High-resolution - Attire Accessories magazine
Transcription
High-resolution - Attire Accessories magazine
ATTIRE JANUARY/FEBRUARY 2015 ISSUE 50 Show previews s¬3PRING¬&AIR¬s¬-ODA¬ s¬3COOP¬)NTERNATIONAL¬ s¬3COTLANDS¬4RADE¬ ¬&AIR¬3PRING Accessories PURE LONDON A comprehensive exhibition guide Go with the FROW A sneak peek at London Fashion Week #HECKING¬IN Our pick of the latest travel accessories W IN W IN prod worth £ ucts RRP co 500 ur of URB tesy COUN AN TRY Here comes the hotstepper The best summer shoes PLUS s¬%80%24¬!$6)#% s¬).$53429¬.%73 s¬"2!.$¬.%7¬02/$5#43 WWW.ATTIREACCESSORIES.COM CONTENTS Contents 121 REGULARS 9 Editor’s letter What to look out for this issue 10 Industry news Get the low-down on the latest happenings in accessories retail 17 On with the show All of the latest trade show news, dates and developments 20 BTAA news Paul Yates brings us a round-up of the association’s news 23 Competition Win products worth £500 RRP, courtesy of URBAN COUNTRY PROFILES 75 75 Caught in a wrap Rew founder, Rachel Emma Wright talks about the inspiration behind the scarf brand’s inception and dedication to British manufacture 24 Brand spanking new The hottest new products to hit the market 125 All the answers Our industry experts answer your retail queries 95 A bolt from the blue Suzie Blue’s Ben Adams explains the family business’ ethical approach and why it’s hard to pick a best seller from its vast accessories range 138 108 In the spotlight Suzanne Johnson, Fullspot UK’s Sales Manager tells us about the quirky Italian label’s beginnings and colourful, customisable collections 121 All in good time Owner of Dundee’s Time Lifestyle Boutique, Nicola Donnelly invites us into her design-conscious retail space 24 138 All bold Design by Tala’s founder, Tala Habbal reveals the eclectic influences behind her bag collections ATTIRE 5 · FEATURES 50 Insurance solutions Broker TH March addresses queries and concerns about insurance 79 Buckle up The hottest shoes for summer 2015 99 Precious cargo A look at the latest travel accessories 117 Taming the big bad Penguin David Fairhurst of Intelligent Retail discusses how to protect and get the most out of your website 128 Treasure island Turn your shop into a fashion maven’s paradise by adding a tropical twist and jungle accents to your displays 130 Laying down the law ACID’s Dids MacDonald explains the new design law to improve protection and support for designers 128 6 ATTIRE 95 SHOWS 31 A pure thing A comprehensive guide to the capital’s leading fashion trade show, Pure London 53 The real spring A sneak peek at the Spring Fair line-up 87 The modern age What to expect at Moda this February 103 In the scoop All the latest on Scoop International 107 Highland fling Highlights to watch out for at Scotland’s Trade Fair Spring 113 Front row and centre Insider details on the upcoming London Fashion Week 87 53 EDITOR’S LETTER Cover image courtesy of Gaby www.gabysfashions.com ATTIRE Accessories JANUARY/FEBRUARY 2015 MANAGING EDITOR Jo Fletcher-Cross +44 (0)1376 535 611 DEPUTY MANAGING EDITOR Rosie Orgles EDITOR Laura Sutherland +44 (0)1376 535 613 [email protected] CHIEF SUB EDITOR Stephen Ducker SALES & MARKETING MANAGER Robert Clark +44 (0)1376 514 000 [email protected] ACCOUNT MANAGER Claire Rogers +44 (0)1376 535 600 [email protected] PRODUCTION MANAGER Scott Brothwell +44 (0)1376 535 616 [email protected] DEPUTY PRODUCTION MANAGER Sarah Young +44 (0)1376 535 616 [email protected] GRAPHIC DESIGNERS Alex Bolton, Stephanie Hodder PRODUCTION ASSISTANT Charlotte Potter WEB DEVELOPMENT MANAGER Stuart Weatherley SUBSCRIPTIONS Kay Tilbury, Cheri Love +44 (0)1376 514 000 KD Media Publishing Limited Pantile House, Newlands Drive, Witham, Essex CM8 2AP www.attireaccessories.com ISSN 1758-0919 Attire Accessories is solely owned, published and designed by KD Media Publishing Limited. Whilst every effort was made to ensure the information in this magazine was correct at the time of going to press, the publishers cannot accept legal responsibility for any errors or omissions, nor can they accept responsibility of the standing of advertisers nor by the editorial contributions. The views expressed do not necessarily reflect those of the publisher. Attire Accessories is published six times a year. Subscription rates for overseas readers are £75 per annum (incl. p+p), Cheques should be made out to KD Media Publishing Limited and sent to Attire Accessories, Pantile House, Newlands Drive, Witham, Essex CM8 2AP. Fabulous at 50 As we enter a new year, I’m delighted to be able to celebrate Attire Accessories’ landmark 50th issue with you, readers – thanks for all your support and continued interest in our take on trade events, accessories collections and design trends over the past seven years. Here’s to another 50 issues dedicated to showcasing the best that the fashion accessories industry has to offer. Our 2015 fashion coverage begins with our exclusive preview of Pure London. Our continued partnership with the show means that we bring you a comprehensive exhibition guide, complete with information on all of the latest reedit developments, a full accessories and footwear sector brand listings and extensive exhibitor profiles. With a fresh jewellery initiative, and an expanded line-up in the footwear sector, it’s bound to be the London-based event’s best edition to date. There are also extensive guides for Spring Fair, Moda, Scoop International and Scotland’s Trade Fair Spring, key events in the trade buying calendar, as well as a sneak peek at the country’s most prominent sartorial occasion: London Fashion Week. With a mixture of heritage labels and upand-coming names lined up to showcase their latest pieces, all of the events covered in these pages are vital for retailers who want to stay relevant and promote diversity in their offerings. Alongside our bumper show previews and regular features and interviews, we also take a look at the market’s best travel accessories and hottest summer shoes for the forthcoming season. This issue’s competition prize of products worth £500 RRP comes courtesy of UK-based bag label, URBAN COUNTRY. Happy New Year! Laura Laura Sutherland Editor Summer shoes, page 79 Editor’s pick While I find packing for long haul expeditions a breeze, it’s the day-to-day travelling that I find myself woefully underprepared for, and my make-up bag is often forgotten in the morning rush, meaning that I have to forgo my lipstick top ups. However, if I had this leather Lamb 1887 beauty to keep my cosmetics in, I’d be camera ready at all times. As chic as any of my handbags, the only problem would be keeping it in my tote, rather than having it on display everywhere I go. ATTIRE 9 READERS’ POLL Industry news What we’ve learnt from the latest reader poll at www.attireaccessories.com We asked: Do you stock eco-friendly accessories? FIND OUT WHAT’S NEW IN FASHION ACCESSORIES RETAILING You said: Yes: 67% No: 33% Morplan celebrates 170 years in business Morplan, one of the UK’s best-known wholesale suppliers to the retail industry, is celebrating a mighty 170 years in business. Back in 1844, when George Morrish set up his print workshop in Union Row Cottages in the Camberwell area of London, the Factory Act was only just being introduced to protect women and children working in the textile mills, and Queen Victoria had only recently acceded to the throne. Fast forward 170 years and today the company supports more than 50,000 retail shops, factories and colleges with its next day delivery service and a choice of 5,000-plus stocked products. In fact, www. morplan.com attracts more than a million visitors a year and the company sends out at least 500 orders every day. Morplan’s Marketing Director, Norman Haynes says: “We guarantee competitive prices and fast delivery on a fantastic range of products. We offer just about everything you need to run a successful retail business. I’d like to think we’ll still be the UK’s leading retail wholesale supplier in another 170 years’ time.” Celebrities open CW Sellors Christmas Wishes and raise more than £1,800 for charity CW Sellors kicked off the Christmas season with the annual Christmas Wishes Fine Jewellery and Luxury Watch Showcase hosted at the estate in Derbyshire. Olympic gold medallist and TV presenter, Colin Jackson CBE, opened the event with a speech on Movember, a charity he supports in conjunction with Maurice Lacroix Watches. Paul Cummins, the artist who made the ceramic poppies displayed at the Tower of London in the weeks before the WWI Remembrance commemorations, was also a special guest. The event, the largest of its kind in the country, raised funds for NSPCC and the Derbyshire, Leicestershire and Rutland Air Ambulance. With a range of fundraising activities on offer, the event invited visitors to try their hand at selecting a real diamond from a sea of cubic zirconia, test their luck at roulette and be photographed wearing jewellery worth more than £300,000. 10 ATTIRE THE GA’S MEET THE BUYER EVENT WITH JOHN LEWIS IS BIG HIT Following the resounding success of The Giftware Association’s first major ‘Meet the Buyer’ event, staged in conjunction with the John Lewis Partnership in November 2014, the Association’s confirmed it’s planning further events for 2015. “We simply couldn’t accommodate all the members who wanted to attend and I know a number of companies were very disappointed to miss out. Fortunately the John Lewis team found the day a very efficient way of working and we’re currently in negotiations with the partnership to stage two more events in 2015,” says GA Chief Executive Isabel Martinson. If you’d like to take part, not just with John Lewis but possibly with other major gift and home retailers, you can register your interest by emailing [email protected]. Bagabook makes an impact in the USA Bagabook’s delighted that its new in-house designs have been received with such enthusiasm in the USA. The company’s extended ranges of iPad pouches, tote bags and scarves, all designed in-house, have helped to enhance overseas interest. Owner Basil Doha, informs us that due to commitments in the States, the company’s unable to attend this year’s Spring Fair. For more product information, you can register online at www.bagabook.com/customer/register. COME AND SEE OUR NEW SPRING COLLECTION AT SPRING FAIR STAND NUMBER 19G20 | MODA STAND NUMBER O72 ALTERNATIVELY, CONTACT US ON 01423 868362 FOR A COPY OF OUR LATEST BROCHURE VISIT OUR WEBSITE www.parklaneonline.com VIEW THE RANGE BY APPOINTMENT AT OUR SHOWROOM IN HARROGATE. 20 designs of hand made natural fibre jewellery & accessory displays available to order from www.parklaneonline.com NEWS & EVENTS Olivia Burton founders win NatWest everywoman award The two founders of watch label Olivia Burton have been announced as the winners of the Demeter category at NatWest’s everywoman awards. This particular plaudit recognises female business owners aged between 26 and 35. The everywoman awards were judged by some of Britain’s most successful female entrepreneurs, including Cath Kidston MBE and The White Company’s Chrissie Rucker MBE. Jemma Fennings and Lesa Bennett were delighted to receive the award, with Jemma saying: “It’s fantastic to see so many successful women being celebrated for their contributions to business. The past year has been amazing for Olivia Burton and we can’t thank NatWest and everywoman enough for recognising that with this award. We also want to say a huge thank you to our team, which is incredibly focussed and dedicated to the brand.” Co-founder of everywoman, Maxine Benson MBE remarked on the winners: “It takes a bold and gutsy individual to start a business and today’s winners are all women with vision and determination, qualities that have contributed to their success. They not only fly the flag for British business, but are role models for future generations of entrepreneurs.” The watch brand is inspired by catwalk and vintage styles and the designs are wearable, affordable and bursting with British style. Despite operating in a highly competitive market, Olivia Burton has grown into a global brand that exports to 11 countries worldwide and is stocked in top retailers such as John Lewis, Harvey Nichols and Selfridges. For more information about Olivia Burton, visit the label’s website www.oliviaburton.com. BRITISH JEWELLERY & GIFTWARE FEDERATION BENEVOLENT SOCIETY BALL The 79th British Jewellery & Giftware Federation Benevolent Society Ball took place on 4th December at the St Johns Hotel, in Solihull. Incorporated within this longstanding annual event were the BJA Member Awards, which are designed to flag up all that’s excellent about the UK’s diverse jewellery industry. The Benevolent Society Ball attracts guests from the Jewellery Trade and Giftware Associations and other member organisations of the British Allied Trades Federation. David Simons, the Benevolent Society’s Chairman, was delighted that more than 370 guests attended the black tie event, with many companies using it as the perfect occasion to celebrate Christmas with staff and their colleagues in the trade. A charity auction was conducted by the Society’s Vice Chairman, David Doyle of Jewellery Brokers, and early indications are that about £30,000 was raised on the evening. Lots for the auction included lunch for 12 at Assay Office Birmingham, a silver curve claret jug from silversmith Martyn Pugh and a full VIP Package to an NEC venue donated by Paul Thandi and Kathryn James of the NEC Group. Tables at the 2014 event were taken by companies including the NAG, CMJ, Charles Green & Son, Gems TV, Continental Jewellery, Diamonds Please, Weston Beamor, Hockley Mint, Clogau Gold, Cookson Gold, CW Sellors, Assay Office Birmingham and TH March. The date for this year’s Benevolent Society Ball is Thursday, 3rd December, 2015 and it will be held again at the St Johns Hotel. Early bird tickets can be obtained by contacting Lynn Snead on +44 (0)121 745 4613 or via email at [email protected]. IMPORT SERVICES SET FOR EXPANSION Import Services is set for expansion in 2015 with the opening of a distribution centre at London Gateway to launch a twin port strategy from its established operation at Southampton container port. A partnership between DP World London Gateway and Import Services will ensure that all shippers will benefit from low-cost supply chain opportunities at London Gateway’s new common user facility. Mike Thomas, client services director at Import Services, said, “This is an exciting new venture and we’re delighted to have been selected by DP World London Gateway. Operating the facility will enable import services to replicate our portcentric logistics model developed in Southampton, and help both existing and new clients to grow.” Import Services links supply chains with global real time information to provide the optimum route to market in multichannel retailing. ATTIRE 13 · THE APPSSG LAUNCHES THE BEST SMALL SHOP COMPETITION Sponsored by PayPoint, The Best Small Shops Competition celebrates small retailers in the UK economy, and is run by the All Party Parliamentary Small Shops Group (APPSSG) and administered by the Independent Retailers Confederation (IRC). The IRC is an established organisation that brings together like-minded trade associations with interests in the small and independent retail sector. It represents approximately 100,000 independent retailers throughout the UK, creating a growing retail network committed to the development and sharing of best practice among associations and their members in the sector. Speaking at the launch, APPSSG Chairman Simon Danczuk MP said: “We’re looking for the best small shops in the UK to tell us about the great work they do to serve their communities and create jobs in the economy. Small shops really are the backbone of Britain, providing essential services for local people and creating jobs in their communities. “There are many great qualities that small shops bring to our high streets, but there are a few I particularly want to recognise. Firstly, the innovation that small shops bring is really inspiring and is a key part of their ability to compete. This is a driving force behind the success not only of small shops but of the wider economy, with new practices leading to jobs and growth. “Secondly, smaller retailers are often hugely influential in their local area and provide the anchors for communities up and down the country. As well as this, there are countless examples of ZATCHELS RECEIVES A ROYAL VISIT HRH The Princess Royal, President of the UK Fashion and Textile Association (UKFT), visited leathergoods label Zatchels at its Charter Street factory in Leicester. The visit included a tour of the factory, a meeting with Zatchels’ joint founders and co-owners Dean Clarke and Brian Brady and introductions to employees and key suppliers. The tour concluded with the unveiling of a commemorative plaque. Zatchels was the second member of UKFT to receive a visit from The Princess Royal in 2014. Paul Alger, Director of International Business Development at UKFT said: “Our President is extremely interested in the success of the UK fashion and textile manufacturing sector. She is a particularly strong supporter of small and medium-sized enterprises, especially those manufacturing in the UK, such as Zatchels. This visit is part of our Let’s Make It Here campaign. “The company is enjoying continued retail expansion, employs local and highly skilled craft and leather workers in the making of its products and is building a healthy export market. This is exactly the kind of commitment to niche UK manufacturing I believe Her Royal Highness is keen to see.” Dean Clarke, co-owner and founder of Zatchels said: “We’re thrilled and honoured that UKFT chose Zatchels for The Princess Royal to visit. Naturally our workforce and suppliers were delighted to meet her. 14 ATTIRE small retailers contributing to local projects or helping out their neighbours on the high street. “Finally, I want to celebrate the entrepreneurial spirit that is so typical of small shops in the UK. Having set up a shop myself in Rochdale, I know how rewarding it is when your idea takes shape in front of you. It takes courage and resilience to go into retail, and I think it’s important that politicians recognise this. I can’t wait to see all the fantastic small shops from across the country enter or this competition and I look forward to meeting retailers at our reception in February. May the best small shop win!” Andrew Goddard, Pay Point Retail Director and competition sponsor said: “We’re pleased to be supporting the Best Small Shops Competition again. It’s a great chance to showcase the work that small shops do across the country and how important they are to their local communities.” Applicants may use a maximum 500 words to set out why they are the best small shop, covering the key criteria areas of innovation in business, community engagement and entrepreneurial activity. The application process for the Best Small Shops Competition is available at www.bestsmallshops.uk. Entries close at 4pm on 30th January, 2015. There will be a reception for shortlisted retailers at the Palace of Westminster on 25th February, 2015 where the overall winner will be announced. “During the tour, The Princess Royal was able to see our staff at work during the different stages of the manufacturing process, and enjoy meeting and talking with people about their work and the skills needed to hand make a Zatchels bag.” The UK Fashion & Textile Association (UKFT) is the British network for fashion and textile companies. UKFT brings together designers, manufacturers, agents and retailers to promote their businesses and our industry throughout the UK and internationally. UKFT runs the successful www.letsmakeithere.org website, which is a free-to-use resource of UK manufacturers who undertake work for other companies. For more information on Zatchels, visit the company’s website www.zatchels.com. NEWS & EVENTS On with the show CHECK OUT ALL THE IMPORTANT NEWS AND DATES FOR YOUR BUSINESS DIARY... Ambiente announces partner country Ambiente 2015 has announced the USA as its partner country. Around 90 of the 4,700 exhibitors are expected to come from the USA, including companies such as American Cookware, Chef ’n, Design Ideas, Gibson, Hampton Forge, KitchenAid, Lenox Corporation, Yankee Candle and Vitamix. “The USA is characterised by an incredibly exciting range of different styles. I’m looking forward to the exchange of ideas and the impulses sure to be generated by their appearance,” said Nicolette Naumann, the Vice President of Ambiente/Tendence. A highlight of the show is the Partner Country Day on the Monday of the fair. Many exhibitors from the USA will offer special activities for visitors. In Hall 4.1, for example, Lenox will be raffling fine bone china dinnerware made in the USA, while, Big Mouth Toys will hold a two metre inflatable football raffle in Hall 9.2. For more information on the show, visit the exhibition’s website www.messefrankfurt.com. GIVING & LIVING WELCOMES NEWCOMERS FOR 2015 Giving & Living’s a vibrant home and gift trade show, with a strong focus on the tourism sector, and an unrivalled selection of coastal products. At the last count, with stands filling up fast, there were 66 companies exhibiting at Giving & Living for the first time in January 2015. Some 15 of these are also newcomers – companies that have never exhibited at any trade show before. Among the new faces for you to meet are Algan Arts, Little Trove, Sapooni, Holy Mackerel, Molly Mac, and Nature’s Jewellery. In addition to the Newcomers space, there’s the Designed & Made in Britain area where you’ll find products of high quality with a distinct local flavour, reflecting the UK’s heritage. If you’re after products with a strong ethical and/or environmental background, the Naturally Trail will lead you to them. Also new for 2015, the Enhance area will inspire you to add new items to your offering, and source services that could help you do business more profitably. For more details, visit the show’s website www.givingliving.co.uk. Success for designer-makers Handmade in Britain 14 welcomed more makers than ever before, with more than 120 exhibitors in interiors and fashion offering an exciting variety of craftsmanship. Alongside established and well-known makers, Handmade in Britain invited visitors to meet designers at the very start of their career in the New Graduate Showcase. Visitor footfall this year was at an all-time high, with nearly 4,000 visitors attending the show’s three days and the private view champagne reception. The ninth year of the show will take place from 13th - 15th November, 2015. For more information on next year’s event, visit the website www.handmadeinbritain.co.uk. ATTIRE 17 · Pure London will celebrate indie retailers with new Best of British awards scheme Pure London, organised by i2i Events Group, is in search of the best independent retailers across the UK and Republic of Ireland; those that excel in business and driving change and innovation in the arena of fashion and footwear retail. Presented in partnership with the Fashion Association of Britain (FAB), the specialist fashion division of the British Independent Retailers Association (BIRA), the Best of British awards will celebrate the triumphs and successes of these indies, giving recognition to their hard work across all aspects of their business. This includes dedicated buying teams, customer service, store merchandising and online offering. Julie Driscoll, the show’s Portfolio Director, said: “Independent retailers are the dynamic lifeblood of Pure London, representing almost 80 per cent of our 11,000 strong audience each season. They’re the most diverse, creative, committed and customeroriented group of individuals and we’re delighted to celebrate their contribution, region by region, with these new awards at Pure London.” Split across 10 categories, the awards will be divided by region, with the exception of a dedicated Footwear Retailer of the Year award, which will span across all regions. The nominations process is open now via the Pure London website, and these will be open to everyone, including independent retailers who are able to enter themselves for the award. Entrants will be asked to answer a series of questions about their company to enable the judging panel to understand its vision, values