batidora” que debe
ser pedida por separado.
Dimensiones:
340x460x500 mm.
Peso: 40 kg
296
E094
MODELOS
DISPONIBLES:
E093
E095
Amasadora automática de morteros
Amasadora de mortero
Esta amasadora, verdaderamente robusta está diseñada expresamente para un mezclado eficiente de pastas de cemento y
mortero, con “tres” secuencias automáticas de ciclo de mezcla, de
acuerdo con las especificaciones de las normas:
EN 196-1, EN 196-3:2005, EN 480-1.
Recipiente de 4,7 litros de capacidad
Pueden seleccionarse dos velocidades:
140 ó 285 rpm para la acción giratoria
62 ó 125 rpm para la acción planetaria
Es posible seleccionar la forma de trabajo manual, o uno de los
dos programas automáticos.La operación automática cambia las
velocidades, paradas y secuencias de mezcla, indicando mediante
una señal acústica las diferentes fases del ciclo de mezclado.
La unidad está equipada con un dispensador automático de arena,
que vierte arena en el recipiente durante un período de 30 segundos (solo en el programa EN 196-1). Se suministra con puerta
de seguridad de acuerdo a la directiva de seguridad CE: si se abre,
automáticamente se detiene la máquina.
Se suministra completa con plato de acero inoxidable, pero “sin
pala batidora” que tiene que pedirse por separado (ver modelos
E095-03 o E095-04).
Alimentación: 230V monofásica 50Hz
Dimensiones: 340x460x700 mm
Peso: 45 kg
Básicamente similar al mod. E094 pero complementada con el
dispensador de arena y la puerta de seguridad según las directivas
de seguridad de la CE.
Pueden seleccionarse dos velocidades. Entregada completa con
recipiente de acero inoxidable pero “sin pala batidora” que debe
ser pedida por separado.
Dimensiones: 340x460x500 mm
Peso: 44 kg
instrumentos para ensayos de materiales
E093 + E095-03
E095
C EMENTO S – MO RTE ROS
E092 KIT
MIXMATIC “ALTO RENDIMIENTO”
AMASADORA AUTOMÁTICA
PROGRAMABLE DE MORTEROS
NORMAS: EN 196-1, EN 196-3:2005, EN 413-2, EN 459-2, EN 480-1
NF P15-314 / EN ISO 679 / DIN 1164-5, DIN 1164-7
ASTM C305 / AASHTO T162
sección E
ACCESORIOS PARA LAS AMASADORAS E093, E094, E095:
E095-03 Pala batidora de acero inoxidable con conexión de bayoneta.
E095-04 Pala batidora de acero inoxidable con conexión de
bayoneta. La pala está perfectamente pulida para eliminar las porosidades.
E096-01 Dispensador con tolva, para facilitar la introducción
manual de agua, aditivos, etc. en el recipiente, también
durante la fase de mezcla. Accesorio para las amasadoras mod. E093 y E095.
E096-01
297
E097-01N Arena de referencia, tamaño de 0,08 ÷ 2 mm según
Norma EN 196-1.
Bolsa de 1350 g. Paquete de 16 bolsas con un total de
21,6 kg.
RECAMBIOS PARA LAS AMASADORAS E093, E094, E095:
E095-01 Recipiente de acero inoxidable
E095-05 Acoplamiento de bayoneta entre la pala batidora y el eje
E097-01
E095-01
E095-03
E095-05
E095-04
E092
Diseño:
- muy robusto y resistente, ideal para uso intensivo en laboratorio.
- transmisión planetaria silenciosa y de bajo mantenimiento.
- dispensador automático de arena, con unas dimensiones y geometría que aseguran la correcta inserción de la arena sin residuos
ni segregaciones de las partes finas y gruesas.
- dispensador de aditivos (ver accesorio mod. E092-05).
- dispensador para la adición automática de agua
(ver mod. E092-06).
- protección transparente en la zona de mezclado, de acuerdo a la
directiva CE, permitiendo la inspección visual de la mezcla durante el ensayo y para verificar la velocidad de rotación a través de
un contador digital de revoluciones.
- completa con pala batidora de acero inoxidable pulido y recipiente para mezclar
- rápida y fácil introducción i extracción del recipiente.
- sistema de seguridad de presencia y posición correcta del recipiente, para evitar accidentes de trabajo, con doble sensor de
discriminación secuencial de carga / descarga del recipiente.
...sigue en la página siguiente...
instrumentos para ensayos de materiales
sección E
CEM E N TOS – M O RT E RO S
E092 KIT MIXMATIC...continuación...
ACCESORIOS:
Firmware:
- diferentes programas de mezclado automático con ciclos conformes a las normativas aplicables.
- el operador también puede programar hasta 5 ciclos automáticos
de mezclado personalizados a través de PC.
- señales acústicas sincronizadas con las etapas del ciclo.
- pantalla de LCD grande, de alta resolución y contraste (negativo
azul) que permite visualizar el estado de las diferentes funciones.
- motor de rotación alimentado a través de un inversor para garantizar la máxima precisión en la velocidad de giro, ajustable por el
operador a través de la pantalla.
- posibilidad de ciclo de mezclado manual.
- posibilidad de almacenar hasta 100 ensayos y transferir los datos
a través de RS 232 al PC.
E092-05
DISPENSADOR (suplementario) con tolva para facilitar la
introducción manual de aditivos
etc. en el recipiente, también
durante la fase de mezcla.
E092-06
DISPENSADOR (suplementario) con tolva para la introducción
automática (gestionado por el software) de agua en el recipiente,
también durante la fase de mezcla.
RECAMBIOS:
E092-10
RECIPIENTE de acero inoxidable de 4,75
litros de capacidad.
298
E095-04
PALA BATIDORA de acero inoxidable
pulido.
- posibilidad de seleccionar diferentes idiomas.
- indicación detallada de todos los tiempos (transcurrido desde el
inicio de los ensayos, residual para terminar el ensayo, contados
desde el termino del ensayo hasta la extracción del recipiente),
estado del desarrollo del ciclo con barras análogas, velocidad,
fase activa (arena, agua), estado del ensayo (correcta ejecución o
interrupción de la prueba con los resultados de pérdida), el tipo
de prueba actual.
Alimentación: 230V 50Hz monofásica
Dimensiones: 530x620xh 780 mm. Peso: 85 kg
EJEMPLOS DE USO
instrumentos para ensayos de materiales
E092-05
E092-06
sección E
C EMENTO S – MO RTE ROS
299
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
E142
sección E
EQUIPO DE ADHERENCIA A TRACCIÓN DIGITAL “PULL-OFF” (BOND),
CAPACIDAD: 16 kN
300
NORMAS: EN 1542, EN 1348, EN 1015-12, EN 13687-2, EN 13963, EN 14496 / NF P18-858 / BS 1881:207 / ISO 4624
Este dinamómetro mide la fuerza de adherencia y la resistencia a la tracción de dos capas de materiales (hormigón, yesos de enlucido, morteros, yesos de construcción, cales, etc.) y es particularmente adecuado para aplicaciones relativas a las reparaciones de cualquier estructura
en la que la fuerza de adhesión entre dos capas es un factor esencial.
Compacto, ligero, de uso en cualquier lugar, este equipo de adherencia Pull-Off está equipado con una célula de carga y una pantalla digital
de alta resolución, por lo que es adecuado para mediciones desde baja carga hasta 16 kN, garantizando una amplia gama de trabajo, ideal
para un gran número de aplicaciones y materiales.
La fuerza de tracción directa se aplica al girar la manivela de mano.
Los tres pies de la unidad se puede fijar en la posición “larga” (dimensiones 176 mm de diámetro, ver el dibujo “A”) con un soporte muy
estable, o en la posición “corta” (dimensiones 92,5 mm de diámetro, ver el dibujo “B”), para realizar ensayos en espacios reducidos, o para
muestras que están muy cerca unas de otras.
Especificaciones:
- Capacidad de carga: 16 kN
- Resolución: 10 N
- Rango de trabajo: de 0,25 a 16 kN
- Precisión y repetibilidad: mejor que ±1%
- Completo con certificado de calibración trazable
- Funciona con pilas
- Puerto serie para conexión a PC
- Giros con la manivela de mano: 60 con cuentavueltas
mecánico
- Indicación gráfica de la tasa de carga aplicada
- Rótula para asegurar la aplicación de la carga axial / central
Se suministra completo con maletín de transporte, pero “SIN”
accesorios para realizar el ensayo, que tienen que pedirse por
separado.
Para la realización del ensayo se precisa de un taladro
eléctrico común.
Dimensiones: 410x210xh 270 mm
Peso: 3,5 kg aprox.
E142-01 Equipo de Pull-Off “Digital”
de 0-5 kN de capacidad
Idéntico al mod. E142, pero con célula de carga y pantalla digital con rango de 0-5 kN para mediciones más
precisas en los valores de baja resistencia.
E142 en maleta de aluminio
instrumentos para ensayos de materiales
E142
con las patas en
su posición larga
Dibujo A
C EMENTO S – MO RTE ROS
sección E
E142
con las patas en la posición
corta
301
Dibujo B
ACCESORIOS:
E142-10 SOFTWARE para descargar los resultados al PC
E143
Discos de aluminio para adherir de 20 mm de diámetro
por 20 mm de grosor (10 unidades)
E143-01 Discos de aluminio para adherir de 50 mm de diámetro
por 20 mm de grosor (10 unidades)
E143-10 Discos de acero inoxidable para adherir de 50 mm de
diámetro por 20 mm de grosor (10 unidades)
Se ajusta a las especificaciones de la EN 1015-12.
E143-13 Placa cuadrada de aluminio para adherir, 50x50 mm, 20
mm de espesor (10 unidades)
Norma: EN 1348
E143-11 Anillos cilíndricos, con forma de cono truncado, 50 mm
de diámetro interior.
Norma: EN 1015-12
E143-02 Corona con broca de centrado, 20 mm de diámetro,
para la preparación de la superficie de ensayo.
E143-03 Corona con broca de centrado,
50 mm de diámetro, para la
E143-11
preparación de la superficie
de ensayo.
E143-12 Pegamento adhesivo acrílico,
cartucho de 300 ml, con
pequeña bomba y boquillas.
E143-03
E143-13
E143-10
E143-12
E143-01
RECAMBIO:
E143-09 Tirantes con cabeza esférica
para ensamblar Disco / Dinamómetro
E143-09
E143
E143-02
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
E102
sección E
Molde de tres probetas prismáticas de
40,1x40x160 mm
302
NORMAS: EN 196-1 / EN ISO 679
Fabricado en acero con una “dureza de las paredes interiores
de más 200 HV”, cumpliendo además con las tolerancias dimensionales de la normativa EN 196 / 1. Todas las superficies están
rectificadas y todas las partes están marcadas con un número de
identificación, para un montaje correcto. Cada molde viene grabado
con su número de serie y se suministra con un certificado de conformidad. Peso. 8560 g
E103
E102
Molde verificado de tres probetas prismáticas de 40,1x40x160 mm
NORMAS: EN 196-1 / EN ISO 679
Idénticos en la forma que el mod. E102, pero fabricados a partir
de acero de alta resistencia con una “dureza de las paredes
interiores de más de 500 HV” (las especificaciones de la norma
EN196 / 1 recomiendan una dureza de 400HV). Este alto valor
de dureza mantiene el molde dentro de las tolerancias solicitadas
por las especificaciones de muchos ensayos, garantizando una vida
útil muy larga. Todas las piezas están marcadas con un número de
identificación para un correcto montaje. Se verifica en cada molde,
las tolerancias dimensiónales, dureza, perpendicularidad, planitud
y rugosidad con instrumentos periódicamente certificados por un
Centro NAMAS (National Measurement Accreditation Service) o
equivalente. Cada molde viene grabado con su número de serie y
se suministra con un certificado de conformidad. Peso: 8560 g
103
E103
DETTAGLIO
LIO
E102-11
Molde de seis probetas prismáticas de
40,1x40x80 mm
DETERMINACIÓN DE LA ABSORCIÓN DE AGUA en morteros
para baldosas de cerámica colocadas en pisos y paredes.
NORMA: EN 12808-5
Idéntico al mod. E102, pero equipado con tres particiones de acero
inoxidable, situado en el centro de las bandas, para obtener seis
probetas de dimensiones
40,1x40x80 mm aprox.
Peso: 8600 g
E105
Molde de tres probetas prismáticas de
40x40x160 mm
NORMAS: NF P15-413 / ASTM C348
DIN 1164, 1060
Fabricado en acero, de dureza
55 HRB, se ajusta a las
especificaciones mencionadas
anteriormente. Peso: 8 kg
E105
ACCESORIOS:
E106
TOLVA DE ALIMENTACIÓN, utilizada para llenar
el molde E102, E103, E105 cuando se monta en la
máquina de sacudidas E130, E131.
Confeccionada en aluminio de fundición. Peso: 1 kg
E102-02 ESPATULAS GRANDES Y PEQUEÑAS
según EN 196-1-2005
S200-11 ENRASADOR de 300 mm de largo
E102-03 PLACA DE VIDRIO de 220x190x6 mm para cubrir el
molde
E102-03
E102-11
E112
Molde de tres probetas
prismáticas de 70,7x70,7x282,8 mm
NORMA: NF P18-401 Fabricado en acero. Peso: 17 kg
E111
Molde en ocho para morteros
NORMAS: ASTM C190, C307 / AASHTO T132
Mecanizado con precisión se ajusta a las especificaciones anteriores
y es fácilmente desmontable.
Completo con base.
Peso: 3 kg
E112
E106
E110
Molde para tres
cubos de 50 mm
S200-11
instrumentos para ensayos de materiales
E102-02
E110
E111
Fabricado en acero, la dureza
HRB 55, puede usarse también para suelos y otros materiales.
Peso: 7 kg
E130
E132
Mesa de sacudidas
Maquina vibradora para moldes cúbicos
70,7 mm
NORMAS: EN 196-1 / EN ISO 679 / BS 3892 / UNE 80101
NF P15-412
Se utiliza para compactar probetas prismáticas de mortero de
40x40x160mm compactadas en los moldes para tres probetas,
según lo solicitado por las especificaciones anteriores. El aparato
consiste en una mesa que sujeta el molde, situado sobre una
leva rotativa que gira a 60 revoluciones por minuto. El grupo de
sacudidas está conectado a la mesa con anclajes en bayoneta para
una rápida verificación de los pesos. La altura de caída (15,0 mm) se
puede ajustar, para mantenerla correcta después de un uso intensivo. El aparato se suministra con el panel de control independiente,
con interruptor principal, contador digital automático de caídas y
botón de inicio/parada. Alimentación: 230V monofásica 50Hz 500W
Dimensiones: 1000x380x420 mm
Peso: 65 kg
NORMA: BS 4550
El molde está montado sobre una plataforma vibratoria con un
mecanismo de excéntrica. La máquina se suministra con panel de
control independiente con temporizador, pero “sin moldes cúbicos” que se deben pedirse por separado.
Alimentación: 230V monofásica 50Hz 250W
Peso: 100 kg
sección E
C EMENTO S – MO RTE ROS
E132 con molde
E133
303
Molde cúbico de 70,7 mm
NORMA: BS 4550
Fabricado en acero con las dimensiones especificadas por la norma arriba
mencionada.
Completo con placa base (para este
ensayo se precisan tres moldes).
Peso: 3 kg
E104
E130 con molde y tolva
Molde verificado de tres probetas
prismáticas de 40,1x40x160 mm
“modelo Italcementi”
NORMA: EN 196-1
Igual que en mod. E103,
pero con:
- Base aumentada
240x245 mm
- Peso: 11,850 kg
Confeccionado expresamente
E104
para la fábrica de cemento de “Italcementi Group”.
E131
Mesa de sacudidas
“alta gamma”
E131 con molde y tolva
NORMAS: EN 196-1 / EN ISO 679
Similar al modelo E130, pero fabricados con componentes
sobredimensionados, tratamientos y acoplamientos extremadamente precisos, para un uso intensivo en condiciones
difíciles. Motor alimentado por un inversor para garantizar
las 60 revoluciones por minuto en cualquier condición.
Peso: 93 kg
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
BAÑOS TERMOSTÁTICOS DE AGUA PARA EL CURADO DEL CEMENTO
sección E
Y PARA FINES DEL LABORATORIO EN GENERAL
NORMAS: EN 196-1, 196-8 / EN ISO 679 / ASTM C109, C511
304
E136-10
Construido con doble pared en acero inoxidable, con aislamiento
de lana y agitador eléctrico para la recirculación del agua, asegurando una temperatura uniforme y constante.
Rango de temperatura: desde ambiente hasta +60 °C con una
precisión de ±0,4 °C a 20 ºC.
El baño está equipado con termostato digital y un doble sistema de
seguridad del termostato con un mayor umbral térmico, garantizando unas condiciones de trabajo seguro.
Un serpentín de refrigeración que se conecta a la red de agua se
utiliza cuando la temperatura ambiente supera la solicitada, con
la posibilidad para reducir la temperatura del baño dentro de las
condiciones de la habitación y la red de agua.
Las muestras se mantienen separadas del fondo mediante una
rejilla perforada.
E136
MODELOS:
E136
Baño termostático, 40 litros de capacidad
Tiene una capacidad de más de 60 muestras de 40,1x40x160 mm
Dimensiones interiores: 510x350x230 mm
Dimensiones generales: 680x420x420 mm
Alimentación: 230V 50/60Hz monofásica 1200W
Peso: 28 kg aprox.
E136-01
E139
E136-01
Armario de curado
Baño termostático, 200 litros de capacidad
Dimensiones interiores: 900x600x360 mm
Dimensiones exteriores: 1050x680x430 mm
Alimentación: 230V 50/60Hz monofásica 2400W
Peso: 55 kg aprox.
B052-02
Baño termostático, con sistema de refrigeración
Al igual que en mod. E136, pero con rango de temperatura: +3 a
+95 ºC. Precisión ± 0,4 °C a 20 ºC.
La unidad de refrigeración se encuentra debajo del baño de agua.
Dimensiones exteriores: 800x430x1000 mm
Peso: 60 kg
ACCESORIO:
E136-10
Termómetro de control de
mercurio, rango de 0-50 °C. div. 0,5 ºC.
instrumentos para ensayos de materiales
B052-02
NORMAS: EN 196-1 / ASTM C87, C109, C190, C191
Tanto las paredes externas como internas son de acero inoxidable,
y aisladas mediante lana de vidrio de 50 mm de grosor.
El armario tiene una puerta interna de cristal para su inspección.
Rango de temperatura: desde ambiente hasta 70 °C, con termostato digital.
Un sistema de doble seguridad/termostato con un mayor umbral
térmico asegura condiciones de trabajo seguras.
Rango de humedad: del 90% a la saturación
Alimentación: 230V monofásica 50/60Hz 1000W
Dentro de dimensiones: 620x440x400 mm
Dimensiones generales: 900x700x800 mm
Peso: 60 kg
E139
ACCESORIO:
V165
TERMO-HIGRÓMETRO para control de humedad y temperatura.
Detalles técnicos: ver pág. 448
E138
ACCESSORIO per mod. E136, E136-01, E138:
Armario de curado de gran capacidad
E141
NORMAS: EN 196-1 / EN ISO 679
ASTM C87, C109, C190, C191 / UNE 80102
Para el curado de grandes cantidades de probetas de mortero,
cemento y de hormigón, en condiciones controladas de humedad y
temperatura.
Realizada en aluminio y policarbonato, se completa con un termostato digital de precisión y cuatro robustas estanterías.
Una humedad desde el 90% a la saturación, se mantiene a través
de nebulizadores de agua activados por aire comprimido, y la
temperatura por una resistencia de inmersión y una unidad de
refrigeración (mod accesorios. E141) Rango de temperatura: desde
ambiente hasta +30 ºC, precisión de ± 1 ºC.
El armario precisa de una fuente de aire comprimido (ver accesorios).
Dimensiones interiores: 1090x470x1200 mm
Dimensiones máximas: 1350x570x1600 mm
Alimentación 230V monofásica 50Hz 2000W
Peso: 100 kg
Refrigerador de agua
Enfría el agua desde la temperatura ambiente hasta +10 °C con una
capacidad de suministro de 2 litros / minuto.
Fabricado en acero inoxidable, con bomba motorizada, termostato
digital sens. 0,1 °C, se conecta a baños de agua y tanques en los que
es necesaria una temperatura inferior a la temperatura de la habitación. Completo con tubos y accesorios para la conexión al baño.
Alimentación: 230V 50Hz 750W monofásica
Dimensiones: 550x500x880 mm
Peso: 55 kg
sección E
C EMENTO S – MO RTE ROS
305
E141
DIAGRAMA DE FUNCIONAMIENTO
CAMARA DE CURADO
E138
NEBULIZADOR
E138
ENFRIADOR
E141
ACCESORIOS para mod. E138:
V206-01 Compresor de aire, caudal de aire: 250 litros / min.
Capacidad del depósito: 100 litros
Recomendado para un uso estándar
V206-02 Compresor de aire, caudal de aire: 400 litros / min.
Capacidad del depósito: 200 litros
Recomendado para uso intensivo o continuo
SUMINISTRO
DE AGUA
COMPRESSOR
RESISTÉNCIA
AIRE
E138-11 Tubos y accesorios para conectar el
armario E138 con el compresor de aire
E134-11
Bandeja, de 240x300x70 mm, de polietileno, que admite hasta seis
probetas prismáticas de 40,1x40x160 mm para el curado en agua.
E134-11
V206-01
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
S205
UNITRONIC 50 kN, PRENSA UNIVERSAL MULTIENSAYOS
sección E
COMPRESIÓN/FLEXIÓN Y TRACCIÓN PARA:
- ENSAYOS DE COMPRESIÓN/FLEXIÓN, de 50 kN MAX.CAPACIDAD DE CARGA
- ENSAYOS DE TRACCIÓN, 25 kN MAX. CAPACIDAD DE CARGA (ver mod. S205-05)
CON CONTROL AUTOMÁTICO DE CARGA O DESPLAZAMIENTO/DEFORMACIÓN,
para ensayos de:
Cemento / Mortero
Hormigón
Rocas y piedras
Bloques de arcilla
Metal, plástico, cables, cuerdas, telas, papeles, etc.
Mezclas bituminosas
Suelos
Los detalles técnicos de Unitronic y ensayos adicionales específicos se describen en la pág. 384
S205
con célula
de carga
APLICACIONES ESPECÍFICAS DE CEMENTO Y MORTERO:
306
Ensayo de flexión en probetas prismáticas
de mortero 40x40x160mm
Norme: EN 196-1 / ASTM C348 / NF P15-451 / DIN 1164
EN ISO 679
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-32 Medida de la tensión con célula de carga de 10 kN.
S212-05 Pistón de carga.
E172-01 Dispositivo de flexión EN para probetas de 40x40x160
mm (disponible también con la norma ASTM, ver pág. 322)
E164
Software para los ensayos de flexión.
Ensayo de tracción
en probetas de mortero en forma de”8”
Normas: ASTM C190, C307 / AASHTO T132
Prueba de compresión en probetas de
mortero (50 kN carga máx.)
Accesorios necesarios:
S205-05 Unitronic Compresión / Tracción
S337-32 Tracción /Compresión tensión con célula de carga de
10 kN de capacidad.
S205-07 Mordazas para el ensayo de tracción en probetas de
mortero en forma de “8”.
S205-08
Software para el ensayo
de tracción
E111
Molde para probetas en
forma de “8” (ver pág. 302)
Normas: EN 196-1 / EN ISO 679 / ASTM C109, C349
NF P18-411 / UNE 80101 / BS 3892 / DIN 1164
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-34 Medida de la tensión con célula de carga de 50 kN.
S212-05 Pistón de carga.
E170
Dispositivo de compresión en porciones de probetas
de 40x40x160 mm (dispositivos para diferentes muestras se describen en pág. 322)
E163
Software para ensayos de compresión.
instrumentos para ensayos de materiales
S205-05
Unitronic Compresión 50 kN / Tracción 25 kN
La prensa de ensayos Unitronic S205 ha sido modificada y
mejorada para llevar a cabo también ensayos de tracción con una
capacidad máxima de 25 kN.
C EMENTO S – MO RTE ROS
S206
PRENSA UNIVERSAL ELECTROMECÁNICA PARA ENSAYOS DE COMPRENSIÓN, FLEXIÓN, Y ENSAYOS DE TRACCIÓN DE MATERIALES DE CONSTRUCCIÓN CON UN SISTEMA SERVO-CONTROLADO DE CARGA O DE DESPLAZAMIENTO / DEFORMACIÓN.
La máquina está compuesta por una base sólida que contiene los componentes de transmisión y los instrumentos de control de hardware.
La base tiene dos columnas, de acero de alta resistencia con revestimiento superficial de cromo duro.
El travesaño superior se puede ajustar en altura, para ubicar los accesorios y realizar los ensayos específicos.
La cruceta inferior móvil es operada por un sistema de tornillo con recirculación de bolas controlado a través de un servomotor, asegura la
correcta aplicación de la carga y una velocidad constante.
Las dos crucetas prevén acoplamientos para fijar los diferentes dispositivos de ensayos (ver accesorios).
La tensión se mide mediante una célula de carga eléctrica, y el desplazamiento de la cruceta por transductores, todo ello incorporado
dentro de la máquina.
Es posible colocar células eléctricas de carga de menor capacidad, para satisfacer los requisitos de ensayos específicos.
sección E
MULTI-ENSAYOS DE 200 kN
Especificaciones técnicas:
- Max. carga: 200 kN (ambas compresión y tracción)
- Max. luz vertical: 800 mm (sin accesorios)
- Max. luz vertical con los platos de compresión: 700 mm
- Diámetro de los platos de compresión: 180 mm (con rótula en
el plato superior)
- Distancia entre columnas: 610 mm
- Desplazamiento de la cruceta: ± 200 mm (400 mm en total)
- Rango de las velocidades de ensayo: de 0,01 a 100 mm / min
- Incremento de carga: de 1 N/s hasta 5 kN/s
- Resolución del desplazamiento: 0,01 mm con una precisión
mejor que 0,2%
- Clase de la máquina: 1
La prensa multiensayos se suministra completa, con célula de
carga eléctrica de 200 kN, transductores de desplazamiento de la
cruceta, software para los ensayos de Duriez, Marshall, CBR, PC
con monitor LCD, teclado, ratón, cables de conexión, platos de
compresión superior e inferior.
“No se incluyen”: la impresora y accesorios para ensayos específicos, que deben pedirse por separado (ver accesorios).
Alimentación: 230V 50Hz 850W monofásica.
Dimensiones: 1350x510xh 2250 mm.
Peso: 850 kg aprox.
307
ACCESORIO:
C128
IMPRESORA LASER, modelo de sobremesa,
para gráficos y certificados, con conexión
directa a través de USB.
S206
Ensayos principales y accesorios específicos:
MATERIALES
ENSAYO
NORMA
ACCESORIOS
Cemento y mortero
Compresión
UNI EN 196-1
ASTM C109
Dispositivo de compresión E170
Dispositivo de compresión E171
Flexión
UNI EN 196-1
Dispositivo de flexión E172-01
Célula de carga 10kN S337-32
Accesorios adicionales específicos para ensayos sobre: hormigón, asfalto, suelos, acero, ver pág. 390
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
MÁQUINAS DE ENSAYOS DE COMPRESIÓN Y FLEXIÓN PARA LA DETERMINACIÓN
DE LA RESISTENCIA DEL CEMENTO
En la sección de cemento y mortero, estamos en condiciones de proporcionar la gama más amplia y completa de equipos de ensayo de compresión/flexión disponibles en la actualidad en el mercado mundial, por lo que Matest es el fabricante líder de máquinas de ensayos de resistencia.
La versatilidad y flexibilidad de la gama de productos Matest, permite al usuario final seleccionar una prensa de compresión / flexión de cementos
para combinar con otra prensa (como por ejemplo una prensa de compresión del hormigón) con el fin de satisfacer y personalizar cualquier
requisito específico.
sección E
En las páginas siguientes se describen:
- Sistemas de medición y control (pág. 309 ÷ 311)
- Máquinas de dos columnas con sólo un intervalo de medición de
“sólo ensayos de compresión” y capacidad de carga de 250 kN
o 500 kN (pág. 312 ÷ 315)
- Máquinas de dos columnas con “doble rango de medición” con
la misma cámara de ensayos, para “ensayos de compresión y
flexión”.
Rangos: 250 kN o 500 kN para ensayos de compresión, y 15 kN
para ensayos de flexión (pág. 316 ÷ 319)
308
instrumentos para ensayos de materiales
- Máquinas con “doble cámara de ensayos” y “dos rangos de
medición independientes”, para “compresión” en la cámara
de ensayos de capacidad de 250 kN o 500 kN, y ensayos de
“flexión” en la cámara de 15 kN de capacidad (pág. 320)
- Grupos combinados para ensayos de compresión y flexión de los
morteros, ensayos de compresión/flexión en el hormigón, tracción indirecta, ensayos de bloques, adecuado para personalizar y
adaptarse a cualquier necesidad específica (pág. 323)
C EMENTO S – MO RTE ROS
C108N DIGITEC
C098N AUTOTEC
COMPRESIÓN Y FLEXIÓN DE HORMIGÓN O MORTERO (también de otros fabricantes).
El sistema puede manejar y procesar los datos de acuerdo con las
- Aproximación rápida, tocando y realizando la rotura de la muesespecificaciones de la EN 12390 y las diferentes Normas internatra bajo el control directo de la bomba (Autotec C098N)
cionales para los siguientes ensayos:
- Control automático del gradiente de velocidad (Autotec C098N)
- Visualización en continuo de la carga en pantalla.
• Compresión en hormigón
- Detección de la carga de rotura.
• Flexión en hormigón
- Elaboración automática del valor de la resistencia específica.
• Tracción indirecta en probetas cúbicas y cilíndricas de hormigón
- Archivos permanentes de hasta 1000 ensayos y archivos de100
• Compresión y flexión en morteros
tipos diferentes de probetas.
• C127N Impresora gráfica incorporada
Pantalla
gráfica de alta resolución: 192x64 píxeles.
• Conexión RS232 con control remoto desde PC
Fuerza
de
medición seleccionable: kN, lb
Especificaciones Digitec / Autotec:
- Idiomas: inglés, francés, alemán, español, italiano, polaco, checo,
- 2 canales analógico-digital conectable a dos prensas diferentes de
turco.
compresión / flexión
- Clase: 0,5% a partir de 10% del valor máximo, a petición del 1%
- Puesta en marcha simple e inmediata de los parámetros y ejecudel valor máximo
ción del ensayo, menús. El uso no requiere personal especializado.
sección E
Sistema informatizado de dos canales, con pantalla gráfica, para controlar y
gestionar todo tipo máquinas de ensayo automáticas (Autotec C098N) y semiautomáticas (Digitec C108N), para la adquisición, visualización, procesamiento,
impresión y recopilación de los datos de ensayo y sus certificados, con software
para el control remoto desde PC. PARA ACTUALIZAR O COMPLETAR SU MÁQUINA DE ENSAYOS DE
C127N Impresora gráfica
incorporada
Compresión y flexión en Morteros
Compresión en hormigones
C098N
C108N
H009-01
Conexión RS-232 con control
remoto desde PC
Flexión en el hormigón
Tracción indirecta en probetas
cilíndricas y cúbicas de hormigón
Detalles técnicos y accesorios: ver pág. 127
instrumentos para ensayos de materiales
309
CEM E N TOS – M O RT E RO S
N
O
I
T
U
L
EVO
sección E
C109N CYBER-PLUS
C104N SERVO-PLUS
Una evolución electrónica con 8 entradas analógicas para máquinas de
ensayo de compresión y flexión de hormigón y mortero.
Diseñado con la última tecnología, un innovador sistema de pantalla táctil como PC, utilizado para controlar y gestionar todo tipo de
máquinas de ensayos automáticas (Servo-Plus Evolution C104N) y semi-automáticas (Cyber-Plus-Evolution C109N).
Para actualizar o completar su máquina de ensayos de compresión y flexión de hormigón o mortero (también de otros fabricantes).
El sistema puede gestionar y procesar los siguientes ensayos:
Compresión y flexión en morteros
Compresión en hormigones
310
C127N Impresora gráfica
incorporada
Tracción en aceros
Flexión en hormigones
C109N
C104N
Tracción indirecta
en probetas cúbicas
y cilíndricas de
hormigón
Conexión a Internet
para asistencia
remota en línea.
C128 Impresora láser USB para
gráficos y certificados
H009-01
Conexión a PC.
Control remoto
desde el PC.
instrumentos para ensayos de materiales
C EMENTO S – MO RTE ROS
Interruptor de paro de seguridad
8 entradas analógicas para
conectar hasta 8 células
de carga y transductores
Impresora gráfica
incorporada
2 puertos USB
Ranura para tarjeta SD
(memoria ilimitada)
sección E
Características principales:
La unidad de control
Cyber / Servo-Plus Evolution
funciona como un PC estándar
basado en el sistema operativo
Windows.
La pantalla táctil con sistema de
íconos gráficos permite una fácil
puesta en marcha de los parámetros e inmediata ejecución
de los ensayos.
Pantalla a color de alta resolución, ¼ VGA, ofrece todas
las funciones de un PC para la
gestión y análisis de los datos,
resultados de los ensayos, y
gráficos.
311
L A U N I DA D P U E D E S E R G E S T I O N A DA U T I L I Z A N D O :
Pantalla táctil
como un PC
normal, ¼VGA
Conexión directa de Cyber/Servo-Plus
Evolution a la Intranet (conexión directa a
una red LAN) e Internet para establecer
una comunicación a distancia y recibir un
diagnóstico de un posible problema, con
capacidad de ejecutar el ensayo a distancia, y
proporcionar una actualización del software.
El equipo técnico de Matest comprobará
las unidades ubicadas en el extranjero para
garantizar una asistencia rápida y profesional.
Direccionador de teclas de flecha
lo suficientemente grande para
el uso con o sin guantes
Conexión directa a Internet para
asistencia por control remoto
Funciones principales:
- Interfaz muy intuitiva que simplifica el uso de la máquina (el
ensayo se inicia después una sencilla introducción de datos)
- Mayor capacidad de cálculo y visualización de datos (tablas y
gráficos en pantalla)
- Alta capacidad de gestión para el marco multilingüe y la configuración internacional (fecha y hora, unidades decimales, unidad de
medida)
- Software elástico que permite la instalación de nuevos ensayos
cuando lo desee.
- Gestión del perfil de la configuración
- Supervisión de la configuración y calibración de los canales analógicos
- Gestión de alarmas
- Configuración de los parámetros de Ethernet
- Configuración de los ajustes internacionales
- Funciones de diagnóstico de hardware
La conexión de un teclado
o ratón como un PC
Sistema operativo Windows
como un PC estándar.
con pantalla táctil a color, ¼ VGA
- Funciones para la actualización de licencias del software
- Ejecución de ensayos a través de los parámetros personalizados
- Varios niveles de protección (contraseña) para evitar el acceso a
los menús de configuración por parte del personal no autorizado.
Cyber-Plus Evolution C109N y Servo-Plus Evolution C104N
se suministran completos con licencias para la ejecución de los
siguientes ensayos:
- COMPRESIÓN en mortero
- FLEXIÓN en mortero
- COMPRESIÓN en hormigón
- FLEXIÓN en hormigón
- ENSAYO DE TRACCIÓN INDIRECTA en probetas cúbicas y
cilíndricas de hormigón
En conformidad a las siguientes Normas: UNI EN, ASTM, BS, NF,
UNE, DIN, etc.
Detalles técnicos, características y accesorios: ver pág. 130
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
PRENSAS SÓLO PARA ENSAYOS DE COMPRESIÓN
sección E
PARA MUESTRAS DE CEMENTO Y MORTERO, LADRILLOS, PIEDRAS, MATERIALES REFRACTARIOS, etc.
NORMAS: EN 196-1 / ASTM C109, C349 / NF P18-411 / UNE 80101 / DIN 1164 / BS 3892
312
Diseñadas para realizar ensayos de compresión en las porciones de
probetas prismáticas de 40,1x40x160 mm, cubos de 40, 50, 70, 100
mm y 2” de lado, testigos con 180 mm de altura máx., mediante el
uso de los dispositivos de compresión adecuados descrito en las
páginas siguientes (accesorios mod. E170 -.E171-01)
- Bastidor con dos columnas de una gran rigidez.
- Max. luz vertical entre las placas: 185 mm
- Diámetro de los platos: 153 mm
- Recorrido del pistón: 45 mm aprox.
- Precisión: Grado 1 a partir de 1/10 de la escala
- Medidor de diámetro 200 mm, rango de 0-300 kN, Subdiv. 2,5 kN
- Se suministra completa con plato de compresión inferior y
pieza de acoplamiento para colocar fácilmente el dispositivo de
compresión.
- Alimentación (modelos con motor): 230V monofásica 50Hz 750W
- Peso: 300 - 330 kg
E159D + C127N + E170
E161A + C127N + E170
E151 + E170
COMPRESIÓN
Modelo
E151
E155
E159 D
E159-01 D
E161 A
E161-02 A
Carga Máxima
kN
Manual
300
300
500
250
250
500
•
instrumentos para ensayos de materiales
Motorizado
•
•
•
•
•
SISTEMA DE MEDICIÓN DE C ARGA
Manómetro
Digitec
Autotec
mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
•
•
C EMENTO S – MO RTE ROS
ACCESORIOS PARA MÁQUINAS DE COMPRESIÓN:
E170
DISPOSITIVO DE COMPRESIÓN para porciones de probetas
prismáticas de 40,1x40x160 mm rotos en flexión.
EN 196, EN/ISO 679, ASTM C349. Ver pág. 322
E170
E171-01
DISPOSITIVO DE COMPRESIÓN
de cubos de 70,7 mm de lado.
BS 4550. Ver pág. 322
E171-01
sección E
E171
DISPOSITIVO DE COMPRESIÓN
de cubos de 50 mm y 2” de lado.
ASTM C109. Ver pág. 322
C123
SOFTWARE “Servonet” para el manejo totalmente automático y
control remoto desde un PC. Para utilizar con los modelos Autotec.
Ver pág. 14
C123
Software “Servonet”
H009-01
ORDENADOR PERSONAL, monitor LCD de 17 “, teclado, ratón,
cables. La oferta del PC incluye la instalación del Software
313
E171
E161-05 SUPLEMENTO, 50 mm de altura
E161-06 SUPLEMENTO, 25 mm de altura
Nota: los dispositivos de compresión no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada
para los modelos CyberPlus y Servo-Plus Evolution.
C127-11 PAPEL TÉRMICO, rollos de papel para impresora
(paquete de 10 rollos).
E161-12 PROTECCIONES DE SEGURIDAD, según las directivas
de seguridad de la CE, realizadas en policarbonato, con
bisagras y cierre
C121-51 INTERRUPTOR de las puertas de seguridad. Ver pág.214
C097-05
CLASE 1, a partir de 1% de toda la escala. Con un procedimiento
especial de calibración, es posible conceder la clase 1 práctica sobre
la gama completa de la máquina de compresión. Sólo se aplica a las
máquinas digitales.
E163
SOFTWARE para ensayos de compresión. Desarrollado
para la gestión y el control remoto desde un PC. Para
utilizar con los modelos Digitec. Ver pág. 14
E161-11 BANCO, para soportar la prensa de compresión.
E161-11
C115-01
VALVULA HIDRÁULICA DE DOS VIAS, conectada a máquinas
digitales, para activar una segunda prensa.
Detalles técnicos: ver pág. 215
C115-01
E163
Software de compresión
C106-10
C106-10
DISPOSITIVO DE FLEXIÓN PARA PROBETAS PRISMÁTICAS DE
HORMIGÓN de 100x100x400 mm y 150x150x600.
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
PRENSAS SÓLO PARA ENSAYOS DE COMPRESIÓN
Para ensayar muestras de cemento y mortero, ladrillos, piedras, materiales refractarios, etc.
3ISTEMA$IGITALDE0ANTALLA4fCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
sección E
NORMAS: EN 196-1 / ASTM C109, C349 / NF P18-411 / UNE 80101 / DIN 1164 / BS 3892
314
Diseñadas para realizar ensayos de compresión en las porciones de
probetas prismáticas de 40,1x40x160 mm, cubos de 40, 50, 70, 100
mm y 2” de lado, testigos con 180 mm de altura máx., mediante el
uso de los dispositivos de compresión adecuados descrito en las
páginas siguientes (accesorios mod E170 - E171-01)
- Bastidor con dos columnas de una gran rigidez.
- Max. luz vertical entre las placas: 185 mm
- Diámetro de los platos: 153 mm
- Recorrido del pistón: 45 mm aprox.
- Precisión: Grado 1 a partir de 1/10 de la escala
- Se suministra con plato de compresión inferior y pieza de acoplamiento para colocar fácilmente el dispositivo de compresión.
- Alimentación: 230V monofásica 50Hz 750W
- Peso: 300 - 330 kg
E159N + C127N + E170
C104-04
E161N +
C127N
E161N + C127N + E170
ACCESORIOS:
C104-04
CONSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para
mejorar el diseño y el aspecto de la máquina.
COMPRESIÓN
Modelo
E159 N
E159-01 N
E161 N
E161-02 N
Carga Máxima
kN
Motorizado
500
250
250
500
•
•
•
•
instrumentos para ensayos de materiales
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el
servicio de Atención al Cliente Matest ofrece soporte en tiempo
real para analizar el problema, para encontrar una solución posible
y efectuar la ejecución del ensayo.
SISTEMA DE MEDICIÓN DE C ARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
•
•
C EMENTO S – MO RTE ROS
ACCESORIOS PARA MÁQUINAS DE COMPRESIÓN:
E170
DISPOSITIVO DE COMPRESIÓN para porciones de probetas
prismáticas de 40,1x 40x160 mm rotos en flexión.
EN 196, EN/ISO 679, ASTM C349. Ver pág. 322
E170
E171-01
DISPOSITIVO DE COMPRESIÓN
de los cubos de 70,7 mm de lado.
BS 4550. Ver pág. 322
E171-01
sección E
E171
DISPOSITIVO DE COMPRESIÓN
de cubos de 50 mm y 2” de lado.
ASTM C109. Ver pág. 322
C123N
SOFTWARE “Servonet” para el manejo totalmente automático y
control remoto desde un PC. Para utilizar con los modelos ServoPlus Evolution. Ver pág. 14
C123N
Software “servonet”
H009-01
ORDENADOR PERSONAL, monitor LCD de 17 “, teclado, ratón,
cables. La oferta del PC incluye la instalación del Software
315
E171
E161-05 SUPLEMENTO, 50 mm de altura
E161-06 SUPLEMENTO, 25 mm de altura
Nota: los dispositivos de compresión no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 PAPEL TÉRMICO, rollos de papel para impresora
(paquete de 10 rollos)
E161-12 PROTECCIONES DE SEGURIDAD, según las directivas
de seguridad de la CE, realizadas en policarbonato, con
bisagras y cierre
C121-51 INTERRUPTOR de las puertas de seguridad. Ver pág.214
C097-05
CLASE 1, a partir de 1% de toda la escala. Con un procedimiento
especial de calibración, es posible conceder la clase 1 prácticamente
sobre todo el rango completo de la máquina de compresión. Sólo
se aplica a las máquinas digitales.
E163N
Software para ensayos de compresión. Desarrollado para la gestión
y el control remoto desde un PC. Para utilizar con los modelos
Cyber-Plus Evolution. Ver pág. 14
E161-11 BANCO, para soportar la prensa de compresión.
E161-11
C115-01
VALVULA HIDRÁULICA DE DOS VIAS, para activar una segunda
prensa.
Detalles técnicos: ver pág. 215
C115-01
E163N
Software de compresión
C106-10
C106-10
DISPOSITIVO DE FLEXIÓN PARA PROBETAS PRISMÁTICAS DE
HORMIGÓN de 100x100x400 mm y 150x150x600.
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
PRENSAS DE ENSAYOS DE COMPRESIÓN/FLEXIÓN CON DOBLE RANGO DE
MEDICIÓN
sección E
PARA MUESTRAS DE CEMENTO Y MORTERO, LADRILLOS, PIEDRAS, MATERIALES REFRACTARIOS, etc.
NORMAS: EN 196-1 / EN ISO 679 / ASTM C109, C348, C349
NF P18-411, P15-451 / UNE 80101 / DIN 1164
BS 3892, 4550, 4551
316
Estas máquinas de ensayo poseen un doble rango de medición en
la misma cámara de ensayos.
Los dos rangos se pueden utilizar alternativamente y son adecuados para llevar a cabo:
- Ensayos de flexión en probetas prismáticas de cemento
40,1x40x160 mm (seleccionando la gama de baja capacidad)
- Ensayos de compresión en las porciones de probetas prismáticas
40,1x40x160mm rotos en flexión, cubos de 40, 50, 70, 100 mm y
2” de lado, testigos de 180 mm de altura máxima (seleccionando
el rango nominal)
mediante el uso de los dispositivos de compresión adecuados, que
se describen en las páginas siguientes (accesorios E170 - E172-01).
Las máquinas con lectura digital están equipadas con “dos transductores de presión adecuados” garantizando la concesión de la
clase 1 de 1/10 en ambos rangos de medición.
El rango de medición 0 - 15 kN también puede ser utilizado para
los ensayos de compresión en las muestras con valores esperados
de baja resistencia.
- Bastidor con dos columnas de una gran rigidez.
- Max. luz vertical entre las placas: 185 mm
- Diámetro de los platos: 153 mm
- Recorrido del pistón: 45 mm aprox.
- Precisión: Grado 1 a partir de
1/10 de la escala
- Dos manómetros de diámetro
200 mm: rango de 0-300 kN,
Subdiv. 2,5 kN - rango de 0-50 kN,
Subdiv. 0,5 kN
- Se suministra con plato de compresión
inferior y pieza de acoplamiento para
colocar fácilmente el dispositivo de
compresión.
- Alimentación (modelos con motor):
230V monofásica 50Hz 750W
- Peso: 310 - 340 kg
E156 + E170
COMPRESIÓN / FLEXIÓN
Modelo
E152
E156
E160 D
E160-01 D
E161-01 A
E161-03 A
de doble rango
kN
Manual
300/50
300/50
500/15
250/15
250/15
500/15
•
instrumentos para ensayos de materiales
Motorizado
•
•
•
•
•
E161-01A + C127N + E172-01
E160D + C127N + E170
SISTEMA DE MEDICIÓN DE C ARGA
Manómetros
Digitec
Autotec
mod. C108N (pág. 127) mod. C098N (pág. 127)
•
•
•
•
•
•
C EMENTO S – MO RTE ROS
E170
DISPOSITIVO DE COMPRESIÓN para
porciones de las probetas prismáticas
de 40,1x40x160 mm roto en flexión.
EN 196, EN/ISO 679, ASTM C349.
Ver pág. 322
E170
E172-01
E171
DISPOSITIVO DE COMPRESIÓN
de los cubos de 50 mm y 2” de
lado. ASTM C109.
Ver pág. 322
E171-01
DISPOSITIVO DE COMPRESIÓN
para cubos de 70,7 mm de lado.
BS 4550. Ver pág. 322
E171
E171-01
E172-02
DISPOSITIVO DE FLEXIÓN
para probetas de mortero
de 40x40x160 mm.
ASTM C348. Ver pág. 322
E161-05 SUPLEMENTO, 50 mm de altura
E161-06 SUPLEMENTO, 25 mm de altura
Nota: los dispositivos de compresión no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada
para los modelos Cyber-Plus y Servo-Plus Evolution.
C127-11 PAPEL TÉRMICO, rollos de papel para impresora
(paquete de 10 rollos)
E161-12 PROTECCIONES DE SEGURIDAD, según las directivas
de seguridad de la CE, realizadas en policarbonato, con
bisagras y cierre.
C121-51 INTERRUPTOR de las puertas de seguridad. Ver pág.214
C097-05 CLASE 1, a partir de 1% de toda la escala. Con un procedimiento especial de calibración, es posible conceder
la clase 1 prácticamente sobre todo el rango. Sólo se
aplica a las máquinas digitales.
E163
SOFTWARE para ensayos de compresión. Desarrollado
para la gestión y el control remoto desde un PC. Para
utilizar con los modelos Digitec. Ver pág. 14
E164
SOFTWARE para los ensayos de flexión. Desarrollado
para la gestión y el control remoto desde un PC. Para
utilizar con los modelos Digitec. Ver pág. 14
sección E
ACCESORIOS PARA LA FLEXIÓN / COMPRESIÓN:
E172-01
DISPOSITIVO DE FLEXIÓN para probetas de mortero de
40,1x40x160 mm. EN 196-1, EN/ISO 679. Ver pág. 322
E163
Software
de compresión
E164
Software de flexión
C123
SOFTWARE “Servonet” para ensayos de flexión y compresión.
Desarrollado para el manejo totalmente automático y control
remoto desde un PC. Para utilizar con los modelos Autotec.
Ver pág. 14
C106-10
DISPOSITIVO DE FLEXIÓN
PARA PROBÉTAS PRISMÁTICAS DE HORMIGÓN
de 100x100x400 mm y
150x150x600 mm
C106-10
H009-01
ORDENADOR PERSONAL, LCD de 17 “monitor, teclado, ratón,
cables. La oferta del PC incluye la instalación del software.
E161-11 BANCO, para soportar la prensa de compresión.
E161-11
instrumentos para ensayos de materiales
317
CEM E N TOS – M O RT E RO S
PRENSAS DE ENSAYOS DE COMPRESIÓN/FLEXIÓN CON DOBLE RANGO DE
MEDICIÓN. Para ensayar muestras de cemento y mortero, ladrillos,
piedras, materiales refractarios, etc.
sección E
3ISTEMA$IGITALDE0ANTALLA4fCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
318
NORMAS: EN 196-1 / EN ISO 679 / ASTM C109, C348, C349 / NF P18-411, P15-451 / UNE 80101 / DIN 1164
BS 3892, 4550, 4551
Estas máquinas de ensayo poseen un doble rango de medición en
la misma cámara de ensayos.
Los dos rangos se pueden utilizar alternativamente y son adecuados para llevar a cabo:
- Ensayos de flexión en probetas prismáticas de cemento
40,1x40x160 mm (seleccionando la gama de baja capacidad)
- Ensayos de compresión en las porciones de probetas prismáticas
40,1x40x160mm rotos a flexión, cubos de 40, 50, 70, 100 mm y
2” lado, testigos de 180 mm de altura máxima (seleccionando el
rango nominal)
mediante el uso de los dispositivos de compresión adecuados, que
se describen en las páginas siguientes (accesorios E170 - E172-01).
Las máquinas con lectura digital están equipadas con “dos transductores de presión adecuados” garantizando la concesión de la
Clase 1 de 1/10 en ambos rangos de medición.
El rango de medición 0 - 15 kN también puede ser utilizado para
los ensayos de compresión, en las muestras con valores esperados
E161-01N + C127N + E172-01
de baja resistencia.
- Bastidor con dos columnas de una gran rigidez.
- Max. luz vertical entre las placas: 185 mm
- Diámetro de los platos: 153 mm
- Recorrido del pistón: 45 mm aprox.
- Precisión: Grado 1 a partir de 1/10 de la escala
- Se suministra con plato de compresión inferior
y pieza de acoplamiento para colocar fácilmente el dispositivo de
compresión.
- Alimentación
E160N +
(modelos con motor):
C127N +
230V monofásica 50Hz 750W
E172-01
- Peso: 310 - 340 kg
ACCESORIOS:
C104-04
CONSOLA TORRE DE SERVO-PLUS EVOLUTION
El conjunto de la bomba y el sistema digital se encierran para mejorar el
diseño y el aspecto de la máquina.
C104-05
PAQUETE DE TELEASISTENCIA EN LÍNEA
La máquina cuenta con una conexión a Internet a través del cual el servicio de
Atención al Cliente Matest ofrece soporte en tiempo real para analizar el problema, para encontrar una solución posible y efectuar la ejecución del ensayo.
E161-01N + C104-04 +
C127N + E172-01
COMPRESIÓN / FLEXIÓN
Modelos
E160 N
E160-01 N
E161-01 N
E161-03 N
Doble rango
kN
Motorizado
500/15
250/15
250/15
500/15
•
•
•
•
instrumentos para ensayos de materiales
SISTEMA DE MEDICIÓN DE C ARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
•
•
C EMENTO S – MO RTE ROS
E170
DISPOSITIVO DE COMPRESIÓN para
porciones de probetas prismáticas de
40,1x40x160 mm rotas en flexión. EN
196, EN/ISO 679, ASTM C349.
Ver pág. 322
E170
E172-01
E171
DISPOSITIVO DE COMPRESIÓN
de los cubos de 50 mm y 2” de
lado. ASTM C109.
Ver pág. 322
E171-01
DISPOSITIVO DE COMPRESIÓN
para cubos de 70,7 mm de lado.
BS 4550. Ver pág. 322
E171
E171-01
E172-02
DISPOSITIVO DE FLEXIÓN
para probetas de mortero
de 40x40x160 mm.
ASTM C348.
Ver pág. 322
E161-05 SUPLEMENTO, 50 mm de altura
E161-06 SUPLEMENTO, 25 mm de altura
Nota: los dispositivos de compresión no requieren ningún suplemento.
C127N IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 PAPEL TÉRMICO, rollos de papel para impresora
(paquete de 10 rollos)
E161-12 PROTECCIONES DE SEGURIDAD, según las directivas
de seguridad de la CE, realizadas en policarbonato, con
bisagras y cierre.
C121-51 INTERRUPTOR de las puertas de seguridad. Ver pág.214
C097-05
CLASE 1, a partir de 1% de toda la escala. Con un procedimiento
especial de calibración, es posible conceder la clase 1 prácticamente
sobre todo el rango completo de la máquina de compresión.
E163N
Software para ensayos de compresión. Desarrollado para la gestión
y el control remoto desde un PC. Para utilizar con los modelos
Cyber-Plus Evolution. Ver pág. 14
E164N
SOFTWARE para los ensayos de flexión. Desarrollado para la gestión y el control remoto desde un PC. Para utilizar con los modelos
Cyber-Plus Evolution. Ver pág. 14
sección E
ACCESORIOS PARA LA FLEXIÓN / COMPRESIÓN:
E172-01
DISPOSITIVO DE FLEXIÓN para probetas de mortero de
40,1x40x160 mm. EN 196-1, EN/ISO 679. Ver pág. 322
E163N
Software
de compresión
E164N
Software de flexión
C123N
SOFTWARE “Servonet” para ensayos de flexión y compresión.
Desarrollado para el manejo totalmente automático y control
remoto desde un PC. Para utilizar con los modelos Servo-Plus
Evolution. Ver pág. 14
C106-10
DISPOSITIVO DE FLEXIÓN
PARA PROBÉTAS PRISMÁTICAS DE HORMIGÓN
de 100x100x400 mm y
150x150x600 mm
C106-10
H009-01
ORDENADOR PERSONAL, LCD de 17 “monitor, teclado, ratón,
cables. La oferta del PC incluye la instalación del software.
E161-11 BANCO, para soportar la prensa de compresión.
C115-01
VALVULA HIDRÁULICA DE DOS VIAS, para activar una segunda
prensa. Detalles técnicos: ver pág. 215
C115-01
instrumentos para ensayos de materiales
319
CEM E N TOS – M O RT E RO S
PRENSAS DE ENSAYOS A COMPRESIÓN Y FLEXIÓN “DE ALTO RENDIMIENTO” CON
DOBLE CÁMARA DE ENSAYOS CON DOS CELULAS DE CARGA Y RANGOS
INDEPENDIENTES DE 250 kN Y 15 kN.
sección E
3ISTEMA$IGITALDE0ANTALLA4fCTIL#YBER0LUSO3ERVO0LUS%VOLUTION
320
NORMAS: EN 196-1 / EN ISO 679 / ASTM C109, C348, C349 / NF P18-411, P15-451 / UNE 80101 / DIN 1164
BS 3892, 4550, 4551
Estas máquinas de ensayos de alto rendimiento, soluciones
avanzadas y componentes de alta calidad están equipadas con dos
cámaras de carga con dos rangos de medición independientes. Son
adecuadas para llevar a cabo:
- Ensayos de flexión en probetas prismáticas de cemento
40,1x40x160 mm (con rango de 0 - 15 kN)
- Ensayos de compresión en las porciones de probetas prismáticas
de 40,1x40x160 mm rotas a flexión, cubos de 40, 50, 70, 100 mm
y 2 “ de lado, testigos de 180 mm de altura máxima (con rango
de 0 - 250 kN)
mediante el uso de los dispositivos de compresión adecuados que
se describen en las páginas siguientes (accesorios E170 - E172-01).
La carga aplicada se mide mediante dos células de carga de bandas
extensométricas (15 kN y 250 kN) de una gran precisión.
Esta solución elimina el peso del pistón dando una menor compresión a los platos, y reduciendo el conjunto de fricciones del
pistón, etc. garantizando una precisión muy alta (error máximo de
+/- 0,5%).
La cámara de carga de 0 a 15 kN permite ensayos muy precisos
sobre las muestras con una baja resistencia (tanto en compresión
como en flexión).
E181N + C127N con dispositivos de compresión
-
E183N + C127N con dispositivos de compresión
COMPRESIÓN / FLEXIÓN
Modelo
Doble rango
kN
E181 N
E183 N
250/15
250/15
instrumentos para ensayos de materiales
-
Max. luz vertical entre placas: 189 mm
Diámetro de los platos: 165 mm
Desplazamiento del pistón: 35 mm aprox.
Precisión: Grado 1 a partir de 1/10 de la escala, para ambos
rangos.
Protectores de seguridad según las directivas de la CE, realizados
en policarbonato, con bisagras.
Se suministra con plato de compresión inferior y pieza de acoplamiento para colocar fácilmente el dispositivo de compresión
(ver accesorios).
Dimensiones de la prensa: 1300x400xh1500 mm aprox.
Alimentación: 230V monofásica 50Hz 750W
Peso: 400 kg aprox.
SISTEMA DE MEDICIÓN DE C ARGA
Cyber-Plus Evolution
Servo-Plus Evolution
mod. C109N (pág. 130)
mod. C104N (pág. 130)
•
•
C EMENTO S – MO RTE ROS
C104-05
PAQUETE EN LÍNEA DE ASISTENCIA REMOTA
La máquina cuenta con una conexión a Internet a través del cual
el Servicio de Atención al Cliente Matest proporciona soporte en
tiempo real para analizar el problema, para encontrar una posible
solución, y llevar a cabo una ejecución correcta del ensayo.
E172-01
DISPOSITIVO DE FLEXIÓN para probetas de mortero de
40,1x40x160 mm.
EN 196-1, EN/ISO 679. Ver pág. 322
E170
DISPOSITIVO DE COMPRESIÓN
para porciones de probetas prismáticas
de 40,1x40x160 mm rotas en flexión.
EN 196, EN/ISO 679, ASTM C349.
Ver pág. 322
E163N
Software para ensayos de compresión. Desarrollado para la gestión y
el control remoto desde un PC. Para ser utilizado con mod.E181N.
Ver pág. 14
E164N
Software para los ensayos de flexión. Desarrollado para la gestión y
el control remoto desde un PC. Para ser utilizado con mod. E181N.
Ver pág. 14
sección E
ACCESORIOS PARA CAMARA DOBLE:
E163N
Software
de compresión
E172-01
321
E170
E171
DISPOSITIVO DE COMPRESIÓN
de los cubos de 50 mm y 2” de
lado. ASTM C109.
Ver pág. 322
E164N
Software de flexión
E171-01
DISPOSITIVO DE COMPRESIÓN
para cubos de 70,7 mm de lado.
BS 4550.
Ver pág. 322
E171
E171-01
C123N
SOFTWARE “Servonet” para ensayos de compresión y de flexión.
Desarrollado para el manejo totalmente automático y control
remoto desde un PC. Para ser utilizado con mod. E183N.
Ver pág. 14
E172-02
DISPOSITIVO DE FLEXIÓN para probetas de mortero de
40x40x160 mm. ASTM C348. Ver pág. 322
E161-05 SUPLEMENTO, 50 mm de altura
C123N
Software “Servonet”
E161-06 SUPLEMENTO, 25 mm de altura
Nota: los dispositivos de compresión no requieren ningún suplemento.
C127N
IMPRESORA GRÁFICA de papel térmico incorporada.
C127-11 PAPEL TÉRMICO, rollos de papel para impresora
(paquete de 10 rollos)
H009-01
ORDENADOR PERSONAL, pantalla LCD de 17 “, teclado, mouse,
cables. La oferta del PC incluye la instalación del software.
C097-05
CLASE 1, a partir de 1% de toda la escala. Con un procedimiento
de calibración especial, es posible garantizar la clase 1 a prácticamente todo el rango de la máquina.
instrumentos para ensayos de materiales
CEM E N TOS – M O RT E RO S
Dispositivos de compresión
E171
Que se colocan entre las placas de compresión de la máquina; encajan perfectamente sin quitar nada y sin añadir ningún espaciador.
Dimensiones: 153x153xh185 mm
Dispositivo de compresión para cubos de 50
mm y 2”de lado
sección E
MODELOS:
E170
Dispositivo de compresión para porciones
de probetas prismáticas de 40,1x40x160
mm rotas a flexión
NORMAS: EN 196-1 / ASTM C349 / NF P15-451
EN ISO 679
Las placas de compresión tienen una dureza de 60 HRC y plato
superior con rótula. Las clavijas de centrado se encuentran a 10
mm del plato de compresión, según lo solicitado por las especificaciones de la EN 196-1.
Cadmiado para protección contra la oxidación.