and achievements. A panel of judges – including representatives from both Pure London and FAB – will compile a shortlist of finalists who’ll be invited to attend the official awards event on 9th February, 2015. Supporting the new initiative, Melissa Wheeler, Chairman of FAB and Retail Columnist, said: “Fashion is now one of the UK economy’s strongest assets and we have British retailers to thank for this. FAB takes enormous pride in supporting our British fashion indies and giving them a platform to voice their concerns, the means to invest in their businesses and the opportunity to have their profile raised. “In an age when it’s often the business who shouts the loudest who gets noticed, the Pure London Best of British Retail Awards is a priceless opportunity for independent retailers to be seen, heard and recognised.” To cast your nomination, go to www.purelondon.com/ bestofbritish. The next edition of Pure London will take place from 8th - 10th February, 2015 at London Olympia. Diary dates Scotland’s Trade Fair Spring 18th - 20th January, 2015 SECC, Glasgow www.scotlandstradefairs.co.uk Spring Fair 1st - 5th February, 2015 NEC Birmingham www.springfair.com Moda 15th - 17th February, 2015 NEC Birmingham www.moda-uk.co.uk Scoop International 1st - 3rd February, 2015 Saatchi and Phillips Galleries, London www.scoop-international.com Pure London 8th - 10th February, 2015 Olympia, London www.purelondon.com London Fashion Week 20th - 24th February, 2015 Somerset House, London www.londonfashionweek.com 18 ATTIRE BTAA News Chief Executive Paul Yates brings us all the latest developments from the British Travelgoods & Accessories Association members www.btaa.org.uk New year, new start Last year was another tough 12 months for UK-based accessories suppliers. With many companies holding excess stock, a balanced approach is needed when introducing new products to avoid putting pressure on stock holding and, as a result, finances. The first few months can determine how successful companies are going to be for the rest of the year, as they sell their ranges at the many key industry shows taking place in London, Birmingham, Harrogate and Glasgow. In February, the BTAA will have a stand (20P28) at Spring Fair, beside the Fashion Catwalk. Please visit us to see how we can help your business. We’ll also be launching The BTAA Fashion Accessory of the Year 2015 awards at the show. This year, any product available to retailers in 2015 prior to the closing date in August is valid for entry, so all the new product designs displayed at the January and February trade shows are eligible. Spring Fair will be your first opportunity to acquaint yourself with our organisation and enter the competition. Quindici closes David Nathan, Managing Director of Quindici, recently announced the closure of the business effective from 24th December last year. He says: “I’ve been in the industry over 25 years and have enjoyed all of them. I’ve met some wonderful people and had some great times, but as the market has changed in recent years I find it less fun and more of a grind. That seems to me to be the time to move on.” Arrangements have been made for an ongoing repair service, and all spares have been passed to Aldridges. The same company has also taken over repairs with 20 ATTIRE BTAA membership numbers are continuing to grow steadily. I’d like to welcome our newest members – The Italian Bag Company, Kosmos Accessories, Loxley Luggage Company, Andrew & Arnica Yuille, Firstflight Projects, Wolffepack, Bags Incorporated, Himalaya Fashion, Bessie Handbags, JC Unique, Vaude Sport, Urban Junk, BRYHT Design, The Pukka Luggage Company and Suit Suit. The BTAA also has a new National Committee member: Tony McCourt from W Brown International, who I know will be a valuable asset to our team. In 2015 the BTAA will continue to promote British quality and design values further afield with pavilions at The Travel Goods Show in Las Vegas and Leatherworld in Dubai. If you’re considering exporting to North America or the Middle East, please contact the BTAA as reduced rates for BTAA members have been negotiated. Finally, I’d like to wish everyone within this industry the best of luck with their forthcoming trade exhibitions. immediate effect, and all repairs must be sent to its shop at 90-91 Friar Street, Reading, RG1 1EN. For more information, contact Jonny Aldridge on +44 (0)118 957 2383 or at [email protected]. Bewitched Accessories announces new collections and agent Bewitched Accessories is following the success of its coated ranges in autumn/ winter 2014 with the launch of further styles and summer hats matching its collections range. The brand’s also pleased to announce that it’s taken on a new agent, Simon Paul Yates, Chief Executive, BTAA Fisher, to cover East Anglia, Bedfordshire and Hertfordshire after the previous agent, Sally Lambourn Brown retired. Contact [email protected] if you’d like to receive a call. New lines, labels and positions at Modrec Modrec International’s new Saddler spring/summer 2015 collection is set to launch at Spring Fair (stand 20H40-J41). Boasting a range of fresh, on-trend shades for the coming season, the line will complete the brand’s current best-selling range of ladies. small leather goods. This follows the news that Modrec is now the official distributor for the leading children’s luggage brand, Cuties & Pals, across the UK and Ireland. The label’s selection of innovative characters makes travelling fun for children of all ages. Modrec is also on the look out for new sales agents across all brands. If you’re interested in a role with the company, please don’t hesitate to email [email protected]. BTAA newsletter coming soon From February 2015 onwards, all BTAA members will be able to have information on their new product ranges, offers and promotions published in an online newsletter .This will be emailed to a closely targeted retail database of luggage, handbag, leather goods and accessory retail buyers in the UK, allowing members to market their products to these key buyers and enabling retail buyers to see what’s currently available in the marketplace. International Spring Fair: Hall 20, Stand L38 & L40. Pure London: Stand T210 & Moda: Stand O8 International Spring Fair: Hall 20, Stand L29. .PEB4UBOEø. International Spring Fair: Hall 20, Stand G18-H23 HELPING YOUR BUSINESS GROW The British Travel goods, Handbags & Accessories Association would like to wish all our members success at the forthcoming Top Drawer, Scotland’s Trade Fair,International spring Fair,Pure London & Moda shows. BTAA members exhibiting are: TOP DRAWER Earth Squared Stand 208, Hydestyle 709, Mala Leather 245, Quintessential K69, Urban Country 429 SCOTLAND’S TRADE FAIR Easton Design Studio D24, Mala Leather K6, Lindy Lou F10. INTERNATIONAL SPRING FAIR Hall 20: A.C. Jade Trading M26, Access Wholesale G28, A&A J40, Ashwood Leather L38 & L40, Bags2Trade G10, Bessie Handbags M01, Bewitched Accessories M01, Blousey Brown J30, Bollabags G21, Checker Leather M38-N39, Cristina F45, Davidt’s G18-H23, Design Go N41, Eastern Counties Leather L08, Faye (UK) Ltd E40, Fenland L41, Firelog L05, Galarti H39, Gee Bee Enterprises L10, G.H Stafford H04-J05, Gorjus Accessories H02-K02, Handbag2handbag J47, Hansson K02, Himalaya Fashion F40-G41, Hydestyle L36, Italian Bag Company Too H29, J.C. Unique F40, Kosmos "DDFTTPSJFT(-JDImFME Leather L28, Long & Son G41, Lulu Bags G33, M Golunski M41, Mala Leather K20, Maria Carla L40, Modrec H40-J41, Nova Leathers L20-M21, NV Bags L29, Purseworld L31, Rock Luggage L04, Sirco J04, Sunrise Bag Co. G10-H11, Travel Style H11, Troop London K06, Umbrellas By Lindy Lou G40, Urban Country M42, Urban Junk K28, Vendula London F01, W Brown International G04-H05. Hall 19: Bardot Accessories C22-D23, Earth Squared B04-C03. Hall 5 Mele K23, Mag Mouch Sophos J18. Hall 6: Quintessential N22-K39. PURE LONDON Bardot T156, Bobby Black T161, Claudia Canova T138, Golunski T264, Loxley T95, Maria Carla T210, Modrec K35, Nova Leathers T170, NV Bags Q28, Smith & Canova T126, Vendula T172. MODA A&A R53, Ashwood Leather O8, Bardot N31, Claudia Canova N73 & O76, Cristina O59, Eastern Counties Leather O20, Gorjus N20, Maria Carla 08, Milan Fashion O59, NV Bags M29, Smith & Canova N73 & O76, Sirco Leather 039. See how we can help you by visiting our stand at International Spring Fair: Hall 20, Stand P28. International Spring Fair: Hall 20, Stand L36 Top Drawer: Stand 709 International Spring Fair: Hall 20, Stand G18-H23 Pure London: Stand T170. International Spring Fair: Hall 20, Stand H40-J41 Pure London: Stand K35 Top Drawer: Stand 429 International Spring Fair: Hall 20, Stand M42 Jewellery Storage solutions Presenting “Tommy Tou” Genuine Australian Giftboxed Sheepskin Accessories, “Von Lilienfeld” & “Lindy Lou” Umbrellas. at NEC Spring Fair 1st – 5th Feb 2015. Hall 20 Stand G40. Designed to hold up to 48 pairs of earrings. Earrings are kept UCHGUGEWTGCPFCOCVEJKPIRCKTKUCNYC[UGCU[VQ¾PF The Little Book of Necklaces Designed to hold necklaces safely and securely at home or when traveling. The Little, Little Book of Earrings Designed like the Little Book of Earrings but smaller. Able to hold up to 12 pairs of earrings. If you would like any further information please phone: (0044)0 2033711522 email: [email protected] Visit us: www.littleshopof.co.uk www.lindy-lou.co.uk [email protected] Gema UK Ltd. 925 Silver Jewellery Rhodium Plated 28 Greville Street, London EC1N 8SU Tel. 020 7404 2524 Fax. 020 7404 2528 Mob. 07973 128826 Email: [email protected] C COMPETITION WIN! Win products worth £500 RRP courtesy of URBAN COUNTRY This issue, URBAN COUNTRY is offering Attire Accessories readers the chance to win a selection of their choice from the bag brand’s latest Florence and Milan ranges – collections which are certain to bring a touch of glamour to any shop’s 2015 accessories offering. URBAN COUNTRY is a British label, owned and managed by Peter and Tim Lockey. With previous experience as independent retailers and wholesalers, they know what works, and what sells. Their passion and flair for combining high fashion with durable, exciting materials continues to be well received in the fashion accessories marketplace. This season the brand is introducing two new collections. The first range is Florence, which features structured statement pieces available in two distinctly different finishes; matte cross-hatch grained PU, and the same material but finished with a clear capping sheet, giving it a striking high gloss finish. The internal padded iPad/ tablet compartments make this style ideal for work, business or leisure. The totes come in a spectrum of six shades from delicate neutrals to striking cerise and red. Meanwhile, the second collection, Milan, is timeless and conservative, and introduces a new PU material that has a soft, pliable matt finish. The designs are classic shapes relying on the quality of the material and the precision of construction to set them apart from other handbags with these details and proportions. The organisational pocketing and adjustable/detachable straps make this an original and versatile line. Each piece is available in black, brick, navy and taupe tones, and is adorned with the distinctive URBAN COUNTRY twin chrome metal bar. URBAN COUNTRY bags has exclusivity of design and materials, as the team takes an active role in commissioning the right materials for the style and use of the bag, providing the perfect merchandising solution. The brand has gone from strength to strength and as well as being sold online, URBAN COUNTRY collections are stocked in more than 140 retail outlets in the UK. The label’s team continues to promote the brand, and in doing so, actively promotes suppliers through online media. The company also offers a guaranteed next-day delivery service on its orders. For more information about URBAN COUNTRY, visit the website www.urbancountrybags.com. To make an appointment or discuss the latest collections, please contact Tim on +44 (0)1462 446 048. A For your chance to win, answer the following question: What are the names of the two new collections from URBAN COUNTRY? a) Milan and Venice b) Milan and Florence c) Venice and Florence Visit www.attireaccessories.com and fill in the online competition form to enter the draw. The deadline for entries is 9th March, 2015. Terms and conditions apply. ATTIRE 23 Brand Spanking New OUR EXCLUSIVE ROUND-UP OF THE NEWEST PRODUCTS Designs by Tala Seeing Stars clutch +44 (0)7426 985 954 www.designsbytala.com £190 RRP Dents Oatmeal angora and wool gloves with fur cuff +44 (0)1985 212 291 www.dents.co.uk £16 RRP Storm Rose gold Eva backlace +44 (0)20 7874 6926 www.stormwatches.com £49.99 RRP Ilex London Chain bag in wood +44 (0)20 3657 5680 www.ilexlondon.com £44 RRP Pearls of the Orient Keishi pearl and crystal bracelet +44 (0)1483 202 232 www.pearlsoftheorient.co.uk £42 RRP Miss Milly Kisses scarf +44 (0)1905 622 509 www.missmilly.co.uk £11.85 RRP Stuf ! Marketing Skimp belts +44 (0)7890 822 183 www.stufmarketing.com £24.99 RRP 24 ATTIRE Heidi Klein St Christopher wrap bracelets +44 (0)20 7259 9426 www.heidiklein.com £16 RRP [email protected] Moda Accessories Brimingham Stand: M13 NEW PRODUCTS Fiorelli Pineapple necklace +44 (0)1376 532 000 www.geckojewellery.co.uk £20 RRP Taisir Gibreel Culture Mix Discus square silk scarf +44 (0)7947 949 926 www.taisirgibreel.co.uk £149 RRP Vizati Allure collection ction 85 605 +44 (0)1323 485 www.vizati.com £70 - £80 RRP Irregular Choice I Love You shoes +44 (0)1273 724 020 www.irregularchoice.com £149 RRP D for Diamond Pink Fox necklace +44 (0)1376 532 000 www.geckojewellery.co.uk £42 RRP Balagan Narrate necklace in rose gold vermeil +44 (0)845 260 0925 www.balagan.co.uk £42 RRP Fred Bennett Men’s leather strap watch +44 (0)1376 532 000 www.fredbennett.co.uk £85 RRP Talbot Fashions Beaded bracelet with owl charm +44 (0)1273 776 415 www.talbotfashions.com £3.50 RRP ATTIRE 27 · Orli Designs Bubbles necklace and bracelet +44 (0)141 616 3334 www.orlij.com £48 and £35 RRP Swedish Hasbeens Suzanne sky high sandals +44 (0)7590 560 006 www.swedishhasbeens.com £165 RRP Cocorose London Bond Street pump +44 (0)20 8829 8919 www.cocoroselondon.com £145 RRP 28 ATTIRE Moda in Pelle Jolies court shoes +44 (0)113 239 2379 www.modainpelle.com £79.95 RRP Ilex London Slouch bag in aubergine +44 (0)20 3657 5680 www.ilexlondon.com £88 RRP Talbot Fashions Cat earrings +44 (0)1273 776 415 www.talbotfashions.com £6.99 RRP Rainbow Club Satina clutch +44 (0)1392 207 030 www.rainbowclub.co.uk £69 RRP Tamaris Canvas printed sneakers +44 (0)1604 880 146 www.tamaris.eu £16.75 RRP w w w . c a r a l o n d o n . c o . u k PURE LONDON Harriet Sanders, www.harrietsanders.co.uk BRAND listings Your comprehensive show guide RY E L L A G e d i u g w sho Plus • Pre-show round-up • Exhibitor profiles • Product showcase w of A previe ories access fashion twear and foo rs exhibito Official media partner ATTIRE Accessories ATTIRE 31 · A pure thing With continued development in its Accessories and Footwear sectors and the launch of Pure Rocks, the London show is set for a strong 2015 IN BRIEF Show: Pure London Venue: Olympia, London Dates: 8th - 10th February, 2015 Website: www.purelondon.com Twitter: @PureLondonShow As a result of its continued re-edit, Pure London is set to offer a broader spectrum of fashion-forward accessories, jewellery and footwear labels than ever before. More than 220 accessories brands will join the Pure London line-up in February, with a host of first-time exhibitors adding to the mix. Showcasing an array of trendled pieces, from faux fur and knitted scarves to premium fashion extras, quality leather goods and statement jewellery, the area will also showcase the finest in capsule collections from emerging brands. Pure London is set to expand its jewellery offering for the forthcoming show with the introduction of a new area: Pure Rocks. Supported by Retail Jeweller, the area will focus on sterling silver, goldplated and semi-precious jewellery, adding a fresh and exciting element to the wider accessories offering at the show. The introduction of Pure Rocks comes as a response to the growing interest in silver and gold-plated jewellery among highend fashion boutiques and online retailers, as consumers’ appetites grow for more premium and luxury-led fashion. Exclusive to first-time exhibitors being introduced to the show, the area will provide up-andcoming British and international brands with a dedicated platform in which to target key buyers and retailers. Comprising just nine stands, the area will have an open-plan layout of low level plinths and tables, similar to that of the Emerging Brands area launched last season. This set-up offers a cost-effective route to market for designers and brands keen to reach discerning and influential premium fashion buyers and boutiques in a growing 32 ATTIRE jewellery market. Located within Accessories, adjacent to Premium Accessories and Emerging Brands, the area will have easy access directly from the premium Agenda and contemporary Aspire womenswear sectors. Within the wider accessories offering is Premium Accessories; an area that will house more than 40 high-end labels, each offering original, bespoke and couture collections for autumn/winter 2015 as well as short order for spring/summer 2015. Following its highly-acclaimed inauguration at the August show, the Emerging Brands area will return to Accessories this season, offering an innovative and exciting way of presenting capsule collections from a variety of premium footwear and accessories brands. Significant changes have also been made to Footwear at Pure London over the last few seasons, and the show is set to grow its offering further for February 2015, with a notable list of exhibitors confirmed. As part of the re-edit, focus has been given to bringing new and exciting names to the show, and finely editing the collections under one roof for a wholly original and inspirational showcase. The spectrum of labels in Footwear has been sourced from around the globe, with a mix of established Pure London regulars and up-and-coming companies set to launch in the UK at the forthcoming show. Footwear will also expand into Premium Accessories, allowing for boutique labels to showcase their full range of products alongside other high-end and niche brands. Footwear and Premium Accessories will be linked by the inspiring Emerging Brands section. Following its launch last season, the area has gained high praise from exhibitors and buyers alike and will return to the show to offer the best in capsule collections from a small number of premium companies. Footwear will be located above Spirit in the National Hall Gallery of London Olympia, where visitors, buyers and press will also find the VIP Lounge, Press Office and the Fashion Café, which is sponsored by trade fashion magazine, Drapers. Vicky Ogden, Head of Footwear and Accessories at Pure London, commented: “Pure London continues to listen and work with the footwear offering within the editing criteria, giving good brand adjacencies the opportunity to present the best of their collections to key buyers, not only in the UK but internationally. Footwear is a growing and important part of the most successful trade show in London. We’re stepping into 2015 with excitement and the knowledge that we are working together and appreciating the challenges ahead.” To register for Pure London, visit the website www.purelondon.com. A SEE US AT SPRING FAIR 19C18 SEE US AT PURE V11 Se e the st unn i n g n ew r a n g es o f S p r i ng s umme r a c ces s o r i es f ro m B ewi t c h ed. We will be launching our new products at the Scottish trade show in Glasgow 18th – 20th Jan and then at the NEC Birmingham 1st to 5th February HALL 20 Stand MO1 Call us for a catalogue. Tel 01488 649520, email [email protected], www.bewitched-accessories.co.uk VENUTTI VENUTTI AGENCIES ARE SHOWING THERE EXCITING AUTUMN WINTER 2015 COLLECTIONS FROM: VANILLA MOON, SACHELLE COUTURE, BRENDA ZARO, MARIAN and PEDRO ANTON AT THE FOLLOWING EXHIBITIONS PURE, LONDON 8th to 10th February STAND Q19 MODA, BIRMINGHAM 15th to 17th February STAND P20 MICAM, MILAN 15th to 18th March LONDON SHOE SHOW, KENSINGTON 1st to 3rd March THE BRIDGE HOTEL, WEATHERBY 3rd and 4th March THE SALUTATION HOTEL, PERTH 5th and 6th March DUBLIN SHOE SHOW 8th to 10th March THE TICKLED TROUT HOTEL, PRESTON 10th and 11th March THE BEACHLAWN HOTEL,BELFAST 11th and 12th March For more information please contact Venutti Agencies Showroom at 7 – 8 Piccadilly Buildings Sheep St,Kettering,Northants,NN16 0AN Email: [email protected] Tel: 01536 310447 PURE LONDON Brand listings Caprice Cocorose London Jewelcity 1Mishap ABOÛT ACCESSORIES by Wolfram Kopka Adele Marie Air On Feet ALEX DORE Alex Hats Alex Max Alexi Alice Hannah ALPE âme moi Amor Collections And Mary ANGE Antalina Armadura Urbana Artsac Artwear Dimitriadis Ashiana Aspiga Astrid & Miyu Australia Luxe Collective b4ballerinas Bagnara Bardot Accessories BBco Bcharmd Beaumont Belle & Flo Bernard Delettrez Bessie Glory Bibi Big Metal Birkenstock Bloch UK Ltd Bobby Black Bohemian Jewellery Tattoos Boho Betty Borgenni Born Bad Betty Brenda Macleod Brit-Stitch Bueno Bulaggi Bvba Globetrotter (CATHs) By Elise By London Cabbage White England S28 T159 T141 Q114 T177 T165 T260 R61 T248 Q109 T70 T163 S3 Q113 S16 T167 T140 T235 T2 T75 R51 Q160 Q135 R55 T156 S25 Y4 Q72 X2 Q208 X12 T53 T217 Q189 Q69 T161 V27 Z3 Z27 Q75 T89 R23 Q86 T146 Q190 V16 V30 V9 Cadari London Calzados Laro Camalya Caprice Cara CARO Carouzou Catherine and Jean Catseye ClairB Bags Cloud Footwear Co.Ro Jewels Coco Sebastian London Cocorose London Concept 15 Milano Corteeza Cox Moore Cubanas DANIELACATRAIA Design Six DIDI Creations Disaster Designs Durval Dyrberg Kern Echo Design Europe Ekotree Elia B Eliza Gracious Envy Jewellery Ernest Esska Estella Bartlett Etnika Fabrizio Chini Fashion Universe Felix Bendish Fil de Joie Filomena Fiorelli Flora Brown Designs t/a Flora Brown Fly London Flyin’ Shoe Italia Srl FRAAS UK Fred & Eve Friis Frog & Tower Gabriele Srl Gala Gloves Geox Gian Paolo Maria T181 Q68 V40 Q120 Q20 X17 T183 R9 V14 R15 Q173 R29 T150 Q5 T117 Q77 Y20 Q176 Q28 T258 S26 T270 Q107 T54 Q206 S15 Q3 X10 W10 Q200 Q153 T212 T175 Q9 T225 S9 T221 K124 T88 T135 Q34 Q117 T62 W4 Q85 Y22 V12 T81 Q44 T71 Gipsy Tights Girls Gi l & Pearls P l Glen Prince Of Great Britain Glove Story Goby Golunski HADAKI-Amy Butler-Kalencom Harriet Sanders HDJewels Helen Moore Hergest Designs Highline United Europe Hispanitas Hultquist Copenhagen Icon Watches Ieduebi IMELDA’SECRET Industrial Jewellery by Hila Rawet Karni INUOVO Ismad Italca of Italy Ixli J’S Designs Jewelcity Jo Edwards Jolie Lola JuditB Juno Kapre Karishmas World Kate Lee Kazuri Beads Keddo Kirsteen Stewart Kirstin Ash Jewellery Kompanero Konplott UK Krama Heritage Kris-Ana Krystall-Soamas Kusan Lacambra Bags Laceys Footwear Ltd Lacoste Chaussures Lala Queen Laura Vita LEA TONI LES INTERCHANGEABLES T179 T152 T236 T55 Q182 T252 T234 T131 R53 T244 Y14 Q142 Q165 Q4 T207 Q127 Q202 T119 Q16 Y32 T104 T189 R25 W21 T151 R17 R67 T198 T201 R7 T73 W11 Q92 V3 R57 Z26 T67 S19 T237 T97 T87 T105 Q60 Q184 T63 Q145 V13 T106 ATTIRE 35 · Moda in Pelle Pia Rossini Juno Accessories Létol Ligia’s Accessories Little Moose Lodi Lofina Lola Rose Lorina Bijoux Lotusfeet Lovat & Green Love & Jewel Loverocks Lovesmith UK Luri Malissa J Collection Mania + Exeter ManiCay Maria Carla Mark Bags Matanah matt & nat Max & Ellie MEL Dreamed by Melissa Melinda Maria Mimu Mineli Boutique Minnetonka Miralles Headwear Miss Milly Miss Shorthair Mjus Moccis Moda in Pelle Modalu Mojiana Moniko Monkey Shirley MR MTM Manufacture des Toiles Mundoconalma* My Flash Trash My Name Is Lolo Nali Natalia Machinena NATERRA Neuendorf, Dietrich goetz NICA NODOVA nooki design NorthSkull London 36 ATTIRE T155 R27 V21 Q186 Q10 T91 R21 X15 T219 V32 T166 S14 T193 T224 Q161 S10 T210 T95 W13 Q2 V10 Q132 Y1 T145 Q149 Q1 T216 V11 W5 Q164 S18 Q8 T86 S4 V23 S12 T172 T149 S11 R63 Q93 T206 W12 T107 Q204 T84 S17 T197 T59 Nour London T100 Nouv-Elle T205 Nova Leathers T170 NR Rapisardi Q196 Oka-B Q89 Ollie&Nic W3 One Hundred Stars S5 Orelia T218 Orli Designs X13 Ottoman Hands T103 Owen Barry T246 pampeano T129 Paperthinks T160 Papucei Q151 Parkside Accessories Y17 Pasotti Ombrelli R33 Pasotti Ombrelli R31 Peach Accessories X3 Peak a Boo T96 Pearls Of The Orient T169 Peter