Peso: 12 kg
322
E170
ACCESORIO PARA MOD. E170
E170-11
Centrado enchufe
NORMA: EN 1015-11
Fija en el dispositivo E170 en sustitución de las clavijas de centrado
estándar, modifica la distancia del plato de compresión a 16 mm,
conforme a lo solicitado por las especificaciones de la Norma
EN 1015-11.
NORMA: ASTM C109
Placas de diámetro: 75 mm
y el rodillo superior está
montado sobre una rótula.
Este dispositivo se puede
utilizar también para ensayar
testigos con una altura
máxima de 50 mm.
Dimensiones:
153x153xh185 mm
Peso: 12 kg
E171
E171-01
Dispositivo de compresión para cubos de
70,7mm de lado
NORMA: BS 4550
Se puede utilizar también para ensayos de testigos con una altura
máxima de 70 mm.
Dimensiones:
150x130xh185 mm
Peso: 9 kg
E171-01
E172-01
Dispositivo de flexión para probetas
prismáticas de 40,1x40x160 mm
NORMAS: EN 196-1 / NF P15-451 / DIN 1164 / EN ISO 679
El apoyo superior está montado sobre una rótula.
La distancia entre los apoyos inferiores es de 100 mm y uno de ellos
tiene una rótula. Cadmiado para protección contra la oxidación.
Dimensiones: 160x153xh185 mm
Peso: 11 kg
E170-01
Dispositivo de compresión para porciones
de probetas prismáticas de 40,1x40x160
mm rotas en flexión
NORMA: DIN 1164
Idéntico al mod. E170 pero con
los platos de compresión de
40x62’5 mm de tamaño, según
lo solicitado por las Normas DIN.
Peso: 12 kg
E172-01
E172-02
Dispositivo de flexión para probetas
prismáticas de 40x40x160 mm
E170-01
instrumentos para ensayos de materiales
NORMA: ASTM C348
Idéntico al mod. E172-01, pero los apoyos inferiores se encuentran
a una distancia de 119 mm según los requisitos de la norma ASTM.
Peso: 11 kg
C EMENTO S – MO RTE ROS
COMBINADO DE DOS PRENSAS
Opción de actualización:
sección E
- ENSAYOS DE COMPRESIÓN Y FLEXIÓN EN PROBETAS DE
MORTERO
- ENSAYOS DE COMPRESIÓN EN PROBETAS CÚBICAS Y
CILÍNDRICAS DE HORMIGÓN, MUESTRAS DE BLOQUES,
ELIGIENDO UNA PRENSA DE COMPRESIÓN ESTANDAR
ENTRE NUESTROS DIFERENTES MODELOS DISPONIBLES
DE 1300 kN A 5000 kN (ver sección de hormigón de pág. 140 a
pág. 188)
La composición del grupo combinado se obtiene:
C092-05
Prensa de compresión en probetas de
mortero de 250 kN o 500 kN de capacidad, (mod. E159D,
C055 ejemplo
E159-01D, E159N, E159-01N, E161A, E161-02A, E161N, E161-02N;
detalles técnicos y accesorios específicos a las pág. 312 ÷ 315) se
completa con un transductor de presión que se utiliza en conjunción con una máquina digital de compresión de hormigón
(Digitec, Autotec, Cyber-Plus / Servo-Plus Evolution, consulte
pág. 140 ÷ 188).
C092-05
323
C092-06
Prensa de Compresión / Flexión para
probetas de mortero, doble rango:
0-250 kN (o 500 kN) para ensayos de compresión,
0-15 kN para ensayos de flexión (mod. E160N, E160-01N, E16101N, E161-03N, detalles técnicos y accesorios específicos en pág.
316 ÷ 319) completa con dos transductores de presión se utiliza
junto con una máquina digital de compresión de hormigón
(sólo para los modelos Cyber – Plus / Servo-Plus Evolution,
ver pág. 140 ÷ 188).
C056 ejemplo
C092-06
Además de los grupos propuestos, se pueden hacer combinaciones de muchos otros grupos de ensayo alternativos, con el sistema de
medida con pantalla digital; como por ejemplo:
- Grupo formado por dos prensas de compresión de hormigón.
EJEMPLO DE GRUPO
- Grupo formado por una prensa de flexión de hormigón y una
prensa de compresión de mortero.
EJEMPLO DE GRUPO
instrumentos para ensayos de materiales
sección E
CEM E N TOS – M O RT E RO S
324
E190N
E190N + E183N
Determinación del MÓDULO DE ELASTICIDAD en la compresión de los productos
y sistemas para la protección y reparación de estructuras de hormigón (Morteros)
Sistema Automático con control de velocidad incluso en la liberación de la carga
NORMA: EN 13412
Se puede utilizar con las máquinas de ensayos MATEST a seleccionar
entre los modelos Servo-Plus Evolution (ref. C104N, ver pág.130).
El equipo incluye:
• El sistema hidráulico
Se trata de una instalación hidráulica que presenta una válvula de alto
rendimiento controlada directamente por la unidad digital que garantiza
el control automático del gradiente de carga, manteniendo una cierta
carga y el control del gradiente de carga en descenso (al disminuir la
carga).
El control del gradiente de carga se realiza por una válvula muy sensible
accionada por un motor paso a paso y permite una acción micrométrica sobre el gradiente garantizando excelentes resultados.
Un sensor de posición láser permite un posicionamiento rápido del
pistón, garantizando un suave contacto al inicio del ensayo de alrededor
de 0,1 por mil de la capacidad máxima.
• Sistema electrónico de medida
Las elevadas prestaciones del control y de la unidad de procesamiento
de datos, son controlados por un microprocesador de 32 bits, que
puede gestionar hasta 8 canales de alta resolución para el control de
las células de carga o transductores con puente de galgas extensiométricas.
instrumentos para ensayos de materiales
C134
La unidad contiene dos convertidores Analógico/Digital de última de
generación con una resolución de 24 bits. El sistema procesa las señales
procedentes de las células de carga y de los extensómetros almacenando todos los resultados necesarios para su posterior procesamiento
según las Normas internacionales actualizadas para esta aplicación.
• Software UTM2 para la adquisición y elaboración de datos
Licencia para el módulo elástico según la norma EN 13412.
El software ha sido desarrollado en la línea funcional del ya conocido
software UTM-2 (menú Windows).
Contiene los parámetros de las principales normas utilizadas, pero que
el usuario pueda modificar según desee, personalizando el perfil del
ensayo, que será luego ejecutado de forma totalmente automática por
la máquina de ensayo.
C EMENTO S – MO RTE ROS
El software ofrece la posibilidad de imprimir en una impresora estándar un certificado del ensayo donde se indican todos los datos relativos al ensayo y
el gráfico del ensayo. El software incluye la licencia “Servonet” mod. C123N, mientras que las galgas extensométricas (se proponen dos modelos: A y B)
no se incluyen en el suministro estándar y deben solicitarse por separado (ver accesorios).
NOTA:
El módulo de elasticidad en Morteros mod E190N se puede
utilizar junto con:
A) GALGAS EXTENSÓMETRICA (MEDIDORAS DE ESFUERZO)
DE UN SOLO USO, ELÉCTRICOS, disponibles en diferentes
tamaños, mod. C125-10 hasta C125-13 (ver accesorios),
o:
sección E
El usuario puede introducir una serie de datos relativos a la muestra que se ensaya y el tipo de ensayo que se desea realizar, por ejemplo: la forma de
la muestra (probeta cilíndrica - probeta cubica-bloque), dimensiones, edad de la muestra, promedio de resistencia de rotura, etc.... El equipo permite la
verificación de la lectura corregida de las galgas extensométricas y, si todo está dentro de las tolerancias previstas, se gestiona el valor de la deformación
media indicada en los transductores y se procesa en la unidad digital, que se transmite por medio de un puerto RJ (conexión de red) de comunicación
en serie a un ordenador personal, que puede ser propiedad del usuario final o suministrado por separado (no incluido con el Software), todos los datos
del ensayo. Estos datos son procesados por el software transformándolo posteriormente en un gráfico de carga/deformación y carga / tiempo, siguiendo
las Normas internacionales.
B) EXTENSÓMETROS / COMPRESSOMETROS, electrónicos,
universales, bastidor mecánico, mod. C134 (ver accesorios)
ACCESORIOS:
A) GALGAS EXTENSOMÉTRICAS (MEDIDORAS DE
ESFUERZO), DE UN SOLO
USO, ELÉCTRICOS
Paquete de 10 unidades
325
Pantalla durante un ensayo y un marcador que indica un cambio.
C125-10...C125-13
Modelos disponibles:
C125-10 Galga extensométrica eléctrica, longitud de base 10 mm
C125-11 Galga extensométrica eléctrica, longitud de base 20 mm
C125-12 Galga extensométrica eléctrica, longitud de base 30 mm
C125-13 Galga extensométrica eléctrica, longitud de base 60 mm
C125-15 KIT para la aplicación de las galgas extensométricas
de un solo uso, compuesto por: cola, soldador, líquido
limpiador, accesorios y todo contenido en un maletín.
C125-09
MÓDULO DE INTERFAZ, “accesorio necesario” para conectar
hasta 4 galgas extensométricas eléctricas de un solo uso. Este
módulo permite también la
calibración automática del
cero y del rango de medición
después de una compensación
térmica especial. Esto garantiza
una precisión cinco veces
C125-09
superior a la solicitada por las
Normas
Personalización del
certificado del ensayo
COMO ALTERNATIVA:
B) C134
EXTENSÓMETRO / COMPRESSOMETRO, ELECTRÓNICO,
UNIVERSAL, BASTIDOR MECÁNICO.
Puede ser utilizado únicamente con muestras con una altura
mínima de 130 mm. Detalles técnicos: ver pág. 192
C134-10 PLANTILLA, para regular y calibrar la longitud de la
base de la galga extensométrica C134
Personalización y composición de
un perfil de ensayo
C134
instrumentos para ensayos de materiales
326
instrumentos para ensayos de materiales
sección H
Sección H
ACEROS
AC EROS
327
Esta sección Matest propone una amplia gama de máquinas
universales electromecánicas e hidráulicas para poder realizar
ensayos de tracción, compresión, flexión, doblado-desdoblado,
resiliencia sobre materiales metálicos, con la posibilidad de extender tales ensayos sobre materiales plásticos, goma, materiales
compuestos, alambres, cables, papel, textiles, etc.
Este surtido de máquinas satisface las exigencias de control sobre las barras de armaduras del hormigón, así como los ensayos
de calidad en el campo de la siderurgia, metales, plásticos, etc.
instrumentos para ensayos de materiales
AC E ROS
H003N
sección H
Máquina universal hidráulica 600 kN servocontrolada mediante sistema digital
3ERVO0LUS%VOLUTIONCONPANTALLATfCTIL para realizar ensayos estáticos
de tracción en materiales metálicos. NORMAS: EN 10002 / EN ISO 6892, 7500-1 / ASTM A370
328
Básicamente consiste en:
- un gran bastidor de carga con una célula de carga integrada en el
pistón
- un sistema de control hidráulico Servo-Plus Evolution con pantalla
táctil (ver detalles técnicos en la pág. 130; detalles del hardware en la
pág. 24), para la adquisición, el control y el procesamiento de datos.
La estructura del bastidor está diseñada para efectuar ensayos de
tracción por medio de las mordazas situadas en los cabezales de
sujeción, mientras en la parte superior entre el cabezal y el puente
se pueden efectuar ensayos de flexión, compresión, plegamiento,
dureza, prensado y otros ensayos según las Normas Internacionales,
usando los dispositivos adecuados (ver accesorios).
La central hidráulica servocontrolada permite el control del gradiente de carga. Un dispositivo de emergencia permite en cualquier
momento el paro inmediato de la máquina, siguiendo las Normativa
Internacionales de Seguridad.
Un pedal de control situado en la prensa dirige
el movimiento de la cabeza de tracción inferior (0 ÷ 580 mm de
recorrido con interruptores eléctricos de final de carrera) para un
posicionamiento más fácil de la muestra de acuerdo a su longitud.
La máquina se suministra completa con bastidor de carga, consola
torre de control de la prensa, y bancada, mientras que el software
(mod. H009N), los extensómetros (mod. H014 a H014-10) las
mordazas y la impresora “son opciones que deben pedirse por
separado”, según las necesidades del usuario.
CARACTERÍSTICAS TÉCNICAS:
Capacidad ....................................................................600 kN
Recorrido máximo del puente ........................200 mm
Distancia máxima entre mordazas.................647 mm
Anchura puente de flexión ................................190 mm
Distancia máxima apoyos de flexión ............1000 mm
Distancia máxima placas de compresión.........235 mm
Lectura de carga.......................................................Detección por célula
de carga. Resolución de
0,01% U.V.
Precisión ........................................................................Clase 1 EN 10002-2. Sólo
lectura de la escala
1:1 -1:20 U.V.
Lectura del recorrido ............................................Detección por transductor lineal. Resolución de
0,01 mm
Lectura de la deformación .................................Detección por extensómetro electrónico
(accesorio). Resolución
de 0,001 mm
Precisión ........................................................................Clase B 2 (B 1 para bases
hasta 50 mm) ASTM E83
Altura necesaria ........................................................4050 mm
El peso maquina ......................2.600 kg aprox.
Dimensiones consola ...........610x630xh.1600 mm
Alimentación .............................230V 50Hz monofásica
2kW
H003-99
KIT PARA LA ENTREGA DE LA
MÁQUINA
El kit está compuesto por diferentes dispositivos mecánicos para la
alineación de la máquina permitiendo su transporte. La cantidad de
este kit es totalmente reembolsada
al cliente si el equipo se devuelve a
Matest después de la entrega.
H003N con accesorios
instrumentos para ensayos de materiales
ACCESORIOS PARA EL MOD. H003N
MORDAZAS REDONDAS Y PLANAS. Un conjunto se compone
de dos dobles pares que deben situarse en el cabezal de tracción
superior y en el inferior.
H003-03 Conjunto de mordazas para probetas planas de espesor
2-18 mm, ancho max de 80 mm, y probetas redondas
de diámetro 5-12 mm.
H003-04 Conjunto de mordazas para probetas planas de espesor 18-36 mm, ancho max de 80 mm.
H003-07 Conjunto de mordazas para probetas redondas diámetro 12-24 mm.
H003-08 Conjunto de mordazas para probetas redondas diámetro 25-40 mm.
C128
Impresora gráfica formato A4 para la impresión de
Certificados o Gráficos del ensayo.
H003-12 Ensayos de plegado
NORMAS: UNI 564 / ASTM E290
El equipo se compone de un par de apoyos inferiores con soportes
regulables y un apoyo superior.
Carga máxima: 200 kN
Distancia máxima entre los apoyos inferiores: 1000 mm
Anchura apoyos: 120 mm
Diámetro apoyos: 50 mm
Peso: 70 kg
Nota: sobre pedido se suministran apoyos de diámetro diferente.
H003-13 Ensayos de compresión
NORMA: UNI 558
El equipo se compone de un plato superior con rótula y de un
plato inferior.
Carga máxima: 600 kN
Diámetro platos de compresión: 90 mm
Peso: 25 kg
sección H
AC EROS
H003-13
329
H003-03
H003-08
NOTA: para el software (H009N) y extensómetros
(H014 ÷ H014-10) ver pág. 335, 336.
ACCESORIOS PARA ENSAYOS EN METALES:
H003-11 Ensayo de flexión
NORMA: UNI 559
El equipo se compone de un par de apoyos inferiores con soportes regulables y un apoyo superior.
Carga máxima: 200 kN
Distancia máxima entre los apoyos inferiores: 1000 mm
Anchura apoyos: 120 mm
Diámetro apoyos: 50 mm
Peso: 70 kg
H003-14 Ensayo en mallas electro soldadas
Dispositivo de anclaje para mallas electro soldadas, para utilizarse
con las mordazas para probetas planas.
Peso: 5 kg
ACCESORIOS PARA ENSAYOS EN HORMIGÓNES:
H003-21
Prueba de compresión en muestras de cubo de
hormigón, máx. 150 mm lado
El equipo se compone de:
Plato superior diámetro 287 mm con rótula.
Plato inferior diámetro 287 mm.
Luz máxima entre platos: 185 mm.
Peso: 60 kg
H003-22
Ensayo de flexión en probetas prismáticas de hormigón
H003-11
de 100x100x400/500 mm y de 150x150x600/750 mm.
NORMAS: EN 12390-5 / BS 1881:118 / ASTM C78, C293
AASHTO T97 / NF P18-407 / UNI 6133
Compuesto por dos apoyos inferiores y uno superior.
Carga máxima: 200 kN
Distancia máxima entre los apoyos inferiores: 1000 mm
Anchura apoyos: 160 mm
Peso: 40 kg
instrumentos para ensayos de materiales
AC E ROS
H002N
Máquina Hidráulica servocontrolada de 600 kN de capacidad con sistema digital
3ERVO0LUS%VOLUTIONCONPANTALLATfCTIL para realizar ensayos estáticos
sección H
de tracción en materiales metálico. NORMAS: EN 10002 / EN ISO 6892, 7500-1 / ASTM A370
330
La máquina consiste básicamente en:
- robusto bastidor de carga con célula de carga eléctrica para las lecturas de carga y transductor lineal de desplazamiento en el pistón
- grupo hidráulico y sistema Servo-Plus Evolution con pantalla táctil
(detalles técnicos: ver pág. 130; detalles del hardware: ver pág. 24),
ubicado en una consola, para la adquisición, control y procesamiento de datos.
La prensa está diseñada para realizar ensayos de tracción por medio
de las mordazas situadas en los cabezales de sujeción, de acuerdo
con las Normas Internacionales anteriormente mencionadas.
El sistema hidráulico servo-controlado regula el paso de carga.
Un dispositivo de emergencia permite detener la máquina en
cualquier momento de acuerdo con las normas de seguridad CE.
La cabeza de tracción inferior se puede ajustar en altura a través de
un motor eléctrico, para un posicionamiento más fácil de la muestra
de acuerdo a su longitud.
Las morzadas son de accionamiento neumático
a través de un compresor (accesorio mod. V206).
La máquina se suministra completa con bastidor de carga y consola
de control, mientras que, el software (H009), las morzadas, la
impresora y extensómetros (H014 a H014-10) que se describe
en las páginas siguientes “son opcionales y debe pedirse por
separado”, de acuerdo a las necesidades de cada usuario.
ESPECIFICACIONES TÉCNICAS:
Capacidad ..............................................................................600 kN
Distancia entre las mandíbulas de min / máx. ....100/800 mm
Distancia adecuada entre las mordazas para ensayo ...450 mm
Pistón superior de carga hidráulica, recorrido....300 mm
Cabeza de tracción inferior, recorrido...................400 mm
Distancia ideal entre las mordazas para ensayo...500 mm
Luz entre columnas verticales ....................................440 mm
Lecturas de carga...............................................................Detección por célula
de carga Resolución de
0,01% U.V.
Precisión..................................................................................Clase 1 EN 10002-2
Lecturas de deformación ..............................................Detección por
transductor lineal
Resolución de 0,01 mm
Altura necesaria ..................................................................3200 mm
Dimensiones de la prensa ............................................860x480x3000 mm
Dimensiones de la consola ..........................................610x630x1600 mm
Peso total:...............................................................................2200 kg aprox.
Alimentación:........................................................................230V 50Hz monofásica 2kW
ACCESORIOS PARA LA MÁQUINA H002N
MORDAZAS para los ensayos sobre muestras
redondas y planas. Un juego consiste en dos pares
dobles de morzadas que se colocan en la cabeza de
tracción superior e inferior.
H002-03 Juego de mordazas para muestras
planas 1-12 mm de espesor, muestras
de ancho máx.65 mm, y muestras
redondas de 1-12 mm de diámetro
H002-04 Juego de morzadas para muestras
redondas de 13 a 23 mm de diámetro
H002-05 Juego de morzadas para muestras
redondas de 24 a 35 mm de diámetro
V206
COMPRESOR de aire de laboratorio.
Detalles técnicos: ver pág. 454
H002-03
NOTA:
H002
instrumentos para ensayos de materiales
H002-04
El SOFTWARE mod H009N y los EXTENSÓMETROS
mod. H014 a H014-10 se describen en la pág. 335, 336
sección H
AC EROS
331
instrumentos para ensayos de materiales
AC E ROS
sección H
Máquina de ensayo universal
electromecánica servocontrolada
332
Proyectada y realizada para su uso en laboratorios de control de
calidad e investigación de materiales metálicos, plásticos, materiales
compuestos, alambres, cables, papel, textiles, etc. para la ejecución de
ensayos de tracción y alargamiento en materiales, según la Normas
EN 10002 / EN ISO 6892, 7500-1 / ASTM A370.
La máquina se compone de una robusta base que contiene el
equipo de transmisión y la instrumentación Hardware del control.
La base sostiene dos columnas de guía del puente, fabricadas en
acero de alta resistencia y sus superficies de cromo duro. El gran
diámetro y la disposición de las columnas garantizan una gran
rigidez lateral. El sistema es apropiado para la ejecución de ensayos
mono direccionales y bidireccionales.
La transmisión del movimiento al puente móvil se realiza por medio
de dos husillos con recirculación de bolas y tuercas pretensadas
para garantizar la ausencia de juegos.
Se pone gran atención en el sistema de montaje de los husillos y de
los grupos de cojinetes situados en la base y en el cabezal superior.
El puente móvil de gran sección y el sobredimensionamiento de
todos los elementos aseguran una gran “Rigidez de la máquina” (ver
UNI ISO 5893).
El movimiento del puente superior sobre las columnas de guía
se realiza a través de casquillos de bronce sinterizado de bajo
coeficiente de fricción.
Sobre el puente móvil hay una serie de agujeros para el montaje de
las células de carga.
La célula de carga de acero inoxidable permite realizar cargas
de tracción y compresión con gran precisión y de acuerdo a las
Normas EN 10002-2 / EN ISO 6892, 7500-1
Características de la célula según Norma ISO 376:
Precisión de Clase ..............................................................................1
Error relativo de repetibilidad .......................................................≤ ± 0.145%
Error relativo de interpolación .....................................................≤ ± 0.090%
Error relativo de cero ........................................................................≤ ± 0.03%
Error relativo de reversibilidad .....................................................≤ ± 0.240%
Error de no linealidad.........................................................................≤ ± 0.04%
Capacidad máxima de sobrecarga..............................................200%
Sobre el bastidor pueden montarse células de carga de varias capacidades intermedios a la carga nominal de la máquina para poder
responder a las exigencias de cada aplicación específica.
Sobre el puente móvil y sobre la base están previstos puntos de
agarre para el montaje de varios dispositivos de anclaje y de ensayo
(ver accesorios en las páginas siguientes).
La máquina comprende una serie de dispositivos para la limitación
del recorrido máximo del puente. Hay además un dispositivo
regulable que permite colocar un límite superior y uno inferior
personalizado en función del accesorio montado.
El equipo de control está formado por una serie de placas electrónicas, situadas en el interior de la base, que gestionan las unidades
de control y las unidades de lectura situadas en la máquina.
La placa electrónica de adquisición tiene un potente microprocesador y convertidor AD 24 bits, toma los datos del funcionamiento y
a través de la conexión RS 232 manda dichos datos a un PC, que
controla las funciones de la máquina y elabora todos los cálculos
gracias al programa UTM2.
Sobre la base se encuentran:
dispositivo que permite un fácil y rápido posicionamiento del
puente móvil, un botón para interrumpir la ejecución del ensayo
en cualquier momento, una serie de conectores para la conexión al
PC de control y a los dispositivos auxiliares (extensómetros, células
de carga, etc.), interruptor general/emergencia.
NOTA:
El SOFTWARE. mod H009N y
los EXTENSÓMETROS mod.
H014 a H014-10 se describen
en las pág. 335, 336
H007 + H009 + H009-01
instrumentos para ensayos de materiales
AC EROS
MODELOS DISPONIBLES:
MODELO
H004
H005
H006
H007
H008
CAPACIDAD
CARGA kN
10
50
100
200
600
VELOCIDAD
DE ENSAYO
mm/min
Mínimo
Máximo
0,01
500
0,01
500
0,01
500
0,01
480
0,01
300
VELOCIDAD DE
POSICIONAMIENTO
mm/min.
500
500
500
480
250
CARRERA MÁXIMA
DEL PUENTE
(*) mm
1130
1130
1180
1150
1500
LUZ DEL LUGAR
DE TRABAJO
Vertical mm (**)
Horizontal mm
H008 + H009-01 + H009
- La alimentación no debe presentar picos de tensión, sobretensiones o sobrecorrientes transitorias o caídas de tensión superiores
al 10% de la tensión nominal.
- Temperatura de funcionamiento de + 10 ºC a + 38 ºC.
- Rango de humedad de + 10% a + 90%, sin condensación
333
1253
421
1251
421
1310
600
1280
600
1510
713
DISTANCIA MÁXIMA
ENTRE LOS CABEZALES
mm (***)
630
612
510
480
550
DIMENSIONES mm
Altura
1708
Anchura
550
Profundidad
683
PESO kg
250
1845
810
670
370
2340
1370
700
1000
2340
1370
700
1150
3000
1465
930
2600
ALIMENTACIÓN 230V 1F 230V 1F 400V 3F 400V 3F 400V 3F
50 Hz 50 Hz 50 Hz 50 Hz 50 Hz
POTENCIA
CONSUMIDA EN W 1000
(*)
(**)
H005 + H009-01 + H009
sección H
Las columnas se encuentran protegidas por marcos metálicos y los tornillos han sido fabricados con aluminio anodizado; los cierres de las caras
interiores están provistos con fuelles anti polvo y todas las partes exteriores e interiores están tratadas adecuadamente contra la corrosión.
Los siguientes equipos no están incluidos por lo que deben pedirse
aparte (ver páginas siguientes):
- Ordenador mod. H009-01 (indispensables para el funcionamiento de la máquina).
- Software standard UTM2 modelo H009 (indispensable para el
trabajo del equipo).
- Programas especiales personalizados (siguiendo la demanda de
los clientes)
- Accesorios para la sujeción de las muestras.
- Impresora modelo C128
- Extensómetros modelo H014 a H014-10
- Otros accesorios
1200
2000
3000
3000
La carrera del puente se refiere a la distancia entre
la superficie superior de la base y la superficie inferior del puente, esto no incluye la célula de carga,
mordazas, dispositivos varios, etc.
La luz vertical del lugar de trabajo es la distancia
entre la superficie superior de la base y la superficie
inferior del puente, sin la célula
de carga, mordazas y otros
dispositivos.
(***) La distancia máxima entre los
cabezales de tracción es la distancia entre las mordazas cuando
el puente está en el punto
muerto superior. En la práctica es
la parte de la probeta que queda
libre entre los cabezales.
H004 + H009-01 + H009
…sigue…
instrumentos para ensayos de materiales
AC E ROS
ACCESORIOS:
MOD. DE MÁQUINA H004
CAPACIDAD
10 kN
H005
H006
H007
H008
50 kN
100 kN
200 kN
600 kN
Conexiones para instalación de los
cabezales o dispositivos H005-40 H005-40 H007-40 H007-40
sección H
Cabezales de tracción H005-11 H005-11 H007-11 H007-11 H008-11
334
Cuñas de anclaje
planas para probetas:
Espesor de las muestras planas
0÷10 mm
Anchura máxima 25 mm
Muestras redondas
Ø 3÷5 mm
H005-21 H005-21
Espesor de las muestras planas
0÷10 mm
Anchura máxima 50 mm
Muestras redondas Ø 3÷10 mm
H007-21 H007-21
Espesor de las muestras planas
11÷22 mm
Anchura máxima 50 mm
H007-22 H007-22
Espesor de las muestras planas
0÷12 mm
Anchura máxima 70 mm
Muestras redondas Ø 3÷10 mm
H008-21
Espesor de las muestras planas
12÷24 mm
Anchura máxima 70 mm
H008-22
Espesor de las muestras planas
24÷36 mm
Anchura máxima 70 mm
H008-23
Cuñas de anclaje en
forma de “V” para
probetas redondas:
Diá. 5 ÷ 12 mm
H005-31
Diá. 11 ÷ 18 mm
Diá. 18 ÷ 25 mm
Diá. 25 ÷ 32 mm
Diá. 11 ÷ 22 mm
Diá. 23 ÷ 34 mm
Diá. 35 ÷ 45 mm
Diá. 45 ÷ 55 mm
Accesorio para
compresión
H005-41
Accesorio de anclaje con
rodillo estriado
H005-42
Accesorio para tracción de
alambres y cables
H005-43
Dispositivo de flexión y plegamiento
en 3 puntos
H005-44
Dispositivo de
centrado
para probetas
instrumentos para ensayos de materiales
H005-31
H007-31 H007-31
H007-32 H007-32
H007-33 H007-33
H008-31
H008-32
H008-33
H008-34
H005-41 H007-41 H007-41 H008-41
H005-42
H005-43
H005-44 H007-44 H007-44 H008-44
H005-51 H005-51 H005-51
H005-11 - H007-11 - H008-11
Pareja de cabezales de tracción con diferentes
capacidades. Fabricados en acero tratado y mecanizados cuidadosamente, tienen una geometría que
garantiza un efecto de autoacoplamiento sobre la
probeta de las cuñas de anclaje. Un dispositivo a tornillo
permite el correcto funcionamiento de las cuñas de
anclaje, garantizando un bloqueo correcto de la
probeta, empezando por las cargas más bajas
y reduciendo al mínimo el desplazamiento del
puente derivado del efecto de la penetración de
los dientes de las cuñas en la probeta.
Todos los pares de cabezales de tracción se suministran con:
- llave para el montaje y desmontaje de las cuñas de anclaje
- bote de grasa especial para una correcta lubricación.
H005-21
Cuñas de anclaje para pletinas de espesor 0 ÷ 10 mm, anchura
máxima 25 mm y para probetas redondas
diá. 3 ÷ 5 mm. El conjunto se compone de
H005-21
un doble par de cuñas.
H005-31
Cuñas de anclaje en forma de “V”
para probetas redondas diá. 5 ÷ 12 mm.
El conjunto se compone de un doble par
H005-31
de cuñas.
H005-41
Dispositivo de Compresión, compuesto por un plato superior con
rótula y de uno inferior fijo.
H005-42
Dispositivo de anclaje con rodillo estriado, compuesto por un par
de cuñas con capacidad máxima hasta
20 kN, idóneo para ensayar láminas de
plástico de un cierto espesor y dureza, así
como materiales similares.
H005-43
H005-41
Dispositivo de tracción para alambres
y cables. Compuesto por un par de
ruedecitas autoalineadas apropiadas para
tracciones sobre alambres y cables de
pequeña sección y máxima capacidad de
H005-42
carga hasta 20 kN.
H005-44
Dispositivo de flexión y plegamiento
en 3 puntos, apropiado para ensayos
de flexión y plegamiento de probetas
redondas y planas.
H005-43
H005-51
Dispositivo de centrado para probetas.
Este dispositivo se compone de un
par de rodillos montados sobre bases
regulables atornilladas en los cabezales
H005-44
de tracción. Regulando las bases según
las dimensiones de la probeta se obtiene un tope que permite un
rápido y preciso posicionamiento de la probeta en las cuñas planas.