Kaiser Q102 Peter& Suzanne Bettley T228 Pia Rossini T191 Pia Rossini T186 Pikolinos Q180 Porthia Q105 Prenella Z21 Pretty Nana Q84 Prochaine R13 Proteus PsBesitos di Jessica Bermudez V17 Pure Rocks R65 Push X14 Ravel Q158 Red Fox Fashion S40 Reeves & Reeves T121 Rodgers&Rodgers T83 Rosa Maseda Q140 Rose B. Brown S21 Rose Black Accessories T125 Ruby & Ed T44 Rukhsana Jewellery LondonW27 Santacana Complementos T74 Save My Bag Y3 Seeberger Q194 SENCE Copenhagen T111 Shoenco Q169 Showroom One T58 Shruti V2 Siga Shoes Q91 SIOOU Ska Sofia Costa Sol Sana SOL-ID SSP Hats Stella Green Strata Street Level Supercheria Susie in the Sky Suzywan DELUXE Swear Swedish Hasbeens Talented Tallis LTD Tantrend Bijoux S.L. Taschka LTD Tatty Devine Ten Points AB The Alpaca Wardrobe The Giving Keys The Real Pearl Co. Tilley & Grace Timex Tutti & Co UKTWENTYFOURSEVEN Ukwenza Umber Panezai Unisa Vanilla Moon Vendula London Vero Moda Vivien Walsh Volum VOW LONDON Wagner Arte William Lamb Footwear Wonders XUZ Handmade Lovers Yorubatik Yull Zandra Rhodes Handbags Zeha Berlin Y30 Q198 Q27 Q163 T223 Y10 X11 T173 W30 T185 R19 S23 Q66 Q157 Z22 V25 T202 R5 T51 Q67 S20 Y34 Z2 Z20 W14 T211 R11 T233 V6 Q181 Q19 T176 Q126 S2 T57 X16 T101 Q192 Q177 Q112 V19 Q125 T137 Q119 * Stand numbers correct as of 09/01/2015. For all show stand numbers, please visit www.purelondon.com. A collection of beautiful designer jewellery, with a combination of stylish, modern and classic designs. ( Hand made in Britain.) Contact us on: 0141 616 3334 Email: [email protected] w w w. o r l i j . c o m Pure London Exhibitor profiles Orli Designs X13 +44 (0)141 616 3334 www.orlij.com Caprice Q120 47 669 +44 (0)7734 247 www.capriceshoes.co.uk Orli Jewellery was established in 2007 by Sandra Talbot. With over 200 stockists across the UK, and its own in-house design team, the label is constantly developing original concepts for its collections, which are all hand-made in the UK. The Orli range is completely nickelfree, and all pieces are plated with silver 925, rose gold or 22ct gold. Freshwater pearls, semi-precious stones and Swarovski crystals adorn many of the beautiful designs. This season, the brand’s popular selection of leather bracelets in a spectrum of shades and styles will be on show at Pure London, alongside its most recent addition, a hugely successful line of friendship bracelets. Sandra and her daughter, Orli, head up the creative designing team, and as a family business they aim to provide a personable, first-class service to all their customers. Fashion meets comfort in Caprice’s autumn/winter 2015 collection. Rarely have new shoe ranges been more influenced by convenience, practicality and pragmatism. The combination of fashion and wellness in the footwear label’s new line is in line with the current trend for sportier, laid-back styles. This season sees a variety of different materials being combined, including elastics, crocodile, gold and silver as well as padding that will provide new tension in the upper. Appliqués executed with an exquisite attention to detail will ensure that this new line will stand out. Skilfully displayed zippers, straps and buckles make for a fresh, of-the-moment look. Belle & Flo X2 +44 (0)1892 824 396 www.belleandflo.co.uk With an array of vintagelook pastel gems, earrings combining pretty beads and delicate crystals, and tiny pearl details giving necklaces a delicate feel, the latest collection from Belle & Flo is all about refined femininity. The new sapphire shade championed by the brand is now a strong favourite in its best-selling Crystal Ring range, acting as a subtle pop of colour amongst spring/ summer 2015’s sophisticated muted tones. Always with one eye on the next big jewellery trend, this is a label looking ahead to the next season with excitement, and this year’s no different. 38 ATTIRE Claudia Canova T140 +44 (0)113 265 7676 www.claudiacanova.co.uk Claudia Canova’s spring/summer 2015 range showcases the label’s continuing commitment to providing a high quality, affordable, fashion-led product with a fresh collection of exclusive and original pieces. The design team has combined strong, trend-led shapes with the ladies’ bag brand’s signature features of strong colour, unusual fabrics and eye-catching hardware and fittings. Tel: 01656 842102 www.tempestdesigns.co.uk Pure London Exhibitor profiles Harriet Sanders T131 +44 (0)1242 525 836 www.harrietsanders.co.uk Luxury handbag designer Harriet Sanders established her eponymous label on graduating from the London College of Fashion five years ago. She designs and makes her bags with a small team in her studio, using ethically sourced Italian leather. Her signature detail for each bag is fun, brightly coloured suede. Harriet’s collections are trans-seasonal and classic in design. The designer’s current offering includes a selection of purses, clutches, tote bags and rucksacks, and for all occasions; from daywear to evening/occasion wear. The design team can produce each bag from a selection of 14 leather colours and six suede-lining options, giving each bag its own bespoke feel. She will be showcasing her latest additions to the label’s line at Pure London. Cocorose London Q5 +44 (0)20 8829 8919 www.cocoroselondon.com Cocorose London is passionate about creating shoes with a remarkable difference. The brand has become known for its revolutionary concept of foldable shoes, premium presentation and collaborations with The Royal Ballet and Liberty Art Fabrics. The dainty yet resilient ballet pumps are perfectly designed for multi-tasking, on-the-go lifestyles. For spring/summer 2015, the footwear label presented its Next Generation of foldable shoes, including its first lifestyle sneakers and boots. This season, following the incredible response to these designs, Cocorose London’s designers were inspired to push the boundaries even further for the second generation. The main design theme of Intellectual Sportswear is a fusion of sporty and street with sleek and elegant. With sophisticated colour combinations and textures, the autumn/winter 2015 collection provides styles for confident, strong and independent women. 40 ATTIRE Moda in Pelle Q8 +44 (0)113 239 2379 www.modainpelle.com British ladies’ footwear brand, Moda in Pelle, is set to unveil its brand refresh exclusively to Pure London visitors in February. The anticipated refresh will highlight the label’s commitment to affordable luxury, quality and craftsmanship and will prepare for the roll-out of further stores across the UK and internationally in the near future. Visitors to the stand will also be able to preview never seen before styles from the autumn/winter 2015 range. The refresh is part of Moda in Pelle’s continued growth plan, following its recent capital investment. Juno T198 +44 (0)1484 475 800 www.junoaccessories.co.uk Juno Accessories is delighted to announce the launch of its main spring/ summer 2015 and preautumn/winter 2015 collection at Pure London. The collection ranges from statement clutches to classic shoulder bags with an exotic twist of snakeskin, metallics and pretty pastels. Tapping into key catwalk trends while maintaining its classic signature styling, Juno is also excited to reveal a fresh logo for next season ‒ the metallic embossed lettering on many bags in the collection. PURE LONDON Pure London Exhibitor profiles Smith & Canova ova T140 +44 (0)113 265 65 7676 www.smithandcanova.co.uk andcanova.co.uk J Jewelcity W W21 +44 (0)1494 + 94 444 200 www.jewelcity.co.uk w welcity.co.uk Smith and Canova is an established British itish heritage brand d with a growingg worldwide customer base.. Its collections can n be found in several al of the UK’s leading ng department and independent stores. Established in the early ’90s, the bag and luggage label has built its reputation on good design and attention to detail. This season’s key offerings are presented in bold colours and soft pastels, as well as the company’s timeless classic tan, burgundy and black tones. JJewelcity uses ses digital prints of floral motifs to give a fresh take oon the fashion world’s love of bloom patterns, with faux leather ttrims completing the elegant nature-themed range. Alongside tthis ultra-feminine collection, the brand will showcase a more iillustrative print range, which is available in a casual saddlebag sstyle, as well as satchels, shoppers and purses. The company’s sspring/summer 2015 collection has been designed to keep the modern retailer at the forefront of design. m Paperthinks T160 +44 (0)1246 299 800 www.paperthinks.com Paperthinks is a leading global recycled leather bags, accessories and notebooks brand, with all pieces being available in a rainbow palette of bold colours. Since it was established two years ago, the label has grown considerably; and is now known all over the world for its fashionable yet eco-friendly range. The company strongly believes people should not have to choose between being green and being stylish, and is dedicated to producing eco-friendly sustainable and quality products without sacrificing design. There are 24 beautiful colours to choose from. M Miss Milly V11 +44 (0)1905 622 509 www.missmilly.co.uk This will be Miss Milly’s first time at Pure London and the award-winning British jewellery and scarf supplier is looking forward to sharing its new lines for spring/summer 2015, as well as current best-selling products. For next season, the label is launching a limited range of cotton scarves to enhance its existing collection, which mainly comprises viscose pieces. In response to customer demand, plain colour styles will return alongside a pretty hibiscus print and the brand’s ever-popular bird pattern. Designs in the viscose range include abstract art, floral, dragonflies and stars. Along with the swing tickets that come with all necklaces and bracelets, Miss Milly pillow pack, and ribbon bag packaging is available to order at cost price. The company also offers its white acrylic display stands for purchase, having added two sizes of earring stand to the range. ATTIRE 43 · Pure London Exhibitor profiles Pearls of the Orient T169 +44 (0) 1483 202 232 www.pearlsoftheorient.co.uk Artsac T140 +44 (0)113 265 7676 www.smithandcanova.co.uk a.co.uk With refreshed colour palettes firmly on the spring/summer 2015 agenda, Pearls of the Orient is keen to share its new vibrant mixed colours side-drilled freshwater pearl loop necklace and matching bracelet with Pure London’s visitors. The kaleidoscope of colours will match any outfit, and using a shortener with the long loop necklace means it can be doubled up or twisted to give added depth as well as style. Prices are accessible and there’s no minimum order. Artsac, a youthful brand in the Smith & Canova stable, ble, offers a range of handbags, gs, backpacks and tote bags that are stylish, colourful and fun, as well as practical and durable urable enough for even the most st active individual. Constructed ucted in a selection of lightweight, showerproof and durable fabrics, the collection is split in to three categories, Lite, White Label and Sport, each with its own signature appeal. Shruti Designs V2 +44 (0) 1985 847 774 www.junction18.com Shruti Designs prides itself in developing easy-to-wear, on-trend fashion accessories. Inspired by the seasons, the label’s collection for spring/summer 2015 truly embraces crisp colours, cool tones, natural fibres and all the novelty associated with this time of year. It features fresh British talent – collections from new designers including Lisa Buckridge, Susie Faulks and Casey Rogers, whose product ranges complement the core 100 per cent cotton canvas collections synonymous with the brand. 44 ATTIRE Ottoman Hands T103 +44 (0)7595 429 377 www.ottomanhands.com Ottoman Hands is a British-based jewellery company supplying gems with a Turkish influence. Established in 2009 by Deniz Gurdal, the collections are the result of the founder working closely with local Turkish gem cutters and artisans. The aim of the label is to create one-of-a-kind pieces that exhibit modern design aesthetics, while remaining loyal to the beauty of ancient Ottoman jewellery-making traditions. For spring/summer 2015, the brand will offer seven collections. The main inspiration this season is nature, so the Organic collection is all about earthy beauty. Colour palettes for the forthoming season range from soft subtle tones in the Ottoman Classics range, to candy brights in the Festival line – there really is an original piece of jewellery to suit every individual. Visit us at WWW.VENDULA.CO.UK SPRING FAIR 1st - 5th February 2015 Stand: 20F01 PURE LONDON 8th - 10th February 2015 Stand: T176 Please come and see our new handbag collection at: Pure 8 – 10 February Please come and see our new Stand T137 handbag collection at: – 17 February PureModa 8 – 1015 February Stand T137 Stand N28 Stand N28 Moda 15 – 17 February Or for showroom appointments: Tel: 020 3006 3994 Cavendish House, 369 Burnt Oak Broadway, Edgware, HA8 5AW [email protected] %PMGI,ERRELLEWKEMRIHEVITYXEXMSRJSVGVIEXMRKJEWLMSREFPIERHTSTYPEVEGGIWWSVMIW F]GSQFMRMRKXVEHMXMSREPORMXXIHWIXW[MXLJEY\JYVFS[WKIQWERHIQFIPPMWLQIRXW 3YVEFMPMX]XSYTHEXIEZMRXEKIWX]PIF]KMZMRKMXERI[X[MWXLEWFIIRXLIFIHVSGOSJ XLIFVERH *SV[ILEZI[SVOIHIZIRLEVHIVERHLEZIGVIEXIHE[SRHIVJYPP]ZEVMIHFYX JSGYWWIHGSPPIGXMSRIQFVEGMRKELSWXSJRI[MHIEWMRWTMVEXMSRWERHPSSOW%RSRKSMRK I]IJSVFIEYXMJYPP]XI\XYVIHORMXWIPIKERXIQFIPPMWLQIRXERHSRXVIRHWX]PMRKXIEQIH [MXLEQSVIYVFERZMFIQEOIWXLMWGSPPIGXMSRFSXLVIEWWYVMRKP]JEQMPMEV]IXMRXVMKYMRKP] HMJJIVIRX -RXVMGEXIWRS[¾EOIMRWTMVIHPEGIQM\IW[MXL[MWT]QIXEPPMG]EVRWERHETVIXX]GSQFMREXMSRSJ³TSMRXIPPI TIEVPW´JSVE PSSOXLEX´WHIPMGEXIJIQMRMRIERHVI½RIH -RGSRXVEWXFSLIQMER¾SVEPWERHJSPOW]TVMRXWFVMRKEVMGLGYPXYVIHJIIPXSXLIGSPPIGXMSR4EXGL[SVOWRSSHWGSQFMRI GEFPIORMXWNEGUYEVHWERHWXVMTIWXSWXYRRMRKIJJIGX%RHTPE]JYPJYVTERIPWEHHJYVXLIVHVEQEERHI\GMXIQIRX 3XLIVRSXEFPILMKLPMKLXWMRGPYHISZIVWM^IHJVMRKIHTPEMH[VETWHIGSVEXMZIWXYHHIH½RMWLIW2SVHMGWX]PIJYVXVMQQMRKW WRS[¾EOI*EMVMWPIWGSRXIQTSVEV]PISTEVHTVMRXWERH¾SVEPMRWTMVIHGEQSY¾EKIW ;;;%0-'),%22%,'39/``-2*3$%0-'),%22%,'39/ 4039+,0%2)789(-374039+,0%2)8)((-2+8321-((0)7)<8;&2 PURE LONDON Pure London Exhibitor profiles The Workshop Collection from Artsac T140 +44 (0)113 265 7676 www.smithandcanova.co.uk Little Moose V21 +44 (0)1273 930 053 www.littlemoose.co.uk British fashion brand Little Moose made an impact on the accessories industry last season with its unusual hand-made jewellery born out of a highly original, colourful world vision. Key pieces included the endearing Sausage Cat and Sloth Family necklaces. The label’s proud to release its first collection of handbags and accessories featuring two striking designs – a quirky, illustrated take on classic leopard print and a colourful geometric triangle pattern, which leans heavily on Japanese pop culture influences. Lotusfeet X15 0 +44 (0)7793 675 070 www.lotusfeet.co.uk uk The spring/summer 2015 Lotusfeet collection will be a kaleidoscope of rainbow hues contrasting with soft, dreamy summer pastels. Chokers and long glass-beaded cascade necklaces will be colour blocked in hot orange, turquoise and fuchsia shades, while pearl lariats and long crystal, faceted stone necklaces will be in cooler, softer shades of lilac and aquamarine. A new collection of Mala necklaces and bracelets in white coconut and chakra glass beading and tassels will herald the start of summer festivals and the prospect of another wonderful summer for 2015. Lotusfeet works with cooperatives and small family businesses. The label designs and produces high quality jewellery and fashion accessories, employing fair trade principles. The Workshop Collection from Artsac is a collaboration between Artsac and independent designers and artists, combining experienced accessories design with bespoke artwork for a new approach to fashion concept. In this collection, the label worked with renowned designer Alex Fowkes, combining specialist materials and construction with his detailed typographic work to create a distinctive collection. Alice Hannah T248 +44 (0)20 8943 9383 www.alicehannah.co.uk For 2015, Alice Hannah has created a varied but focused collection, embracing a host of new ideas, inspirations and looks. An ongoing eye for textured knits, elegant embellishment and on-trend styling, teamed with a more urban vibe, makes this range both reassuringly familiar yet intriguingly different. Intricate, snowflakeinspired lace mixes with wispy, metallic yarns and a pretty combination of pointelle and pearls for a look that’s delicate, feminine and refined. In contrast, bohemian florals and folksy prints bring a rich, cultured feel to the collection. Patchwork snoods combine cable knits, jacquards and stripes to stunning effect. Other notable highlights include oversized, fringed plaid wraps, decorative studded finishes, Nordic-style fur trimmings, snowflake Fair Isle patterns, contemporary leopard prints and floral-inspired camouflages. ATTIRE 47 · Pure London Exhibitor profiles Laceys Footwear Q60 +44 (0)20 7739 0398 www.laceysfootwear.co.uk Pia Rossini T186 +44 (0)289 146 7999 www.piarossini.com Pia Rossini is one of the UK’s leading accessories brands, offering an exclusive range of coordinated fashion accessories at cost-effective price points worldwide. As well as luxury faux fur collections to versatile blanket wrap and poncho lines, the label offers an extensive selection of ladies fashion accessories to meet the needs of independent boutiques and department stores across the world. The Laceys Footwear portfolio comprises a contemporary, diverse and exciting selection of brands, ranging from price-competitive, youthful shoe labels to high-end American fashion iconoclast Jeffrey Campbell. For more than 30 years, the company has worked out of its Shoreditch showrooms supplying contemporary Laceys London collections. Current best-sellers include Roadhog footbed sandals, Laceys Kit casual shoes and Claudia Ghizzani fast fashion. This season sees the supplier team up with star of TV reality show The Only Way is Essex, Jessica Wright, for a selection of glamorous yet playful summer styles. Brampton London - Maria Carla T210 +44 (0)121 333 7000 www.brampton-london.co.uk Brampton is a British leather design house based in the trendy East London suburb of Shoreditch. The design team uses the local cobbled streets filled with vintage boutiques, retro shops and local icons as a constant influence. By combining the old with the new, adding edge to classic styles and creating fluid forms, the brand has evolved a wholly original leather clothing and accessories line. The hides, which are carefully selected, are made in a way that preserves natural characteristics and defines the article as genuine leather. The natural changes in shade and visible wear on the surface should be expected and embraced – natural leather is the only material that gets better with age. 48 ATTIRE Reeves & Reeves T121 +44 (0)1460 221 630 www.reevesandreeves.com Reeves & Reeves will present a new collection of Celebration lockets at Pure London. The heart-shaped and circular lockets are crafted from crystal glass with a sterling silver casing. Each locket contains a delicate selection of floating silver and gold vermeil charms, as well as precious and semi-precious stones. The pieces can be opened, so that further charms can be added too. The sentiment aspect of the jewellery makes them ideal for celebrating birthdays, anniversaries, friendships, births and Christmas. INSURANCE solutions Attire Accessories readers put their insurance queries, concerns and questions to leading brokers T.H. March Q I plan to exhibit at Jewellery & Watch Neil McFarlane, Birmingham. Do Managing Director I need to inform of T.H. March my insurance & Co Limited company ? Yes, it’s always a good idea to inform your insurance company, as there can be insurance implications and various problems that might occur arising from misunderstandings over the level of cover provided under standard insurance policies. For exhibitors, there’s the risk associated with attendance at the trade fair itself and you need to make sure you have the following covered: • Stock and trade stands, fixtures and fittings. Does your policy extend to cover attendance at trade exhibitions? If so, is the extension sufficient to cover the values at risk? Commercial policies are traditionally subject to an under insurance condition which means that if you insure for 50 per cent of the value taken to the exhibition any claim you make will be reduced by 50 per cent. • Public liability. Notify your insurers that you plan to attend trade exhibitions, as there may be exclusions within your policy. • Exhibition event organisers can demand a minimum level of cover of £5 million. While this can be purchased separately, it’s often cheaper to increase the limit under the annual cover rather than take out small extensions to cover each of the individual exhibitions attended. • Loss of profits. Does your policy provide cover for loss of profits arising from problems at the event? Most policies won’t and do require specific extension. This cover isn’t widely available but some insurers will give cover. For example a fire on your stand causing damage to property, which leads to a loss of profit arising from the event, can be insured. Again – you’ll need to have told your insurers that you’re attending events. 