Este accesorio se usa solo en las máquinas de 50kN, 100kN, 200kN
de capacidad (mod. H005, H006, H007).
AC EROS
H014
Extensómetro electrónico
Medición base 50 mm, rango de deformación +1 mm / -0,2mm.
Porcentaje máximo medible de
deformación: 2%. Es posible medir
las deformaciones longitudinales de la
probeta durante el ensayo de tracción.
Se obtiene una gráfica tensión /
deformación, pudiendo identificarse en
este gráfico el coeficiente
de elasticidad junto con las
H014
cargas RP0.1 - RP0.2 - Rt1,
incluso en los materiales que
no presentan un límite de
elasticidad claramente identificable.
El aparato se suministra completo con
cables de conexión.
Extensómetro electrónico para los ensayos
de deformación a la fuerza de tracción
hasta la rotura
Este extensómetro electrónico coaxial, se utiliza para medir la deformación de una probeta de ensayo a tracción hasta su rotura.
El extensómetro se fija directamente a la muestra y permanece
conectado hasta la rotura, midiendo la deformación tanto en la fase
elástica como en la plástica. La medición base de probetas redondas:
5 x diámetro de la probeta. Se suministra completo con 4 separadores para la muestras de diámetros intermedios al rango de medida
específico, cable de conexión, accesorios, estuche de transporte.
sección H
ACCESORIOS PARA MOD. H003N, H002N
y para MOD. H004 a H008:
335
H003-18
H014-07
Extensómetros para cordones de cables
trenzados
NORMA: UNI 7676
El instrumento se aplica directamente sobre la muestra a través
de dos tubos telescópicos coaxiales endurecidos para medir la
deformación / alargamiento del cordón hasta la rotura.
Se suministra completo con precisión electrónica transductor de
50 mm de carrera y 0,005 mm de sensibilidad.
Medición base: 600 mm
El extensómetro H003-18 puede ser utilizado sólo con
el mod. H003N
Dimensiones: 105x630 mm
Peso: 1000 g
Modelos:
H014-06 Extensómetro para barras redondas de 4,5 a 11 mm
diámetro. Desplazamiento del transductor: 25 mm
H014-07 Extensómetro para barras redondas 10 a 19 mm
diámetro. Desplazamiento del transductor: 50 mm
H014-08 Extensómetro para barras redondas 18 a 27 mm
diámetro. Desplazamiento del transductor: 50 mm
H014-09 Extensómetro para barras redondas 26 a 36 mm
diámetro. Desplazamiento del transductor: 50 mm
H014-10 Extensómetro para muestras planas, ancho máximo 25
mm; espesor máximo 10 mm. Medición base: 25 - 50
- 60 - 70 mm. Desplazamiento del transductor: 50 mm
H003-18
H003-18
Montado en la máquina
H003N
H014-06
con los accesorios
…sigue…
instrumentos para ensayos de materiales
AC E ROS
ACCESORIOS PARA MOD. H003N, H002N
y para MOD. H004 a H008:
H009N
sección H
SOFTWARE UTM2
NORMAS: EN 10002-1 / ISO 527, 178, 604, 898-1, 3506-1,
10113, 12275 / ASTM A370
Este software, que se ha desarrollado siguiendo el UTM2, se ha
realizado siguiendo el método de trabajo del sistema operativo de
Microsoft Windows.
El programa ha sido concebido de forma abierta e interactiva y
es la solución ideal para una gestión completa y eficiente de los
ensayos de materiales.
Se compone de numerosos procedimientos de ensayo de acuerdo
con las Normas Internacionales para realizar ensayos en materiales
metálicos, plásticos, cemento, materiales compuestos y madera.
336
los datos específicos de la probeta tales como tipo, dimensiones,
unidad de medida…
El usuario puede seleccionar y configurar los cálculos correspondientes a la Norma elegida. Como ejemplo para la Norma EN
10002/1 puede seleccionar la longitud inicial, la sección inicial de la
probeta, el cálculo de la carga máxima, la carga unitaria, los límites
elásticos (ReH, ReL, Rp%), la estricción, el módulo de Young…
Para algunos cálculos el usuario, puede introducir los parámetros
para la ejecución del algoritmo correspondiente de cálculo, como
por ejemplo para la desviación de la proporcionalidad Rp puede
introducir el porcentaje %.
El software permite una gestión rápida y simple de todos los
parámetros de la máquina tales como la gestión de adquisición de
la carga mediante una célula de carga, las deformaciones de la probeta mediante un extensómetro y del desplazamiento del puente.
Para cada uno de los canales analógicos el usuario puede introducir
la unidad de medida de calibración y visualización, y los límites de
utilización: alarma, valor de inicio del cálculo del ensayo, etc.
La introducción de los datos del ensayo se hace subdividiendo el
proceso en diferentes fases o plantillas de velocidad, para cada una
de ellas es posible introducir el tipo de control (gradiente de carga,
carga/tiempo, deformación/tiempo), las opciones de tara y puesta a
cero, los límites y los cambios de fase o de velocidad.
Además se puede seleccionar la modalidad de fin de ensayo y el
eventual límite de rotura.
El software permite personalizar e introducir los parámetros de
visualización del gráfico de ensayo y el color, la etiqueta de los ejes
cartesianos, el color de la función carga/deformación y los parámetros del certificado tales como títulos, márgenes…
Ensayo de tracción en una muestra de acero sin extensómetro, visualizándose el
inicio de la ruptura de la muestra con la posibilidad de aumentar las dimensiones
del área de la gráfica por medio de la función zoom.
La concepción flexible de este programa cubre una amplia gama
de necesidades de cálculo para ensayos de tracción, compresión y
flexión.
El técnico tiene la posibilidad de personalizar nuevos perfiles de
ensayos: definición de los datos del ensayo tales como la fecha
del ensayo, el número de certificado, lote de material de entrega,
origen de la probeta, temperatura de ensayo… y definición de
Ejemplo de impresión de certificado de ensayo
Al final del ensayo el usuario puede decidir realizar o no los
cálculos seleccionados o archivar el ensayo. En cualquier momento
todos los ensayos realizados están disponibles para un eventual
análisis de resultados o para la impresión de certificados.
Se pueden efectuar análisis de gráficos del ensayo mediante la
función zoom.
Ensayo de tracción en una muestra de acero con un extensómetro mostrando los símbolos de la
dimensiones a considerar y la localización relativa en diferentes colores seleccionables por el usuario.
instrumentos para ensayos de materiales
C128
IMPRESORA LASER, modelo de
sobremesa, para gráficos y certificados con conexión directa a través
de USB.
AC EROS
S205-05
UNITRONIC 50 kN, PRENSA UNIVERSAL MULTIENSAYOS PARA:
- ENSAYOS DE TRACCIÓN, 25 kN MAX. CAPACIDAD DE CARGA
- ENSAYOS DE COMPRESIÓN / FLEXIÓN, 50 kN MAX. CAPACIDAD DE CARGA
CON CARGA AUTOMÁTICA O CONTROL
DE DESPALZAMIENTO/ DEFORMACIÓN.
sección H
La carga es aplicada por un gato mecánico que es impulsado por un motor “sin
escobillas con circuito cerrado a través de un codificador óptico” y controlado por
un microprocesador. Interruptores eléctricos de final de carrera se aplican al pistón de
carga para salvar a la máquina de manipulaciones accidentales.
El panel de control se coloca de frente y se suministra con una membrana que tiene
6 pulsadores multifunción interactivos guiados por menú, una pantalla gráfica de gran
tamaño y un puerto RS 232 para conexión a PC.
Ensayos de tracción en metales, plásticos, cables,
textiles, etc.
Desarrollo de ensayos con control de carga.
Accesorios necesarios para las muestras de metales planas y redondas:
S337-36 Célula de carga a tracción de 25 kN de capacidad
H005-11 Cabezales de tracción (superior e inferior)
S205-09 Dispositivos para fijar las cabezas de tracción a la estructura
H005-21 Cuñas de anclaje para muestras planas de 1 a 10 mm de espesor
máximo y 25 mm de anchura y barras redondas de 1 - 5 mm diámetro
H005-31 Cuñas de anclaje en forma de “V” para barras redondas 5 - 12 mm de
diámetro.
S205-05
con la célula
de carga
Accesorios opcionales:
H014
Extensómetro electrónico, para los ensayos en tracción de tensión deformación.
H009N Software para la visualización en tiempo real el gráfico de la carga / deformación, el certificado de control, etc.
S205-05
accesorios para
ensayos de
tracción
En las páginas 334 y 335 del catálogo se enumeran los dispositivos para los ensayos
sobre plásticos, cables, textiles, ensayos de flexión y doblado así como diversos modelos
de extensómetros.
Diferentes materiales:
Mediante el uso de dispositivos adecuados, la prensa Unitronic,
dentro de los límites de su máxima capacidad de 50 kN para la
compresión/flexión, realiza ensayos de compresión, flexión, tracción
indirecta y de tracción directa sobre: hormigón, cemento, rocas,
materiales bituminosos, suelos, etc., con carga automática o control
del desplazamiento/deformación.
Para detalles técnicos de Unitronic y ensayos específicos adicionales:
ver pág. 384
S206
MULTI-ENSAYOS 200kN
PRENSA UNIVERSAL ELECTROMECÁNICA PARA ENSAYOS DE
TRACCIÓN EN METALES, CON SISTEMA DE CARGA SERVOCONTROLADO O DESPLAZAMIENTO/DEFORMACIÓN
La máquina también es adecuada para los ensayos sobre:
- Mezclas bituminosas (Marshall, Duriez, corte Leutner, Tracción
indirecta)
- Hormigón (flexión en vigas y tejas de arcilla, tracción indirecta en
probetas cúbicas y cilíndricas y adoquines, punzonado)
- Cemento y mortero (compresión y flexión)
- Suelos (CBR)
Detalles técnicos: ver pág. 390
S206
instrumentos para ensayos de materiales
337
AC E ROS
sección H
MÁQUINA UNIVERSAL TRACCIÓN/COMPRESIÓN
Sistema digital con 0ANTALLA4fCTIL
- Tracción de barras de acero para hormigón armado,
capacidad máxima 500 kN
- Compresión en probetas cúbicas y cilíndricas de hormigón,
capacidad máxima de carga 1500 kN
338
NORMAS: EN 10002 / EN ISO 6892, 7500-1 / ASTM C39, E4 / BS 1610 / NF P18-411 / AASHTO T22 / DIN 51220
Esta máquina, de dimensiones compactas se utiliza para ensayos de tracción de barras de armado de acero redondo de diámetro 6 a 25 mm, y
pletinas de máximo 25 x 15 mm. Además puede efectuar ensayos de compresión de probetas cúbicas de hormigón de lado máximo 150 mm y
cilindros de diámetro máximo 160x320 mm. La estructura de carga de 4 columnas asegura una gran estabilidad y rigidez. El pistón de doble efecto
está rectificado y pulido, disponiendo de un sistema de seguridad hidráulico de fin de carrera superior e inferior, evitando riesgos de eventuales daños
debido a errores de manipulación. Un distribuidor hidráulico permite seleccionar el ensayo de tracción o bien el de compresión. Las mordazas de
anclaje de las cuñas están hechas de un único bloque de acero al tungsteno para conseguir una dureza superior a 65 HRC. La geometría en “V”
autoblocante permite una rápida y práctica fijación de la probeta. Detalles técnicos del Hardware, ver pág. 24 La máquina se suministra completa con
los dos cabezales portacuñas pero “sin” accesorios para los ensayos de tracción y compresión, que deben pedirse separadamente (ver accesorios).
ESPECIFICACIONES TÉCNICAS:
- Capacidad máxima a tracción: 500 kN
- Capacidad máxima a compresión: 1500 kN
- Distancia entre las cuñas de tracción: mín. 300 mm
máx. 400 mm
- Distancia máxima entre los platos de compresión: 340 mm
- Distancia útil horizontal entre las columnas: 270 mm
- Carrera máxima del pistón: 100 mm
- Precisión y repetibilidad: ±1% del valor de lectura
- Alimentación: 230V monofásica 50Hz 750W
- Dimensiones: 780x420x1700 mm
- Peso: 850 ÷ 900 kg
H011-01N con accesorios
H011N con accesorios
Modelo
H010
H011 N
H011-01 N
Motorizado
Manómetro
•
•
•
•
instrumentos para ensayos de materiales
Cyber-Plus Evolution
mod. C109N (pág. 130)
•
Servo-Plus Evolution
mod. C104N (pág. 130)
•
AC EROS
C109-10N Software para ensayos de compresión en el hormigón para Cyber-Plus Evolution modelo H011N
RECAMBIOS:
H011-11N Unidad electrónica con microprocesador, pantalla
digital “Cyber-Plus Evolution” completa.
H011-12N Sistema de servocontrol digital e hidráulico
“Servo-Plus Evolution” completo.
H014
Extensómetro electrónico
H010
con accesorios
ACCESORIOS para
H010, H011N y H011N-01N:
PARA ENSAYOS DE TRACCIÓN EN MUESTRAS DE ACERO
REDONDAS Y PLANAS:
H012-01
Conjunto de 4 cuñas
superiores e inferiores para
probetas redondas diá. 6 ÷
15 mm y planas de espesor
6 ÷ 15 mm (anchura
H012-01
máxima 25 mm)
H012-02
H012-02
Conjunto de 4 cuñas superiores e inferiores para probetas redondas diá. 15 ÷ 25 mm.
PARA ENSAYOS DE COMPRESIÓN DE PROBETAS CÚBICAS Y
CILÍNDRICAS DE HORMIGÓN:
H013-01
Plato superior provisto de una rótula esférica, dispositivo de fijación,
plato inferior y suplementos para probetas cúbicas de 150 mm de
lado y cilindricas de diámetro máximo 160x320 mm
Los platos tienen diá. 216 mm y están
endurecidos y rectificados de acuerdo
con los requisitos de las Normas.
H013-02
Protecciones de seguridad según la
directiva CE, de policarbonato, comH013-01
pleta con bisagras y cerradura.
ACCESORIOS
(sólo para mod H011N y H011-01N.)
C127N
Impresora gráfica para papel térmico
H009N Software para ensayos de tracción en aceros
(de carga/deformación, gráficos, certificado de ensayo,
etc.). Detalles técnicos: ver pág. 14
Medición base 50 mm, rango de deformación +1 mm / -0,2mm.
Porcentaje máximo medible de deformación: +2%.
Es posible medir las deformaciones longitudinales de la probeta
durante el ensayo de tracción.
Se obtiene una gráfica tensión/deformación, pudiendo identificarse
en este gráfico el coeficiente de elasticidad junto con las cargas
RP0.1 - RP0.2 - Rt1, incluso en los materiales que no presentan un
límite de elasticidad claramente identificable.
El aparato se suministra
completo con cables de
conexión.
sección H
C123-01N Software “Servonet” para ensayos de compresión en
hormigón para Servo-Plus Evolution
modelo H011-01N
H014
Extensómetro
electrónico
para los ensayos
de deformación
a la fuerza de
tracción hasta
la rotura
H014-07
Este extensómetro electrónico coaxial, se utiliza para medir la deformación de una probeta
de ensayo a tracción hasta su rotura.
El extensómetro se fija directamente a la muestra y permanece
conectado hasta la rotura, midiendo la deformación tanto en la
fase elástica como en la plástica. La medición base de probetas
redondas: 5 x diámetro de la probeta. Se suministra completo con
4 separadores para la muestras de diámetros intermedios al rango
de medida específico, cable de conexión, accesorios, estuche de
transporte.
Modelos:
H014-06 Extensómetro para barras redondas de 4,5 a 11 mm
diámetro. Desplazamiento del transductor: 25 mm
H014-07 Extensómetro para barras redondas 10 a 19 mm
diámetro. Desplazamiento del transductor: 50 mm
H014-08 Extensómetro para barras redondas 18 a 25 mm
diámetro. Desplazamiento del transductor: 50 mm
H014-10 Extensómetro para muestras planas, ancho máximo. 25
mm; espesor máximo 10 mm
Desplazamiento del transductor: 50 mm. Medición base:
25 - 50 - 60 - 70 mm.
instrumentos para ensayos de materiales
339
sección H
AC E ROS
H020
H052
Máquina marcadora de probetas
Baño de enfriamiento para ensayos de
resiliencia
Automática, motorizada
NORMA: UNI 556
Utilizada para marcar probetas redondas, cuadradas y con adherencia aumentada para la medida del alargamiento porcentual tras
la rotura de la probeta, de acuerdo con el procedimiento previsto
por las Normas.
Puede marcar probetas con dimensiones:
- redondos desde 4 mm hasta 50 mm de diámetro
- pletinas desde 4mm hasta 50 mm de grosor.
- cuadrados de 4mm a 45 mm de lado
Longitud útil 300 mm.
Marcaje del paso a elegir de 5-10 mm que se introducen con
graduación lateral.
Velocidad de marcaje: 60 marcas por minuto.
Alimentación: 400V trifásica 50Hz
Dimensiones 530x480x445 mm
Peso: 58 kg aprox.
340
Este aparato satisface la exigencia operativa de los ensayos Charpy
que deben llevarse a cabo a bajas temperaturas. Está realizado en
acero inoxidable con doble cámara y cavidad aislante rellena de
espuma de poliuretano expandido de 65 mm de espesor.
Completo con tapa de doble cámara y cestillo para muestras.
Dimensiones internas:
125x125x h 180 mm
Peso: 12 kg
H054
H052
Pinza de acero
cromado y forma
especial para recoger
la probeta enfriada en
el baño y colocarla
directamente en el
Péndulo Charpy.
H057
H054
Entalladora
Utilizada para entallar probetas que se usarán en las pruebas de
impacto de los ensayos de resiliencia.
El pistón con cremallera permite un
correcto alineamiento del cepillo
o cremallera respecto
a la muestra y un
empuje perfectamente
axial.
H020
H057
H021
Máquina marcadora de probetas, similar al mod.
H020 pero con funcionamiento manual con manivela.
H057-10
H050
Productor de Hielo-Seco
Instrumento idóneo para producir instantáneamente la cantidad
necesaria de hielo seco (CO2 sólido)
para obtener temperaturas de -80 ºC.
El instrumento debe conectarse a una
botella de CO2 líquido con tubos de
conexión y produciendo pastillas de
hielo seco de 100 gramos aprox. (diá.
75 mm y espesor 25 mm).
Peso: 3 kg
H050
instrumentos para ensayos de materiales
H057-11
ACCESSORI:
H057-10 Cremallera para el entalle en “V” en probetas de
sección cuadrada 10x10 mm
H057-11 Cremallera para el entalle en “U” en probetas de
sección cuadrada 10x10 mm
C351
Sierra de disco para
barras metálicas
Máximo diámetro de disco 350 mm
Capacidad de corte: 120 mm
Completa con disco de corte para
metales de diámetro. 350 mm
Alimentación: 230V monofásica 50Hz 2000W
Dimensiones: 560x460x390. Peso: 20 kg
RICAMBIO:
C351-11 DISCO DE CORTE para metal.
C351
AC EROS
H060
NORMAS: EN 10045-1 / ASTM E23 / UNI 4431, 4714
ISO TC/7 / BS 131 / EURONORM 7-55
La máquina está equipada con una maza de caída pendular, capaz de
romper de un solo golpe, una probeta entallada por su mitad, apoyada en
dos soportes.
Este ensayo se efectúa en la probeta “CHARPY” con el fin de verificar la
energía absorbida durante el impacto, que se mide en JOULE.
Este valor representa la resistencia al impacto del material ensayado
(resiliencia).
- Estructura de hierro colado
- Péndulo con cuchilla templada
- Freno para parar el péndulo
- Energía de impacto 300J con graduación de 2J
- Ángulo de caída: 140º
- Peso efectivo: 21.300 kg
- Velocidad de impacto: 5,187 m/s
Se suministra completo con una cuchilla de punta para realizar el ensayo
de acuerdo con la norma ASTM.
No se puede vender en los mercados de la CE sin protección (ver accesorios)
Dimensiones: 500x1400x1900 mm
Peso: 470 kg aprox.
ACCESORIOS para H060:
H060-01
JAULA DE PROTECCIÓN, según las directivas de seguridad de la CE.
H060-02
CUCHILLA para efectuar el ensayo de resiliencia de acuerdo con
las normas EN 10045-1 y BS 131.
H061
H060
sección H
Péndulo Charpy para ensayos de resiliencia
341
H061
Equipo digital de impactos Péndulo
Charpy, de “alto rendimiento” para
ensayos de resiliencia
NORMAS: EN 10045-1 / ASTM E23 / UNI 4431, 4714
ISO TC/7 / BS 131 / EURONORM 7-55
Marco de hierro fundido monobloque.
Panel de control independiente con indicador digital de resolución
de 0,1 J.
Energía de impacto: 300 J
Tamaño de la pieza: 10x10x55 mm
Distancia entre soportes: 40 mm
Martillo de impacto montado sobre cojinetes de bolas.
Mecanismo de freno electromagnético para detener el péndulo.
Completa con una cuchilla templada y dispositivo de sujeción de la
muestra.
Jaula de protección, según directiva CE de seguridad, de acero,
aislando el movimiento pendular del martillo en la parte delantera
y trasera de la máquina.
Cuando la caja se abre para cargar el martillo, un dispositivo electromecánico de seguridad no permite lanzar el martillo.
Alimentación: 230V monofásica 50Hz
Dimensiones: 550x1400x1900 mm
Peso: 550 kg aprox.
instrumentos para ensayos de materiales
AC E ROS
H065N
Máquina dobladora
sección H
NORMAS: EN ISO 7438, EN 10080, EN ISO 15630-1
ASTM A615, ASTM A615M / D.M. 09/2005
H065-01
DATOS TÉCNICOS:
- Carga máxima del pistón: 16 kN
- Carrera máxima del pistón: 550 mm
- Pistón de velocidad regulable de 0 a 6 mm/s
- Alimentación: 230V monofásica 50Hz 1500W
- Dimensiones: 1540x800x h 1300 mm
- Peso: 350 kg
ACCESORIO:
H065-01
Protecciones de seguridad
según directivas de la CE.
342
H065N
Proyectada y realizada para llevar a cabo ensayos de doblado en
barras de acero para hormigón armado.
El ensayo consiste en doblar a 180º la barra a examinar o bien a
90º y luego enderezarla al menos 20º.
Esta máquina de doblado posee un bastidor robusto que sostiene
una viga, sobre la cual está fijado un cilindro con el pistón de carga
correspondiente, activado por una célula de carga hidráulica completa con ajuste de la velocidad del pistón, con válvula de control
direccional, válvula de máxima presión y manómetro de control. El
conjunto se cierra con una caja metálica transparente para proteger
cualquier componente del polvo y el usuario de cualquier daño.
Un pequeño recipiente se ha instalado debajo de la viga, donde se
dobla la barra de acero. Sobre la viga se encuentran dos rodillos de
contraste que son fácilmente ajustables en distancia para estar de
acuerdo con las Normas para barras de 5 a 40 mm de diámetro.
Fijar y cambiar los mandriles al final del cilindro de empuje es fácil
y práctico, garantizando al operador un perfecto intercambio de
los mismos. Un dispositivo impide el desbloqueo de la barra que
se está ensayando entre los rodillos y el mandril de empuje, tanto durante el ensayo de
flexión como durante el enderezamiento. La máquina acepta barras hasta 40 mm diá y se
suministra completa con dos series de rodillos, que tienen respectivamente 50 y 100 mm
de diá. Los mandriles, los portamandriles y los estribos están excluidos del equipo estándar
y deben ser pedidos por separado. (Ver tabla página siguiente).
instrumentos para ensayos de materiales
H065N DETALLE
AC EROS
Mandril
Modelo
Mandril
Ø mm
Varilla Ø mm
EN ISO 15630-1
H066-07
H066-10
H066-12
H066-14
H066-15
H066-18
H066-19
H066-20
H066-61
H066-62
H066-24
H066-28
H066-30
H066-31
H066-32
H066-33
H066-35
H066-36
H066-37
H066-49
H066-38
H066-40
H066-41
H066-53
H066-43
H066-45
H066-46
H066-58
H066-60
24
32
40
44
48
56
60
64
70
80
96
112
128
132
140
144
160
176
180
192
200
224
250
260
280
320
336
340
400
4e6
7
8
10
12
14
16
18
20
22
24 e 26
28
30 e 32
34 e 38
40
-
Varilla Ø mm
Varilla Ø mm
ASTM A615-A615M D.M. 09-2005
9,5
12,7
15,9
19
22,2
25,4
28,7
32,2
35,8
-
6
8
10
12
12
14
16
18
20
22
24
25
26
28
32
34
40
Porta-Mandril
Modelo
Estribo
Modelo
Estribo
Distancias mm
H067-03
H067-03
H067-03
H067-03
H067-03
H067-04
H067-04
H067-04
H067-04
H067-04
H067-04
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
* No
H068-12
H068-17
H068-17
H068-13
H068-11
H068-20
H068-13
H068-13
H068-19
H068-20
H068-12
H068-21
H068-13
H068-01
H068-05
H068-13
H068-09
H068-05
H068-07
H068-07
H068-08
H068-05
H068-05
H068-03
H068-04
H068-22
H068-23
H068-22
H068-23
80, 170, 226
98, 196
98, 196
85, 172, 298
75, 160, 262
110, 244
85, 172, 298
85, 172, 298
106, 226
110, 224
80, 170, 226
120, 254
85, 172, 298
200, 260, 412
232, 342, 516
85, 172, 298
230, 320, 490
232, 342, 516
244, 364, 550
244, 364, 550
250, 375, 580
232, 342, 516
232, 342, 516
220, 280, 438
225, 292, 464
122, 542, 594
134, 568, 620
122, 542, 594
134, 568, 620
sección H
TABLA DE LOS MANDRILES DISPONIBLES Y SOPORTES DE Ø5 A Ø 40 DE ACUERDO CON LAS NORMAS EN, ASTM, D.M.
TABLA DE OTROS MANDRILES DISPONIBLES Y SOPORTES
Mandril Mod.
H066-01
H066-02
H066-03
H066-04
H066-05
H066-06
H066-08
H066-09
H066-11
H066-13
H066-16
H066-51
H066-17
H066-21
Ø Mandril mm
10
12
15
16
18
20
28
30
36
42
50
52
54
66
Estribo
Modelo
Estribo
Distancias mm
H068-02
H068-06
H068-10
H068-14
210, 268, 425
240, 360, 520
256, 386
86, 180
Porta-Mandril Mod.
H067-01
H067-01
H067-02
H067-02
H067-02
H067-02
H067-03
H067-03
H067-03
H067-03
H067-03
H067-04
H067-04
H067-04
Estribo
Estribo
Modelo Distancias mm
H068-15
90, 184
H068-16
92, 190
H068-18
100, 208
Mandril Mod.
H066-48
H066-22
H066-52
H066-23
H066-55
H066-26
H066-63
H066-39
H066-50
H066-56
H066-54
H066-57
H066-59
H066-47
Ø Mandril mm
72
75
78
84
90
108
114
220
240
300
312
360
380
384
Porta-Mandril Mod.
H067-04
H067-04
H067-04
H067-04
H067-04
* No
* No
* No
* No
* No
* No
* No
* No
* No
* NOTA: A partir de Ø 100 a 400 mm el mandril está directamente montado en el pistón sin el uso del porta-madril.
Todos los mandriles se han producido a partir de acero de calidad,
cadmiado para la protección contra la oxidación, y de Ø 10 mm
hasta Ø 96 mm incluido, los cuales se han endurecido para evitar
el desgaste.
instrumentos para ensayos de materiales
343
344
instrumentos para ensayos de materiales
sección S
Sección S
SUELOS
S UELOS
345
En la realización de estructuras para ingeniería civil, el proyectista
debe basar sus cálculos en función de la tipología del terreno
sobre el cual su proyecto debe integrarse.
Esta sección consiste en el estudio y el análisis en muestras de
terreno para prever su comportamiento, proponiendo los equipos
adecuados para: muestreo, extracción, clasificación, consolidación,
resistencia al corte directo, triaxiales, compactación, penetración,
capacidad de carga, permeabilidad, densidad, ensayos geotécnicos y químicos, entre otros, con respecto a la conformidad de las
Normas EN, ASTM, BS e Internacionales más utilizadas.
instrumentos para ensayos de materiales
SUE L OS
MUESTREO Y EVALUACIÓN
S050
S050
sección S
Penetrómetro dinámico ligero
346
NORMA: DIN 4094
Utilizado para establecer el espesor de los diferentes estratos
cuando se ensayan los trabajos de compactación y para determinar
la densidad relativa de los rellenos y de los terrenos no cohesivos
depositados naturalmente.
En general si el suelo no está demasiado compactado, los ensayos
de penetración pueden llevarse a cabo hasta los 8-12m.
El conjunto del penetrómetro consiste en:
Maza de 10 kg con guía de caída de 500 mm y yunque.
11 barras de sondeo de diá. 22 mm por 1 m de largo completo
con barra guía y collar.
Varilla ranurada para extraer las muestras.
Dos puntas cónicas a 90º, con superficies de 5 cm2 y 10cm2.
Dispositivo para extraer la varilla de sondeo y accesorios.
Caja de transporte.
Dimensiones: 1080x360x220 mm
Peso: 72 kg
S053
S053-04
S053
Extractor de muestras
de suelo de 38 mm de diámetro
S054
S057
Cizallómetro para ensayos en obra
NORMA: ASTM D 2573
Utilizado para determinar la resistencia de corte (CU) de los
suelos cohesivos muy blandos, asegurando la no alteración de los
suelos en obra.
El equipo consiste en un cabezal de medida con el asa en “T” cargada con muelle, y 3 paletas intercambiables de diferentes tamaños,
utilizadas en función de la resistencia esperada del suelo a ensayo.
La paleta se inserta en el suelo unos 60 mm aprox. y el valor de
par máximo se mide en un collar sujeto al mástil.
Rango de medición: 0 a 240 kPa
La unidad, hecha de acero inoxidable, se suministra “calibrada con
certificado de calibración y tabla de conversión” y con tres paletas
de dimensiones (diámetro x altura) 16x32, 20x40, 25,4x50,8 mm,
varilla de extensión de 500 mm de largo, herramientas, caja de
transporte.
Dimensiones: 500x300x100 mm
Peso: 4 kg aprox.
ACCESORIO / RECAMBIO:
S057-01 Varilla de extensión de 500 mm de largo.
Utilizado para obtener muestras inalteradas de suelo con diá. 1 ½’’
(38mm).
El extractor está formado por:
Asa en “T” con varilla de extensión de 900 mm de larga.
Vaina con peso deslizante de ¾’’.
Tubo troquel en acero inoxidable diá. 1 ½’’ x 9’’ (38x230mm)
Peso: 7 kg
RECAMBIOS Y ACCESORIOS:
S054
Extractor manual utilizado para extraer las muestras de suelo de
diá. 1 ½’’ desde el tubo troquel.
S053-04
Tubo troquel de repuesto en acero inoxidable diá. 1 ½ x 9’’.
instrumentos para ensayos de materiales
S057
MUESTREO Y EVALUACIÓN
S051
Penetrómetro cónico dinámico (DCP)
TRL = TRANSPORT RESEARCH LABORATORY DEL REINO UNIDO.
NORMA: BS 1377:9
Este equipo portátil de accionamiento manual está diseñado para
obtener una rápida y directa evaluación in-situ de la resistencia
estructural de las capas de pavimentos construidos con materiales
no consolidados. Los resultados del Penetrómetro DPC pueden ser
comparados e interpretados con los del CBR (California Bearing
Ratio) como en los estudios experimentales de Kleyn 1982.
La prueba se realiza con penetraciones continuas en 800 mm
aprox. de profundidad con una profundidad máx. de 2 m usando las
barras de extensión.
El equipo consta de:
- Maza de caída por deslizamiento de 8 kg de peso, la altura de
caída de 575 mm
- Yunque de impacto con barra de conducción.
- Barra de penetración con punta cónica de 60° y punta de 20 mm
de diámetro.
- Llaves inglesas, allen, accesorios.
- Caja de madera para llevar.Dimensiones (en la caja):
1210 x 340x190 mm aprox.
Peso: 29 kg
RECAMBIOS:
S051-11 Cono de penetración
S051-12 Varilla de extensión, 400 mm de largo
sección S
S UELOS
S051
347
S051-01
Kit de prospección Mackintosh
Este equipo es especialmente útil para el trabajo inicial de investigación “in situ” en áreas remotas. Es capaz de alcanzar profundidades de
10 a 12 metros dependiendo de las condiciones del terreno. El uso de acopladores especialmente diseñados para las varillas de extensión
reduce al mínimo la fricción del pozo, lo que permite un fácil manejo a una profundidad considerable.
Equipo consta de:
- 12 barras de perforación 1 m de largo con
12 acopladores
- 2 llaves de tubo y una llave de grifo
- Tubo adaptador central y el tubo de testigos
de arcillas
- Cabezal y varilla de limpieza
- Barra de guía, corta y larga
- Herramienta Auger y tubo central estándar
- Herramienta de elevación / conducción
y martillo
- Tuerca muerta y grifo de mano
Todos los equipos se suministran en una
caja de madera fuerte.
Peso: 45 kg aprox.
S051-01
instrumentos para ensayos de materiales
SUE L OS
MUESTREO DE SUELOS
Barrenas de mano
NORMAS: ASTM D 420, D 1452 / CNR a VI n° 25 / AASHTO T86, T202
Diseñadas para investigación y exploración de suelos.
Completa con asa en “T”.
Fabricadas en acero galvanizado especial.
sección S
S095
S094 KIT
S093 KIT
S092 KIT
MODELOS:
348
S092 KIT
S093 KIT
S094 KIT
S095
Barrena de mano diá. 80 mm, longitud 1 m
Barrena de mano diá. 100 mm, longitud 1 m
Barrena de mano diá. 150 mm longitud 1m
Varilla de extensión para los anteriores de 1m
de largo, completa con dispositivos de acople.
Peso kg
4
5
6
2
Barrena motorizada para obtener muestras de suelo alterado.
Suministrados “sin” barrenas, deben pedirse por separado (ver
accesorios).
MODELOS:
S096
Barrena motorizada
Capacidad del motor de 2 CV, de dos tiempos, sin convertidor de
velocidad.
Equipada con dos asas de mano, para ser utilizada por un operador.
Perfora diámetros de hasta 200 mm y profundidad máx. de 1000 mm
No acepta las barras de extensión.
Peso: 10 kg
S096
S097
S097
Barrena motorizada
Capacidad del motor de 6 CV, de dos tiempos, equipada “con convertidor de velocidad” para facilitar la extracción de las barrenas.
Equipada con dos asas de mano, para ser utilizada por dos operadores.
Perfora diámetros de hasta 200 mm y profundidad máx. de 3 m en
suelo blando, mediante el uso de barras de extensión.
Peso: 30 kg
ACCESORIOS:
S097-01 Barrena de 60 mm de diá. x 1 m de longitud
S097-02 Barrena de 80 mm de diá. x 1 m de longitud
S097-03 Barrena de 100 mm de diá. x 1 m de longitud
S097-04 Barrena de 150 mm de diá. x 1 m de longitud
S097-05 Barrena de 200 mm de diá. x 1 m de longitud
S097-06 Barra de extensión, 1 m de longitud
instrumentos para ensayos de materiales
S UELOS
DENSIDAD Y EVALUACIÓN
Tomamuestras/anillos-troquel de probetas superficiales de suelo
sección S
Utilizado para tomar muestras de suelo inalterado o de rellenos
compactados para evaluar la densidad de compactación de las
muestras de la superficie del suelo.
El conjunto consiste en una maza de caída, que desliza a través de
una varilla guía y cae sobre la cabeza de corte donde está contenido el tubo sacamuestras.
Hecho de acero, cadmiado contra la corrosión.
MODELOS:
S084 KIT
TOMAMUESTRAS CON ANILLO-TROQUEL con tubos sacamuestras de 73 mm de diá. interior x 66 mm de largo y maza de
caída de 5 kg.
NORMAS: ASTM D 2937 / CNR N° 22
Peso: 10 kg
S085 KIT
TOMAMUESTRAS CON ANILLO-TROQUEL con tubos sacamuestras de 100 mm de diá. y de 130 de altura, capacidad: 1/30
pies cúbicos y maza de caída de 10 kg.
NORMA: BS 1377:9
Peso: 16 kg
RECAMBIOS:
S084-01 Anillo troquel de 73 mm de diá. x 66 mm de long.
S085-01 Anillo troquel de 100 mm de diá. y capacidad 1/30 pies
cúbicos.
Indicador de nivel de agua
Utilizado para medir el nivel de agua en sondeos, pozos y cualquier
otra estructura subterránea abierta.
Se activa una señal luminosa y audible cuando la sonda toca el agua.
Funciona con pilas, el cable está medido en intervalos de cm
montado en un tambor con un asa de acero inox. y tiene un diá. de
10 mm.
S085 KIT
S084 KIT
Laboratorio de mezcla de muestras
Apto para mezclar materiales granulares como los suelos y mezclas
bituminosas, utilizando un batidor, según lo prescrito por las
Normas EN y BS.
MODELOS:
E095 + B028-03
MEZCLADOR, 5 LITROS DE CAPACIDAD, con batidor
B027 + B027-03
MEZCLADOR, 20 LITROS DE CAPACIDAD, con batidor
Detalles técnicos: ver pág. 80
S061
MODELOS:
S061
Indicador del nivel de agua 50 m de longitud de cable
S061-01 Indicador de nivel de agua 100 m de longitud de cable
S061-02 Indicador de nivel de agua 200 m de longitud de cable
E095 + B028-03
instrumentos para ensayos de materiales
349
SUE L OS
EVALUACIÓN DEL SUELO
S068
sección S
S066
S065
S071
S076
S070
S076-01
350
PENETRÓMETROS Y CIZALLÓMETROS
DE BOLSILLO
NORMA: ASTM D 2573-94
MODELOS:
S065
PENETROMETRO DE BOLSILLO CON DIAL, para la clasificación
de suelos cohesivos, en términos de consistencia, resistencia al
corte, y resistencia aprox. a la compresión simple.
El valor se mide directamente en kgf/cm2, en un dial graduado de 0
a 6 kgf/cm2. Función de tara y puesta a cero con el botón pulsador.
Peso: 300 g
S066
PENETROMETRO DE BOLSILLO CON DIAL. Idéntico al mod.
S065 pero con rango del indicador de 1-14 kgf/cm2, adecuado para
suelos muy compactados.
S068
PENETROMETRO DE DIAL GEOPOCKET diseñado para una
determinación rápida de los suelos de cimentación desde las arcillas
a los suelos arenosos, se indica:
- El ángulo de fricción interna (suelos arenosos).
- La cohesión “C” (suelos arcillosos) y su resistencia aprox. a la
compresión simple.
Función de tara y puesta a cero con el botón pulsador.
Completo con 5 puntas de diá. 6,4-10-15-20-25 mm
Peso: 400 g
S070
PENETROMETRO DE BOLSILLO diseñado para una determinación rápida de la consistencia del suelo, resistencia al corte y
determinación aprox. de la resistencia a la compresión simple.
Rango de medida 0-4,5 kgf/cm2 con medida directa de los valores
de rigidez. Diámetro de la punta 6,35 mm.
Peso: 300 g
instrumentos para ensayos de materiales
S075
S071
PENETROMETRO DE BOLSILLO, idéntico al mod. S070 pero con
un rango de medida de 0-16 kgf/cm2. Adecuado para suelos muy
compactados.
Peso: 800 g
S075
MOLINETE DE BOLSILLO (VANE-TEST) ESCALA 0-1 kg/cm2.
Diseñado para la determinación rápida en campo o laboratorio de
la resistencia al corte de los suelos cohesivos. El dial indica directamente la resistencia al corte en kg/cm2.
Completo con paletas vane intercambiables de acero inoxidable de
10x20 mm (diá. x altura).
Peso: 300 g
S076
MOLINETE DE BOLSILLO (VANE-TEST) ESCALA 0-2 kg/cm2.
Idéntico al mod. S075 pero con escala de 0-2 kg/cm2.
RECAMBIO:
S076-01
Paleta-Vane de acero inox. de 10x20 mm (diá. x altura) para los
dispositivos S075 y S076.
BOTE DE FUSION, para
fundir cera y cubrir muestras
de suelo manteniendo en
ellos su humedad original.
Ver mod. A106 en la sección
“A” pág. 29.
A106
S UELOS
S086
S088-10
Penetrómetro de anillo
El valor de la condición de la humedad
(MCV) y el valor de trituración del yeso
(CCV)
Utilizado para la determinación del comportamiento, resistencia
y grado de compactación de capas intermedias y también para
determinar la resistencia de penetración del suelo.
Se entrega completo con asa en “T”, anillo dinamométrico 100
kgf (1 kN) con aguja de máximo y tabla de calibración, varilla de
extensión de 500 mm de largo graduada cada 100 mm, punta
cónica intercambiable de 30º con un área superior a una pulgada
cuadrada.
Cadmiado para prevención de la corrosión.
Peso: 5 kg
S086
NORMAS: EN 13286-46 / BS 1377:4
Con este aparato se utiliza para medir el mínimo esfuerzo
comparado con el esfuerzo necesario para acercarse a producir la
compactación completa de un suelo, y la velocidad de trituración
de una muestra de trozos de yeso.
La unidad puede ser utilizada para clasificar yeso como material de
relleno con saturación del contenido de humedad.
El aparato consta de un bastidor robusto donde se deja caer un
robusto pisón, el molde, la escala, contador de golpes, accesorios.
Peso: 60 kg aprox.
sección S
COMPACTACIÓN Y HUMEDAD
351
S088
Penetrómetro proctor
NORMA: ASTM D 1558
Utilizado para determinar en campo la resistencia a la penetración
en función del grado de humedad de los suelos de grano fino.
Carga con muelle con escala de lectura de 0-55 kg, subdivisiones cada 1 kg, con lectura directa de carga máx. sobre la varilla
deslizante.
Completo con 9 agujas de acero inox. intercambiables de diá. 4,52
- 5,23 - 6,40 - 9,07 - 12,83 - 16,54 - 20,22 - 24,79 - 28,55 mm,
accesorios, caja de transporte.
Acabado cromado.
Peso: 8 kg
S088-10
S088
instrumentos para ensayos de materiales
SUE L OS
S059
GEOGAUGE
sección S
EQUIPO DE MEDIDA NO NUCLEAR DEL CONTROL DE COMPACTACIÓN DEL SUELO, RIGIDEZ Y MODULO DE YOUNG.
NORMA: ASTM D6758
Características técnicas:
Rigidez:
Módulo de Young:
Medida de profundidad:
Duración de medida:
Alimentación:
Dimensiones con caja:
Peso:
3 a 70 MN/m
26 a 610 MPa
de 230 a 310 mm
75 segundos
6 pilas tipo “D” (500-1500 medidas)
470x420x330 mm
15 kg
S059
352
El GeoGauge es el único equipo portátil de medida que proporciona la simplicidad requerida, rapidez y precisión para medir y
comprobar directamente en el lugar las propiedades de ingeniería
y hacerlo a la velocidad de la construcción. El GeoGauge aplica una
fuerza de vibración constante a la superficie del suelo y mide el
desplazamiento resultante.
Esta tecnología dinámica simula las condiciones actuales de uso. Un
instrumento que une las especificaciones con la compactación en
75 segundos para un mejor control de calidad (QC/QA).
Las aplicaciones incluyen la supervisión de las capas superficiales, de
las capas centrales y la base, las variaciones del aumento de rigidez
de la cal, cementos, cenizas volantes, y materiales estabilizados
con polímeros, comprobación de la recompactación del asfalto
y su reciclaje en frío sobre el lugar como modo de evitar daños
causados por una sobrecompactación. El GeoGauge complementa
y posibilita una alternativa al módulo de resiliencia, Deflectómetro
por caída de peso, CBR in situ, ensayos de placa de carga, penetración dinámica del cono y otras medidas de resistencia, rigidez,
módulo y deformación.
S060
Medidor nuclear de densidad y humedad
NORMAS: ASTM D6938, D2950, D1040 / AASHTO T310
Proporciona un método rápido de determinación in situ, de la
densidad y el contenido de humedad de los suelos, áridos y hormigones asfálticos.
El microprocesador muestra todas las funciones directamente.
Densidad seca y húmeda, porcentaje de humedad, contenido de
humedad, porcentaje de compactación tanto para suelos como para
hormigones asfálticos, índices de huecos y porcentaje de huecos.
El rango de medida va desde los 300 mm de profundidad de
transmisión en incrementos de 25mm, hasta la transmisión directa.
Almacena hasta 320 ensayos de campo, transferibles a un PC o a
una impresora
Dimensiones:
400x220x140mm
Peso: 14 kg
S060
ACCESORIOS:
S059-01 Conexión infrarroja y adaptador para puerto serie con
programa plantilla (sólo para PC).
S059-02 Yunque de calibración (verifica operaciones del GeoGauge)
ACCESORIO:
S060-10 Conexión infrarroja, completa con cables y programa
para PC.
instrumentos para ensayos de materiales
S060-01
S077
Medidor nuclear de densidad y humedad
Medidor de resistividad del terreno
NORMAS: Métodos de ensayo estándar ASTM D6938, D2950,
C1040 y AASHTO T310
Este medidor ofrece dos modos de funcionamiento:
MODO DE TRANSMISIÓN DIRECTA está diseñado para determinar en suelos, piedra u otros materiales que se deseen la densidad
y contenido de humedad. Los ensayos de transmisión directa por lo
general ofrecen una mayor precisión y control de la profundidad de
la medida siendo el método preferido. La Densidad Seca, Densidad
Húmeda, Humedad, Porcentaje de Humedad y Porcentaje de Proctor se proporcionan cuando se prueba en el modo de suelo.
NORMAS: ASTM G57 / BS 1377:3
Utilizado para búsqueda de agua subterránea incluso a grandes
profundidades, evaluación de depósitos de gravas, vigilancia geológica para la construcción de carreteras, tuberías, etc., estudio y
prevención de deslizamientos del terreno.
MODO BACKSCATTER es rápido y no destructivo. Los rayos
gamma entran en el material de ensayo y se dispersan a través del
material alcanzando los detectores de conteos. El backscatter se usa
principalmente para determinar la densidad
de las capas de asfalto y hormigón.
El sistema consiste en:
Instrumento para la medida de la resistividad
2 electrodos de cobre para el potencial
2 electrodos de corriente
2 rollos de cable de 300 m
2 rollos de cable de 100 m
2 martillos
Conjunto de accesorios estándar.
sección S
S UELOS
S078-01
353
S077
ACCESORIO:
S078-01
Cargador acumulador
Fuente de energía para estudios geoeléctricos (alternativa a las pilas
o generadores). Dimensiones: 35x25x24 cm. Peso: 6 kg
S079
Sismógrafo, tres canales
S060-01
Especificaciones:
• El microprocesador muestra todas las funciones directamente.
• Múltiples compensaciones disponibles para adaptarse a prácticamente cualquier condición de terreno.
• Resultados del ensayo en menos de un minuto permitiendo de
una compactación adicional que se aplicará de inmediato si es
necesario.
• NI-CAD batería recargable, 64H en espera.
• Cargador de 220V CA, adaptador de 12 a 14 V CC.
• Dimensiones: 591x376x231 mm
• Peso: 13,2 kg
Aplicaciones:
- Determinación de la profundidad de la roca madre.
- Determinación de las propiedades elásticas-dinámicas de los
depósitos de superficie.
- Estudios de cimientos.
- Las investigaciones preliminares
para la realización de trabajos
de envergadura.
- Estimación de costos para
la excavación.
- Evaluación del módulo
elástico-dinámico de los
materiales.
- Estudio del fondo del
pozo con geófono
tridimensional para sondeos.
S079
- Microsismógrafos.
Completo con juego de accesorios.
Dimensiones: 350x290x280mm. Peso: 9 kg
instrumentos para ensayos de materiales
SUE L OS
EXTRACTORES UNIVERSALES
NORMAS: ASTM D698, D1587, D1883 / BS 598:107, 1377:4, 1924:2
S111
sección S
Extractor hidráulico motorizado
354
Utilizado para una extracción rápida y suave de muestras de suelo
de tubos incluso con paredes finas con mínima alteración. La unidad
puede extraer muestras de diá. 35 hasta 150 mm (diámetro externo 160 mm) con una carrera máx. de 900 mm.
El pistón hidráulico está equipado con un ajuste de velocidad y
puede pararse en cualquier punto de la carrera.
Carga máx. 70 kN (7000 kg)
La muestra extraída se mantiene en
su lugar por una mesa receptora
ajustable en altura que puede ser
bajada fácilmente a lo largo de
la máquina, para ahorrar espacio.
Completo con adaptadores
(anillo + pistón) para extraer las
muestras, con diá. 38,1 (11/2”),
83, 100 mm.
Alimentación: 230V monofásica 50Hz 1300W
Dimensiones: (en posición de trabajo) 2741x635xh 1200 mm
Peso: 160 kg aprox.
S114
Extractor universal
Utilizado para extraer muestras de diá. 4”, 6”, 100 mm, 150 mm.
Puede por tanto extraer muestras para CBR, Marshall y Proctor.
El extractor es accionado por un pistón hidráulico de 50 kN con
una carrera de 190 mm + 170 mm roscado.
Se suministra completo con adaptadores.
Dimensiones diá. 300x500 mm
Peso: 30 kg
S114
S111
S112
Extractor de tornillo - manual
Esta unidad extrae las muestras de diá. 35 a 101,6mm con una
carrera máx. de 650 mm. Se entrega completo con adaptadores
para extraer muestras de diá. 38,1 (1 1/2”), 83, 100 mm, bancada
de soporte y mesa de recepción de muestras ajustable en altura y
abatible.
Dimensiones 1700x700x1200 mm
Peso: 90 kg
S112
ADAPTADORES (anillo y pistón) para extractores S111 y S112:
S113-10
S113-11
S113-12
S113-13
S113-14
S113-15
S113-16
S113-17
instrumentos para ensayos de materiales
Diá. 38,1 mm (1 1/2”) (de repuesto)
Diá. 50,8 mm (2”)
Diá. 76,2 mm (3”)
Diá. 101,6 mm (4”)
Diá. 83 mm (de repuesto)
Diá. 100 mm (de repuesto)
Diá. 35 mm
Diá. 150 mm (sólo para mod. S111)
S UELOS
S118
Preparador de muestras - troquel
sección S
Para comprimir suelos sueltos y troquelar (cortar) porciones de muestras para ensayos
de corte, consolidación, triaxial y compresión simple.
Es utilizado con los troqueles S122 a S122-16 y pisones S123 a S123-16.
Diámetro de la placa superior es de 120 mm y máx. recorrido vertical es de 470 mm.
Dimensiones: 500x300x900 mm
Peso: 30 kg
TROQUELES Y PISONES
Utilizados para preparar muestras de suelo y encajarlas en las celdas adecuadas para
efectuar el ensayo triaxial, consolidación, corte, compresión simple.
El troquel tiene paredes finas con borde de corte, y el pisón extrae la muestra del
hueco insertándola directamente en la célula sin alterar la muestra.
Célula
Dimensiones
Troquel
Pisón
Consolidación
Consolidación
Consolidación
Consolidación
Consolidación
Ø
Ø
Ø
Ø
Ø
50,47
71,40
75,00
79,80
112,80
xh
xh
xh
xh
xh
20 mm
20 mm
20 mm
20 mm
25 mm
S122
S122-01
S122-17
S122-02
S122-03
S123
S123-01
S123-04
S123-02
S123-03
Consolidación permeable
Consolidación permeable
Consolidación permeable
Consolidación permeable
Consolidación permeable
Ø
Ø
Ø
Ø
Ø
50,47
71,40
75,00
79,80
112,80
xh
xh
xh
xh
xh
20 mm
20 mm
20 mm
20 mm
25 mm
S122-04
S122-05
S122-18
S122-06
S122-07
S123
S123-01
S123-04
S123-02
S123-03
Corte
Corte
Corte
Corte
Corte
Ø
Ø
Ø
50
60
100
60x60
100x100
xh
xh
xh
xh
xh
25 mm
25 mm
25 mm
25 mm
25 mm
S122-08
S122-09
S122-10
S122-11
S122-12
S123-08
S123-09
S123-10
S123-11
S123-12
Triaxial + Compresión simple Ø
Triaxial
Ø
Triaxial
Ø
Triaxial
Ø
38
50
70
100
xh
xh
xh
xh
76 mm
100 mm
140 mm
200 mm
S122-13
S122-14
S122-15
S122-16
S123-13
S123-14
S123-15
S123-16
S120
S118
con troqueles y pisones
Tallador para suelos
Diseñado para reducir por corte el diá. de
las muestras de suelo hasta alcanzar el diá.
deseado usando una sierra de hilo. El tallador
se acciona a mano, la altura es ajustable hasta
230 mm y acepta muestras de diá. 38 a 110
mm. Se entrega completo con tres reductores
para muestras de diá. 38-50,47-60 mm, sierra
de hilo y seis hilos de corte.
Dimensiones: diá. 460x720 mm
Peso: 20 kg
V112-01
S124
V113
S125
S120
V112-01 NORMAS: ASTM D421 / BS 1377:2, 1924:1
MORTERO DE PORCELANA diá. 125 por 65 mm con mano de porcelana.
V113
MANO DE MORTERO, cabeza de goma.
S124
SIERRA DE HILO para cortar muestras de suelo. Con seis hojas.
S125
CUCHILLO para preparar las muestras.
ACCESORIO:
S120-01 Reductores superior e inferior disponibles desde diá. 38 hasta 110 mm.
Cuando se pase el pedido por
favor especificar diámetro.
instrumentos para ensayos de materiales
355
SUE L OS
ANÁLISIS EN AGUA Y SUELO
S132
Carta de colores estándar
sección S
IMPUREZAS ORGÁNICAS EN SUELOS
NORMAS: ASTM C40 / AASHTO T21 / UNI 8020-14
Para la determinación de impurezas orgánicas en suelos y áridos
finos. Carta con 5 escalas de referencia de vidrio.
S132-01
S136
CONJUNTO PARA ENSAYO DE CLORUROS EN AGUA. Este
conjunto comprende diferentes reactivos, contenedores graduados,
pipeta, jeringa, e instrucciones.
S137
CONJUNTO PARA ENSAYO DE LA DUREZA DEL AGUA, para
la determinación del porcentaje de calcio y magnesio.
Este conjunto comprende diferentes reactivos y contenedores
graduados, jeringa, pipeta e instrucciones.
S132-02
S132
S132-03
356
S135
CONJUNTO PARA ENSAYO DE ACIDEZ DEL AGUA, para
evaluar el potencial corrosivo. Este conjunto comprende diferentes
contenedores graduados, reactivos, jeringas, pipetas e instrucciones.
S132-01 Botella de ensayo de impurezas graduada, de vidrio
Pyrex, con tapón, 500 ml - ASTM C40
S132-02 Botella de ensayo de impurezas graduada, de vidrio
Pyrex, con tapón, 500 ml, graduada a 130 y 200 ml
- UNI 8020-14
S132-03 Botella de ensayo de impurezas graduada, de vidrio
Pyrex, con tapón, 1000 ml - ASTM C40
V300-24 Hidróxido de sodio. Paquete de 1000 g
S138
KIT PARA ENSAYOS DE MATERIA ORGÁNICA.
NORMA: BS 1377
Formado por diferentes botellas, reactivos y accesorios para
realizar alrededor de 50 ensayos para cada uno de los factores
del suelo en los siguientes ensayos: pH - pH Nitrato - Amoníaco
- Nitratos Nitrógeno etc.
S133N
Carta de colores para suelos
S138
Carta de colores para identificación de suelos.
El conjunto consiste en 7 cartas de color constante con 196 colores, más dos cartas de colores para suelos tropicales.
S133N
S136
S135
instrumentos para ensayos de materiales
S137
ANÁLISIS QUÍMICOS EN SUELOS
B073-01
S140
Agitador / calentador
magnético
Dispositivo de intercambio iónico
DETERMINACIÓN DEL CONTENIDO DE SULFATOS
NORMA: BS 1377:3
Este dispositivo se utiliza para conocer el contenido en sulfatos del
agua del suelo y del agua extraída de las muestras.
Consiste en un tubo de vidrio para el intercambio iónico de 400
mm de longitud, conector y frasco de 500 ml de capacidad.
La unidad está montada en
S140
un soporte.
Dimensiones: 190x110x600 mm
Peso: 5 kg
Para la valoración y la agitación de
los materiales líquidos y semisólidos.
Placa de diámetro 150 mm.
De velocidad variable y la temperatura con reguladores
electrónicos.
Se suministra completo
con varilla magnética
recubierta de teflón.
Alimentación:
B073-01
230V monofásica, 50Hz 400W
ACCESSORIO:
V300-30
Resina de intercambio iónico,
500 g
MEDIDOR DE pH, DIGITAL
V300-30
sección S
S UELOS
NORMAS: ASTM D1067 / BS 1377:3
V215
Medidor de pH, de bolsillo, pilas, con
electrodo reemplazable.
Rango: 0,00 a 14,00 pH - Resolución 0,01 pH
2 puntos de calibración manuales.
Alimentación: batería estándar, 3000 horas de uso.
Se suministra completo con: electrodo, pilas, kit
5+5 de soluciones de calibración de pH 4 y 7
Peso: 70 g
V215-01
357
V215
Medidor de pH / mV / °C, portátil, resistente al agua.
Contenido de clorhídrico y sulfatos
Método Rápido
NORMAS: BS 812:117 / BS 1377:3
Utilizado para determinar los iones de sulfatos en soluciones
acuosas de arena y áridos finos.
A019-01 Quantab tiras valoradoras de cloruro, tipo 1175, rango
de 0,005% a 0,1% (30 a 600 ppm) de NaCl. Paquete de
40 tiras.
A019-02 Quantab tiras valoradoras de cloruro, tipo 1176,
rango de 0,05% a 1% (300 a 6000 ppm) NaCl. Paquete
de 40 tiras
Rango de pH: -2,00 a 16,00 - Resolución pH 0,01
mV: +/- 699,9 a +/- 1999 - Resolución 0,1 mV – 1 mV
Temperatura: -20,0 a 120,0 °C - Resolución 0,1 °C
1 o 2 puntos de calibración automática con 3 soluciones tampón
en memoria.
Compensación automática de temperatura.
Alimentación: batería de 9V, 100 horas de uso.
Se suministra completo con: electrodo, sonda de temperatura,
batería, soluciones de calibración.
De peso. 180 g
Contenido en sulfatos, Método rápido
NORMA: BS 1377:3
Se utiliza para determinar los iones de sulfato en soluciones acuosas de arena y áridos finos..
A019-03 Tiras de ensayo de sulfatos, el rango de detección
de 200 a 1600 mg/l. Paquete de 100 tiras.
A019-01
A019-03
V215-01
A019-02
NOTA: Gama completa de medidores de pH, en pág. 455
instrumentos para ensayos de materiales
SUE L OS
HUMEDAD Y DENSIDAD DE LAS PARTICULAS
DEL SUELO
A028
sección S
Medidor universal de carburo
NORMAS: BS 6576 / AASHTO T217 / ASTM D4944 / UNE 7804
Para la determinación rápida y precisa del contenido de humedad
en arenas, tierra, grava, áridos, etc., basado en el método de carburo
de calcio. Es posible variar el peso de la muestra desde 3 a 100 g
para alcanzar un rango de humedad de 50% (3 g) - 7,5% (20 g) 1,5% (100 g). La botella está calibrada y equipada con un termómetro de superficie. La ampolla de vidrio que contiene el carburo de
calcio se rompe cuando la botella se cierra y se agita, garantizando
una mayor precisión al ensayo.
El instrumento consta de la botella de ensayo con manómetro,
balanza pequeña, 25 ampollas de reactivos, accesorios, maletín.
Dimensiones: 520x340x140 mm. Peso: 6 kg aprox.
C279-02
A117 + A116-11 + A116-12
A117
Agitador de cilindros
A028
358
NOTA: Otros modelos de medidores de carburo: ver pág. 30
RECAMBIO:
A028-11 Ampollas de carburo
(paquete de 100)
A028-11
V023-01
Determinación del porcentaje de humedad
160 g de capacidad x 0,001/0,01 g sensibilidad con tara de hasta 10 g.
Las muestras se secan con una lámpara de infrarrojos con control
de temperatura ajustable.
Un temporizador incorporado de 0-61 min. desconecta el calentador al final del ciclo de secado, que
se indica por una campana.
El porcentaje de humedad y la pérdida
de masa residual se leen directamente
en la escala iluminada.
Alimentación:
230V monofásica 50/60 Hz
V023-01
instrumentos para ensayos de materiales
DENSIDAD DE LAS PARTICULAS DE LOS SUELOS
NORMA: BS 1377:2
Se utiliza para determinar la densidad de las partículas de los suelos
que contienen hasta un 10% de las partículas retenidas en el tamiz
de 37,5 mm.
Este hace girar dos frascos de vidrio en aprox. 50 rpm para satisfacer Norma BS.
El agitador está equipado con un embrague conforme a las directivas de seguridad de la CE.
Suministrados “sin” frascos de vidrio que se piden por separado
Alimentación: 230V 50Hz monofásica 150W
Dimensiones: 550x430x500 mm
Peso: 20 kg
ACCESORIOS:
A116-11
FRASCOS DE VIDRIO para determinar el peso específico de los suelos.
Completo con tapa de vidrio.
Diámetro de 75 mm por 300 mm de
altura
Peso: 1,3 kg
A116-11
A116-12
A116-12
TAPÓN DE GOMA para el cilindro de vidrio A116-11.
C279-02
PANEL DE CONTROL SEPARADO, completo con interruptor
ON / OFF, temporizador, fusible, protecciones eléctricas.