50 ATTIRE Q When dispatching goods sold at my show stand or from my premises, what should I be aware of and what needs to be included in my insurance policy? The extent of your insurance can include all shipments of goods within the UK whether by your own or hired vehicles; haulage contractors; and post and delivery services. It’s important to be aware that many carriers restrict their liability for loss or damage to the goods they carry. This could potentially leave you seriously out of pocket in the event of a claim. Although, arranging your own insurance protection can solve this problem. Overseas shipments (imports and exports) can also be insured from place of origin to destination. Insurance is usually offered by freight forwarders and monetary limits may apply in all or part depending on methods of transport – often there are more than one, i.e. road, air and sea. if your business is located in an area that isn’t normally at risk and you’ve simply fallen foul of unusual weather conditions, you may experience only a temporary increase in premiums. Each case is highly individual and this is where a good broker will be your most valuable asset because we’ll be acting on your behalf, fighting your corner to achieve the best possible outcome for you and your business. A Q What’s Business Interruption Cover and should I have it? Imagine you’ve been flooded. Clearly your business insurance policy will cover flood damage to premises and stock. If you also have business interruption cover, which I believe to be vital, additional costs such as hiring temporary premises will be met. This means you’ll be able to continue trading during the subsequent repair and clean-up period enabling you to maintain both cash flow and customers. Business Interruption Insurance will also replace the gross profit for your business for the period that the business is interrupted by an insured risk (such as a flood). This covers the recovery of customers phase. Business Interruption cover will cushion you from the blow and may even be the vital factor that saves your business. Many who don’t have such cover will go out of business within 12 months of a major incident. Many people who’ve been flooded want to know if their premiums will automatically go up. The answer to this isn’t simple. However, Visit T. H. March at Jewellery & Watch Birmingham in February in Hall 17 Stand S48 where Neil and the team will be happy to talk through your insurancerelated queries. Further information: T.H. March is a chartered firm of insurance brokers. Established in 1887, the company has offices in London, Birmingham, Manchester, Glasgow and Sevenoaks, as well as its National Administration Centre in Yelverton near Plymouth. To find out more, call +44 (0)1822 855 555, email [email protected], or visit www.thmarch.co.uk. Spring 2015 range in stock now! at Top Drawer Spring and Spring Fair or at: www.fairtradewholesale.co.uk COMPETITION SPRING FAIR Earth Squared, www.fairtradewholesale.co.uk THE REAL Spring The Birmingham-based show returns with another stellar line-up ATTIRE 53 · Spring has sprung Benefiting from 2014’s growth in retail, Spring Fair’s fashion sector continues its expansion this year IN BRIEF Show: Spring Fair Venue: NEC, Birmingham Dates: 1st - 5th February, 2015 Website: www.springfair.com Twitter: @SpringAutFair The organiser of Spring Fair, i2i Events Group, is pleased to report a 10 per cent year-on-year growth in exhibitor numbers at the 2015 event, due to take place from 1st - 5th February at the NEC Birmingham. The Gift, Home and Volume Halls 10, 11 and 12 will open one day earlier on Saturday, 31st January. Such clear growth at the UK’s most important retail exhibition is a positive indicator for the trading year ahead, which also looks set to benefit from strong high street sales over the Christmas period. Spring Fair will present the hottest new lines from 3,000 British and international suppliers, 400 of them new to the show in 2015, providing the ideal launch platform 54 ATTIRE for more than 300,000 new products across 14 market sectors. These areas are Gift; Contemporary Gift; Greetings & Gift; Children’s Gift, Toys & Gadgets; Christmas Gift, Floral & Seasonal Decoration; Gift, Home & Volume; Home; Table & Kitchen; Fashion Jewellery, Accessories & Luggage; Body & Bath; The Summerhouse; The Party Show; Retail Shop and Jewellery & Watch Birmingham. The strongest year-on-year growth is seen in the Gift, Home and Fashion Jewellery, Accessories & Luggage sectors. The overall international exhibitor numbers are also up on Spring Fair 2014. The inclusion of Luggage within the show’s fashion sector represents an important expansion for this part of the show, which also includes a huge selection of costume jewellery and the full gamut of fashion accessories, from scarves, belts and umbrellas to purses, handbags and iPad cases. Stand sales in this sector were on track to achieve year-on-year growth of almost 10 per cent, with 330 exhibitors set to join Fashion Jewellery, Accessories & Luggage at Spring Fair. Visitors can look forward to seeing the latest products from some of the biggest names in the industry, such as Jackie Brazil, Lovett & Co, Oxford Blue, Joe Cool UK Ltd, Boardman Bros Ltd, Design Go Limited and Bessie handbags. With 79 new exhibitors participating in the 2015 event, this sector’s line-up has increased by 19 per cent on last year’s show. These brands join 22 international companies, including Zwei, Sonata, Ciak Roncato, Sac & Co and Ninet Bijoux. Halls 19 and 20 will also be home to several key exhibitors who are returning to the show, including JayLey Collection, Big Metal, Woodbridge Bags, Brakeburn, Checker Leather and Nova Leathers. Fashion Jewellery, Accessories & Luggage will once again be home to one of the most spectacular Spring Fair features, the Fashion Accessories Catwalk, with runway shows taking place three times a day, interspersed with WGSN Trend presentations. Also located within Hall 20 will be one of two Design Lab presentations of unique designer products, with a second feature area located within Contemporary Gift in Hall 6. Exhibiting within the Fashion Jewellery, Accessories & Luggage Design Lab this year are: Heartfelt Fashion, May 28th, Little Moose, Hergest Designs, Nadia Vieira, Designed-by-me-printing, Aine Knitwear, Fenland, Sampson & Christie and Morelli Doris Ticercrea. For more information and to register, visit the website www.springfair.com. A Visit us at Spring Fair, Hall 18 - Stand F04 and Pure Olympia - Stand T169 Spring Fair - NEC 1st - 5th February Stand 18E14-F15 No Minimum Order Pearls of the Orient (Wholesale) Ltd Tel: 01483 202232 Fax: 01483 203680 Email: [email protected] Website: pearlsoftheorient.co.uk SPRING FAIR ATTIRE 57 · Exhibitor profiles Goodlookers Cavendish French 5K48 +44 (0)1634 713 900 www.goodlookers.co.uk uk 18F10-G11 +44 (0)1372 459 944 www.cavendishfrench.com Goodlookers is set to launch many trend-setting new readers, sun-readers, sunglasses and glasses accessories that are perfect for spring/summer 2015. Among the many fresh reading glasses collections is the ’50s inspired Bromley model: an iconic unisex frame that fuses a heavy browline with a metal rim, coming in rich tortoiseshell or black. Also new is the extremely lightweight Olivia model, which combines stainless steel arms with a trendy paisley front design and is available as standard readers or as sun-readers. Goodlookers is adding to its best-selling Bamboo range with stunning new sunglasses fusing vintage-style unisex frames with natural bamboo side arms, complete with the extra benefit of antiglare polarised lenses. The chic bow design glasses cases will also be back by popular demand, this time in an eye-catching array of new colours. Cavendish French specialises in striking, original sterling silver and stone set jewellery. Known for quality, style and a distinctive look, the label’s keen to build on its reputation for glamorous pieces with the new Celestial collection. The hand-crafted circular and heart-shaped pendants and matching earrings, which are available in rose gold and sterling silver, are certain to make a fashion statement in 2015 with their free-floating cubic zirconia details. As well as the latest luxe designs, the label also offers a vintage-inspired range in silver and faux gold. Cavendish French’s heritage style jewellery is inspired by the romance and grace of the Victorian, Edwardian and Art Deco periods with elegant and intricate features. Mala Leather 20K20 +44 (0)1827 67401 www.malaleather.com Mala Leather predicts a bright start to the season with its new line, which features many fresh designs in a colour palette of refreshing blues and greens. Following the success of its recent handbag range and numerous customer enquiries, the brand is pleased to launch the Anishka range of timeless leather bags, made in silky soft nappa with a simple logo detail on the front. The bags will be available in a variety of shades, which will change with each season. The Origin collection, which is made with built-in radio frequency identification (RFID) protection, has had new styles added and a new colour for ladies. RFID protection stops valuable details from being stolen without the owner’s knowledge. The material used is tested to high standards and test results are available upon request. 58 ATTIRE Little Moose 20K45 +44 (0)1273 930 053 www.littlemoose.co.uk British fashion brand Little Moose courted attention last season with its unusual hand-made jewellery born out of a vision for a crazy, colourful world. Key pieces included the endearing Sausage Cat and Sloth Family necklaces. The label’s proud to release its first collection of handbags and accessories featuring two striking designs – a quirky, illustrated take on classic leopard print and a colourful geometric triangle pattern, which leans heavily on Japanese pop culture influences. At Spring Fair, Little Moose will also debut fresh jewellery lines, including a statement leopard necklace. The walking stick specialists Fine quality walking sticks, seat sticks and umbrellas for ladies and gentlemen. Spring Fair: Hall 20, Stand K10-L11 or contact us for a trade catalogue: Warren House, Hinton St George, Somerset TA17 8TQ Tel +44 (0)1460 75686 www.classiccanes.co.uk One of the largest Lady handbags importers/wholesalers/manufacturers. Long & Son Trading, 90-92 Roding Road, London Industrial Park, London E6 6LS www.longandson.co.uk [email protected] 0207 702 3888 Exhibitor profiles Alexander Thurlow & Co 19C32-D33 +44 (0)20 8766 6466 www.alexanderthurlow.com Alexander Thurlow & Co is kickstarting the New Year by unveiling a bold selection of chain and Chanel-inspired jewellery. Keeping the look light and fresh for spring/ summer 2015, this range allows for plenty of subtle colour combinations with its vast array of metal and stone shades. Customer service and bestselling designs are what have made this brand one of the major suppliers of fashion jewellery since 1949. Gorjus Accessories 20H02-K02 +44 (0)20 8577 7132 www.gorjusaccessories.co.uk Handbag and accessories brand Gorjus will be exhibiting with this season’s focus on the leather range and new tapestry designs. The label will be launching the Battersea leather collection – which is set to be available in black and brown tones – to build on the success of the Camden antique and Finchley vegetable-tanned leather lines. New patterns will be added to the tapestry range after a very successful launch last season. There are also fresh styles for the leather purse selection, which is available in bright shades and comes in presentation boxes for gifting. Earth Squared 19B04-C03 +44 (0)1620 824 392 www.fairtradewholesale.co.uk Building on its record-breaking autumn, Earth Squared will be showcasing an inspiring selection of pretty fabric bags and accessories in seasonal hues and fabrics for spring/ summer 2015. Drawn from the same palette, yet with very distinctive looks, the key ranges include the eye-catching butterfly prints and sumptuous, sophisticated wool, as well as tweed ranges and the popular spotty linens. There are also bold new spot and stripe purses and bags in a variety of styles and tones, as well as the return of the company’s extremely popular wraps in all-new colours. With a large selection of matching scarves and purses, the latest collection’s set to be the label’s best-selling one yet. 60 ATTIRE Jewelcity 19B12-C13 +44 (0)1494 444 200 www.jewelcity.co.uk Jewelcity’s spring/summer 2015 collection has been designed to keep the modern retailer at the forefront of fashion. Florals have formed a huge part of the product range this time round, following its emergence as a must-have trend for handbags and accessories in recent catwalk shows. The accessories label’s purse range has also expanded this season to include embroidered and appliqué natureinspired pieces adorned with butterflies and retro patterns, as well as the fabric coin purse design featuring vivid petal prints in bright shades of pink, blue and green. There’s also a vintage-inspired print used across the purse and bag collections that remains popular with Jewelcity customers. See our stunning new Spring/Summer 2015 mix from Saddler plus the new Cuties and Pals soft sided luggage at the Spring Fair! 1st-5th February 2015 Hall 20 Stand no H40 – 20J4 www.modrec-int.com Exhibitor profiles Gecko – Fiorelli Jewellery Bellee & Flo 19D10 )1892 824 396 +44 (0)1892 www.belleandflo.co.uk With one eye always on the next big jewellery trend, Belle & Flo is a label that always looks ahead to the next season with excitement, and this year’s no different. With an array of vintagelook pastel gems, earrings combining pretty beads and delicate crystals, and tiny pearl details giving necklaces a delicate feel, the latest collection is all about refined femininity. The new sapphire shade championed by the brand is now a strong favourite within its best-selling Crystal Ring range, acting as a subtle pop of colour amongst spring/summer 2015’s demure neutral hues. NV Bags and Accessories 20L29 +44 (0)1454 320 650 www.nvbags.co.uk After a successful 2014 at Spring Fair, NV Bags is set to return to exhibit its extensive spring/ summer 2015 range. The Envy collection comprises fashion, day and occasion styles in a broad spectrum of fabrics, colour and stylish designs. Cost prices are very competitive, ranging from £4 to £15. The label’s also excited to introduce its new Woodlands collection, a range of designs with a casual country appeal. 62 ATTIRE 18K30-L31 +44 (0)1376 532 000 www.geckojewellery.com Catering both for consumers seeking statement style or modest glamour, Fiorelli Costume’s floral forms come in a wearable mix of perky pastels and brilliant brights, encapsulating the essence of what’s set to be a sultry season for costume jewellery. For a more everyday look, nostalgic symbols adorn trinkets for a keepsake feel. Meanwhile, the Fiorelli Silver collection for spring/summer 2015 offers an alluring mix of texture, tone and timeless elegance. Hot summer hues are showcased through delicate inlay, with cabochons in muted hues complementing geometric shapes. URBAN COUNTRY 20M42 +44 (0)1462 446 040 www.urbancountrybags.com The URBAN COUNTRY brand is growing fast, with a host of new lines broadening its fashion. At Spring Fair, retailers and buyers will be able to view the full range ready for immediate delivery, including the fresh spring/summer 2015 colours in the Florence and Milan collection: glacier grey, strawberry ice, lucite green, aquamarine, and custard. COOL TRADE WINDS Beautiful and Unique Fair Trade Scarves and Accessories To find out more about our Spring/Summer collection, please visit us at Top Drawer - Stand 801, Giving & Living (Exeter) - Stand B206 and Spring Fair - Stand 19A07 Tel: 01425 461 594 | Mob: 07906 627 691 | Email: [email protected] www.cooltradewinds.co.uk Handbags & Accessories. Niche Trading (UK) Ltd T: 020 8577 7132 E: [email protected] [email protected] EXHIBITIONS Spring Fair N.E.C. Hall: 20 Stand: 20H02-K02 1st - 5th February 2015 Moda Accessories Hall: 19 Stand: N20 15th - 17th February 2015 www.gorjusaccessories.co.uk SPRING FAIR Peace of Mind Vizati 19F20-G21 +44 (0)1225 777 749 www.pom925.com 18H05 +44 (0)1323 485 605 www.vizati.com Following its most successful year ever, 2015 will see a softer, more mature Peace of Mind: the designs are still playful, but now with a grown up edge. The company will be introducing some new elements, such as heritage Liberty prints in the charm bracelet collection, refined silver-plated designs and gold and rose gold metals, which will suit the mellowness of the collection’s nature theme. Dragonflies, bees, flora and fauna are not only beautifully handcrafted into the jewellery range, but also echoed in its very popular range of scarves. Allure by Vizati is an exciting new collection of contemporary designs in 18ct matt gold vermeil, as well as matt and shiny sterling silver. High quality faceted tanzanite, amethyst, blue topaz, peridot, garnet and citrine stones add splashes of colour to the elegantly finished jewellery. Also on display at Spring Fair will be intriguing new additions to the 5XTRA range of silver-plated and dichroic glass jewellery. Tommy Tou 20G40 +44 (0)845 053 6812 www.lindy-lou.co.uk Tommy Tou, the quality Australian sheepskin fashion accessories label, will be showcased at Spring Fair. The distributor for the brand is Lindy Lou, which is renowned for see-through, pagoda and fine art design umbrellas. The collection includes slippers, gloves, mittens, headbands and other great gift lines. Comprising high quality materials and innovative design, most Tommy Tou items also come gift packaged. Classic Canes 20K10-L11 +44 (0)1460 75686 www.classiccanes.co.uk Walking-stick specialist Classic Canes will be exhibiting at its 26th consecutive Spring Fair this February. The family business is distinguished by the fact that it grows and manufactures many of its wooden walking sticks at its Somerset woodlands. The firm exports its range of more than 650 traditional and contemporary walking sticks, seat sticks and umbrellas to nearly 50 countries, appealing to buyers in search of unusual, stylish and good quality accessories and gifts. New products this spring include tartan folding canes, acrylic leopard print derbies and decorated shepherds’ crooks and other wooden canes. ATTIRE 65 · Exhibitor profiles Midhaven 18F02 +44 (0)1299 851 513 www.midhavensilver.com Midhaven will be showing its accessibly priced and extensive silver cubic zirconia range, which comes with or without rose-gold plating. Other ranges at the exhibition will include freshwater pearls, stylish silver Lavish bangles, colourful cubic zirconia clusters and marcasite. There’ll also be plenty of new styles and colours in the very successful Tribal Steel range of leather and stainless steel jewellery. Prices range from £8 to £35. Point-of-sale material is free with orders over £200, and each bracelet comes with a branded hessian pouch. The Healthy Back Bag Company 20J19 +44 (0)20 7812 9800 www.thehealthybackbag.co.uk Healthy Back Bags are a distinctive teardrop shape, specifically designed to contour to the spine, reducing the stress on neck and shoulders. They come in hundreds of different colours and fabrics, they’re hardwearing, stylish, packed with intelligent pockets that help organise belongings and spread weight around the bag sensibly. They can even be worn four different ways; on either shoulder or cross-body. Designed to combat the problems that can be caused by a one-strap bag, be kind to the spine, and, of course, look great, the bags distribute weight asymmetrically, meaning they are comfortable for people of all shapes and sizes. Gaventa London 5G86 +44 (0)1707 654 820 www.gaventa.london Carrie Elspeth 19C20-D21 +44 (0)1446 771 271 www.carrieelspeth.com Carrie Elspeth is celebrating the return of spring with the launch of a gorgeous new jewellery collection full of colour. Bursting with fresh ideas, Carrie’s new ranges express the layers and depths of the modern woman: from elegant femininity to decadent sophistication; from vibrant energy to playful fun, the designs once again showcase the company’s wide appeal and versatility. The jeweller’s latest pieces – all of which are hand-made in Wales – will all be on show, alongside her best-selling Sentiments charm bracelets. The Carrie Elspeth team can also offer retailers branded packaging, display materials and excellent lead times. 66 ATTIRE Charm Angels in Silver by Valentina is a fully branded range of beautiful sterling silver angel pendants and bracelets set with glittering Swarovski Elements crystal birthstones, on a sparkling diamond-cut cable chain. Angels are said to bring love, courage, guidance and protection. Combined with compelling symbolic birthstones, these lovely angels, supplied in a glossy white box by Gaventa London, make the ideal sentimental gift for a special occasion or a charming addition to a consumer’s personal jewellery collection. SP PU RE RIN G LO FAI ND R 1 V st O - 5 ISI N 8t T t h h - 1 Feb US AT 0t ru ar h Fe y 20 br ua 15 ry , 20 Sta 15 nd : ,S ta 20F 0 nd :T 1 17 6 Original and fabulous handbags and accessories that will make you smile! www.vendula.co.uk Exhibitor profiles Talbot Fashions 19F21 +44 (0)1273 776 415 www.talbotfashions. co.uk Accessories by Park Lane 19G20 +44 (0)1423 868 362 www.parklaneonline.com At Spring Fair, Accessories by Park Lane will be launching its new spring collection, featuring 250 new lines featuring the latest designs in leather and brushed metal jewellery. The brand’s also exhibiting its popular range of hand-made jewellery and accessory displays. All stock is available for immediate delivery and trade prices start from only £2.50. Brighton-based Talbot Fashions was established F iin 1980, and is now one of tthe UK’s largest fashion jewellery and accessories wholesalers. New collections will be on display at Spring Fair such as additions to the best-selling range of paua shell necklaces, bracelets, earrings, brooches and pendants. Motif designs include Scottie dogs, cats, the tree of life, owls, elephants, butterflies, celtic symbols and more. The turquoise stone collection includes necklaces, bracelets and earrings. The company also supplies diamanté, freshwater pearl, sentiment pieces, stacking rings, earrings including clip-on, beaded and enamel designs, slake bracelets, mood rings, boys’ accessories and an extensive surf and friendship selection. Pearls of the Orient 18F04 +44 (0)1483 202 232 www.pearlsoftheorient.co.uk Timesource 19A20 and 19A21 +44 (0)1778 343 000 www.timesourceltd.com Timesource is excited to launch its new Henley handbag and watch collection. The range features matching handbag, purse and cosmetic bag sets, all with retail prices of £45 or less. The watches side of the label will see the launch of an exquisite line of rosegold diamanté bracelets and strap styles in pastel neutrals and rich premium tones, all with retail values of £30 or less. An ideal choice to stock for the wedding season is the all-new Metallic bag and purse collection. 70 ATTIRE Pearls of the Orient is introducing fresh designs at Spring Fair. With a rejuvenated colour palette firmly on everyone’s agenda as spring/ summer 2015 approaches, the company’s keen to share its new vibrant mixed colours sidedrilled freshwater pearl loop necklace and matching bracelet with the show’s visitors. The kaleidoscope of colours will match any outfit, and using a shortener with the long loop necklace means it can be doubled up or twisted to give added depth as well as style. Visitors to the stand can view the label’s extensive collection of cultured freshwater and sea pearls pieces, some of which feature combinations with semi-precious stones and silver charms. Prices are accessible and there’s no minimum order. SPRING FAIR Balagan Miss Milly 18K28-L29 +44 (0)845 260 0925 www.balagan.co.uk 19C18 +44 (0)1905 622 509 www.missmilly.co.uk The Balagan Group will be unveiling its new Karma Cafe collection of aspirational, sentiment-driven jewellery, new designs for One Wish, Studio and Blowing in the Wind, as well as Narrate. Rose gold and gold vermeil will feature strongly across the ranges, as will bespoke packaging, which supports the label’s collections perfectly. Now in its third year of trading, Miss Milly has chosen h sen the theme Light and Bright for the coming season, with a palette of fresh pastels and sunny, bold colours to complement the concept. With mint greens, soft mauves and dusky pinks alongside lime green and cobalt blue, there really is something for all tastes. The jewellery also features iridescent and marbled finishes, staying in line with seasonal trends. Building on the popularity of the matt silver-plated Amora Collection, nine new designs are being introduced while two heart styles – both of which sold out incredibly fast first-time round – being re-stocked. These pieces all come with a stylish Miss Milly gift box. Opticaid 5G50 +44 (0)1132 391 400 www.opticaid.net Opticaid UK is showcasing its spring/summer 2015 range. New products include a variety of contemporary and classic ready reading glasses, sun-readers and sunglasses by Remaldi, and the ingenious NeckSpex – memory frame readers designed to be worn around the neck when not in use, so that you never lose your glasses. Retail prices for these pieces start at £12.99. New unisex styles include wood-inspired Ascot, Keswick black with silvercoloured metal arms and fashionable Phoenix tortoise and coral. New ladies’ styles include Chelsea black and teal, pretty Kowloon floral and Perth hot fuchsia frames. Shruti Designss M29 7D04-E03 and 20M29 +44 (0)1985 847 774 om www.junction18.com Shruti Designs prides itself in developing easy-to-wear, on-trend fashion accessories. Inspired by the seasons, the label’s collection for spring/summer 2015 truly embraces crisp colours, cool tones, natural fibres and all the novelty associated with this time of year. Featuring fresh British talent, collections from new designers include Lisa Buckridge, Susie Faulks and Casey Rogers, whose product ranges complement the core 100 per cent cotton canvas collections synonymous with the brand. ATTIRE 73 Exhibiting at The Torquay Show Jan 11th – 14th Top Drawer Jan 11th – 14th Scotlands Trade Show Jan 18th – 20th Spring Fair Hall 20 - K 20 www.malaleather.com Tel: 01827 67401 Fax: 01827 67046 2 Bridgeside Trading Estate, Kettlebrook Road, Tamworth, B77 1AG The name ETON is synonymous with producing high fashion, great quality ranges of watches at amazingly affordable prices. Also available are SEIKO, KOOL TIME and ODM watches. Spring Fair Hall 18 - Stand K15 Contact Newcom Distributors Ltd Unit 4 Neville Place High Road London N22 8HX T: 020 8888 8238 F: 020 8881 7506 W: www.etonwatches.com E: [email protected] PROFILE Caught in a wrap Rew designer and founder, Rachel Emma Wright reveals why the scarf label’s dual ethos of simple, easy-to-wear style and British production will continue to define the company as it goes international Rew’s aim has always been to create easy to wear accessories that enable the easy-to-wear consumer to dress with confidence, and after much research and sampling, our signature collar is a best seller worldwide. We pride ourselves on offering exceptional customer service and exceeding expectations, not only with the product but also with the service. We even offer nextday delivery. Tell me a bit about how the label was started. The Rew label was born out of a solution I found to one of my own problems. As I was unhappy tying a scarf around my daughter’s neck when she was small, I created the simple button-round collar as a safer alternative. This quickly evolved into an accessory for myself and other like-minded mums in the school playground. With our day-to-day pace of life becoming faster we all want convenience, style and simplicity from our wardrobes: Rew designs offer this in abundance. What was the aim of the label when it was first established? Rew was finally established in 2011, after I’d sat on the initial idea for 12 years. Realising there was a gap in the market for an alternative to the classic tying scarf, I developed the original concept into a women’s accessory, bridging the gap between classic styles and trend-led scarves. How were the initial products developed, and what was the market response? Here at Rew, we’re all passionate about British production, so while the costs of manufacturing in this country are higher it does mean we are helping keep the UKmade tradition alive, and also cutting down on our carbon footprint. Our first collection was so well received by wholesalers up and down the country that within three months of launching Rew, we’d grown to supplying more than 150 stockists. The response to the brand has been amazing, our customer base keeps growing, and our existing clients continue returning for more. What challenges were overcome when the company was starting out? We’ve had lots of challenges when setting up, the financial investment was a minimum, space was critical and how to offer quality products and affordable prices is always a hurdle to jump. Our greatest difficulty to date has been increasing brand awareness and growing the retail sector of the business. In the last year we’ve also seen a decline in British mills, so our search for quality UK-woven fabrics has proved harder. However, we’ve been fortunate enough to find a long-established supplier that can meet our current needs. ATTIRE 75 · What sets you apart from your competitors in the industry? Rew offers products that aren’t on the market anywhere else right now. We feel that we stand alone in this area with our original designs, which are gaining momentum in the accessories industry. The label currently supplies high quality products at very affordable prices, while also offering low minimum orders and not swamping our wholesale customers with huge pack sizes. How important is the location and history of the company to its success? Our origin and history is of huge significance ‒ we started from my kitchen table with very little resources and have grown organically into a recognised brand. Our made-in-the-Midlands approach is also very important to us, as historically the Midlands was the capital of UK production. We’re happy to continue this tradition by only using local manufacturers to ensure all of our pieces are made on our doorstep. This enhances our reputation and credibility within the industry too, as we’re finding more and more retail and wholesale customers love the authenticity of buying British products. How has the product offering changed over the years? Describe your current collection? We’ve stayed true to Rew’s starting point of easy-to-wear designs, while adding new lines such as our Luxury range, and we’re constantly developing new ideas and experimenting with different textures. However, we’re strong believers in the adage ‘if it ain’t broke, don’t fix it’, so while we move forward with our designs, our aim and ethos remain the same. Our current collection is the Essentials range, aimed at women of all ages who want to enhance their look with minimal fuss, no ties and a fleecy collar style for winter warmth. We’ve also launched men’s and children’s ranges under the Rew branding, and we’ll be introducing our simple yet chic clothing line very soon. How often do you launch new lines? We launch our new lines both seasonally and in season. We have local production on our side and close to hand, so that we can adapt to the ever-changing trends and climate very swiftly. What are the current best-sellers? Our best-selling designs are the original Rew pieces; Francoise is still our bestselling product three years after its launch. We had great success in 2014, with our products being featured in all the glossy magazines. Our recent his/her campaign was a huge success as a soft launch for our new ‘boyfriend’ scarf. Which trade shows do you attend and which one works best for you? We’ve been invited to exhibit at many shows in our three years of trading and have chosen to show at Pure, Scoop International, Pulse, Spring Fair and Made in London. The most successful events for us have been those that serve the gift sector primarily, rather than the high-end, fashion-specific shows. This year we’ll be concentrating on overseas trade events and moving away 76 ATTIRE PROFILE from showcasing in the UK as footfall has dropped dramatically, with fewer international visitors attending exhibitions. When was the website launched and how does it support the business? The Rew website launched in September 2011 and was primarily set up to accommodate the retail sector, as this part of the business has tripled in size year on year. Our main investment in the next year will be a website relaunch, with a wholesale sector, so our trade customers can buy directly from us with ease. What have been the key milestones in the business? We’ve had many milestones since launching Rew. When we look back at our starting point ‒ the custom-built studio in the back garden ‒ to now having our own studio, warehouse and office all under one roof, it’s apparent we’ve made a huge move in the right direction. Also, our brand is now recognised as offering high-end, luxury products. We were recently commissioned by global brand Estée Lauder to design both a women’s and men’s luxury range; this was a huge success and a fabulous project to be part of. increase our presence internationally and invest in our online sales platform. There are lots of new products in the pipeline. As with all designers, these are firmly under lock and key until we release our launch dates, but you can be sure that Attire Accessories readers will be among the first to know! A How do you view the current market and what trends, both in products and in business, do you see emerging over the coming months? We’re finding that a lot of our wholesale customers have shifted buying methods to purchasing in season, which we have always accommodated. We see this continuing as the season’s weather is unpredictable. Looking at last year, with winter starting later and finishing later, we were able to adapt to the needs of retail buyers. We also see the trend for the luxury market growing, with the desirability factor for natural fabrics being on the increase. What are your future plans for the business? We’ll continue to grow the business, increasing our product lines and strengthening the core Rew values of really easy-to-wear styles. We have plans to Contact Rew +44 (0)1827 580 06 www.rewclothing.co.uk ATTIRE 77 SUMMER SHOES Buckle up Step into the summer sun with these fresh takes on seasonal footwear classics Cocorose London, www.cocoroselondon.com ATTIRE 79 · 2 1 3 Take it easy... in sporty styles 4 5 6 7 8 1. Caprice: +44 (0)7734 247 669 or www.capriceshoes www.capriceshoes.co.uk; co uk; 2. 2 Tamaris: T +44 (0)1604 880 146 or www.tamaris.eu; 3. Cocorose London: +44 (0)20 8829 8919 or www.cocoroselondon.com; www c 4. Victoria Plimsolls: +44 (0)7889 544 024 or www.calzadosvictoria.com; 5. Tracey Neuls: Ne l +44 (0)20 7935 0039 or www.traceyneuls.com; 6. United Nude: +44 (0)20 7240 7106 or www.unitednude.com; 7. Moda in Pelle: +44 (0)113 239 2379 or www.modainpelle.com; 8. Carlo Pazolini: +44 (0)20 7591 3913 or www.carlopazolini.com 80 ATTIRE Reading Glasses, Sunglasses, Sun Readers & Accessories Spring Fair - Hall 5 - Stand J51 T: 01635 297911 E: [email protected] W: www.clerevision.co.uk SUMMER SHOES 1 2 3 HIT THE BEACH... in strappy sandals 5 4 6 7 8 1&2 Havva: +44 (0)20 3239 0098 or www.havvamustafa.com; 3. Swedish Hasbeens: +44 (0)7590 560 006 or www.swedishhasbeens. com; 4. Caprice: +44 (0)7734 247 669 or www.capriceshoes.co.uk; 5. J Shoes: +44 (0)1858 468 123 or www.jshoes.com; 6. Cocorose London: +44 (0)20 8829 8919 or www.cocoroselondon.com; 7. Carlo Pazolini: +44 (0)20 7591 3913 or www.carlopazolini.com; 8. Laceys Footwear: +44 (0)20 7739 0398 or www.laceysfootwear.co.uk ATTIRE 83 · 1 2 3 Make waves... in statement shoes 5 4 6 7 8 C L d 44 (0)20 8829 8919 or www cocoroselondon com; 2&3 Moda in Pelle: +44 (0)113 239 2379 or 1&5 Cocorose London: +44 www.cocoroselondon.com; www.modainpelle.com; 4. Swedish Hasbeens: +44 (0)7590 560 006 or www.swedishhasbeens.com; 6&8 Tracey Neuls: +44 (0)20 7935 0039 or www.traceyneuls.com; 7. Jessica Wright for Laceys Footwear: +44 (0)20 7739 0398 or www.laceysfootwear.co.uk 84 ATTIRE COMPETITION MODA THE MODERN AGE This February, Moda will showcase the hottest fashion accessories and footwear for autumn/ winter 2015 The Healthy Back Bag Company, www.thehealthybackbag.co.uk ATTIRE 87 · FASHION FLUX Moda’s 27th edition will bring together the best of both the British and international fashion markets The 27th edition of Moda UK will take place at the NEC Birmingham on 15th 17th February, 2015. Moda’s at the heart of the UK market with its central location at the biggest and busiest exhibition venue in the country and its reputation as a key fixture on the UK trade show calendar. As the first choice for buyers sourcing the hottest new collections each season, there are more than 1,450 brands to be discovered across the show, and as the key launch pad for fresh trends and international brands in the UK, buyers are guaranteed to find exciting new products. Fusing the best of British and international emerging brands and household-name labels across womenswear and accessories, Moda Woman will offer visitors this season a dynamic mix of contemporary and mainstream brands. Recognised as one of the country’s leading fashion trade shows, Moda provides a prominent platform for brands to showcase collections to prospective buyers, independent boutiques, department stores and e-tailers. Brands have shown an early commitment to Moda Footwear, welcoming back key favourites such as Dr Martens, Birkenstock, Mel by Melissa and Fly London. They’ll join some of Britain’s leading homegrown labels, with Barker Shoes from Northampton and Van Dal from Norwich signalling a strong contingent of UK 88 ATTIRE manufactured brands. A key selection of women’s footwear brands exhibiting include Rocket Dog, Moda in Pelle, Babycham, Dolcis, Ravel and Gardiner Bros, which is set to bring Riva Shoes and The Flexx. Skechers are set to exhibit this season, offering styles combining memory foam and a relaxed fit for every age and activity across an eclectic range of casual lifestyle sneaker collections. Adding to the casual footwear line-up are well-known labels Gola Sport and Gumbies. Notable brands making a much In brief Show: Moda Venue: NEC, Birmingham Dates: 15th - 17th February, 2015 Website: www.moda-uk.co.uk Twitter: @ModaExhibitions anticipated appearance in February after a previous hiatus include Anatomic & Co, Ara, Shepherd of Sweden, Steptronic, Sorel, HB Shoes and Hi-TEC. In addition to the diverse and exciting range of brands set to exhibit at the show, this season will see the introduction of the BE2B Hub. This is a dedicated business inspiration centre within the show. It brings leading e-commerce technologies, retail services and in-store product providers together with a new retail-oriented seminar programme in one easy-to-access pop-up area, enhancing the overall Moda experience for visitors. Sean O’Connor, Event Director for Moda Footwear said, “I’m delighted with the positive uptake from big names and new brands alike, it shows a very promising start to the season. We have a diverse selection of brands exhibiting which is always encouraging to see, and we’re committed to expanding our offer and enriching the trade show experience for visitors.” To find out more about Moda and register free of charge, visit the website www.moda-uk.co.uk. A Stand Q6 2);137%-''300)'8-32 [[[QE]XEPMWYOGSYO QE]XEP$JVIIRIXREQIGSYO MODA Exhibitor profiles CAPRICE R10 +44 (0)7734 247 669 www.capriceshoes.co.uk co.uk Many new fashion trends rends have been implemented in Caprice’s price’s boot range for autumn/winter 2015. 015. Young, flat and pointed shapes complement the brand’s varied models, ls, while fine materials, soft leather, r, lightweight soles and fashionablee uppers result in an ideal combination n of fashion and convenience for the chillier months. Material mixes, paddings, straps and buckles, as well as striking zips, give each boot model a distinctively Caprice look. The new line also includes overknees and three-quarter high boots. For the next season, the footwear label will offer sporty as well as fashionable styles, including new, attractive sneakers and lace-up variants. GABY N11 +44 (0)1985 212 291 www.gabysfashion.com Fast becoming known for its on-trend, must-have jewellery looks, Gaby blends glamour, elegance and intricate design in its collections. Covering a striking range of very distinctive statement styles for day and night, the latest range includes its trademark juxtaposition of European pearls and tactile, textural details. DENTS M11 +44 (0)1985 212 291 www.dents.co.uk With its 237-year history ry and global reputation for or fabulous craftsmanship and stunning design, Dents is a truly iconic British fashion brand. This year at Moda, it’ll be showing off its exciting new designs, featuring exquisitely made leather gloves and accessories for modern women. The brand’s latest fashion gloves incorporate high-tech leathers designed for use with mobiles and tablets, as well as new styles and colourways in Dents’ classic three-point leather gloves range. GORJUS BAGS N20 +44 (0)20 8577 7132 www.gorjusaccessories.co.uk es.co.uk Handbag and accessories ries brand ing its Gorjus will be exhibiting leather range and new tapestry designs. The label will be launching the Battersea ea leather et to be collection – which is set available in black and brown tones – to build d on the success of the Camden antique and Finchley vegetabletanned leather lines. New patterns feature in the tapestry range after a very successful launch last season. Fresh styles will also be added to the leatherr purse selection, which is available in bright shades and comes in presentation boxes for gifting. ATTIRE 91 · FRED BENNETT MI29 +44 (0)1376 532 000 www.fredbennett.co.uk Exploring new avenues in the men’s fashion market, Fred Bennett is renowned for its selection of innovative designs in silver, stainless steel and leather. Evoking modish masculinity without pretension, the brand sees itself as a great fit for Moda this season, as it has pieces to suit all retailers’ buying needs, from men’s gifting to self-purchases. The success of the label has largely been down to the diversity of its product range, with the collections being refreshed at least twice yearly, with an array of men’s jewellery and accessories, including watches and a best-selling wristwear range. THE HEALTHY BACK BAG COMPANY P38 +44 (0)20 7812 9800 www.thehealthybackbag.co.uk Healthy Back Bags are a distinctive d teardrop shape, specifically designed to contour to the spine, reducing the stress on neck and shoulders. They come in hundreds of different colours and fabrics, they’re ntelligent pockets that help hardwearing, stylish, packed with intelligent organise belongings and spread weight around the bag sensibly. They can even be worn four different ways; on either shoulder or cross-body. Designed to combat the problems that can be caused by a one-strap bag, be kind to the spine, and, of course, look great, the bags distribute weight asymmetrically, meaning they’re comfortable for people of all shapes and sizes. MAYTALI’S UK TBC +44 (0)7949 526 197 www.maytalisuk.co.uk www.sashas-mind.com Sasha’s State of Mind’s new TWIST collection features extralarge double sided pendants that can be worn either way around to offer two distinct looks. This season, the jewellery label will also be adding the new crystal shade of midnight blue to the range. Designer Sasha has also created new complete necklaces, including a fresh crystal encrusted O-Ring with logo. Her original vision and philosophy of playful, dreamy fun are reflected in the brand’s every customisable detail, from engraved fanciful sayings sure to make the wearer smile, to sophisticated and quirky pendants. 92 ATTIRE ACCESSORIES BY PARK LANE O72 +44 (0)1423 866 990 www.parklaneonline.com This spring, Accessories by Park Lane will be launching its new collection, featuring 250 new lines featuring the latest designs in leather and brushed metal jewellery. The brand is also exhibiting its popular range of hand-made jewellery and accessory displays. All stock is available for immediate delivery and trade prices start from only £2.50. PROFILE A bolt from the blue Ben Adams of Suzie Blue talks about the ethical accessories company’s commitment to making an impression at trade shows and offering an exhaustive collection of designs Tell me a bit about how the label was started. Suzie Blue’s a family business, and we’ve been buying and importing a variety of products from India and Indonesia for more than 20 years now. Originally focusing on furniture and gifts, we added jewellery to our product range around 15 years ago and found this was something we had a real passion for. Ever since we introduced our first collection, we’ve been hands-on in designing and developing jewellery with a distinct look, with a natural, ethical theme running throughout the collections. Due to the initial success of this new product range, we decided to launch the Suzie Blue brand about 10 years ago, and have been growing ever since, developing ‒ we hope ‒ a solid reputation for distinctive, ethically sourced costume and silver jewellery. What was the aim of the label when it was established? I think we’ve always looked to offer something a bit different from the competition. Since the brand was launched, we’ve worked hard to keep developing exciting new collections at sensible prices. Our products are fun and often quirky, but always at good prices that allow the retail customers to treat themselves without breaking the bank. How were the initial products developed, and what was the market response? Our product ranges have always used natural materials, and initially our jewellery lery comprised a lot of wooden beads, leather, shells and natural stones. This has always provided an interesting alternative to the more glitzy jewellery on the market. When we launched Suzie Blue we were really encouraged by the positive reaction, and soon established a network of retailers around the country. In recent years, our look has certainly become more contemporary, but we try to stay true to our origins and we still use a wide range of materials to create what was been described by one customer as a ‘textural’ jewellery collection. What challenges were overcome when the company was starting out? Working with a large number of small artisan manufacturers quickly led to a huge variety of new ideas, styles and designs, which we were keen to develop into a diverse range of jewellery. However, the size of the range has always presented some problems, particularly from an ordering and stock control point of view. We often think back to the evenings spent collating hundreds of hand-written show orders to establish individual product sales and reorder requirements. We soon realised we’d need a good website, and because we ensure that it’s fully live and stock controlled at all times, this has helped our small team to cope with such a large selection of designs. We’ve also developed our own electronic ordering system for trade shows, which has saved hours of work in post-show analysis, and allows us to get top-up orders confirmed with our suppliers as soon as they’re required by retailers. What sets you apart from your competitors in the industry? Taking such a hands-on approach to product development, together with our large network of exclusive suppliers in Bali and India, instantly gives us a great point of difference from many of our competitors. We continue to use a wide variety of materials, such as suede, leather, shell, stones, horn and wood. Continuing this natural theme, our most popular scarf line over the past 12 months has been our 100 per cent cotton pieces. Not only do we offer a wide variety of costume jewellery, but we’re also one of the few trade suppliers to also present buyers with a collection of .925 silver alongside our bags and scarves. We continue to work closely with our suppliers and regularly visit them to design and develop new collections in person. In Bali, for example, we have numerous ATTIRE 95 · suppliers, and we work closely with all of them to create new designs twice a year. We also believe in trading fairly and ethically, and this has always been a key aspect of our brand. We have our own local staff on the islands, and ensure that everyone is paid directly in local currency for their work. We’ve worked with many of these artisans and makers since the beginning, and have seen their businesses grow like Suzie Blue. How important is the location and history of the company to its success? We have always been based in the East Midlands, and have no plans to move. We have a showroom in Newark-on-Trent, and this convenient location right in the middle of the country means people from the north and south of the UK can visit anytime to see the full collection in person and take the stock away with them. Obviously, having been based in the area for so long, we’ve developed relationships with smaller local suppliers and service providers, to whom we remain loyal and always try to favour over larger national or international alternatives. Perhaps the most important locations for our business are not so much our UK homes, but where we buy from – India and Bali, provide a vibrant source of inspiration and ideas, and it’s always a joy to visit our suppliers and work on new collections with them. The relationships we have established in both countries are vital to our business. How has the product offering changed over the years? Describe the current collection. As mentioned, the product range has certainly become more contemporary in the past 10 years. As tastes and trends have evolved, so have we as a brand. We always try to move our collection forward, and introduce new styles, seasonal shades and modern materials – but we do this without 96 ATTIRE compromising the look and trademark that has made us successful. How often do you launch new lines? We have two key launches each year; the spring/summer range is generally introduced at the January and February trade shows, such as Giving & Living, Top Drawer, Spring Fair and Moda, while autumn/winter collections are launched in July at Home & Gift and then offered at trade shows later in the year, like Moda and Autumn Fair. However, we continue to design new collections and develop existing ranges throughout the year, which often results in mid-season product launches. What are the current best-sellers? With such a diverse range, we’ve come to fear the question ‘what’s your best-seller?’ With a collection of more than 1,500 pieces, it’s often difficult to answer. However, some of our best-selling costume lines include our beaded heart and dragonfly necklaces, our new asymmetric heart on coloured suede ‒ a redesign of an old favourite, our ever-growing range of buffalo horn jewellery, and our flat, beaded collars. As for silver, we’re selling a lot of simple studs at the moment, including little butterflies and dragonflies, and also some cute silver and shell hearts. We’ve also introduced a range of scarves this year, and in particular, our 100 per cent cotton styles from India have proved to be hugely popular with our customers. Which trade shows do you attend and which one works best for you? We’ve been exhibiting with Spring Fair and Autumn Fair for many years now, as well as Home & Gift, Harrogate. These remain our key show dates, and are generally the best opportunity for our customers to see the full collection, including our range of silver. Over the past few years we have increased the number of trade shows that we attend. We began to exhibit at Moda a few years ago, and this has proved to be really successful. Obviously, being a fashion show, it offers a slightly different customer base from the more gift-orientated shows, which has been beneficial for us. In 2014 we were at nine shows in total, having added both Top Drawers and also the mid-season Pulse in London. This has provided a great opportunity to meet buyers and business owners from the south, many of which are unable to attend the shows in Birmingham. Similarly, we’ve also been exhibiting at Giving & Living in Exeter for four years now. For those customers in the south west, even getting up to London can be difficult, so this show allows us to go to them directly. Since first exhibiting there, we’ve established relationships with some really important independent customers in the region, many of whom attend the show in January and get their order in for the start of the tourist season around Easter. We work very hard on the look of our trade show stand, which is all designed and built in-house. Our current stand design was inspired by a trip to Bali a few years ago, and combines whitewashed slats and ladders with natural wooden busts and PROFILE displays. It’s important to stand out at trade shows, and we always appreciate the number of compliments we receive for our stand displays. When was the website launched and how does it support the business? We launched our website more than five years ago, and aside from trade shows, this is how the vast majority of our orders come in. It’s been a huge success from day one, particularly as we do not operate a team of agents or representatives. Generally, we offer next-day delivery on any web orders submitted before 1pm, and the website is fully stock-controlled. This is something we insisted on from the beginning to ensure that customers can see exactly what’s available. That way, they get what they pay for and have the option of selecting an alternative style when something is unavailable. Another excellent feature is the option to be notified when an out-of-stock item becomes available again. Customers can simply hit the relevant notification request button for any item, and as soon as it’s back in stock they will receive an automatic email notification. What have been the key milestones in the business? Obviously the launch of the Suzie Blue brand was a key starting point. Prior to that we were already importing jewellery, but this gave us an identity that we’ve built upon for the past 10 years. As with any small growing business, there are numerous milestones and turning points along the road. But 2014 has seen a couple of really important developments. Firstly, we moved to our new showroom. We were fortunate to find a fantastic converted barn in the heart of Newark, right next to the river, which is perfect for Suzie Blue. The showroom has been designed to offer the same buying experience as a trade show, with the full collection available to view. But unlike a trade show, you can take the stock away with you, get a 10 per cent discount for visiting us in person and complimentary tea and coffee! How do you view the current market and what trends, both in product and in business, do you see emerging over the coming months? After a few challenging years for retailers, I think most people would agree that 2014 has seen an upturn and a return to positivity. Certainly Suzie Blue has had a good year, with sales up and increasingly optimistic reports from our customers. There’s been much talk of the death of the high street in recent years. Retail is changing and businesses are having to adapt, but I think it’s easy to overstate this, and one only has to walk around Newarkon-Trent to see a buoyant and vibrant high street with some great independent boutiques and gift shops. The growth in internet businesses has certainly had an effect on the market, with an increasing number of online shops contacting the company to enquire about becoming new customers. The important thing for us in this regard is that we don’t offer Suzie Blue jewellery directly to the public online. We have no retail arm to our website, which is strictly trade-only, and therefore we don’t compete with our customers who chose to sell online, whether as part of their shop-based business or as an online boutique. What are your future plans for Suzie Blue as a brand? In short, to continue what we‘re already doing and to grow as a brand and as a business. The addition of scarves has been a really positive step over the past year, and our 100 per cent cotton scarf designs have been developed to sit alongside our new range of costume jewellery for spring/ summer 2015. This is an area where we will now look to grow, and hopefully we can become known for scarves in the same way that people now recognise the Suzie Blue brand for jewellery. A Contact Suzie Blue +44 (0)1636 704 042 www.suziebluejewellery.co.uk ATTIRE 97 01322 380 480 [email protected] www.michaelsbridalfabrics.co.uk 1MGLEIP´W&VMHEP*EFVMGWEVIRS[EFPIXSSJJIVXLI%YXYQR;MRXIVVERKI SJ6EQSR7ERXEIYPEVME´WFYXXSRWERHEGGIWWSVMIW8LIMV[MHIVERKIMRGPYHIW QSXLIVSJTIEVPFYXXSRW7[EVSZWOMFYXXSRWERHEGGIWWSVMIWEW[IPPEWQER] SXLIVREXYVEPQEXIVMEPW 7LS[(EXIW 4VIQMIV:MWMSR%GGIWWSVMIWXLXL*IFVYEV] 8I\XMPI*SVYQXLXL1EVGL 0SRHSR&VMHEP7LS[XLXL1EVGL TRAVEL ACCESSORIES Precious cargo From make-up bags to heavy-duty luggage, we’ve chosen our pick of the best travel accessories available to retailers in 2015 Troop London www.trooplondon.com The Troop brand was established in 2004 with one key aim – to create lasting travel pieces from fabrics that should go on to become not just a style statement, but a cornerstone of their owners’ lives. Founded in London, the range was designed to meet the needs of a multitude of lifestyles, from the urban crusader to the global traveller. Using natural fabrics such as cotton canvas and Italian leathers, the brand’s designs feature simple, clean and sophisticated details. Available in a timeless colour palette of charcoal black, classic khaki and rustic browns, the bags’ natural washes are complemented by distressed gunmetal and antique-finish fittings and hardware, adding to the character of the collection. Comprising high-quality materials and skilled craftsmanship, Troop London’s travel accessories are built to last. Caribee www.caribee-uk.com Shruti Designs www.junction18.com Shruti’s textile-based accessories extend from scarves, rucksacks and clutches to include this fun and fashion-led range of men’s and women’s toiletry and make-up bags by up-and-coming designer Casey Rogers. With designs featuring playful, illustrated motifs, they make an ideal add-on line alongside luggage ranges in-store. The latest additions to luggage label Caribee’s line are the Stratosphere 75 and Drag Bag. Weighing less than three kg, the Stratosphere 75 is a lightweight hybrid travel bag comprising the latest aluminium frame structure and feather-light trolley. The result is a quality piece with ample packing space and a convenient concealable harness – a bag that’s sure to arrive at its destination in one piece, no matter how bumpy the journey is. Meanwhile, the Drag Bag is designed for moving large loads quickly and easily. Providing 130 litres of capacity, its heavy duty, reinforced construction will ensure that your cargo is safe, while in-line skate wheels aid swift, stress-free transportation. Caribee, along with Secrid Wallets and Vaude, is distributed in the UK by Brand Agility. To find out more about the brand, email Jacquie Sanderson at [email protected]. ATTIRE 99 · RedDog Designs www.reddogbags.com RedDog Designs’ Voyage BagPod – available in leather or nylon in an array of hues – is designed to keep all its owner’s essentials together while they’re on the go, whether it’s day-to-day commuting or globetrotting. With four slip pockets and a large zip pocket in its interior, it keeps valuables such as purses and wallets safe and out of sight. Meanwhile, its two external high slip pockets and large external zipped pocket are ideal for iPad Minis, Kindles and notebooks. There are leather hoops on each side for attaching keys or adding straps to make it a bag in its own right. Available in two sizes, it’s a handy travel extra for both short and long-haul situations. Abbey Oak [email protected] Founded in 1994 by leatherware industry veteran, John Dawson, Abbey Oak specialises in small leathergoods with a collection of men’s wallets, ladies’ purses, credit card holders, key cases, spectacle cases and assorted sundries making up its exquisitely made ranges. The company also offers products from Katana. A French leather goods label based in Paris, Katana is highly regarded throughout Europe as a supplier of crafted products. The pieces are made using Italian vegetable-tanned leather hides, which are finished by hand polishing to gives the leather’s surface a rich shine and texture. 100 ATTIRE Lamb 1887 www.lamb1887.com Lamb 1887’s Duchess make-up and wash bags add a touch of sophistication to a female consumer’s luggage collection. Made from leather and lined with luxe jacquard fabric, the pieces all feature the label’s classic lamb emblem. Combining of-the-moment colour block pattern with timeless blackand-burgundy and black-and-tan options, these designs are both functional and chic. The brand also offers an envelope tablet clutch made to fit the dimensions of tablet and iPad devices. Made with snakeskin-print cows’ leather and a suede leather lining, the case is completed with gold metal edging. Theses elegant extras will complement other high-end travel collections in-store. SECRID WALLETS Brought to you exclusively in the UK by Brand Agility Ltd. For more details call or email Jacquie Sandison on 0131 554 5555 or [email protected] :LJYPK>HSSL[Z 9-0+ZHML Abbey Oak Accessories specialists in small leathergoods Mens Wallets | Ladies Purses | Credit Card Holders | Key Cases | Spectacle Cases | Katana Bags Abbey Oak Leather is a family-run company in Hampshire UK. Founded in 1994 by John Dawson after having been in the leathergoods trade since 1970. Abbey Oak now specialises in small leathergoods with a collection of mens wallets, ladies purses, credit card holders, key cases, spectacle cases and assorted sundries. Suppliers of: Waxy Hide Leather, Soft Hide Leather, Katana (Paris) and Vitali (London). Abbey Oak Cottage, Wherwell, Andover, Hampshire, SP11 7HY | 01264 860804 | 07786 705040 | [email protected] Come and see our exciting new collection at AIS/INDX 21-23rd April - Platinum Suite Bags & Jewellery www.nadiaminkoff.com +44(0) 208 202 1099 SCOOP INTERNATIONAL In the SCOOP A sneak peek at what to expect from the high-end London-based lifestyle trade event IN BRIEF Show: Scoop International Venues: Saatchi and Phillips Galleries, London Dates: 1st - 3rd February, 2015 Twitter: @ScoopLondonShow Launched in February 2011 by fashion industry expert Karen Radley, Scoop International is the must-visit show for contemporary premium designer collections. Its first eight seasons have been a phenomenal success, and with its ninth edition this February featuring autumn/winter 2015 collections, expect to see a wealth of established labels as well as pioneering collections from emerging designers. Taking place in London’s cultural epicentre, Scoop attracts leading industry exhibitors from all around the globe. This season Scoop represents the best in contemporary womenswear and accessories, with exhibitors including Cameo, Madeleine Thompson, Sam & Lavi, Parka London, Beaumont Organic, J Lindberg and many, many more. Karen Radley comments, “Scoop International’s more than a fashion trade show, it’s a meeting place for the industry, a trend watching opportunity and platform for up and coming designers as well as more recognisable labels. It offers buyers and visitors alike the chance to view selected and edited collections that offer something fresh and original over three days. Scoop’s layout is easy to navigate, the show’s well served by public transport and most importantly, it has an excellent mix of collections, including ready to wear, accessories, shoes, bags and perfumes.” An array of pre-eminent names return to Scoop, such as British knitwear enterprise, Cocoa Cashmere; Goat, another premier UK-based cashmere label; Sargossa, a chic shoe brand, and the cool Italian designer clothing company Transit. Meanwhile, newcomers to the show include Italian company Kyme Sunglasses, Agnelle gloves, Angelo di Spirito Rosa jewellery, British footwear label J Shoes, and Malaysian fashion designer, Bernard Chandran. For more information on the show, visit www.scoop-international.com. A ATTIRE 103 · Exhibitor profiles Tracey Neuls www.traceyneuls.com Mirabelle www.mirabellejewellery.co.uk Footwear designer and retailer, Tracey Neuls launched her eponymous label in 2000 after winning NewGen sponsorship at London Fashion Week. Straddling both the fashion and art worlds, Tracey is known for her distinctive, extraordinary and intelligent designs as well as her eclectic collaborators, including illustrators, architects and museums. Mirabelle Jewellery was established with the aim to develop a range of eco-friendly jewellery for the modern woman. Drawing on her extensive travelling experiences, founder Veronique Henry fuses Asian influences with British production to create wonderfully feminine and distinctive jewellery. Each piece is hand-made in her studio in north London, maintaining an east meets west aesthetic. Veronique’s eastern influences are evident in the collections, with the vibrant use of semi precious stones and religious references, such as Buddha and the hand of Fatima. With a strong belief in the power of jewellery to uplift the spirits, her pieces are enhanced with symbolism and meaning, from crystal stones to ancient talismans. Becksöndergaard www.becksondergaard.com Sharing a strong passion for fashion and entrepreneurship, Lis Beck and Anna Søndergaard founded the Danish accessory brand, Becksöndergaard in 2003. Combining the duo’s mutual love for colours and Scandinavian simplicity, the company creates stylish accessories with a playful twist. A playful tonal palette, original handdrawn prints, soft leather shapes and hand-made designs in eelskin leather have become the signature of the brand. 104 ATTIRE J Shoes www.jshoesonline.co.uk J Shoes is a label that aims to create shoes with as much personality as the people who wear them. Each shoe is meticulously designed and engineered in a process celebrating the quality and individuality of hand-crafted products while reflecting an expression of true character and originality into each pair. Spring/ summer 2015 sees the introduction of new styles across both the men’s and women’s ranges, including driving shoes, high-top sneakers, cut-out brogues and mules. The brand’s popular signature collection of smart brogues and summer boots for both men and women will continue to run alongside its latest designs. S SP CO RI TT St NG IS an H d FA F4 IR 6 Hazel Atkinson Jeweller y Jewellery to give, to love, to treasure. [email protected] www.lilycharmed.com Handmade In The UK tel 0115 9411110 www.hazelatkinsonjewellery.co.uk Sc o Sp tla S h rin nd o g Tra w Fa d ir e i n - S Fa g ta ir - a nd S t 18 tan D d1 Q 4 38 4 Beautiful sterling silver and gold vermeil charm jewellery, presented with unique message cards to share the meaning behind the gift. SCOTLAND’S TRADE FAIR SPRING Highland fling Find out all the latest about Scotland’s most important spring trade show IN BRIEF Show: Scotland’s Trade Fair Spring Venue: SECC, Glasgow Dates: 18th - 20th January, 2015 Website: www.scotlandstradefairs.co.uk Twitter: @ScotTradeFair For more than 30 years, Scotland’s Trade Fairs have been the primary marketplace for Scottish retail buyers and suppliers to meet and conduct business. Some 5,000 buyers from department stores, multiples, mail order and online, tourist attractions and independent retail outlets will visit the show over three days. It’s also the ideal destination for buyers from all over the world wishing to source Scottish-made and Scottish-themed products. Scotland’s Trade Fair Spring will offer a huge selection of giftware, ranging from design-led products to volume gift Miss Shorthair Chris Lewis collections from more than 450 Scottish, UK and continental ranges. The spring show runs in conjunction with Scotland’s Speciality Food Show, so whether you’re looking for clothing, jewellery, home accessories, stationery, general giftware or food products, the spring edition’s Scotland’s most comprehensive buying opportunity for the season ahead. As one of the first shows in the New Year, it’s the ideal place to source the latest designs launched for the 2015 season and discover what talent lies in Scotland. Some major British exhibitors also take part in the show, keen to get a slice of the thriving northern market. Newcomers to the show for 2015 include Hawick Knitwear, Abraham Moon woollens, Churchill China, Bomb Cosmetics, Lucy Donnell knitted pieces, PellMell’s Scottish bags, Kit Heath and Kali Ma’s wholesale silver jewellery. Central to the show is the Launch Gallery for young, innovative companies under two years old. This area is positioned right down the centre of the hall. Here, artisan companies are given extra marketing support and the next show includes some stunning newcomers such as Badger & Baird’s silver jewellery, Braw’s homewares and Dwelling Bird’s soft furnishings. Companies are chosen for their original ideas, commercial appeal and the design of their products. Complementing the newcomers to the show will be many favourites such as Portmerion China, Sea Gems, McConnell woollen mills, Tartan Twist’s original jewellery, Eribe’s Scottish woollen accessories and Samantha Holmes’ alpaca knitwear designs. The show will also have a newly designated area for the large group of Orkney Isles-based exhibitors, including names such as Sheila Fleet, the newly relaunched Ortak company, Quernstone knitwear, Fursbeck Pottery and Hume Sweet Hume. The Best Product Awards will be presented on the opening day for various categories judged by industry experts. The Seminar Theatre has grown in recent years and the 2015 show will include talks about social media and retailing, trend forecasting, e-commerce and web sales, and setting up a business, all by renowned industry experts. For more details or to register for free entry, visit the new website www.scotlandstradefairs.co.uk. A ATTIRE 107 In the spotlight Fullspot UK’s Sales Manager, Suzanne Johnson talks to us about the Italian accessories label’s colourful, distinctive approach and how this has led to its global success Tell me a bit about how the label was started. Two school friends with an original and distinctive aesthetic vision started Fullspot in Italy in 2009. Today, it’s a dynamic lifestyle label offering diverse, colourful designs to a worldwide audience. What was the aim of the label when it was first established? It was to develop a characteristic, quirky brand offering well designed Italian products, which stand out, at affordable prices for everyone. This is an ethos that the Fullspot label hasn’t veered from in the past five years. How were the initial products developed, and what was the market’s response? All of the company’s products were ‒ and still are ‒ developed and tested in Italy. The response was overwhelming, so much so that a business plan and international campaign was formulated. What challenges were overcome when the company was starting out? Due to the singular properties of the raw material and the high quality required by Fullspot, there were some challenges in the 108 ATTIRE early stages in terms of finding the right machinery and identifying the correct manufacturing process necessary to pull off the desired finish. The process required modifications to the standard machinery available on the market. What sets you apart from your industry competitors? There’s no other brand or collection that’s so original or has so many combinations to suit every customer’s individual look or mood across an entire bag and watch range. The O Clock and O Bag lines’ pieces allow the customer to completely customise and evolve their look over time. Also, with a great variety of price points across the brand, Fullspot offers consumers an accessible method of personalisation. How important is the location and history of the company to its success? Vitally important. Fullspot’s ‘Made in Italy’ stamp is at the core of its history and branding. All products are developed and finished in Italy, a country renowned for its excellent design credentials. How has the Fullspot offering changed over the years and how would you describe the company’s current collection? Fullspot launched with the O Clock, and then the O Bag was the next range to drop. Following on from the success of the two initial lines, there are now style variations of the O Bag ‒ including O Pocket and O Basket, as well as Fullspot sunglasses and flower bracelets. There are always fresh products being launched, with colour and PROFILE pattern updates available seasonally. New shades are offered twice yearly, with novel pieces each launched season as the range gets stronger. The current collection highlights the autumnal tones of autumn/winter 2014: brick, mustard, English green and volcano. There are new trims available for all O Bag sizes, including faux fur and quilted trims. New patterned and textured canvas inners and straps are also now available, again highlighting the look of this season, including gold, silver and flat leather handles with a buckle trim. Within the watch range, there are all-new strap and dial colours, and fresh collections including an expanded colour palette in the Numbers and Crystal lines. The O Basket, which is similar in style to a bucket bag and is a completely new shape for Fullspot, has just been launched. How often do you launch new lines? Fresh collections are unveiled twice yearly in line with the fashion calendar, although there are also several “flash” limited edition items available throughout the year. What are the current best-selling designs? Tell me about Fullspot’s recent campaigns. The best-selling designs are the O Bag in classic hues such as rock, sand and black, and in bright colours such as ruby red and signal blue, with classic long leather handles. This winter season, faux fur and knitted woollen trims have been selling fast. Within the O Clock collection, the Classic and Numbers ranges are continually strong. The Safari designs, with fun animal print dials, and the ’80s selection’s bright primary shades have sold well this summer, along with the classic Tone on Tone line. In the run up to Christmas, the Crystal collection ‒ complete with diamanté stones ‒ and the Disney designs were selling well as gift ideas. We’re looking forward to the launch of the newest range of O Clocks, which will include the seconds hand, and the O Folder bag, which is big enough to hold a laptop. Which trade shows do you attend and which one works best for you? Fullspot has a big marketing plan in place for 2015, and we’re looking forward to attending several international trade shows. Successful trade shows for the brand in the past have included Maison & Objet in Paris and the New York International Gift Fair. ATTIRE 109 · With so much competition around, the market’s tough, but Fullspot’s originality and distinctive designs have kept development strong in new markets and new countries, based on people seeing the products’ performance in Europe. With an understanding that its pieces need to start fashion movements and stand out from the crowd, the label aims to give its customers greater freedom in expressing themselves sartorially and accessorise in a distinctive, constantly changing way. Fullspot accessories are customisable and can be bought to mix and match with the customer’s outfit, preference or mood of the day, while complementing the ephemeral trends of the moment. When was the website launched and how does it support the business? The label’s website was launched in 2012 and it really supports the business. There are two UK platforms available, a businessto-business site and a consumer one, with new products and stock levels being uploaded daily. There are also constant product and company news updates, details of new store openings and coverage of the company’s worldwide events. What are the future plans for Fullspot as a brand? The plan for Fullspot’s future is to grow and develop the business, while increasing its high street presence with more store openings and franchises worldwide, and building a stronger platform in the UK. The typical customer is looking for individuality and character in their accessories, this is the company’s core principle, and what it’ll continue to develop from. A What have been the key milestones in the business? Key milestones have been continual, what with franchisees and store openings. Fullspot has moved from starting and growing in Italy to supplying products worldwide – working closely with distributors and enthusiastic entrepreneurs, product development and recognition, and successfully moving the head office and factory to larger premises. How do you view the current market and what trends, both in product and in business, do you see emerging over the coming months? 