S UELOS
PESO ESPECÍFICO DE SUELOS
Desecadores de vidrio de borosilicato
Baño de agua, digital
NORMA: BS 1377:2
Para la determinación de la densidad de las partículas, método del
picnómetro, de acuerdo con las especificaciones de BS 1377:2, y
para fines generales de laboratorio.
Hecho completamente de acero inoxidable, con aislamiento de
lana y agitador eléctrico de circulación de agua, el baño asegura una
temperatura uniforme y constante.
Completo con termostato digital y doble termostato de seguridad
con un mayor umbral térmico estableciendo condiciones seguras
de trabajo.
Un dispositivo de refrigeración se conecta a la red de agua utilizándola en caso de que la temperatura ambiente supera la solicitada.
Capacidad: 40 litros.
Rango de temperatura: ambiente de 90 °C, precisión ±0,5 °C.
Dimensiones interiores: 510x350x230 mm
Dimensiones generales: 680x420x420 mm
Alimentación: 230V monofásica 50Hz 2000W
Peso: 28 kg aprox.
sin vacío
con vacío
A035
Diá. 200 mm
A036
Diá. 250 mm
A036-01 Diá. 300 mm
A039
Diá. 200 mm
A040
Diá. 250 mm
A040-01 Diá. 300 mm
ACCESORIO:
V300-15 Caja desecadora de sales de gel de sílice para 1000 g.
A039
A035
sección S
Completo con plato perforado de cerámica
E136
A035
S147
S147
Picnómetros
NORMA: BS 1377:2
Utilizado para la determinación
del peso específico y la
absorción de agua en arenas y
áridos finos.
Jarra de vidrio con cono de
aluminio y junta de goma.
Capacidad: 1 kg
E136
Picnómetros de Gay-Lussac
NORMAS: BS 1377:2 / ASTM D854 / AASHTO T100
NF P18-054, NF P94-054
Construidos en vidrio Pyrex, completo con tapón esmerilado, se
utilizan para determinar la gravedad específica y la densidad de
suelos finos y rellenos en áridos finos.
MODELOS:
V108
Capacidad 25 ml
V108-01 Capacidad 50 ml
V108-02 Capacidad 100 ml
V108-03 Capacidad 250 ml
S148
S148
Cono y pisón para
absorción de arena
NORMA: BS 812
Para determinación del peso específico y la absorción de agua de los
áridos finos.
Peso: 500 g aprox.
V108-01
V202
V108-02
V202
Bomba aspirante
Para ser conectada a la red de agua con una
presión mínima requerida de 0,7 kg/cm2, produciendo una moderada presión al vacío.
Peso: 100 g
instrumentos para ensayos de materiales
359
SUE L OS
sección S
S155 KIT juego completo
Análisis del tamaño de las partículas de los suelos
Método del hidrómetro
NORMAS: ASTM D422 / AASHTO T88 / UNE 103.102
Este equipo se utiliza para determinar la distribución cuantitativa del
tamaño de partículas muy finas en los suelos como arcillas y limos.
360
S155 KIT El juego completo consta de:
S155-01
PROBETA sin pico, 1000 ml de capacidad
(6 unidades)
V172
HIDRÓMETRO para suelos, 151H, rango de 0,995 a
1,038 g/ml con div. 0,001
S155-04
TANQUE DE CRISTAL, dimensiones:
600x300x380 mm
S155-09
CALENTADOR, “de tipo profesional”, completo
con termostato, serpentín de refrigeración, unidad de
circulación.
230V monofásica 50Hz 1000W
S155-10
TERMÓMETRO DE VIDRIO, rango de 0 – 50 °C,
Subdiv. 0,5 °C.
V104-03 VASO DE PRECIPITADOS, de pyrex, 250 ml de
capacidad
V300-23 Hexametafosfato de SODIO, 1000 g
S156-01 KIT AGITADOR DE ALTA VELOCIDAD, 10.000 rpm,
con frasco, paleta, deflector anti-salpicaduras, para
la dispersión de las partículas del suelo en el agua.
230V monofásica 50/60Hz
Peso total: 60 kg aprox.
NOTA: cada elemento se puede pedir por separado.
ACCESORIOS:
V172-02 HIDRÓMETRO para suelos, 152H, rango -5 a 60 g/l
(alternativa a mod. V172)
S155-02 TAPÓN de goma para el cilindro de S155-01
S156
AGITADOR, manual, para los cilindros de 1000 ml de
capacidad mod. S155-01
C306-03 PANEL DE CONTROL SEPARADO, con el interruptor
de encendido/apagado y protecciones eléctricas, para
que el calentador S155-09 cumpla según la directiva de
seguridad de la CE.
ACCESORIOS para NF P94-057:
S155-03 PROBETA sin pico, de 2500 ml de capacidad,
85 ± 5 mm de diámetro, graduadas a 500, 1500, 2000 ml.
S156-03 AGITADOR MANUAL, para cilindros de largo 600 mm
2500 ml de capacidad, mod. S155-03.
V172-03 HIDRÓMETRO para suelos, 0,995 a 1,030 g/ml.
RECAMBIOS para S156-01 KIT Agitador:
S156-11 Deflector anti-salpicaduras
S156-12 Paleta
S156-13 Frasco
de agitación
S156-13
S156-12
S156-11
C306-03
S156-03
S155 KIT
instrumentos para ensayos de materiales
S156-01 KIT
S156
S143-KIT conjunto completo
S157 KIT
Distribución del tamaño de las partículas
por el método de la pipeta NORMA: BS 1377:2
Ensayo del azul de metileno
Este equipo se utiliza para determinar la distribución cuantitativa de
tamaño de partículas muy finas en el suelo, como la arcilla y limo.
El juego completo consta de:
S144
PIPETA ANDREASEN, 25 ml de capacidad, para una extracción precisa de las cantidades de suelo en suspensión para su análisis.
S144-01 SOPORTE PIPETA, SOPORTE PARA LA PIPETA, para
subir y bajar con precisión la Pipeta Andreasen sin
transmitir vibraciones para no alterar la suspensión de
la muestra. Peso: 10 kg
S144-02 CILINDRO DE SEDIMENTACIÓN, 500 ml de capacidad
S144-03 TAPÓN DE GOMA para el cilindro
S144-04 CÁPSULA DE VIDRIO, de 90 mm de diámetro por
50 mm de altura
V172-03 SUELO HIDRÓMETRO, de cuerpo largo, graduado de
0,995 a 1030 g / ml. (BS, NF)
S155-04 TANQUE DE VIDRIO, dimensiones: 600x300x380 mm
S155-09 CALEFACTOR, “de tipo profesional”, completo con
termostato, serpentín de refrigeración, unidad de
circulación. 230V 50Hz monofásico 1000W
S155-10 TERMÓMETRO con escala de 0 - 50 °C, subdivisiones
cada 0,5 °C.
Peso total: 40 kg aprox.
NOTA: cada elemento se puede pedir por separado.
ACCESORIOS:
S144-10 PIPETA ANDREASEN, 10 ml de capacidad
C306-03 PANEL DE CONTROL SEPARADO, con el interruptor
de encendido/apagado y protecciones eléctricas, para
que el calentador S155-09 cumpla según la Directiva de
seguridad de la CE.
AGITADOR DE CILINDROS. Detalles técnicos: ver pág. 56
A117
CONTENIDO DE ARCILLA EN ÁRIDOS FINOS
NORMAS: EN 933-9 / NF P94-068 / UNI 8520-15 / UNE 83180
Utilizado para determinar el contenido de arcilla en los áridos finos.
El conjunto comprende:
S157-01 Agitador eléctrico ajustable de 400 a 700 rpm., completo
con hélice de 70mm de diá. 230V monofásico 50/60Hz.
S157-06 Base de soporte para el agitador.
S157-02 Bureta de 50x0,1 mm con grifo.
S157-07 Base soporte para la bureta.
S157-08 Recipiente 200x150x80 mm
S157-03 Filtros de papel de 90 mm de diá. (paquete de 100)
S157-04 Varilla de vidrio diá. 8 x 300mm
S157-05 Vaso de precipitado de plástico de 2000 ml de capacidad
V300-28 Azul de metileno, 100 g
V300-29 Caolinita, 500 g
Peso total 10 kg
NOTA: cada elemento se puede pedir por separado.
sección S
S UELOS
ACCESORIO:
S157-10 DISPENSADOR AUTOMATICO 0-10 ml con divisiones
cada 0,1 ml. Capacidad 1000 m (como una alternativa a
la bureta S157-02 + S157-07)
S157-10
C306-03
S143 KIT
S144
S157 KIT
S144-01
S157-20
S155-09
S155-04
S144-02
S144-03
S144-04
V172-03
Equipo de ensayos de azul de metileno
automático
Este instrumento determina automáticamente la cantidad de arcilla en la
arena. Garantiza resultados exactos y reproducibles, ahorrando mucho
tiempo (aprox. 30 minutos de cada
S157-20
ensayo). El aparato está compuesto
por: bomba de precisión, un colorímetro, unidad de control, filtros,
líquidos, polvos, accesorios.
Alimentación: 230V monofásica 50Hz
Dimensiones: 300x400x350mm aprox.
Peso: sobre los 10 kg
instrumentos para ensayos de materiales
361
sección S
SUE L OS
362
S158-02 KIT
S159-01 KIT
Ensayo del equivalente de arena (completo)
Ensayo del equivalente de arena (simple)
EVALUACIÓN DE LOS ÁRIDOS FINOS
NORMAS: EN 933-8 / NF XP18-598 / CNR N.27
UNI 8520-15 / UNE 83131
El conjunto comprende:
S158-03 Cilindro de medida de plexiglás graduado en 100 y 380 mm
(5 piezas)
S158-02 Tapón de goma para cilindro (2 piezas)
V176-02 Regla graduada 500 mm en acero inoxidable
V136-01 Embudo, boca ancha
S158-05 Bote de medida de 200 ml de capacidad
Botella de plástico, 5 l de capacidad
V121
S158-10 Tubo irrigador con grifo y sifón, EN/ASTM
S158-13 Pistón con guía para nivel de arena
A052-37 Tamiz de diá. 200 mm con apertura de 2 mm
S158-09 Solución concentrada, 1000 ml
V170
Cronómetro digital
S158-11 Soporte para colgar el sifón y la botella
S158-12 Estuche de transporte, dim. 550x250x400 mm
Peso total: 18 kg.
NORMAS: EN 933-8 / NF XP18-598 / UNI 8520/15
CNR N.27 / UNE 83131
El conjunto comprende:
S158-03 Cilindro de media de plexiglás graduado en 100 y 380
mm (4 piezas)
S158-02 Tapón de goma para cilindro (2 piezas)
V176-02 Regla graduada 500 mm en acero inoxidable
V136-01 Embudo, boca ancha
S158-05 Bote de medida de 200 ml de capacidad
V121
Botella de plástico, 5 l de capacidad
S158-10 Tubo irrigador con grifo y sifón, EN/ASTM
S158-13 Pistón con guía para nivel de arena
S158-09 Solución concentrada, 1000 ml
Peso total: 5 kg
S159-01 KIT
S158-20 KIT
S159-11
S159 KIT
Ensayo del equivalente de arena (simple)
NORMAS: ASTM D2419 / AASHTO T176
Este conjunto es idéntico al mod. S159-01 KIT a excepción de:
S158-01 Cilindro de medida en plexiglás, graduado en 100 y 380
mm, con etiqueta adhesiva transparente, graduada en
mm y pulgadas (4 piezas)
S158-04 Bote de medida con 88 ml de capacidad
S158-07 Pistón con guía para nivel de arena
S158 KIT
Ensayo del equivalente de arena (completo)
NORMAS: ASTM D2419 / AASHTO T176
Este conjunto es idéntico al mod. S158-20 KIT a excepción de:
S158-01 Cilindro de medida en plexiglás, graduado en 100 y 380
mm, con etiqueta adhesiva transparente, graduada en
mm y pulgadas (5 piezas)
NOTA: cada elemento se puede pedir por separado.
ACCESORIOS:
S159-11
Maletín de transporte,
de plástico, conteniendo el conjunto de
equivalente de arena mod. S159 KIT,
o S159-01 KIT, excepto la botella V121
S158-04 Bote de medida con 88 ml de capacidad
S158-07 Pistón con guía para nivel de arena
A052-44 Tamiz de diá. 200 mm con apertura de 4,75 mm
instrumentos para ensayos de materiales
S158-08 Embudo metálico, conforme a las
Normas EN 933-8 / NF XP18-598
UNI 8520/15
S158-08
Cilindros de medida
S160 N
Modelos disponibles:
S158-01
CILINDRO DE MEDIDA EN
PLEXIGLAS, graduado en 100 y
380 mm, con etiqueta adhesiva
transparente, graduada en mm y
pulgadas (5 piezas).
NORMAS: ASTM D2419,
AASHTO T176
Agitador motorizado para E.A.
COMO ALTERNATIVA:
S158-01 S158-01G S158-03
S158-01G
CILINDRO DE MEDIDA EN
PLEXIGLAS, graduado en 100 y 380 mm con “escala graduada
desde 0 a 380 mm” adicional.
NORMAS: ASTM D2419, AASHTO T176
NORMAS: EN 933-8 / ASTM D2419 / AASHTO T176
NF XP18-598 / UNE 83131 / CNR N.27 / UNI 8520-15
La unidad permite una agitación uniforme y constante con un
ciclo de ensayo automático. Carrera de la oscilación de 203 mm
a velocidad ajustable entre 175÷180 carreras/min. Completo con
temporizador digital que detiene automáticamente el agitador al
final de ensayo. No se puede vender en mercados de la CE sin la
cubierta de seguridad (ver mod. S160-01N).
Alimentación: 230V monofásica 50Hz 250W.
Dimensiones: 700x360x350 mm
Peso: 30 kg
sección S
S UELOS
S158-03
CILINDRO DE MEDIDA DE PLEXIGLAS, graduado
en 100 y 380 mm
NORMAS: UNI EN 933-8 / NF XP18-598
CBR N . 27 / UNI 8520-15 / UNE 83131
363
S160 N + S158-03 + S158-02
S160-01 N
Agitador motorizado para
equivalente de arena
Tal como el descrito pero equipado con la cubierta
de seguridad, conforme a la Directiva de Seguridad
de la CE. Cuando se abre la cubierta durante el
funcionamiento del agitador, un microinterruptor
detiene la máquina.
S160-01 N + S158-03 +S158-02
S161
Agitador manual para equivalente de
arena
NORMAS: EN 933-8 / ASTM D2419 / NF XP18-598
AASHTO T176 / UNI 8520-15 / UNE 83131
Operación manual a través de manivela.
Completo con contador mecánico de carreras.
Dimensiones: 700x350x420 mm aprox.
Peso: 20 kg
S161
instrumentos para ensayos de materiales
sección S
SUE L OS
364
S170-01
S170
S170-05
LÍMITE LÍQUIDO: método de casagrande
NORMAS: UNI CEN ISO / TS 17892-12 / ASTM D4318
AASHTO T89 / UNI 10014 / NF P94-051,
comparable a la: BS 1377:2 / UNE 103 103-94
Usado para evaluar la relación entre el porcentaje de humedad de
las muestras de suelo y el numero de golpes requerido para cerrar
un surco hecho en el suelo; por tanto determinar cuando las arcillas
del suelo cambian del estado plástico al estado líquido. La unidad
comprende una cuchara de bronce extraíble que a través de un
dispositivo de leva cae en una base de baquelita (o una base de
goma dura). Entregado completo con contador de caídas, pero sin
la herramienta de hacer los surcos que debe pedirse por separado.
El instrumento está disponible en dos versiones:
- operación manual a través de una manivela (lateral derecho o
izquierdo)
- operación motorizada a 120 golpes/min. asegurando una mayor
precisión y uniformidad.
MODELOS:
S170
Dispositivo de límite líquido
Operado a mano con “manivela en lateral izquierdo” y base de
goma dura. Peso: 3 kg
NORMAS: UNI CEN ISO / TS 17892-12 / ASTM D4318
AASHTO T89 / UNI 10014,
comparable a la: BS 1377:2 / UNE 103 103-94
ACCESORIOS:
S173-02 Cuchara de bronce, rugosa, con banda central lisa de 10
mm de ancho. Según requiere la NORMA NF P94-051,
usada para suelos con baja plasticidad.
S173-03 Ranurador según las UNI 10014 - AASHTO T79
S173-04 Ranurador según la Norma ASTM D4318
S173-04P Ranurador, hecho de plástico duro. Paquete de 10
unidades. NORMA: ASTM D4318
S173-05 Ranurador según la Norma: NF P94-051
S173-06 Ranurador según la Norma: BS 1377:2
S173-06P Ranurador, hecho de plástico duro. Paquete de 10
unidades.
Norma: BS 1377:2
S170-05 Dispositivo de límite líquido
Operado a mano, similar al mod. S170, pero con “manivela en lateral derecho”.
S170-01
Dispositivo de límite líquido
S172-01
S172
S173-04P
S173-08
S173-02
S173-07
S173-01
Operado a mano, con base de goma dura, cuchara cromada.
NORMA: NF P94-051. Peso: 3 kg
S172
Dispositivo de límite líquido
Operado a mano, con base de goma dura, cuchara cromada.
NORMAS: UNI CEN ISO / TS 17892-12 / ASTM D4318
AASHTO T89 / UNI 10014,
comparable a la: BS 1377:2 / UNE 103 103-94
Alimentación: 230V monofásica 50 Hz. Peso: 4,5 kg
S172-01 NORMA: NF P94-051
Dispositivo de límite líquido
Motorizado con base de baquelita y copa cromada
Alimentación: 230V monofásica 50Hz. Peso: 4,5 kg
instrumentos para ensayos de materiales
S173-04
S173-05
S173-03
S173-06
RECAMBIOS:
S173-01 Cuchara de bronce (ASTM, BS, UNI, UNE, AASHTO).
S173-07 Cuchara cromada (NF P094-051)
S173-08 Pieza de acoplamiento entre la cuchara y el dispositivo,
modelo manual.
S173-09 Pieza de acoplamiento entre la cuchara y el dispositivo,
modelo motorizado.
S UELOS
S175
NORMAS: ASTM D 427 / AASHTO T 92 / UNI 10014
UNE 103-108 / NF XP94-060-1 / BS 1377:2
Usado para determinar el máx. contenido de humedad al cual el
suelo no se contrae después de secar la muestra.
Completo con estuche de transporte.
El conjunte comprende:
V122-04 Plato de contracción diá. 45x12,7 mm (2 piezas)
V122-03 Plato de cristalización, diá. 57x32 mm
S175-03 Pletina de contracción de plexiglás con tres puntas de metal.
S175-04 Plato de vidrio para evaporación diá. 120 mm fondo plano
V100-01 Cilindro graduado de 25 ml de capacidad
V192
Espátula flexible, hoja de 100 mm
Peso: 2 kg
sección S
Límite de retracción
S178
S178
NOTA: cada elemento se puede pedir por separado.
S175
Límite plástico
NORMAS: ASTM D4318 / AASHTO T90 / BS 1377:2 / UNI 10014
UNE 103-104 / NF P94-051 / CEN ISO-TS 17892-12
El límite plástico determina el menor contenido de humedad del
suelo al cual la muestra puede ser enrollada en bastoncillos de 3
mm de diá. sin romperse ni longitudinalmente o transversalmente.
El conjunto completo con estuche de transporte comprende:
S178-01 Pletina de vidrio 300x250x10 mm
S178-02 Varilla de calibre de 3 mm de diá.
V114-03 Plato de porcelana de mezclado de 120 mm de diá.
V192
Espátula flexible de 100 mm de hoja
Latas de aluminio para humedad 55x35 mm (cantidad 6)
V122
Peso: 5 kg
NOTA: cada elemento se puede pedir por separado.
S176
ACCESORIOS:
S178-06 Pletina de vidrio de 105x50 mm graduada cada 10 mm
con separador de bronce de 5 mm para medir el diá.
de la muestra de suelo a 3 mm ± 0,5 de acuerdo a NF
P94-051
S179
Pletina de vidrio esmerilado de 500x500x10 mm
S176
Contracción lineal
NORMA: BS 1377:2
Molde para producir muestras de 140 mm de largo x 12,5 mm de
radio. El ensayo cubre la determinación de la contracción lineal de
los suelos e indica las propiedades plásticas de los suelos con bajo
contenido en arcilla.
Peso: 500 g aprox.
S179
S178-06
instrumentos para ensayos de materiales
365
SUE L OS
Método del penetrómetro de cono para:
sección S
- Determinación del Límite Líquido.
NORMAS: UNI CEN ISO/TS 17892-12 / BS 1377:2 / NF P94-052-1
- Determinación de la Resistencia al Corte. NORMAS: UNI CEN ISO/TS 17892-06, 17892-12
LÍMITE LÍQUIDO
El ensayo se basa en la relación entre el contenido de
humedad en los suelos arcillosos, que pasan de estado
plástico a estado líquido. Este valor se obtiene de la
capacidad de penetración del cono estándar en la
muestra permitiendo la caída libre en la muestra por
un período de 5 segundos.
RESISTENCIA AL CORTE
El penetrómetro de cono
es adecuado para medir la
resistencia al corte sin drenaje en muestras de suelo
inalterado según Norma
CEN ISO / TS 17892-06.
S166 KIT
S165 KIT
B057-02
366
MODELOS:
S165 KIT
Penetrómetro de cono
El penetrómetro de cono compuesto por:
- Base de aluminio con tornillos de nivelación y el nivel de burbuja.
- Varilla cromada vertical con “dispositivo de desplazamiento
vertical micrométrico”
- Dial de 150 mm de diámetro, graduado a 360° y con divisiones
de 0,1 mm
- Deslizador de bronce, con caída libre, parada y botón de liberación, ajuste a cero automático.
- Cono de ensayo de penetración de acero inoxidable de 35 mm
de largo, ángulo de 30°
- Peso 20 g
- Dos copas de bronce de diámetro 55x35 mm y 70x45 mm
Dimensiones: 220x170x410 mm
Peso: 13 kg aprox.
S166 KIT
Penetrómetro de cono semiautomático
Estructura básica como mod. S165 KIT, pero equipado con un
dispositivo de control magnético con temporizador electrónico
digital programable, que automáticamente libera la cabeza del
émbolo y asegurando la caída libre del cono durante el ensayo de
5 segundos.
Se suministra completo.
Alimentación: 230V monofásica 50Hz 200W
Dimensiones: 220x280x410 mm
Peso: 15 kg aprox.
instrumentos para ensayos de materiales
ACCESORIOS:
S166-03 GALGA DE ENSAYO, para medir las condiciones de la
punta del cono, ángulo de 30º.
B057-02 ESPEJO para facilitar el ajuste de altura del cono.
S166-04 CONO DE ENSAYO DE 60º de ángulo y 60 g de peso
(ensayos de límite líquido y resistencia al corte).
S166-05 GALGA DE ENSAYO, para medir las condiciones de la
punta del cono, ángulo de 60º.
S166-06 PESO, de 320 g para ser añadido al cono de 30º de
ángulo, obteniendo un peso total de 400 g (ensayo de
resistencia al corte).
RECAMBIOS:
S166-01 Cono para ensayo de penetración de 35 mm de largo y
ángulo de 30º.
S166-02 Peso de 20 g para ser añadido al cono de 30º de
ángulo, obteniendo un peso total de 100 g.
V122-05 Copa de bronce, diá. 55x35 mm
V122-06 Copa de bronce diá. 70x45 mm
V122-06
V122-05
S166-06
S166-02
S166-04
S166-03
S166-01
S166-05
S UELOS
Método del penetrómetro de cono para:
LÍMITE LÍQUIDO
El ensayo se basa en la relación entre el contenido de
humedad en los suelos arcillosos, que pasan de estado
plástico a estado líquido. Este valor se obtiene de la capacidad de penetración del cono estándar en la muestra
permitiendo la caída libre en la muestra por un período
de 5 segundos.
RESISTENCIA AL CORTE
El penetrómetro de cono es adecuado para medir la
resistencia al corte sin drenaje en muestras de suelo
inalterado según Norma CEN ISO/TS 17892-06.
sección S
- Determinación del Límite Líquido.
NORMAS: UNI CEN ISO/TS 17892-12 / BS 1377:2 / NF P94-052-1
- Determinación de la Resistencia al Corte. NORMAS: UNI CEN ISO/TS 17892-06
S165-02 KIT
S165-01 KIT
B057-02
367
MODELOS:
S165-01 KIT
Penetrómetro de cono digital
El penetrómetro de cono compuesto por:
- Base de aluminio con tornillos de nivelación y nivel de burbuja.
- Varilla cromada vertical con “dispositivo de desplazamiento
vertical micrométrico”
- Lector digital de valores de penetración.
- Lecturas en mm y pulgadas, con resolución de 0,1 mm Pantalla
LCD de 5 dígitos, con ajuste de cero en cualquier posición.
- Fuente de alimentación: baterías de 1,5 V
- Deslizador de bronce, con caída libre, parada y botón de liberación, ajuste a cero automático.
- Cono de ensayo de penetración de acero inoxidable de 35 mm
de largo, ángulo de 30°
- Peso 20 g
- Dos copas de bronce de diámetro 55x35 mm y 70x45 mm
Dimensiones: 220x170x410 mm. Peso: 13 kg aprox.
S165-02 KIT
ACCESORIOS:
S166-03 GALGA DE ENSAYO, para medir las condiciones de la
punta del cono, ángulo de 30º.
B057-02 ESPEJO para facilitar el ajuste de altura del cono.
S166-04 CONO DE ENSAYO DE 60º de ángulo y 60 g de peso
(ensayos de límite líquido y resistencia al corte)
S166-05 GALGA DE ENSAYO, para medir las condiciones de la
punta del cono, ángulo de 60º.
S166-06 PESO de 320 g para ser añadido al cono de 30º de
ángulo, obteniendo un peso total de 400 g (ensayo de
resistencia al corte)
RECAMBIOS:
S166-01 Cono para ensayo de penetración de 35 mm de largo y
ángulo de 30º.
S166-02 Peso de 20 g para ser añadido al cono de 30º de
ángulo, obteniendo un peso total de 100 g
V122-05 Copa de bronce, diá. 55x35 mm
V122-06 Copa de bronce diá. 70x45 mm
Penetrómetro de cono semiautomático digital
Estructura básica como mod. S165-01 KIT, pero equipado con un
dispositivo de control magnético con temporizador electrónico
digital programable, que automáticamente libera la cabeza del
émbolo y asegurando la caída libre del cono durante el ensayo de
5 segundos. Se suministra completo.
Alimentación: 230V monofásica 50Hz 200W
Dimensiones: 220x280x410 mm. Peso: 15 kg aprox.
V122-06
V122-05
S166-06
S166-02
S166-04
S166-03
S166-01
S166-05
instrumentos para ensayos de materiales
SUE L OS
ENSAYO PROCTOR: RELACIÓN HUMEDAD-DENSIDAD
NORMAS: EN 13286-2 / ASTM D558, D698, D1557 / AASHTO T99, T134, T180 / BS 1377:4, 1924:2 / CNR N° 69
NF P94-093, P98-231-1 / DIN 18127 / NLT-108-91 / UNE 103-500, 103-501
Moldes Proctor
Usados para hallar la relación entre el contenido de humedad y la densidad de tierras compactadas. Fabricados en acero, completos con
cilindro del molde, collar y base, cadmiado anticorrosión. Los diferentes moldes proctor están disponibles de acuerdo a varias Normas
Internacionales en uso.
sección S
MODELOS:
368
Código
Descripción
Molde Proctor
Normas
Diá. Int.
mm
Escuadra
mm
Volumen
ml
Peso
kg
S185
Estándar
ASTM / AASHTO / NF / CNR
101,6
116,4
944
4,5
S186
Modificado
ASTM / AASHTO / CNR
152,4
116,4
2124
10
S189
Estándar abierto
ASTM / AASHTO / NF / CNR
101,6
116,4
944
5
S190
Modificado abierto
ASTM / AASHTO / CNR
152,4
116,4
2124
10
S190-01 KIT Modificado
NF
152
152
2758
10
S190-02 KIT Modificado abierto
NF
152
152
2758
11
S191
Estándar
BS
105
115,5
1000
5
S191-01
Estándar
UNE 103-500
102
122,4
1000
5
S191-02 KIT Modificado
UNE 103-501, NLT-108-91
152
127
2320
10
S194
EN 13286:2 equiparable a la DIN
100 ± 1
120 ± 1
942
9
S194-01 KIT Modificado
EN 13286:2 equiparable a la DIN
150 ± 1
120 ± 1
2120
13
S194-03
Estándar abierto
EN 13286:2 equiparable a la DIN
100 ± 1
120 ± 1
942
7,5
S194-04 KIT Estándar abierto
EN 13286:2 equiparable a la DIN
150 ± 1
120 ± 1
2120
12,5
S194-02
EN 13286:2 equiparable a la DIN
250 ± 1
200 ± 1
9817
32
Estándar
Gran tamaño
S194-01 KIT
S185 ÷ S191
instrumentos para ensayos de materiales
S194-04 KIT
S194-02
S194
S UELOS
MAZAS PROCTOR
Se utiliza para compactar la muestra de suelo dentro del molde. El mando de mano esférico es de baquelita con tornillo de metal y tuerca
de anillo de protección; manguito con guía y orificios de ventilación. Las mazas son de acero, chapado anticorrosión, disponibles en diferentes modelos de acuerdo a las diversas Normas Internacionales en uso. Como alternativa a las mazas se pueden utilizar las compactadoras
automáticas mod. S199 (ver pág. 370).
Código
Descripción
Normas
Diá.
Maza
Altura de
caída
mm
Peso maza
kg
mm
Peso total
kg
S187
Maza Proctor
estándar
ASTM / AASHTO
CNR / UNE / NF
50,8
304,8
2,495
5
S187-01
Maza Proctor
estándar
EN 13286:2
equiparable a la BS
50 ± 0,5
305 ± 3
2,5 ± 0,02
5
S188
Maza Proctor
modificado
ASTM / AASHTO
CNR / UNE / NLT / NF
50,8
457,2
4,536
8
S188-01
Maza Proctor
modificado
EN 13286:2
equiparable a la BS
50 ± 0,5
457 ± 3
4,5 ± 0,04
8
S188-02
Maza Proctor
gran tamaño
EN 13286:2
125 ± 0,5
600 ± 3
15 ± 0,04
23
sección S
MODELOS:
369
Chapa de acero (disco de compactación)
NORMAS: EN 13286:2 / DIN 18127
Se utiliza para compactar en los moldes EN, se suministra completo
con asa en T, chapado contra la corrosión.
MODELOS:
S194-09
PLACA, de diámetro 99,5 mm
y espesor de 10 mm
S188-01
S188-02
S194-11
S194-10
PLACA, de diámetro 149,5 mm
y espesor de 10 mm
S194-11
PLACA, de diámetro 249,5 mm
y espesor de 20 mm
S194-10
S194-09
Collar de corte
Junto al cuerpo del molde Proctor, hace
más fácil el muestreo del suelo.