110 ATTIRE Contact Fullspot UK +44 (0)845 519 6161 www.fullspot.uk.com Shape up your boots and bags with these perfect care products These inflatable shapers provide an innovative and simple solution to help protect your boots and bags from creasing, losing shape and falling over. Once inflated, the shapers adjust to the shape of your boots and bags providing the necessary support, while avoiding creasing and folds. BRAND NEW for 2015 BOOT & BAG SHAPERS SIZE SIZE small - medium 24 x 34cm approx RRP £14.99 38cm / 15 inches RRP £10.99 SIZE medium - large 32 x 45cm approx RRP £16.99 Both products can be personalised! Personalisation available for larger orders, contact us for details. LIKE WHAT YOU SEE? Visit www.loveitbagit.com or email: [email protected] TORQUAY LEATHER & ACCESSORIES LONDON FASHIONSHOW WEEK Ryan Lo spring/summer 2015 Photograph: Daniel Sims Front row and centre The world’s fashion elite return to London, the home of up-and-coming designers ATTIRE 113 · One step ahead This February sees the sartorial spotlight return to the capital for London Fashion Week In brief Show: London Fashion Week Venue: Somerset House, London Dates: 20th - 24th February, 2015 Website: www.londonfashionweek.com Twitter: @LondonFashionWk The provisional schedule for February’s London Fashion Week has been announced, with a host of fresh names to watch out for in autumn/winter 2015. To maintain its reputation as a career-starting world stage, the UK capital is constantly reinforcing its international credibility as a venue for up-and-coming designers to make their mark on the industry, as well as being the home of well-established heritage brands, such as Burberry Prorsum, Mulberry and Daks. NEWGEN showcases the best emerging British-based fashion talent and is central to the British Fashion Council’s talent identification, designer development and showcasing programme. Recent 114 ATTIRE Marques’Almeida spring/summer 2015 Photograph: Shaun James Cox alumni include Mary Katrantzou, Erdem, Roksanda Ilincic and JW Anderson. The scheme has become a key draw for the international fashion media and buyers attending London Fashion Week. Established in 1993, it’s the world’s most globally recognised fashion talent identification scheme, which offers catwalk designers financial support towards their show costs and an opportunity to use the BFC Catwalk Show Space during London Fashion Week. Others receive a sponsored presentation or exhibition space to showcase their collections, offering emerging UK-based talent an important introduction to influential press and buyers from around the world. NEWGEN also provides business and mentoring support through the BFC in partnership with Shoosmiths, Baker Tilly and Lloyds TSB. The fledgling designers receiving catwalk sponsorship for the forthcoming season include 1205, Ashley Williams, Marques’Almeida and Ryan Lo, while Claire Barrow, Danielle Romeril, Faustine Steinmetz and Molly Goddard have been given presentation sponsorship. Meanwhile, Marta Jakubowski and Sadie Williams have been awarded exhibition sponsorship. Sarah Mower MBE, BFC Ambassador for Emerging Talent and chair of the NEWGEN selection committee, commented: “For the committee, it’s endlessly rewarding and thrilling to be able to see the trajectory of growth of our designers, from maybe occupying one rail as newcomers to selling to the world. Everyone knows this scheme, with all its benefits, can set them on the same road as Christopher Kane, Nicholas Kirkwood, Mary Katrantzou or JW Anderson ‒ in other words, to be top names in international fashion. I would like to thank Sir Philip Green for paving this astonishing British path to the top ‒ Topshop’s continued sponsorship and support really is held in awe by many nations.” Mary Homer, Managing Director of Topshop, said: “Topshop is incredibly proud of its support of NEWGEN, and it’s a testament to the success of the platform that such strong talent comes through every season. The company is committed to ensuring that we continue to help, develop and nurture young British designers.” A number of luxe accessories labels are also returning to Somerset House’s showroom spaces, including footwear designer Havva, scarf brand Cleo Ferin Mercury, and quirky ’80s-inspired accessories label Eshvi. Names that are set to make a debut at the exhibition in February include jeweller BAM-B, shoe designer Alex White and bespoke bag brand Williams. For more information about the designers exhibiting, the updated catwalk schedule and to register for exhibition access, visit www.londonfashionweek.com. A SPRING/SUMMER 2015 Spring Fair | 1-5th February 2015 | Stand 20M41 NEC Birmingham B40 1NT Pure | 8-10th February 2015 | Stand T252 Gallery Olympia W14 8UX M Golunski & Co Ltd Tel: 01384 78326 Email: [email protected] Web: www.golunski.co.uk Importers, Exporters and Wholesalers of the latest Fashion Jewellery, Scarves and Bridal Accessories Minimum order £100 (excl VAT) All orders placed online will be carriage paid (UK Mainland Only) Telephone: 07894 963402 Email: [email protected] ORDER ONLINE TODAY AT www.accessoriesworld.co.uk RETAIL TECHNOLOGY Taming the big bad Penguin David Fairhurst, Head of Creative Online marketing at Intelligent Retail, discusses how to protect and get the most out of your website If you’ve been an online retailer for many years then you’ll have become very aware of one hard and fast fact: Google can be a fickle friend – one who sometimes acts like your worst enemy, has a stroppy temper, is blighted with bouts of megalomania and changes his mind on a regular basis. You’ll also realise that this friend, whilst being a nightmare to live with, sometimes (when not pushed by corporate and shareholder agendas) means well. Which brings me neatly round to Google algorithm changes and the recent updates to Google Penguin and Panda, codenames for parts of Google’s ranking algorithm dealing with low quality links and low quality (or ‘thin’) content pages. For many years, Google has struggled to show quality search results against the tide of web spam and link spam, which is ironic as both of these types of online spam have been created as a direct result of flaws in Google’s own ranking algorithms. By putting focus on external links as the main ranking factor, for instance, Google created the opportunity (some might say the requirement) for link spammers to exist and in this respect, Google has created a thriving online spam industry, one which they’re now trying desperately to topple. Google Penguin – link spam killer Google Penguin was first launched in April 2012 and has since become more and more aggressive against link spam – these are links from pages specifically crafted to give additional ‘votes of confidence’ to the pages that they’re linked to in order to lift the rankings of that linked-to web page. Entire companies have sprung up over the past couple of decades, specialising in giving clients thousands of links from low quality, spammy websites to boost rankings in Google’s search results. For quite a number of years this technique worked very well, with Google unable to cope with the linking signals it was getting from all of this spam. Since Penguin, all of that started to change, with obviously spammy links finally being weeded out and sometimes, entire link networks being totally removed from search results. Over the summer of 2014, the web spam team at Google were handing out manual penalties to those who were deemed to be going against published ‘terms and conditions of use’ for Google search, with notices displayed in Google Webmaster Tools accounts stating the full reason for the penalty. The trouble with this is of course, only Google decides what kinds of links are against their terms and conditions and this definition certainly isn’t what you could call a hard and fast rule – previously safe and high quality techniques like guest blogging to gain links being the latest in a long list of things which Google doesn’t appear to like or accept anymore. The different spam signals employed in these manual signals have now (it’s thought) been rolled out into the latest iteration of Google Penguin, dubbed Penguin 3.0. This means Google can now algorithmically penalise for the following rule infringements: • Use of exact match anchor text. These are pieces of text used to link to another page on the web with the same text as the title of the page they are linking to, so linking the words for instance ‘Wrangler jeans’ to a page all about ‘Wrangler jeans’. • Use of links in bylines on blog posts. This is the use of commercial links in blog and forum bylines, which Google say should only be used for information about the author of the post. • Use of site-wide external links. Many web design companies, for instance, put a link in the footer of every website they design, back to their own corporate website homepage. Google’s previously been OK with this, now they’re not. • Use of links from off-topic websites. This means it’s no longer a matter of getting a link from another website to one of your pages, it has to be from a site which is talking about roughly the same topic that your page is about. Which is slightly bonkers if you think about it, especially for news websites, which link to many different types of websites! • Any other link that Google deems ‘manipulative’, in particular links from blogs or websites that don’t show clear quality signals and are off-topic. So you can see, Google really does intend to kill off aggressive link building for good; some say any kind of links which aren’t earned organically are the ultimate target. ATTIRE 117 · Going old-school If you really want to protect your business website going forward, then you need to go old-school, abandon mass link building and concentrate on content within your own website. This requires a solid content strategy, thinking carefully what your actual website visitors are likely to need from your website. A good place to start is to look at Google’s own webmaster guidelines, this lays out a set of things you should be doing and many references to things you definitely shouldn’t, see: goo.gl/Eo55U Think about generating interest and increasing link-worthiness, not creating links – this means creating resources for real people, not search engine robots. Create help guides, interesting articles, even things like interviews with artists, user guides and video reviews of products can help get your website noticed and linked to naturally. Utilise social media to tell people about your content, this way you’re not link-building directly, you’re getting others to do it for you in a natural way which Google should never have a reason to penalise. Reviews and customer reassurance Just as important as your content strategy is the use of customer reassurance for when people get to your website, one good way to do this is website reviews. On your website, you have just one chance to hook a customer, so as well as a set of good quality product images and a top quality, well written description you really should be using product and website reviews. These reassure the potential purchaser that you’re a good company to deal with and the product they’re interested in is the right one for them – remember, selling online isn’t like selling in a bricksand-mortar store as it’s very easy to dip in and out of different shops selling the same thing online. If you intend to increase sales on your website, you really have to differentiate yourself from your competitors and make it as safe and easy as possible to buy from your online store. Social sharing Ever since social media platforms like Facebook, Twitter, Google+ and many others started to gain such large global usage, the owners of these platforms have been developing mechanisms to allow sharing of content. Many of these mechanisms now exist, however Google favours OpenGraph and Schema, Google’s own (and preferred) solution to structured data tagging in websites. These mechanisms allow tagging of content so that they’re easily crawlable by search engine spiders, easily indexable and easily shared by social media platforms. If your website doesn’t currently use structured data, it’s probably time to ask your web developer to add these or think about building a new website with the latest features. Your website community You’d think that if you’ve got an e-commerce website then you sell and nothing else. Nothing could be further from the truth. What online shoppers really want from your website is trust, a feeling of connection and community, after all if someone wants to buy something and nothing else then they’ll probably gravitate to auction sites like eBay and Amazon. I work with a lot of very successful online traders and the same elements appear in all of these online sites – they’re either highly price driven (and use online and offline marketing extremely well) or they engender a sense of community through the provision of free information for potential clients. This intelligent use of content on e-commerce sites is the real way to drive organic linking and drives repeat custom, which means the baseline of customers coming to the site increases over time, driving revenue increases. If you want to fit in with Google’s fickle nature then, remember… content is king! A David Fairhurst is Head of Creative Online Marketing at Intelligent Retail. David has been involved with search engine optimisation and web development since 1999 and has spoken at many different retail and SEO conferences including Spring Fair and SES London. Contact David on +44 (0)845 680 0126. 118 ATTIRE at 49 s M tu A d si D n Vi MO Sta 9, l1 al H SCARVES | JEWELLERY | FASCINATORS | OCCASION BAGS See us at Scoop! www.mirabellejewellery.co.uk W H Hunt Ltd is a long established company founded in 1895 with a solid and loyal customer base. We constantly work to improve our customer service and to enhance our range of fashion accessories. Going forward we will be offering even more fashionable and saleable ranges of fashion jewellery, scarves, purses, occasion bags and fascinators. Our agents throughout the United Kingdom and Ireland visit customers on a regular basis. We also exhibit at the Moda shows for both Spring and Autumn. 0114 269 5745 | [email protected] | www.whhunt.co.uk Elizabeth Dickens +44 1353 723675 email: [email protected] web: elizabethdickensveils.co.uk RETAILER INTERVIEW All in good time Nicola Donnelly invites us into her new Dundee shop, Time Lifestyle Boutique, to talk childhood shopkeeper dreams and becoming part of the city’s independent, design-conscious scene Cinderela B What was your career background before opening the boutique? For the past eight years, I worked in marketing and communications for a local university. Before that, I’d worked in retail – at Debenhams and Jenners, a family-owned department store – while studying at the University of Edinburgh, and had really enjoyed the experience. What prompted you to launch the business? My dream when I was little was to have my own shop. Initially the fantasy was a sweetie shop, and then as I got older, it became a bookshop. I started thinking about it more seriously in the last year, and in April, I decided handing in my notice at the university was the only way to make me focus on this dream. I was newly married and my husband and I thought it was our ‘now or never’ moment. I knew I wanted to run my own business and be doing something much more creative. How did you decide on the concept of the shop, with the premises and location for your store? The shop’s inspired by lifestyle stores I’ve visited in London like Oliver Bonas, White Company and Anthropologie. I also loved the quirky yet luxurious heritage feel of Liberty. While there’s a strong artisan community here in Dundee, it’s not reflected by the number of independents selling design-led and luxury products. It was recently made a UNESCO City of Design, so we have very strong design credentials here. I want to be part of the independent scene that visitors to the city will look for, as well as provide a shopping experience for our design-conscious residents. Choosing the right premises was definitely the hard part – I eventually found the right place at the right price in July, 2014 and opened in August. The street we’re on is definitely up-and-coming. A new pizza restaurant is opening soon and there’s already a designer clothes boutique and gentlemen’s outfitter nearby. What accessory lines to you offer and how do these support the rest of Time Lifestyle Boutique’s product offering? Many of the brands I stock were suggested by local people during my market research. During this period, I discovered the lovely Karen Mabon, who designs beautiful, luxurious scarves – we’ve since hosted a popup shop for her, which was great fun. I also stock local jewellers Jane Gowans, Sheila Roussel and Genna Delaney. Dundee’s a real hub for jewellery and metal design, so much so that it recently hosted Scottish Jewellery Week. It’s great to stock local names to reflect this growing craft reputation. As well as the regional brands, I stock national jewellery labels, like Pearl & Queenie and Cinderela B. These brands offer pretty, distinctive pieces at very fair prices. Customers come to my shop looking for accessories to give as gifts as well as for themselves, and I stock Yoshi, which offers great quality leatherwork, classic styles and a fantastic range of colours all at a great price point for the customers. Its leather and tweed satchels and quirky coin purses have been most popular. I also sell Powder scarves, which my customers just adore. They use a lovely palette of colours and the ladylike woollen gloves are just flying off the shelves this season. How would you describe the presentation of the shop? I like to keep the layout and fixtures very simple. As Time is a very recent start-up, the design was done on a tight budget and I just wanted to focus on the products while keeping the store neutral, but with a contemporary feel. The shop’s very airy and open with lots of items at touching height. I like customers to be able to interact with the products. What do you consider to be your core customer base? The boutique’s situated on a busy shopping street in the centre of town, so lots of people pop in on their travels. My initial target was Genna Designs ATTIRE 121 · Jane Gowans for early-to-mid-career professionals with a reasonable disposable income, but I’ve actually found that my clientele often comes from an older demographic. Most of our visitors are looking for unusual products that offer good value, but more importantly, are of a high quality. What are the key factors you consider when sourcing new product lines? First and foremost, I’m looking for good production quality in any collections that I’d potentially order. Then I’m interested in the design aesthetics and price-point. Now that we’ve been open a few months, I can gauge what’s been popular and what pieces certain types of customer prefer. Good packaging and a strong brand are also really important for marketing and display in store. How important is product knowledge and customer service in store? I find customers do a lot of research and are very informed about their choices. I talk a lot about the companies I buy from and the materials they use, and take time to talk to the brands’ representatives and makers about the products I’m stocking. I feel customer service is an area where independent shops can really shine. We can spend time with browsers and help them find exactly the right product – especially when helping select a gift. Good service is not only important for word-of-mouth reputation in the city, but also returning customers and repeat sales. I’ve started a loyalty scheme, which is very popular with regulars. How important is an online presence to your plans for the business? Now that my store is open and sales are coming through, my next big challenge is my online presence. I want to use the inevitable quiet spell at the beginning of the year to do research and create content. I’d love to bring the Time brand to a wider audience and target stay-at-home shoppers. 