MODELOS:
S185-01 Diámetro 4”
S200-09 Diámetro 6’’
S200-09
S187
S114
S114
EXTRACTOR UNIVERSAL para moldes de diámetros de 100, 150
mm; 4”, 6”. Detalles técnicos en la pág. 354.
instrumentos para ensayos de materiales
SUE L OS
S199
Compactadora automática, programable de PROCTOR / CBR con microprocesador,
“Alta tecnología”
sección S
NORMAS: EN 13286-47 / CNR UNI 10009 / CNR N. 29, 69 / ASTM D698, D1557, D1883 / AASHTO T99, T180, T193
BS 1377 :4, 1990, 1994 / NF P94-093, P94-066 / DIN 18127 / UNE 7365, 7255, 103-501-94 / DUTCH RAW
y la mayoría de la Normas Internacionales.
370
Expresamente fabricado para compactar probetas Proctor y CBR,
asegura un grado de compactación extremadamente uniforme,
garantizando resultados de confianza y reproducibles.
El software del microprocesador permite seleccionar y llevar a
cabo los diferentes ciclos de compactación mediante un sistema
totalmente automático, con el estricto cumplimiento de las mencionadas Normas Internacionales.
Los golpes se distribuyen automáticamente tal como requiere la
Norma específica con rotación del plato inferior y movimiento de
la maza a través de sensores con fotocélula y microprocesador.
Componentes de alta calidad y funcionamiento mecánico de alta
precisión garantizando una larga vida de uso, bajo usos intensivos.
El cuadro de mandos digital está separado de la compactadora y
puede, o bien fijarse sobre una pared o apoyarse sobre una mesa.
La pantalla gráfica es de alta resolución (azul negativo) 320x240
píxeles de selección de visualización Estándar, número total de golpes, realizados y los restantes para finalizar el ensayo, y la ejecución
de cada capa.
S199-11
El compactador es fácil de usar, con una sencilla guía de menús, de
simple y práctico mantenimiento.
El usuario puede “seleccionar y memorizar hasta 10 ciclos de
ensayo personalizados”, que pueden ser posteriormente modificados o reemplazados por otros. Esta es una función muy importante,
porque permite actualizar el compactador de nuevas Normativas, o
no incluir cualquier otra Norma en el microprocesador, o con fines
de investigación.
El original sistema de elevación de las mazas puede ser seleccionable para 12” o 18” o 300 o 450 mm, garantizando una altura de
caída correcta y constante.
S199 con molde y maza
Velocidad de caída de la maza: 1 golpe cada 2 segundos.
El compactador acepta moldes de diámetro 4” y 6”, 100 y 150 mm,
ambos fabricados por Matest o por otros productores, gracias a su
sistema de fijación universal del molde.
Pantalla de introducción de datos
instrumentos para ensayos de materiales
La máquina se suministra “sin mazas” que deben pedirse por separado y deben ser seleccionadas de acuerdo a la Norma deseada
(las mazas son intercambiables).
No se vende en los mercados de la CE.
(ver accesorios: elementos de Seguridad mod. S199-11)
Alimentación: 230V monofásica 50Hz 500W
Dimensiones: 610x470xh1710 mm
Peso: 165 kg
ACCESORIOS NECESARIOS:
S199-06 MAZA ESTÁNDAR 50 ± 0,2 mm de diámetro y 2500
± 10 g de peso
S199-07 MAZA MODIFICADA 50 ± 0,2 mm de diámetro y
4535 ± 5 g de peso
De acuerdo a las Normas: EN 13286-47 / BS 1377:4
UNE 7255, 7365, 103-501 / DIN 18127
O:
S199-08 MAZA ESTÁNDAR 50,8 ± 0,13 mm de diámetro y
2491,25 ± 1,25 g de peso
S199-09 MAZA MODIFICADA 50,8 ± 0,13 mm de diámetro y
4537 ± 3 g de peso
De acuerdo a las Normas: ASTM D558. D559, D698, D1557, D1883
NF P94-066/93 / CNR UNI 10009
CNR N. 69 / AASHTO T99, T180, T193
O:
S199-13 MAZA ESTÁNDAR 50 ± 0,4 mm de diámetro y 2700
± 10 g de peso
S199-14 MAZA ESTÁNDAR 50 ± 0,4 mm de diámetro y 4900
± 10 g de peso
De acuerdo a las Normas: AS 1289 (Norma australiana)
Pantalla de la
prueba
sección S
S UELOS
371
ACCESORIOS:
S199-11
ELEMENTOS DE SEGURIDAD según la
Directiva CE.
Si la puerta se abre cuando el compactador está trabajando, se detiene
automáticamente.
S199-12
CABINA DE SEGURIDAD INSONORIZADA, hecha de acero con
microinterruptores, en cumplimiento
a la Directiva de Seguridad de la CE,
revestido con material fonoabsorbente
para reducir el ruido. Si se abre la puerta, mientras que el compactador está
trabajando, se detiene automáticamente.
Dimensiones: 740x730x1900 mm
Peso: 80 kg aprox.
RECAMBIOS:
S198-22 Barra calibrada de soporte
de la maza.
S198-23 Conjunto de dos dispositivos
de fijación del molde al plato.
S199-07
S199 + S199-12 con accesorios
S199-06
instrumentos para ensayos de materiales
SUE L OS
CBR - INDICE CALIFORNIANO DE LA CAPACIDAD PORTANTE
NORMAS: EN 13286-47 / UNI EN 13286-4 / ASTM D1883 / AASHTO T193 / CNR UNI 10009 / UNE 103-502
NF P94-078, P94-093, P98-231-1 / BS 1377:4, 1924:2
Este método ha sido desarrollado por el “California State Highway Department” y es aceptado por casi
todas las Normas Internacionales en vigor. El ensayo va dirigido a la evaluación de la capacidad portante
de terreno para el diseño de pavimentos flexibles en la construcción de carreteras. El ensayo de compactación se puede realizar tanto con las mazas manuales o con las compactadoras automáticas mod. S199.
sección S
S201-05
S200-01... EQUIPO CBR SEGÚN NORMAS ASTM, AASHTO, CNR/UNI, UNE
372
S201 KIT... EQUIPO CBR SEGÚN NORMAS NF
S202 KIT... EQUIPO CBR SEGÚN NORMAS BS, EN 13286-4
El equipo CBR, hecho de acero y
chapado contra la corrosión está disponible en diferentes versiones según
las diferentes Normas en vigor.
S203 KIT... EQUIPO CBR SEGÚN NORMAS EN 13286-47
instrumentos para ensayos de materiales
S114
S UELOS
Normas
ASTM D1883
CNR UNI 1009
UNE 103-502
AASHTO T193
EN
13286-47
NF P94-078
NF P94-093
NFP98-231-1
EN 13286-4
BS 1377:4
BS 1924:2
Molde CBR completo con collar y base perforada:
Diá. 6” (152,4 mm) altura 7” (177,8 mm) .........................................S200-01
Diá. 150 mm, altura 120 mm...................................................................................................................................S203 KIT
Diá. 152 mm, altura 152 mm..........................................................................................................................................................................S201 KIT
Diá. 152 mm, altura 127 mm.....................................................................................................................................................................................................................S202 KIT
Molde CBR abisagrado con collar y base perforada:
Diá. 6” (152,4 mm) altura 7” (177,8 mm).....................................................S200-13
Diá. 150 mm, altura 120 mm...................................................................................................................................S203-01 KIT
Diá. 152 mm, altura 152 mm ....................................................................................................................................S201-01 KIT
sección S
Descripción
Base no perforada para molde CBR ..................................................S200-12 .............................S194-15..............S201-12 ................ S202-03
Base perforada para molde CBR........................................................S200-10 ...................... S194-14..................S201-10 ................ S202-10
Filtro de malla acero inoxidable diá. 149 mm
Abertura de malla 0,150 mm (ASTM n° 100) .................................S200-02 ...................... S200-02..................S200-02 ................ S200-02
Disco espaciador con asa tipo “T”:
Diá. 5 15/16” (150,8 mm) x 2,416” (61,4 mm) de altura ................S200-03
Diá. 149,5 x 36 mm de altura .................................................................................................... S194-21
Diá. 151 x 25,4 mm de altura ...................................................................................................................................S201-02
Diá. 151 x 36 mm de altura ......................................................................................................................................S201-06
Diá. 150 x 50 mm de altura ....................................................................................................................................................................... S202-07
Placa perforada para hinchamiento
con vástago regulable ..........................................................................S200-04 ...................... S194-23..................S200-04 ................ S200-04
Placa de hinchamiento lisa.......................................................................................................... S194-24
Trípode (porta-comparador)..............................................................S200-05 ...................... S194-26..................S200-05 ................ S200-05
Comparador carrera 10 mm div. 0,01 mm .......................................S376 .....................................S376
Comparador carrera 25 mm div. 0,01 mm .............................................................................................................S377 ...................... S377
Sobrecarga anular de 2270 g ..............................................................S200-07
Sobrecarga anular de 2300 g ....................................................................................................................................S200-07
Sobrecarga anular de 2000 g ..................................................................................................... S202-08............................................... S202-08
Sobrecarga ranurada de 2270 g .........................................................S200-08
Sobrecarga bipartida de 2300 g ...............................................................................................................................S201-04
Sobrecarga bipartida de 2000 g ................................................................................................ S202-09............................................... S202-09
Anillo de borde cortante ....................................................................S200-09 .....................................................S200-09 ................ S200-09
Maza de compactación:
Diá. 50,8 mm, altura de caída 457,2 mm, peso 4,54 kg.........................S188
Diá. 50 mm, altura de caída 457,2 mm, peso 4,54 kg ............................................................. S188-01..................S188-01 .....................S188-01
Regla enrasadora 300x30x3 mm .......................................................S200-11 ...................... S200-11..................S200-11 ................ S200-11
Regla enrasadora, borde cortante 300x30x3 mm ...........................S200-06 ...................... S200-06..................S200-06 ................ S200-06
Discos filtrantes de papel diá. 150 mm (paquete de 100 uds.) ......S200-14 ...................... S200-14..................S200-14 ................ S200-14
Tanque de remojo 600x400x400 mm ..............................................S201-05 ...................... S201-05..................S201-05 ................ S201-05
Extractor universal (ver pág. 354) ......................................................S114 ............................ S114..........................S114 ...................... S114
instrumentos para ensayos de materiales
373
SUE L OS
S197
Determinación de la resistencia de suelos
estabilizados
sección S
Martillo Vibrante de compactación
374
NORMAS: EN 13286-4 / BS 1377:4 / BS 1924:2
Este martillo vibrante ofrece una metodología alternativa para la
compactación de muestras de terreno en la determinación de la
relación entre densidad seca / humedad (llamado Proctor), resistencia a compresión de los suelos estabilizados y las pruebas de CBR.
Este martillo se utiliza también para la compactación de asfalto en
el porcentaje de la densidad de rechazo (ver pág. 77).
Se suministra sin pisón de apisonado y sin soporte que deben
pedirse aparte.
Alimentación:
230V monofásica 50/60 Hz 750W
Dimensiones: 105x430x270 mm
Peso: 7 kg
S197
ACCESORIOS:
S197-01
Soporte para martillo vibrante en acero cadmiado
anticorrosivo.
Peso: 45 kg
B097-02
Pisón de apisonado para
ensayos CBR y Proctor de
diámetro 145 mm
B097-03
S197-01
B097-02
B097-03
Vástago de 300 mm de
largo
RESISTENCIA A LA COMPRESIÓN DE MEZCLAS DE SUELO-CEMENTO
NORMAS: EN 13286-41, 12390-4
Se utiliza una máquina de compresión con rango de medición
adecuado (0-250/500 kN) para
ensayos de compresión en
probetas cilíndricas de mezcla
suelo-cemento.
Estas máquinas para cemento
(ver pág. 312) o para hormigón
(ver pág. 140÷189) son adecuadas para realizar este tipo de
ensayos.
NORMAS: EN 13286-53 / NF P98-230-2 / BS 1924 :2
Se utiliza para preparar las muestras estabilizadas con conglomerantes de cemento o mezclas de áridos, con el fin de determinar
la resistencia a compresión en suelos de grano fino y mediano.
Fabricado en acero bañado.
MODELOS:
S195-01 Molde diá. 50x122 mm, para preparar probetas de diá.
50x50 mm de altura de granulometría fina y media (NF)
S195-02 Molde diá. 50x172 mm, para preparar probetas de diá.
50x100 mm de altura de granulometría fina y media
(EN, BS) y gruesa (NF).
S195-15 Molde diá. 100x242 mm, para preparar probetas de diá.
100x100 mm de altura de granulometría gruesa (EN, BS).
S195-20 Molde diá. 100x342 mm, para preparar probetas de diá.
100x200 mm de altura de granulometría gruesa (EN, BS).
S195-03 Pistones de base y superior diá. 50x36 mm
S195-16 Pistones de base y superior diá. 100x71 mm
S195-04 Pistones de penetración y moldeo diá. 50x125 mm
S195-05 Pistones de penetración y moldeo diá. 50x175 mm
S195-17 Pistones de penetración y moldeo diá. 100x245 mm
S195-21 Pistones de penetración y moldeo diá. 100x345 mm
S195-09 Cilindro de recogida diá. 56x60 mm
S195-10 Cilindro de recogida diá. 56x110 mm
S195-18 Cilindro de recogida diá. 106x110 mm
S195-22 Cilindro de recogida diá. 106x210 mm
S195-11 Conjunto de 2 suplementos de anillo diá. 50x5 mm
S195-06 Conjunto de 2 suplementos de anillo diá. 50x6 mm
S195-12 Conjunto de 2 suplementos de anillo diá. 50X8,33 mm
S195-23 Conjunto de 2 suplementos de anillo diá. 50x10 mm
S195-07 Conjunto de 2 suplementos de anillo diá. 50x12,5 mm
S195-24 Conjunto de 2 suplementos de anillo diá. 50x16,66 mm
S195-08 Conjunto de 2 suplementos de anillo diá. 50x25 mm
S195-13 Conjunto de 2 suplementos de anillo diá. 100x10 mm
S195-14 Conjunto de 2 suplementos de anillo diá. 100x16,66 mm
S195-25 Conjunto de 2 suplementos de anillo diá. 100x20 mm
S195-19 Conjunto de 2 suplementos de anillo diá. 100x25 mm
S195-27 Conjunto de 2 suplementos de anillo diá. 100x33,33 mm
S195-28 Conjunto de 2 suplementos de anillo diá. 100x50 mm
NOTA: El equipo está hecho de acero y chapado contra la corrosión.
S195-01 ÷ S195-28
instrumentos para ensayos de materiales
S UELOS
Esta ensayo cubre la determinación de la densidad seca máxima y
el contenido de agua (Índice de humedad / densidad) en las mezclas no cohesivas que se utilizarán en la construcción de carreteras,
y donde la densidad máxima por el método de impacto es menor
que con el método de vibración.
El conjunto de la densidad relativa se propone en dos versiones de
acuerdo a las Normas EN o ASTM:
S238 KIT
Densidad relativa de suelos no cohesivos
NORMA: EN 13286-5
El conjunto está compuesto por:
S238-10
Mesa vibratoria electromagnética, dimensiones de 762x762 mm, frecuencia de vibración de 3600 rpm, rango de amplitud: 0,05 a 0,64 mm,
máx. capacidad de carga de 250 kg, con panel de control separado.
S238-11 Molde de densidad relativa de 0,5 pies cúbicos de
capacidad con accesorios.
S238-12 Sobrecarga de peso y base con mango según la Norma
EN para el molde de 0,5 pies cúbicos.
S238-16 Conjunto de medidores de densidad relativa.
Alimentación: 230V monofásica 50/60Hz . Peso total: 290 kg aprox.
S238-01 KIT
Densidad relativa de suelos no cohesivos
NORMAS: ASTM D4253, D4254
El conjunto está compuesto por:
S238-10 Mesa vibratoria electromagnética, como se describió
anteriormente.
S238-11 Molde de densidad relativa de 0,5 pies cúbicos de
capacidad + accesorios
S238-13 Molde de densidad relativa de 0,1 pies cúbicos de
capacidad + accesorios
S238-14 Sobrecarga de peso y base con mango según la Norma
ASTM para el molde de 0,5 pies cúbicos
S238-15 Sobrecarga de peso y base con mango según la Norma
ASTM para el molde de 0,1 pies cúbicos
S238-16 Conjunto de medidores de densidad relativa
Alimentación:
230V monofásica 50/60Hz
Peso total: 310 kg aprox.
S229
Ensayo de placa de carga dinámica
NORMA: Código Alemán de suelos, rocas, construcción
de carreteras TP BF-StB parte B 8.3/2003
Se utiliza en movimiento de tierras y construcción de
carreteras para determinar la capacidad portante del
suelo y la calidad de la compactación de los suelos y
subbases no cohesivos, así como para aplicaciones de
mejora del suelo. El método de ensayo es adecuado
para suelos de grano grueso y mezclas de grano mixto
con un tamaño de grano máximo de 63 mm.
El método de ensayo puede ser utilizado para determinar el módulo dinámico de deformación en el suelo en
el rango de Evd = 15 ... 80 MN/m2.
sección S
DENSIDAD RELATIVA DE LOS SUELOS
NO COHESIVOS METODO DE LA MESA VIBRANTE
S229
S229-14
375
VENTAJAS sobre el equipo de ensayo de la placa de carga estática:
- La evaluación inmediata de cada medición
- Equipo de poco peso
- Fácil de manejar
- Ahorro de tiempo
- Ensayos en lugares no muy accesibles
- No es necesario ningún vehículo para la carga
De fácil manejo y proporciona resultados inmediatos de las mediciones, la ligereza del equipo lo hace especialmente adecuado para
monitorizar operaciones dentro de la empresa. Facilita decisiones
rápidas para continuar con los trabajos de construcción en el sitio.
ESPECIFICACIONES:
- Bajo peso: 10 kg
- Max. fuerza de impacto: 7,07 kN
- Duración del impacto: 18 ms
- Plato de carga de diámetro 300 x 20 mm
- Rango de medida de asentamiento: 0,10 a 2,0 mm
- Alimentación: 4 x pilas recargables R6
El equipo se suministra completo con unidad de carga,
plato de carga con transductor de aceleración, un
medidor de asentamiento electrónico con visualización
de fecha y hora en un maletín. Impresora térmica con un
puerto adicional para impresora. Peso total: 30 kg
ACCESORIOS:
S229-05 CAIDA de peso de 15 kg con un máximo
de fuerza de impacto de 10605N, completo
con certificado de calibración.
S229-13 CARRO DE TRANSPORTE, plegable, para
desplazamientos de distancias largas.
S238-01 KIT
S229-14 PLACA BASE IMANTADA, para el posicionamiento adecuado de la unidad de carga.
instrumentos para ensayos de materiales
sección S
SUE L OS
376
S131 KIT
S210-KIT
Maquina de ensayo de compresión no
confinada
Equipo para ensayos CBR en obra, manual
NORMAS: ASTM D2166 / AASHTO T208 / BS 1377:7
Este equipo de ensayos manual se utiliza tanto in situ como en
laboratorio, y aplica la carga por medio de una manivela leyéndose
la tensión en un anillo dinamométrico de 200 kg de capacidad.
El aparato puede ensayar muestras hasta de diá. 80 mm x 200 mm
de alto.
EL S131 KIT de ensayos comprende:
Bastidor para reacción
S221
S221-01 Gato mecánico de 50 kN de capacidad
S370-02 Anillo dinamométrico de 2 kN de capacidad
S131-11 Platos de compresión
superior e inferior con
los accesorios
S376
Reloj comparador
de 10 x 0,01 mm
S212-03 Soporte de reloj
comparador
Dimensiones: 380x460x1380 mm
Peso: 68 kg
NORMAS: ASTM D1883 / AASHTO T193 / CNR UNI 10009
BS 1377:4 / NF P94-078
La carga se aplica a través de un gato mecánico con manivela.
La viga superior se puede ajustar de altura.
La máquina S210 KIT comprende:
S221
Bastidor para reacción
S221-01
Gato mecánico de 50 kN
de capacidad
S370-10
Anillo dinamométrico de 50 kN
de capacidad
S212-01
Pistón de penetración CBR
S376
Reloj comparador de 10 x 0,01 mm
S212-03
Soporte de reloj comparador
Dimensiones: 420x370x1180 mm
Peso: 65 kg aprox.
S131 KIT
S210 KIT
NOTA:
Las máquinas descritas en esta página incluyen algunos componentes comunes (como por ej. gato mecánico del mod. S221-01).
Por tanto, es posible combinar estos componentes en máquinas
diferentes, con alguna ventaja de tipo económica.
S220 KIT
Equipo para ensayos CBR en obra
NORMAS: BS 1377:7, 1924:2 / ASTM D4429
CNR UNI 10009 / NF
Utilizada para determinar de forma rápida y precisa la capacidad de
carga en obras de carreteras, subbases, cimentaciones, etc.
El S220 KIT equipo se compone de:
S221-01 Gato mecánico de 50 kN de capacidad
S370-09 Anillo dinamométrico de 40 kN
de capacidad
S212-01 Pistón de penetración CBR
S377
Reloj comparador de 25 x 0,01 mm
S212-03 Soporte de reloj comparador
S220-01
Viga de soporte de 1400 mm de largo; sobrecargas
ranuradas de 4, 5 y 9 kg y anulares de 4,5 kg; juego
de prolongadores: 2x100 mm, 1x300, 600, 1000 mm; accesorios,
caja de madera de transporte. Peso: 70 kg aprox.
instrumentos para ensayos de materiales
S220 KIT
S UELOS
MÁQUINA DE ENSAYOS “CBR”
S209 KIT
S211 KIT
Máquina CBR, manual, de laboratorio
Máquina CBR motorizada, 50 kN
Velocidad: 1,27 mm/min
La carga se aplica a través de gato mecánico con manivela manual.
El puente superior es regulable en altura.
Provista de dispositivo de aproximación rápida del plato.
La máquina CBR S209 KIT comprende:
S209-01 Bastidor de CBR para laboratorio
S212-01 Pistón de penetración CBR
S370-10 Anillo dinamométrico de 50 kN de capacidad
S376
Reloj comparador de 10 x 0,01 mm
S212-03 Soporte de reloj comparador
Dimensiones: 430x380x1180 mm
Peso: 80 kg
Se aplica una carga a través de un gato de tornillo sinfín accionado
por un motor eléctrico con velocidad de avance constante de
1,27 mm/min (Normas ASTM, BS, EN) que se obtiene gracias a un
conjunto de engranajes y “se garantiza incluso bajo carga”.
El puente superior es regulable en altura.
Provista de un dispositivo de aproximación rápida del plato de
base y de finales de carrera eléctricos para el recorrido del plato
protegiéndolo de maniobras accidentales.
La máquina S211 KIT CBR consta de:
S211-10 Bastidor de CBR motorizado
S212-01 Pistón de penetración CBR
S370-10 Anillo dinamométrico de 50 kN de capacidad
S376
Reloj comparador de 10 x 0,01 mm
S212-03 Soporte de reloj comparador
Alimentación: 230V monofásica 50Hz 750W
Dimensiones:
430x380x1180 mm
Peso: 98 kg
sección S
NORMAS: EN 13286-47 / ASTM D1883 / BS 1377-4:1990 / AASHTO T193 / CNR UNI 10009 / NF P94-078
Utilizada para introducir un pistón de penetración en una muestra de suelo a la velocidad constante de 1,27 mm/min (1 mm/min según
BS), verificando las cargas aplicadas y las penetraciones del pistón a intervalos determinados. Matest propone una vasta gama de prensas:
manuales, motorizadas, con dos velocidades, universal multi-velocidad; con medida de la carga con anillo dinamométrico o bien con célula
eléctrica de carga y unidad digital con registrador gráfico X/Y de carga/penetración con conexión a PC a través del puerto RS232.
S209 KIT
S211 KIT
ACCESORIOS:
S210-02
CADENCIÓMETRO CBR
Para aplicar el gradiente de carga
correcto de 1,27 mm/min a la
prensa CBR manual S209 KIT.
Alimentación:
230V monofásica 50Hz
S210-02
S374 DISPOSITIVO DE BLOQUEO, mantiene en el comparador
del anillo dinamométrico la carga máxima aplicada, con
sucesiva puesta a cero manual. Adecuado para prensas
S209 KIT y S211 KIT.
S374-01
DISPOSITIVO DE PARO AUTOMATICO ELÉCTRICO de la máquina
de CBR cuando se alcanza la máxima capacidad de carga. Para evitar
posibles daños debidos a sobrecargas accidentales, este dispositivo se
monta sobre el anillo dinamométrico de la prensa S211 KIT.
...continúa...
instrumentos para ensayos de materiales
377
sección S
SUE L OS
378
S212
S213
Prensa de carga universal multi-velocidad, 50kN
Prensa “CBR/Marshall” de carga de 2
velocidades, 50 kN
Esta máquina motorizada con control electrónico digital y microprocesador, puede utilizarse para todos los ensayos donde la
velocidad requerida está comprendida entre 0,5 y 63 mm/min, con
carga máxima de 50 kN.
Es por lo tanto idónea para ensayos:
• Ensayo de compresión no confinada con velocidad de 0,635 mm/min.
• Ensayo CBR con velocidad de 1,27 mm/min.
• Triaxial rápido
• Ensayo Marshall con velocidad de 50,8 mm/min.
• Ensayo de Tracción indirecta con muestras Marshall
La gama de velocidad es infinitesimal variable, simplemente e
inmediatamente seleccionable.
El puente superior es regulable en altura.
Provisto de fines de carrera eléctricos para el recorrido del plato
de carga para protección de maniobras accidentales.
La máquina se suministra “sin” anillo dinamométrico ni accesorios
que deben pedirse aparte.
Alimentación: 230V monofásica 50/60Hz 750W
Dimensiones: 650x500x1350 mm
Peso: 180 kg
El bastidor va provisto de dos velocidades de avance fijas fácilmente
seleccionables por un cambio mecánico:
1,27 mm/min para ensayos CBR
50,8 mm/min para ensayos Marshall
El puente superior es regulable en altura.
El recorrido del plato está provisto de finales de carrera eléctricos,
para la protección de maniobras accidentales.
La máquina se suministra “sin” anillo dinamométrico ni accesorios
que deben pedirse aparte.
Alimentación: 230V monofásica 50Hz 750W
Dimensiones: 450x400x1200 mm
Peso: 130 kg
ACCESORIOS para prensas S212 y S213
Ensayo CBR:
S212-01 Pistón de penetración CBR
S370-10S Anillo dinamométrico de 50 kN
de capacidad con dispositivo de
seguridad de parada eléctrica.
S374
Dispositivo de freno para mantener
la carga máxima
Reloj comparador de 10 x 0,01 mm
S376
S212-03 Soporte de reloj comparador
Ensayo MARSHALL:
S212-05 Pistón de carga
B046N Molde de Estabilidad
B047
Caudalímetro
B047-01 Reloj comparador para el caudalímetro
S370-08S Anillo dinamométrico de 30 kN
de capacidad con dispositivo de
seguridad de parada eléctrica.
S374
Dispositivo de freno para mantener
la carga máxima
S212
con accesorios para ensayo CBR
Ensayo de COMPRESIÓN NO CONFINADA:
S212-08N Platos superior e inferior de compresión de diámetro
100 mm + suplemento de barra
S212-03 Soporte de reloj comparador
S376
Reloj comparador de 10 x 0,01 mm
S370-02S Anillo dinamométrico de 2 kN de capacidad con dispositivo de seguridad de parada eléctrica.
S374
Dispositivo de freno para mantener la carga máxima
instrumentos para ensayos de materiales
S213
con accesorios para ensayo Marshall
S UELOS
PRENSAS DE ENSAYO:
Características generales:
El bastidor de ensayo es idéntico a los bastidores de las máquinas descritas (mod. S211 KIT a S213), mientras la carga viene dada por una
célula eléctrica de 50 kN con galgas extensométricas de alta precisión. La deformación (flujo) se mide con un transductor de desplazamiento eléctrico de carrera 50 mm con linealidad independiente ± 0,1%.
El “CYBER-PLUS 8 EVOLUTION” sistema de pantalla táctil digital computerizado (detalles técnicos: ver mod.B044N-SET en pág. 382, detalles técnicos de hardware en pág. 24), muestra y visualiza al mismo tiempo la carga (estabilidad) en kN y la deformación (Flujo) en mm con
la elección de los valores de pico y con la posibilidad de imprimir los certificados y gráficos directamente en una impresora láser a través de
USB o de transferirlos al PC vía Ethernet.
sección S
- CBR
- CON DOS VELOCIDADES
- UNIVERSAL MULTI-VELOCIDAD
COMBINADA CON “CYBER-PLUS 8 EVOLUTION”, SISTEMA DE PANTALLA TÁCTIL DIGITAL COMPUTERIZADO
MODELOS DISPONIBLES:
S216 KIT
Prensa CBR digital computerizada
VELOCIDAD DE RECORRIDO: 1,27 mm/min)
Características del bastidor: ver mod. S211 KIT, pág. 377
SUMINISTRADA COMPLETA excepto el software (ver pág. siguiente).
379
S216 KIT + accesorios CBR
S214 KIT
Prensa CBR-Marshall de dos velocidades
digital, computerizada
El bastidor va provisto de dos velocidades de avance fijas, fácilmente seleccionables por un cambio mecánico:
1,27 mm/min para ensayos CBR
50,8 mm/min para ensayos Marshall
Características del bastidor: ver mod. S213, pág. 378
Suministrada completa con el sistema “Cyber-Plus 8 Evolution”,
célula de carga y transductor de desplazamiento, pero “sin”
accesorios ni software para ensayos CBR y Marshall, que deben ser
pedidos aparte (ver accesorios en la pág. siguiente).
S214 KIT + accesorios CBR
...continúa...
instrumentos para ensayos de materiales
sección S
SUE L OS
380
S215 KIT
con accesorios CBR
S215 KIT
Prensa universal multi-velocidad digital, computerizada
Características del bastidor: ver mod. S212, pág. 378
Se suministra completo con sistema “Cyber-Plus 8 Evolución” (Detalles técnicos: ver mod. B044N-SET pág. 382, los detalles técnicos de
hardware en pág. 24), célula de carga y transductores de desplazamiento, pero “sin” accesorio para ensayos CBR, Marshall, Compresión no
confinada, que deben ser pedidos aparte (ver accesorios).
ACCESORIOS PARA LOS BASTIDORES DE CARGA DE 2 VELOCIDADES Y MULTI-VELOCIDAD, MODELOS S214 KIT Y S215 KIT
PARA REALIZAR:
Ensayo CBR
S212-01 Pistón de penetración
Ensayo MARSHALL
S212-05 Pistón de carga
B046N
Molde de estabilidad, de aleación de aluminio
Ensayos COMPRESIÓN NO CONFINADA
S212-08N Platos superior e inferior de compresión de diámetro
100 mm + suplemento de barra
SOFTWARES PARA LOS BASTIDORES COMBINADOS CON EL
SISTEMA “CYBER-PLUS 8 EVOLUTION”:
S218N SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de CBR
Normas: EN 13286-47 / CNR UNI 10009 / ASTM D1883
BS 1377 / NF P94-078
S218-01N SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de COMPRESION NO CONFINADA
Norma:
ASTM D2166
instrumentos para ensayos de materiales
B043-01N SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de MARSHALL.