122 ATTIRE Do you run any special events to attract new customers? Events have been a key part of my awareness-raising marketing campaign. My first event was the pop-up shop with Karen Mabon. I asked Karen to do this event on the same day as the Scot Street Style – an initiative for Scottish creatives – held their gathering in Dundee, as I knew there would be a suitable audience in the city. The marketing involved in promoting that event definitely helped me reach an important set of customers. I don’t have room in the store to stock all the local artists I’d like to, so I set up a series of Christmas pop-up shops. In the lead-up to Christmas I hosted 14 pop-ups on Thursday evenings and Saturday afternoons. As well as bringing in new customers, these events allowed me to network with creative people and come up with some great collaborations for the year ahead. Who would be your ideal customer for the boutique, and why? Alexa Chung. She’s aware of trends, but not a slave to them – often starting a few of her own. She recognises quality but has a quirky sense of style. What has been your proudest moment since opening the shop? I’ve not really had much of a chance to sit and think about it – it’s all been a bit of a whirlwind really. Having the courage to pursue this venture has made me very proud. Most of all, I just feel happy opening the door in the morning and greeting my first customer of the day. How do you view the current state of the fashion and gift retail market? Having little experience of running a business I have very little to compare it to so far. I think people are very conscious of what they’re spending and want to make sure they get good value. Customers are still buying gifts, but perhaps being more cautious about treating themselves. Dundee’s in a very good position for the future though, and I’m optimistic that the cultural growth of the city will lead to economic growth and attract even more businesses and visitors. What advice would you pass onto other independent retailers? Events are crucial for raising the profile of a new business. I’d also say to retailers, talk to customers as much as they can. Find out why they’re buying or not buying an item. Find out about favourite colours and local micro-trends. Ask what their budget is for particular gifts and use that knowledge to select and buy appropriate products for your store and merchandise. What are your plans for Time Lifestyle Boutique going forward? I want to continue attracting new customers to the store, as well as retaining the regulars who’ve visited again and again in the first few months. I have a few ideas for collaborations with designers that’ll be exclusive to the store, which should further develop the Time Lifestyle Boutique identity and design credentials. Most of all, I want the shop to build on its interaction with the local community and be part of the tremendous push to create a thriving retail sector in Dundee. A Yoshi Contact Time Lifestyle Boutique +44 (0)1382 223 499 www.time-boutique.com Edison Shoes Ltd MSRT-12056 TAN £14.99 MSRT-15995-TAN £13.99 MSRT-16651-TAN £14.99 MSRT-17063-BLK £13.99 MSRT-17807-TAN £14.99 MSRT-17924-BLK £14.99 MSRT-18155-TAN £17.99 MSRT-18241-TAN £18.99 MSRT-18373-TAN £14.65 MSRT-18400-NVY £13.99 MSRT-052622-TAN £15.99 MSRT-052908-TAN £13.99 MSRT-052909-BRN £13.99 MSRT-052960-TAN £13.99 MSRT-053907-BLK £16.99 MSRT-054005-BEG £14.65 Real cow leather shoes available to dispatch imediately for enquiries please contact: EDISON SHOES LTD Unit 2 Marlin Park, Central Way, Feltham, Middlesex, United Kingdom TW14 0AN Email: [email protected] Tel: +44 (0)208 844 8201 Q&A All the answers OUR EXPERTS TACKLE YOUR RETAIL-RELATED QUERIES Kerry Wilson is Creative Manager at Morplan. Since studying Fashion Design & Marketing at university, Kerry has spent more than 20 years working with Morplan’s marketing department to develop and promote the 5,000 plus retail products within the company’s range. She’s also worked in fashion and accessory retail and PR. Contact Kerry by calling +44 (0)1279 451 122 or email her at [email protected] Mark Wash is a Creative Director and the Co-owner of Apples to Pears Ltd and has been designing ranges including the ‘Gifts for Gardeners’ and ‘Gifts in a Tin’ for the past 13 years. Previously he was a Senior Manager and Buyer for a national garden centre group. He also runs a plant nursery specialising in South African plants and is a gold medal winner at the Royal Horticultural Society Flower Shows. Contact Mark on +44 (0)1822 834 680 or at [email protected] On display Q A I’ve got quite a small gift shop and need some sort of jewellery display for a counter-top. What would you suggest or recommend that I use? Kerry says: Adding a selection of jewellery items is a great way to boost sales for almost any kind of store. There are hundreds of display stands available that won’t take up too much space – all you have to do is consider the items you’re selling. Firstly, how much is each piece worth? Expensive jewellery (or pieces you want customers to believe are valuable) is best kept in a lockable showcase and displayed individually using leather or acrylic display stands. Make sure the prices of each item are clearly displayed so that customers don’t get any surprises. If value isn’t an issue, you need to decide if you’re using accessory cards or not. Available in lipped or euro slot formats, accessory cards allow you to display jewellery neatly and uniformly, combine items (earring and necklace Neil Coxon is the founder and Managing Director of from you to me, creator of award-winning gifts. He leads the business, growing its brand and presence in international markets. He combines this experience with his previous career as an HR Director in major corporations to answer your people-related questions. Contact Neil on +44 (0)1225 866 225 or at [email protected] sets, multi-earring sets etc) and add your company name or logo. Price details are easy to apply to the back. These cards require a different kind of stand, something with prongs or bars, and offer a highdensity display option – especially if you choose a rotating unit. If you aren’t using accessory cards then you’ll need stands with hooks or prongs for necklaces and bracelets, bars for bangles or holes for earrings and studs. There are stunning stands available in a range of finishes – pick the one that suits your brand the best. As a finishing touch, don’t forget to consider the packaging. An organza or velvet bag, a simple accessory gift box or a purpose-made jewellery box will add value and put a smile on your customers’ faces. Intelligent design Q From a designer’s perspective, what sort of features do you use when designing a new product for your gift range? Mark says: When consumers are shopping Lindsey Straughton is Manager of PR, Marketing and Exports at the British Jewellers’ Association (BJA). She coordinates the PR and marketing activities for the jewellery organisation. Contact Lindsey on +44 (0)121 237 1112 or email her at [email protected] for gifts or craft sets they make a number of sub-conscious decisions in the buying process. When designing a new packaged gift product I try to take as many of these considerations on board. A 1. Impact. Does the gift stand out of the shelf ? The old adage goes that you have just a few seconds to grab the attention of a customer so I always try to develop items with real ‘shelf-appeal’. 2. What does it do? You’d be amazed how many gift items are out there where you have to guess their purpose. The function of the gift has to be clear and obvious, either through words and/or pictures on the packaging or labelling. Sometimes being just a little too clever with words can backfire so considering the best name for a new product is a serious issue. 3.Value for money. Possibly one of the key decisions points when buying a gift. I feel that most consumers shop with a price in ATTIRE 125 · & QA mind and volume sales happen if you can offer a product to meet key price-points. Generally we probably all spend a little less on individual gifts than in the boom years gone by so it’s vital to offer products at the right price. 4. Fit for purpose. How many products have you purchased that don’t work in the way you wanted them to? For me it’s most important that the product works and we spend time and money making sure that prototypes are tried out by test customers before they are offered for sale. 5. Clear instructions. I feel that good pictures or illustrations are vital in instructions, supported by clear wording. None of us want to read through page after page of monotonous text – instructions can be fun and form an integral part of the gift. 6. Packaging, product or air? A quibble I have with many boxed gifts is that many of them involve 80 per cent packaging and air and just 20 per cent product – if we’re designing a new product I like to see a full set of contents with minimal space for air and ‘fillers’. Tins are my favourite packaging material – they add a retro feel to the gift and often have an ongoing use as part of the overall gift itself, added to that is the ability to recycle and minimise wastage. 7. Easy to wrap or post? We live far and wide apart, so many gifts are sent via mail or courier to loved ones so why make things difficult? Gifts that are easy to wrap and post, get a thumbs up from consumers. Get all these points right and you’re halfway to offering a successful product. Presenting yourself I sometimes struggle to get my message 126 ATTIRE Q A across and to influence others. How can I improve the way I communicate? Neil says: I’m sure we can all relate to this, but I’m also sure that we all have times when we do influence others very well, so what’s the difference? A number of large businesses have been looking into how they influence their customers and the power of ‘story-telling’ is now well proven as a successful technique. Take one look at the John Lewis Christmas advertisement this year or the BBC Children in Need campaign. Whether you like them or agree with them is a separate point, but both will have engaged you. The chances are these stories did stir your imagination, touch your feelings and will have influenced you to do something. Did you start feeling Christmassy? Did it make you want to buy some meaningful presents? Did you dig deep to donate or want to do something to help? Or did you simply share these stories with others? What both these examples have in common is the power of storytelling. Stories can change the way you think, can inspire you and change opinions. These both clearly had an objective and desired outcome in mind. Think about how you go about influencing others, whether this is on a personal level or for your business. How can you turn your own message into a story that paints a picture for the audience you are trying to influence? We don’t have to be a top BBC presenter to use storytelling, but we do need to think about what result we want. Words and images can then create a story to engage others and like a good book or a great film, people want to stay to the end to learn more about it. Why not try to introduce storytelling into the way you communicate to get your message across, it may surprise you how people want to listen and, as they find a way to relate to your story, will get involved. Getting press Q A How can I get my work seen at exhibitions by the press? Lindsey says: A really underused facility that all shows have is a press office. Accredited members of the press and PR consultants, as well as a growing number of bloggers, always frequent this area to leave their coats, have a coffee, use computers and Wi-Fi and of course, pick up press releases. Unbelievably, many firms who’ve paid large sums of money for their stands never take an hour to make press packs for the press office. All that’s required is a short, informative write up of around 100 words about the product or service on an A4 page including trade price and RRP. This should be headed up with Press release across the top, a date and a title and finished with contact details including the stand number and the on-site representative at the show. Images on a disc or memory stick should be saved as the product names – rather than lots of numbers – and 300 dpi at 10cm x 10cm is always a good rule of thumb for sizing pictures. Text should be saved as a word document to enable the journalist to pick up your information and paste it easily into their work or on to a website. Your press pack can be creatively packaged incorporating some of your style and even small samples and gifts. However a clear envelope with a label showing the company name, stand number and hall, if relevant, is essential. This can be such a cost-effective way to get yourself noticed and encourage the press to add you to their visit list at the show. Additionally, once you’ve done this exercise you can email the same information after the fair in time for their post-show reviews or if it’s jewellery-related, upload it to PressPoint at www.bja.org.uk A TREASURE ISLAND Make M ake yyour o customers feel like birds of paradise with store layout in spring/summer w ith a jjungle-inspired u 2 015’s tropical t 2015’s colour palette Bolli storage footstool Suzy Newton, £882 +44 (0)7899 754 455 www.suzynewton.com Little Moose, www.littlemoose.co.uk Gisela Graham ceramic parrot wall art The Contemporary Home, £18 each +44 (0)845 130 8229 www.tch.net Flamingo in a tropical cap A3 print birdsinhats at Etsy, £20 www.etsy.com Hello Tiger cushion hunkydory home, £30 +44 (0)191 ( )191 645 4004 www.hunkydoryhome.co.uk Ceramic pineapple Abode, £45 +44 (0)1273 621 116 www.abodeliving.co.uk 128 ATTIRE Palm tree candlestick holder Alison at Home, £39.50 +44 (0)20 7087 2900 www.alisonathome.com WINDOW DRESSING Bali bamboo chandelier Alexander & Pearl, £495 +44 (0)20 8508 0411 www.alexanderandpearl.co.uk Tropical bird cushion Alison at Home, £29.50 +44 (0)20 7087 2900 nathome.com www.alisonathome.com Tropical straw straws The Oak Roo Room, £1.25 for six +44 (0)1707 2257 175 www.oakroomshop.co.uk Framed parrot and woodpecker print Rose & Grey, £79 +44 (0)161 926 8763 www.roseandgrey.co.uk Retro drinks trolley Oliver Bonas, £195 +44 (0)20 8974 0110 www.oliverbonas.com Palm table lamp (gold base only) där lighting group, £83.40 www.darlighting.co.uk Lion’s Whiskers wall clock hunkydory home, £12 +44 (0)191 645 4004 www.hunkydoryhome.co.uk ATTIRE 129 Laying down the law Dids Macdonald, CEO of Anti Copying in Design, discusses the new design law to improve protection and support for designers On 1st October, 2014 a new Intellectual Property Act became law. It’s now a crime to intentionally infringe a registered design. Individual Board Directors will also be held accountable. The changes that are set out in The Intellectual Property Act have been introduced to: • Reduce the scale of registered design infringement by acting as a deterrent • Increase protection for the holders of registered designs • Better punish perpetrators of blatant design infringement. Individual directors will also be liable Intentionally infringing a registered design and producing a copy that differs from an original in only immaterial respects is now a criminal offence punishable by up to 10 years in prison. This is significant for designers, but for now, the law will only assist designers who’ve registered their designs at either the Intellectual Property Office in England or at the Community Design Office in Alicante. It doesn’t cover unregistered designs. The ACID campaign, spanning many years, consistently supported by case studies, demonstrated the scale of the problem and the objective was to address a shortfall in laws to protect designers. In 2011, Professor Hargreaves reported that design and IP had been neglected. Government listened and the Prime Minister put Design and IP law (Ch7) as one of his 10 recommendations. Following consultations, the Bill was introduced in the Queen’s Speech in November 2013. ACID members wrote to their MPs to make them aware about the impact that design theft was having on the job security of their employees and the threat to their growth opportunities. Several ACID members also met with government officials and ministers to add to the argument for reform. Following at times, a tricky route with opponents and, subsequently, through the House of Lords and then House of 130 ATTIRE Commons, the Bill received Queen’s Assent on 14th May, 2014. Nick Kounoupias, ACID’s Chief Legal Counsel and a partner at DMH Stallard, said, “This is the result of a genuine grass roots campaign and shows what can be done with a well presented case argued with integrity and honesty. To get fundamental legislation of this kind, in which copying of designs is made a criminal offence, from lobbying to law in less than a year, is nothing short of phenomenal. Criminal sanctions for registered design infringement should be seen as evolution not revolution and the proposed changes are sensible and pragmatic. However, we believe that the government should listen again to the powerful arguments for including unregistered designs.” When the Bill passed to committee stage, Pete Wishart MP (Vice Chair of the All Party Parliamentary IP Group) commented, “It’s great that it covers registered design rights – the great forgotten IP right. It’s fantastic that ACID has at last got its way and that this will now be covered by criminal infringement provisions, but it’s totally wrong that unregistered designs aren’t covered too.” Dids Macdonald, ACID’s Chief Executive, commented, “I welcome the fact that the IP Bill is a significant step in the right direction. However, there’s still much work to be done because the majority of UK designers rely on unregistered rights. Way back in 1996 when ACID was just a round table action group, I gave a talk along with design law specialist and co-founder of ACID, Simon Clark, saying we needed design issues to be heard and acknowledged within government and a change of law to bring design in line with copyright. Little did I think it would take 18 years to happen! The next step is to persuade government to include unregistered designs, exemplary damages and unfair competition (at the moment our EU designer counterparts can turn to unfair competition laws if IP laws fail them).” Other changes to the law include: 1. Private Copying: (Copyright exceptions) technically, when you rip-off your favourite CD to put onto your MP3 player, you’re infringing copyright. A new exception is introduced for private copies of works we lawfully own for the purpose of back-ups, electronic storage, or format shifting. But be careful – this is private use not commercial and if you give away the original work, you can’t keep using your copies. Further information about accessing content in other areas can be checked out on The Content Map. 2. Quoting: There’s already been a limited right to quote some works for criticism or review without infringing copyright, but that’s now been extended to any purpose. The work must have first been published; use made of it ‘fair dealing’; the source acknowledged; and no more quoted than is necessary for its specific purpose. 3. Legalised Comedy: We’ve all seen those YouTube videos that are a clear skit on a film or song etc. Surely they’re breaching copyright? Well, not anymore, providing the parody is fair dealing. However, a word of caution – fair dealing (whilst a familiar term in UK copyright law) is somewhat of an unknown quantity in the context of parodies, where there could be money to be made. How the courts will interpret the term in this field may be debatable. 4. Designers Own First: Until now, those who commissioned designers would automatically own any unregistered design right (UDR) or rights to apply for registered design rights (RDR) in the UK. However, UK design law will now reflect copyright and EU legislation so that the designer will be the first owner for UDR and RDR purposes. This could create a big headache for businesses if not addressed, so make sure your design contract provides for design rights to be transferred! Subscribe now Attire Accessories magazine, the leading trade title for the accessories industry, is available free of charge, six times a year, to qualified UK based traders. Subscribers based outside the UK will receive six issues per year for a £75 fee. m Register online at www.attireaccessories.com SUBSCRIPTION FORM Are you responsible for purchasing? Yes Alternatively fill in the form opposite and post to Attire Accessories magazine, c/o KD Media Publishing Ltd, Pantile House, Newlands Drive, Witham, Essex, CM8 2AP, UK or telephone +44 (0)1376 514 000. No Name Company Name Job Title Address Top 5 reasons to subscribe Postcode Telephone Facsimile Email Address 1 2 3 4 5 It’s free for anyone working in the fashion industry Tick one or more of the boxes below which best describes your business Independent Fashion Retailer Importer Multiple Fashion Retailer Mail Order Independent Shoe Shop Agent/Rep Jeweller Manufacturer Department Store Each issue will be delivered direct to your door Find out about forthcoming trade shows and exhibitions Other (please specify) Number of employees 1-5 6 - 15 16 - 30 31 - 50 51 - 100 101 - 300 301 - 1,000 1,001 + Be one of the first to preview next season’s collections It’s packed with informative features to help boost your business Annual Turnover £100,001 - £250,000 £250,001 - £1,000,000 £1,000,001 - £5,000,000 £5,000,001 - £10,000,000 NOVEMBER/D ECEMBER 2014 ISSUE 49 £10,000,001 - £50,000,000 ensive A compreh guide exhibition e Go with th FROWk A sneak pee at London ek Fashion We WWW.ATTIR In the loop BOY STORY#HECKING¬IN EACCESSORI Key mensweaOur pick of r st travel accessoriesthe late ies WIN ES.COM accessor WIN products worth £500 RRP courtesy of URBAN COUNTRY WIN pr No oduc ts £500 worth RRP cour Healthtesy of Th e yB Com ack Bag pany CARAT FASH ION An insider look at the hottest jewellery tren ds 2015 S.COM BRUARY • EXPERT ADVI CE • INDUSTRY NEWS • BRAND NEW PRODUCTS REACCESSO RIE JANUARY/FE 2014 PLUS WWW.ATTI PLUS ISSUE 50 ISSUE 49 NOVEMB ER/DECEMBER PURE previews DS¬4RA s¬3COTLAN G ¬&AIR¬3PRIN The very best of belts ontcover_AA49.indd 1 132 ATTIRE ries AccessoLONDON 2015 ¬ • Top Drawer AIR¬s¬-ODA Sprin g G¬& s¬3PRIN ATIONAL¬ • Handmade in Brita COOP¬)NTERN s¬3in DE¬ Weekend bags and holdalls for 2015 WWW.ATTIREAC CESSORIES.COM Date FEBRUARY Show previeSh wsow SMART Do you wish to receive a free copy of Attire Accessories Magazine? Signature Accessories JANUARY/ ISSUE 50 TRIP £50,000,001 + Yes ATTIREATTIRE es £50,001 - £100,000 ATTIRE Accessori £25,001 - £50,000 Accessories £0 - £25,000 ¬!$6)#% s¬%80%24 ¬.%73 s¬).$53429 $5#43 ¬.%7¬02/ es Here comepper the hotst shoes mer The best sum WWW.AT s¬"2!.$ TIREACC ESSORIE S.COM Azara Jewellery Ltd $OH[DQGUD+RXVH6WUDJHOLIIH &DYDQ&R&DYDQ,UHODQG 7 ) (VDOHV#DEVROXWHMHZHOOHU\LH www.absolutejewellery.ie Next issue MARCH/APRIL 2015 www.junoaccessories.co.uk Too hot to handle The latest handbag trends Hands down www.indxshow.co.uk The INDX factor A sneak peek at The British Craft Trade Fair All set What to expect from the Solihull travel and fashion accessories show The hottest jewellery looks of 2015 Plus: A look at eyewear • Brand new products • Expert advice • Industry news Footwear for the season ahead Attire Accessories magazine ISSUE 51 Available from: 9th March, 2015 Advertising deadline: 20th February, 2015 134 ATTIRE Making a spectacle Shoe calling Boogie wonderland Our pick of the best party extras www.belleandflo.co.uk T he Bridal Roadshow 1 Feb 2015 - 2 Feb 2015 Chateau Impney, Dro itwich, Worcestershire Elizabeth Dickens +44 1353 723675 email: [email protected] web: elizabethdickensveils.co.uk WEBSITE Attire Accessories Online If you’ve enjoyed reading Attire Accessories magazine, you’ll love our online presence at www.attireaccessories.com. Featuring up-to-theminute news, events and competitions, the site’s updated regularly with information to help you build your business. Find a supplier The supplier directory allows you to contact advertisers in the magazine for more information about their products and services. Simple to use and available worldwide 24 hours a day, the supplier directory is a reader reply service for the 21st century. www.opticaid.net www.suziebluejewellery.co.uk w www .suziebluejewellery.co.uk Special features Back issues archive If you’re looking for information on a particular subject, take a look at our back issues archive. All back issues will be sent out totally postage-free to registered readers. If you would ld like lik to t find fi d outt more, log l onto t Featured articles Read our regularly updated news articles whenever you wish. Why not register with us online? We’ll keep you fully informed of all new featured articles, competitions and news from the fashion industry. www.attireaccessories.com ATTIRE 137 All bold Tala Habbal of Designs by Tala tells us how her spontaneity, love of travel and passion for statement accessories have influenced her brand What’s the inspiration behind the company and its products? I was born in the USA, but grew up in Lebanon and have always travelled quite a lot. I find that my exposure to different parts of the world and cultures has heavily inspired Designs by Tala and the brand’s bold, eclectic aesthetic. Is the collection aimed at a particular type of retail outlet or consumer? My collection’s definitely aimed at a fashion-forward, trend-savvy, contemporary woman who knows what she wants, isn’t afraid to try new things and likes to stand out from the crowd. the most importance for me has always been quality, and it was quite difficult at first to get a manufacturer with a strong sense of workmanship. It took some time, but I finally found someone whose craftsmanship is impeccable. How was your initial clutch bag collection developed? My initial collection was developed in 2010. I noticed that there were no reasonably priced clutches on the market that I liked, so I decided to try and design my own. Describe your current collection? My current collection is quite bold and distinctive ‒ certainly not for the fainthearted. I love statement pieces, and each of the three clutches in my current collection are meant to make an impact and really be forms of wearable art. What are the long-term plans for Designs by Tala? I hope to start by selling my ranges in London and New York, eventually opening a stand-alone boutique. A Were there any problems when setting up the business? If so, how did the company overcome them? As is the case with most start-up businesses, there were a few obstacles when launching my line. My main concern and the aspect of the brand that holds How often will the company be launching new lines? Rather than working on the seasonal fashion schedule, I tend to debut items sporadically. I’m quite a spontaneous person, so this really comes through in the ethos of the brand. Some of the styles, like the Cici clutch ‒ a classic oval shape ‒ will be staples of the collection and be relaunched in different shades each season. 138 ATTIRE Contact Designs by Tala +44 (0)7426 985 954 www.designsbytala.com Stirlina Milano Interchangeable Pendants Visit www.sterlinamilano.com Email [email protected] Visit us at Giving and Living Exeter - stand A1 Also Birmingham Jewellery Show - stand H01 Come and see the exciting new range of Juno handbags at Pure 8th-10th February, Olympia - Stand T198 T. 01484 475800 E. [email protected]