Normas: EN 12697-34 / CNR N. 30 / ASTM D1559
BS 598 :107 / NF P98-251
B043-02N SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayos de TRACCIÓN INDIRECTA
Normas: EN 12697-23 / CNR N. 134 / ASTM D4123
Descripción y detalles técnicos del software UTM2: ver pág. 14
C127N
Impresora gráfica de papel térmico incorporada.
H009-01
ORDENADOR PERSONAL, con monitor LCD de 17 “, teclado,
ratón, cables de conexión, instalación y puesta en marcha del
software adquirido.
C128
Impresora láser, para los gráficos y la impresión del certificado de
ensayo, con conexión directa a la Cyber-Plus 8.
sección S
S UELOS
381
instrumentos para ensayos de materiales
sección S
SUE L OS
B044N SET
B044N-SET
Cyber-Plus 8 Evolution “Pantalla Táctil”
382
Sistema de adquisición y procesamiento de datos 8 canales.
Desarrolladas para la implementación y mejora de cualquier tipo
de máquinas existentes (incluso las no fabricados por Matest)
aplicable a:
- Máquina de carga motorizada CBR mod. S211 KIT.
- Prensa Universal multi-velocidades mod. S212.
- Prensa de 2 velocidades CBR / Marshall mod. S213.
- Prensa mecánica Marshall mod. B042 KIT.
Cyber-Plus 8 Evolution permite:
- Adquisición de hasta 8 canales analógicos / digitales: la célula de
carga y transductores de desplazamiento lineal potenciométrico
vertical y / o horizontal.
Para llevar a cabo los siguientes ensayos:
- ENSAYO CBR: EN 13286-47 / CNR / UNI 10009 / ASTM D1883
BS 1377 / NF P94-078.
- ENSAYOS DE COMPRESION NO CONFINADA: ASTM D2166
- MARSHALL: EN 12697-34 / ASTM D1559 / CNR N. 30
NF P98-251-2 / BS 598 :107
- ENSAYO DE TRACCIÓN INDIRECTA : EN 12697-23 / ASTM D4123
- DETERMINACIÓN DE LA SENSIBILIDAD AL AGUA EN MUESTRAS BITUMINOSAS: EN 12697-12
- Control remoto de la unidad digital a través del ordenador y el
software UTM2
Especificaciones del hardware:
- 8 canales independientes disponibles para las células de carga o
los transductores potenciométricos o bandas extensométricas
para medidas de carga, deformación o desplazamiento.
- Alimentación estabilizada de los canales analógicos: 5 Vcc y 3 Vcc.
- Entrada analógica: ± 20 mV y ± 5V
- Resolución nominal: 24 bits.
- Adquisición de hasta 200 lecturas por canal.
- Sistema de seguridad on/off específico
instrumentos para ensayos de materiales
- Pantalla gráfica a color 1/4 VGA con pantalla táctil.
- Sistema de tiempo y de calendario
Especificaciones del firmware:
- Visualización instantánea del valor de carga por una célula extensiométrica.
- Visualización instantánea del valor de la deformación medido por
4 transductores de desplazamiento lineal.
- Visualización de la gráfica del ensayo.
- Visualización de fecha y hora.
- Configuración y calibración semi-automática de todos los transductores conectados.
- 20 de los pasos de programa se pueden configurar por el usuario
final.
- Corrección automática del eje del origen en ensayos
CBR / Marshall.
- Cálculo y visualización automática de todos los resultados de
acuerdo a la Norma.
- Configuración de todos los parámetros del ensayo: las alarmas,
puesta a cero, porcentaje del ensayo, parámetros de cálculo.
- Fecha / hora y la selección de idioma (Italiano, Inglés, francés,
alemán, español, polaco).
- Archivos ilimitados para cada tipo de ensayo.
- Los símbolos de las funciones en los botones.
- Mensajes informativos (alarmas de planificación, ajustes de la
célula de carga y de la tensión del transductor, etc.)
- Función de seguridad de parada automática de la máquina cuando se llega a la carga y a la deformación máxima del transductor
de presión.
- Impresión de los resultados con la impresora gráfica térmica
incorporada (accesorio C127N). Transferencia y gestión a través
de Ethernet de los datos de archivos o en tiempo real.
Detalles técnicos de hardware: ver pág. 24
S UELOS
S337-34
CÉLULA DE CARGA, 50 kN de capacidad, con elevada precisión
en los transductores de presión, completa con cable y conector.
B043-01N
SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de MARSHALL
Programa de procesamiento de datos por “X-Y ESTABILIDAD/
DEFORMACIÓN”
Normas: EN 12697-34 / CNR N. 30 / ASTM D1559
BS 598 :107 / NF P98-251-2
sección S
B044N-SET está compuesto por:
B044N
CYBER-PLUS 8 EVOLUTION, unidad adquisición de datos, como
se ha descrito.
Alimentación: 230V monofásica 50/60Hz
S336-14
TRANSDUCTOR DE DESPLAZAMIENTO LINEAL, de 50 mm
de carrera, linealidad independiente ± 0,1% completo con cable y
conector.
Accesorios para la fijación de la célula de carga y el transductor de
la máquina de ensayo.
El sistema se suministra totalmente calibrado con certificado de
calibración, y listo para usar.
Cada artículo se puede pedir por separado.
383
ACCESORIOS:
S218N
SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de CBR
Normas: EN 13286-47 / CNR/UNI 10009 / ASTM D1883
BS 1377 / NF P94-078
S218-01N
SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de COMPRESION NO CONFINADA
Norma: ASTM D2166
B043-02N
SOFTWARE UTM2 (Máquina Universal de Ensayo 2)
Licencia para ensayo de TRACCIÓN INDIRECTA
Normas: EN 12697-23 / CNR N. 134 / ASTM D4123
Descripción y detalles técnicos del software UTM2: ver pág. 14
C127N
Impresora gráfica de papel térmico incorporada.
H009-01
ORDENADOR PERSONAL, completo con monitor LCD de 17 “,
teclado, ratón, cables de conexión, instalación y puesta en marcha
del software adquirido.
C128
Impresora láser, para la impresión del certificado de
ensayo y los gráficos, con conexión directa a la
CYBER-PLUS 8.
instrumentos para ensayos de materiales
SUE L OS
S205
UNITRONIC 50 kN, PRENSA UNIVERSAL MULTIFUNCIÓN DE COMPRESIÓN/FLEXIÓN Y TRACCIÓN PARA:
sección S
- ENSAYOS DE COMPRESIÓN/FLEXIÓN, DE 50 kN MAX. CAPACIDAD DE CARGA
- ENSAYOS DE TRACCIÓN, 25 kN MAX. CAPACIDAD DE CARGA (accesorio mod. S205-05)
CON SISTEMA DE CONTROL AUTOMÁTICO DE FUERZA O DE DESPLAZAMIENTO/DEFORMACIÓN, para los ensayos de:
384
Suelos:
- CBR (California Bearing Ratio)
- COMPRESIÓN NO CONFINADA
- TRIAXIAL RÁPIDO
Asfalto:
- MARSHALL
- TRACCIÓN INDIRECTA
- CORTE DIRECTO (Leutner) entre capas de aglomerado
Hormigón:
- FLEXIÓN EN PROBETAS PRISMÁTICAS DE HORMIGÓN
- FLEXIÓN EN BALDOSAS
Datos técnicos:
- Capacidad de compresión máxima: 50 kN
- Capacidad de tracción máxima: 25 kN (accesorio S205-05)
- Velocidad de ensayo ajustable de 0,01 a 51 mm/minuto
- Relación de fuerza ajustable de 1 a 15000 N/s
- Máx. recorrido del travesaño: 100 mm
- Luz entre columnas: 380 mm
- Max. luz vertical: 850 mm
Alimentación: 230V monofásica 50/60Hz 1500W
Dimensiones: 500x450x1450mm.
Peso: 130 kg aprox
Cemento:
- FLEXIÓN de probetas 40x40x160 mm
- COMPRESIÓN de cubos de 40, 50, 70 mm
- TRACCIÓN en probetas de mortero (accesorio mod. S205-05)
Metal, plástico, cables, cuerdas, telas, papeles, etc.
- ENSAYO DE TRACCIÓN, 25 kN de capacidad máxima de carga
(accesorio mod.S205-05)
Bloques de arcilla:
- PUNZONADO
Rocas y piedras:
- TRACCIÓN INDIRECTA UNIAXIAL
Diferentes materiales:
Mediante el uso de dispositivos adecuados, la prensa Unitronic,
dentro de los límites de 50 kN de capacidad máx. realiza ensayos
de compresión/flexión y de 25 kN en tracción (ver accesorio
S205-05), también realiza ensayos de compresión, flexión, tracción
directa y tracción indirecta, con control automático de carga o de
desplazamiento / deformación.
S205
con célula
de carga
La carga es aplicada por un gato mecánico impulsado por un motor
“sin escobillas con circuito cerrado a través de un codificador
óptico” y controlado por un microprocesador. El pistón de carga
posee interruptores de final de carrera para salvar a la máquina
de manipulaciones accidentales. El panel de control se coloca de
frente y se suministra con una membrana que tiene 6 pulsadores
interactivos multifunción guiado por un menú, una pantalla gráfica
de gran tamaño y un puerto RS232 para conexión a PC.
Especificaciones de hardware y software:
- Pantalla gráfica en negativo azul “320 x 240 píxeles”
- 4 salidas analógicas A/D para transductores o células de carga
- Memoria permanente y reloj-calendario
- Procesamiento del ensayo completamente automático, con la
adquisición en tiempo real y visualización de la carga/desplazamiento o deformación, o la curva de carga/tiempo/deformación.
- Memoria de más de 100 ensayos, con la posibilidad de visualizar/
borrar archivos de ensayo
- Funciones en varios idiomas: Italiano, Inglés, Francés, Español
instrumentos para ensayos de materiales
ACCESORIO:
S205-05
UNITRONIC compresión / tracción
El bastidor Unitronic S205 está modificado y mejorado para llevar a
cabo también ensayos de tracción de 25 kN de capacidad máxima.
(Nota: esta modificación sólo es posible en la fábrica de MATEST)
Ensayo CBR
Triaxial rápido
Ensayo de tensión en probetas
prismáticas de mortero
Punzonamiento en bloques
de arcilla
sección S
S UELOS
385
Compresión en
cemento
Ensayo Marshall
Ensayos de tracción
en metales, plásticos,
alambres, telas, etc.
Corte directo
(Leutner)
Tracción indirecta
Compresión no confinada
Flexión en hormigón
Flexión en tejas de arcilla
Flexión en cemento
Tracción indirecta uniaxial en
rocas
instrumentos para ensayos de materiales
SUE L OS
sección S
UNITRONIC: EJEMPLOS DE PANTALLA
Ensayo CBR
Calibración de la célula de carga
Ensayo Marshall
Pantalla de carga
386
S205
UNITRONIC, aplicaciones específicas:
CBR: Ensayo California Bearing Ratio
Normas: EN 13286-47:2006 / ASTM D1883 / BS 1377:4
CNR UNI 10009 / NF P94-078 / AASHTO T193
UNE 103-502
Desarrollo de los ensayos con control de desplazamiento.
Pantalla principal
Pantalla de configuración
instrumentos para ensayos de materiales
Accesorios necesarios:
S337-34 CELULA DE CARGA, 50 kN de capacidad
S212-01 Pistón de penetración
S218
Software para el ensayo CBR.
Archivo de ensayo
CBR
S218 software para ensayo CBR
S UELOS
Ensayo de flexión con punto central en probetas
prismáticas de hormigón y tejas de cerámica
C109-11 Software para ensayos de flexión en probetas prismáticas de hormigón
Ensayo de punzonamiento en los bloques
de arcilla
Norma: UNI 9730-3
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-32 Célula de carga, 10 kN
de capacidad
C093-11 Dispositivo de punzonamiento
a flexión
S205-15 Viga de apoyo para el
dispositivo de punzonamiento
Ensayo de flexión en prismas de mortero
de 40x40x160 mm
sección S
Normas: EN 12390-5, 491, 538 / ASTM C78, C293
UNI 6133 / BS 1881:118 / NF P18-407 / UNE 83305
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-34 Célula de carga, 50 kN de capacidad
S205-18
Dispositivo de flexión de carga en el punto central para los ensayo
en tejas de cerámica y probetas prismáticas de hormigón dimensiones 100x100x400 (500) y 150x150x600 mm.
Consiste en colocar la probeta prismática en los dos apoyos
inferiores (uno articulado) ajustables desde 100 a 315 mm, y en el
apoyo superior central articulado fijada la célula de carga.
Dimensiones de los apoyos: 38 mm de diámetro por 300 mm de largo
Peso: 20 kg aprox.
C109-11 Software para el ensayo
de flexión en probetas prismáticas de
hormigón
Ensayo de compresión en muestras de
mortero (50 kN de carga máx.)
Normas: EN 196-1 / EN ISO 679 / ASTM C109, C349
NF P18-411 / UNE 80101 / BS 3892 / DIN 1164
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-34 Célula de carga, 50 kN de capacidad
S212-05 Pistón de carga
E170
Elemento del dispositivo de compresión para porciones
de probetas de 40x40x160 mm
(dispositivos para las diferentes muestras se describen
en pág. 322)
E163
Software para ensayos de compresión
Normas: EN 196-1 / ASTM C348 / NF P15-451 / DIN 1164
EN ISO 679
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S337-32 Célula de carga, 10 kN de capacidad
S212-05 Pistón de carga
E172-01 Dispositivo de flexión para muestras de 40x40x160
mm, según Norma EN
(disponible también con la norma ASTM, ver pág. 322)
E164
Software para las pruebas de flexión
E164 Software para
flexión del mortero
E163 Software para la compresión en mortero
instrumentos para ensayos de materiales
387
sección S
SUE L OS
Ensayo de estabilidad Marshall
Ensayo de tracción indirecta
Normas: EN 12697-34 / ASTM D1559 / AASHTO T245
BS 598 :107 / NF P98-251-2 / CNR N° 30
Desarrollo de ensayos con control de desplazamiento.
Normas: EN 12697-23 / ASTM D4123 / CNR N° 134
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-34 Célula de carga, 50 kN de capacidad.
S212-05 Pistón de carga.
B046N Mordaza de estabilidad.
B043-01 Software para el ensayo Marshall.
Accesorios necesarios:
S337-34 Célula de carga, 50 kN de capacidad.
S212-05 Pistón de carga.
B047-02 Dispositivo de tracción indirecta para muestras de
diámetro 4 “y 6”.
B047-04 Juego de DOS transductores de desplazamiento con
accesorios.
B043-02 Software para el
ensayo de tracción
indirecta.
388
Archivo del ensayo
Marshall
B043-02 Software ensayo
tracción indirecta
Ensayo de compresión no confinada
Normas: ASTM D2166 / BS 1377:7 / AASHTO T208
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-31 Célula de carga, 2,5 kN de capacidad.
S212-08N Plato superior e inferior de compresión de diámetro
100 mm, con accesorios.
S218-01 Software del ensayo de compresión no confinada.
B043-01 Software ensayo Marshall
S218-01 Software del
ensayo de compresión no confinada.
Ensayo triaxial rápido
Normas: ASTM D2850 / BS 1377
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-31 Célula de carga, 2,5 kN de capacidad.
S205-11 Pistón de carga con rótula.
S305
Célula triaxial con accesorios (ver pág. 414)
instrumentos para ensayos de materiales
S UELOS
Ensayo de tracción en probetas de mortero
en forma de “8”
Ensayo de tracción indirecta uniaxial en
testigos de roca
Normas: ASTM C190, C307 / AASHTO T132
Desarrollo de ensayos con control de carga.
Accesorios necesarios:
S205-05 Unitronic con la mejora de la tracción, capacidad de 25 kN.
S337-32 Células de carga de tracción/compresión de 10 kN de
capacidad.
S205-07 Mordazas de tracción para probetas de mortero en
forma de “8”.
Norma: ASTM D3967
Desarrollo de ensayos con control de carga.
sección S
Accesorios necesarios:
S337-34 Célula de carga, de
50 kN de capacidad.
S212-05 Pistón de carga.
E171
Dispositivo de
compresión.
S205-08 Software
para ensayo
de tracción.
E111
Molde de
aglomerados
(ver pág. 302)
Ensayo de corte directo (Leutner) entre
capas bituminosas
Ensayos de tracción en metales, plásticos,
alambres, telas, etc.
Desarrollo de ensayos con control de carga.
Accesorios necesarios para las muestras de metales planos y redondos:
S205-05 Unitronic con la mejora de la tracción, capacidad de 25 kN
S337-36 Células de carga de 25 kN de capacidad
H005-11 Cabezales de tracción (superior e inferior)
S205-09 Acople para la instalación de cabezales de tracción
H005-21 Mordazas planas para muestras planas de 1 a 10 mm
de espesor de 25 mm de anchura máx. y bloques
redondos de diámetro 3-5 mm
H005-31 Mordazas en forma de “V” para bloques redondos de
diámetro 5-12 mm
Accesorios opcionales:
H014
Extensómetro electrónico, para ensayos de deformación por tracción.
H016
Software para la visualización en tiempo real de la
carga/deformación,
gráfico, certificado de
prueba, etc.
En pág. 334 del catálogo se enumeran los dispositivos de ensayo de
plásticos, alambres, cuerdas, ensayos
de flexión y de doblado y diversos
modelos de extensómetros.
A petición también es posible
equipar el bastidor Unitronic
S205-05 con dispositivos para
ensayos de tracción de diferentes
materiales, dentro de los 25 kN de
capacidad de carga máx.
Norma: ALP A StB T.4
Ensayo de corte directo (LEUTNER) en la conexión entre las capas
bituminosas, sobre muestras cilíndricas de asfalto de diámetro 150
mm o 100 mm obtenidas a partir de testigos de la carretera o de
muestras realizadas en laboratorio.
Desarrollo de ensayos con control de desplazamiento.
Accesorios necesarios:
S337-34 Célula de carga, 50 kN de capacidad.
S212-05 Pistón de carga.
B047-10 Cabezal de ensayo LEUTNER para la muestras de
diámetro 150 mm
B047-11 Separadores de 100 mm de diámetro con el cabezal
Leutner.
B043-03 Software para los ensayos Marshall y Leutner.
NOTA:
Los accesorios necesarios antes mencionados, son comunes para
los diferentes ensayos. Se recomienda verificar al realizar el pedido,
para evitar alguna duplicidad.
instrumentos para ensayos de materiales
389
SUE L OS
S206
sección S
MULTI-ENSAYOS 200 kN
BASTIDOR UNIVERSAL ELECTROMECÁNICO PARA ENSAYOS DE COMPRESIÓN, FLEXIÓN, TRACCIÓN EN MATERIALES DE
CONSTRUCCIÓN CON SISTEMA SERVOCONTROLADO DE CARGA O DESPLAZAMIENTO / ESFUERZO.
La máquina está compuesta por una base robusta que contiene los componentes de transmisión y los instrumentos de control de hardware.
La base alberga dos columnas, hechas de acero de alta resistencia con la superficie revestida de cromo duro.
La viga superior se puede ajustar en altura, para sostener los accesorios y realizar los ensayos específicos.
La viga móvil inferior es operada por un sistema de husillo de recirculación de bolas, que a través de un motor servocontrolado, asegura la
correcta aplicación de la carga y la velocidad constante.
Se prevén para las dos vigas acoplamientos para fijar los dispositivos de diferentes ensayos (ver accesorios).
El estrés se mide por una célula de carga eléctrica, y el desplazamiento de la viga por los transductores, todo incorporado en la
máquina.
Es posible fijar las células de carga eléctricas de menor capacidad,
para satisfacer los requisitos de ensayos específicos.
390
S206
Especificaciones técnicas:
- Carga Max.: 200kN (compresión y tensión)
- Distancia máxima vertical: 800 mm (sin accesorios)
- Distancia máxima vertical con platos de compresión: 700 mm
- Diámetro de los platos de compresión: 180 mm (plato superior
con asiento de rótula)
- Distancia entre columnas: 610 mm
- Recorrido de la viga: ±200 mm (400 mm en total)
- Rango de velocidad de ensayo: de 0,01 a 100 mm/min
- Tasa de carga: de 1 N/s hasta 5 kN/s
- Resolución del desplazamiento: 0,01 mm con una precisión mayor
que 0,2%
- Máquina de clase: 1
instrumentos para ensayos de materiales
La multiensayos se suministra completa con célula de carga eléctrica de 200kN, transductores de desplazamiento de la viga, software
para Duriez, Marshall y CBR, ordenador con monitor LCD, teclado,
ratón, cables de conexión, platos superior e inferior de compresión.
“No se incluyen”: la impresora y accesorios para ensayos específicos que deben pedirse por separado (ver accesorios).
Alimentación: 230V monofásica 50Hz 850W
Dimensiones: 1350x510xh 2250 mm
Peso: 850 kg aprox.
ACCESORIO:
C128
IMPRESORA LASER, modelo de banco, para los gráficos
y los certificados, con conexión directa a través de USB.
S UELOS
MATERIALES
ENSAYO
NORMAS
ACCESORIOS
Mezclas
bituminosas
Duriez
NF P98-251-1/4
Equipo Duriez (ver pág. 118)
Marshall
EN 12697-34
ASTM D1559
Mordaza de estabilidad B046N
Pistón de carga S212-05
Tracción indirecta
EN 12697-23
ASTM D4123
Dispositivo tracción indirecta B047-02
Conjunto de dos manómetros B047-03
Pistón de carga S212-05
Corte Leutner
ALP A StBT.4
Cabezal Leutner B047-10
Separadores de diá. 100 mm B047-11
Pistón de carga S212-05
Flexión en probetas prismáticas
Flexión de tejas de cerámica
EN 12390-5
ASTM C78, C293
Dispositivo de flexión C106
Dispositivo de flexión S205-18
Tracción indirecta en
probetas cilíndricas
EN 12390-6
ASTM C496
Dispositivo C101-01
Tracción indirecta en
probetas cúbicas y adoquines
EN 12390-6,
EN 1338
Dispositivo C103
Punzonamiento
UNI 9730-3
Dispositivo C093-1
Viga de apoyo S205-11
Compresión
EN 196-1
ASTM C109
Dispositivo E170
Dispositivo E171
Flexión
EN 196-1
Dispositivo E172-01
Célula de carga de 10kN S337-32
Suelo
CBR
EN 13286-47
ASTM D1883
Pistón de carga S212-01
Acero, barras
Tracción
EN ISO 6892
Cabezal a tracción de 50 kN
H005-21
Cabezal a tracción de 200kN
H007-11
(mordazas: ver pág. 334).
Hormigón
Cemento y
morteros
sección S
Ensayos principales y accesorios específicos:
instrumentos para ensayos de materiales
391
SUE L OS
ENSAYO DE PLACA DE CARGA
NORMAS: ASTM D1194, D1195, D1196 / BS 1377:9 / CNR N° 92 e 146 / UNE 7391 / DIN 18134 / SNV 70312
Este ensayo se efectúa para determinar la capacidad portante de un suelo in situ en la construcción de carreteras, bases, subbases de
carreteras, aeropuertos y pavimentos de carreteras.
Está disponible una amplia gama de equipos de placa de carga, junto con muchos accesorios de acuerdo a los diferentes Normas y las
necesidades específicas del usuario final:
S222 KIT
sección S
Equipo de placa de carga de 100 kN de capacidad - Modelo de 1 comparador
392
NORMA: CNR N° 146, Metodo “A”
Compuesto de:
S222-01 Gato hidráulico de 100 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores
rápidos, conjunto de extensiones de barras de diferentes longitudes, caja de transporte.
S222-02 Manómetro de 0-100 kN, div. 0,5 kN
S226-05 Placa de carga diá. 300 mm
S226-12 Dispositivo de centrado del comparador, con rótula
S222-03 Viga de referencia de longitud 2,5 m, telescópica, hecha de aluminio, ajustable en altura.
Completa con base de apoyo, plomada y nivel. Embalados por separado.
S377
Comparador de 25x0,01 mm
S226-16 Soporte articulado con dispositivo de ajuste para el comparador.
Peso: 60 kg aprox.
S222 KIT
S223 KIT
Equipo de ensayo de placa de carga de 100 kN – Modelo de 3 comparadores
NORME: CNR N° 146 metodo “B” / BS 1377:9
Consiste en:
S222-01 Gato hidráulico de 100 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores
rápidos, conjunto de extensiones de barras de diferentes longitudes, caja de transporte.
S222-02 Manómetro de 0-100 kN, div. 0,5 kN
S226-13 Rótula esférica superior
S226-05 Placa de carga diá. 300 mm
S226-06 Placa intermedia diá. 160 mm
S222-03 Viga de referencia de longitud 2,5 m, telescópica, hecha de aluminio, ajustable en altura, completa con base de apoyo, plomada y
nivel. Embalados por separado. (Solución alternativa: S223-03 sistema de medida en “Y”, Método Suizo. Ver pág. 395)
S377
3 comparadores de 25x0,01 mm
S226-16 3 soportes articulados con dispositivo de ajuste para el comparador.
Peso: 60 kg aprox.
S223-01 / S223-02
ACCESORIO para mod. S222 KIT y S223 KIT:
S223-01
MANÓMETRO, escala 0-50 kN, div. 0,25 kN, con amplio cuadrante diá. 200 mm, completo con conector
rápido utilizado para “lecturas de precisión a bajos valores de carga”, tales como precargas de 0,5 kg/ cm2
instrumentos para ensayos de materiales
S UELOS
S225 KIT
NORMAS: CNR N° 146, método “B” / BS 1377:9; y usando las placas de carga (accesorio) de diámetro 450, 600, 760 mm, cumple también
con: ASTM D1195, D1196 / CNR N. 92
Consiste en:
S225-01 Gato hidráulico de 200 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores rápidos, conjunto
de extensiones de barras de diferentes longitudes, caja de transporte.
S225-02 Manómetro de 0-200 kN, div. 1 kN
S226-13 Rótula esférica superior
S226-05 Placa de carga diá. 300 mm
S226-06 Placa intermedia diá. 160 mm
S222-03 Viga de referencia de longitud 2,5 m, telescópica, de aluminio, ajustable en altura, completa con base de apoyo, plomada y nivel.
Embalados por separado. (Solución alternativa: S223-03 sistema de medida en “Y”, Método Suizo. Ver pág. 395)
S377
3 comparadores de 25x0,01 mm
S226-16 3 soportes articulados con dispositivo de ajuste para el comparador.
Peso: 70 kg aprox.
ACCESORIO para S225 KIT:
S223-02
MANÓMETRO, escala 0-50 kN, div. 0,25 kN, con
amplio cuadrante diá. 200 mm, completo con conector
rápido utilizado para “lecturas de precisión a bajos
valores de carga”, tales como precargas de 0,5 kg/ cm2.
sección S
Equipo de ensayo de placa de carga de 200 kN de capacidad - Modelo de 3 comparadores
393
B103-10
B103-10
Placa de carga de 600 mm Ø de aluminio
fundido
NORMA: NF P94-117-1
Se utiliza para determinar la deformación estática en pavimentos
flexibles con el equipo de placa de carga.
Detalles técnicos: ver pág. 121
S225 KIT
(similar a S223 KIT y S226 KIT)
S226 KIT
Equipo de ensayo de placa de carga de 500 kN de capacidad - Modelo de 3 comparadores
NORMAS: CNR N° 146, método “B” / BS 1377:9; y usando las placas de carga (accesorio) de diámetro 450, 600, 760 mm, cumple también
con: ASTM D1195, D1196 / CNR N. 92
Consiste en:
S227-02 Gato hidráulico de 500 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores rápidos, conjunto
de extensiones de barras de diferentes longitudes, caja de transporte.
S227-03 Manómetro de 0-500 kN, div. 2 kN
S226-05 Placa de carga diá. 300 mm
S226-06 Placa intermedia diá. 160 mm
S222-03 Viga de referencia de longitud 2,5 m, telescópica, de aluminio, ajustable en altura, completa con base de apoyo, plomada y nivel.
Embalados por separado. (Solución alternativa: S223-03 sistema de medida en “Y”, Método Suizo. Ver pág. 395)
S377
3 comparadores de 25x0,01 mm
S226-16 3 soportes articulados con dispositivo de ajuste para el comparador.
Peso: 110 kg aprox.
instrumentos para ensayos de materiales
SUE L OS
S224 KIT
sección S
Equipo de ensayo de placa de carga digital de 100 kN de capacidad
3 transductores de desplazamiento lineal y sistema de adquisición Cyber-Plus 8 Evolution
394
NORMAS: CNR N° 146 metodo “B” / BS 1377:9
Consiste en:
S222-01 Gato hidráulico de 100 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores rápidos, conjunto
de extensiones de barras de diferentes longitudes, caja de transporte.
S226-13 Rótula esférica superior
C116-09S Transductor de presión, conectado a la bomba.
C405-15N Cyber-Plus 8 Evolution “Pantalla táctil” para la adquisición, visualización, procesamiento y almacenamiento de datos, se conecta
directamente al ordenador o a la impresora. Detalles técnicos: ver pág. 396
S224-21N Software para el procesamiento de los datos del ensayo.
S226-05 Placa de carga diá. 300 mm
S226-06 Placa intermedia diá. 160 mm
S222-03 Viga de referencia de longitud 2,5 m, telescópica, hecha de aluminio, ajustable en altura, completa con base de apoyo, plomada
y nivel. Embalados por separado. (Solución alternativa: S223-03 sistema de medida en “Y”, Método Suizo. Ver pág. 395)
S336-14 3 transductores de desplazamiento lineal, 50 mm de recorrido.
S336-31 3 extensiones de cables para el transductor, 5 m de largo.
S226-16 3 soportes articulados del transductor con el dispositivo de ajuste.
S335-15 3 pinzas de sujeción para los transductores.
Peso: 60 kg aprox.
S224-01 KIT
Equipo de ensayo de placa de carga digital de 200 kN de capacidad
3 transductores de desplazamiento lineal y sistema de adquisición Cyber-Plus 8 Evolution
NORMAS: CNR N° 146, método “B” / BS 1377:9; y usando las placas de carga (accesorio) de diámetro 450, 600, 760 mm, cumple también
con: ASTM D1195, D1196 / CNR N. 92
Consiste en:
S225-01 Gato hidráulico de 200 kN de capacidad, completo con bomba de mano, tubos de conexión con conectores rápidos, conjunto
de extensiones de barras de diferentes longitudes, caja de transporte.
S226-13 Rótula esférica superior
C116-09S Transductor de presión, conectado a la bomba.
C405-15N Cyber-Plus 8 Evolution “Pantalla táctil” para la adquisición, visualización, pr