AVIC - 505 - Pioneer Europe - Service and Parts Supply website

Transcription

Mobile Navigation System
Manual
AVIC - 505
&RQWHQWV
Introduction ........................................... 4
Licence Agreement.............................................. 4
About Your Mobile Navigation System ............. 7
Important Safety Information .............................. 8
What Is a Mobile Navigation System? ................ 9
• How does it work?
Features of Your Mobile Navigation System .... 10
About This Manual ............................................ 11
• How to use this manual
• Terminology
Getting Started .................................... 13
Hardware Components ...................................... 13
• The Navigation commander
• Navigation commander batteries
• The main unit
Preparing the System for Use ............................ 16
• Inserting the programme disc
• Installing the programme
• Inserting the appropriate map disc
• Registering your home location
• Registering a password
• Calibrating the built-in gyrosensor
• Registering your Mobile Navigation System
with Pioneer
Safety-related Features ...................................... 31
• Handbrake interlock
• Day and night map backgrounds
What Next? ........................................................ 32
Basic Operation .................................. 33
When You Switch On........................................ 34
Basic Menu Usage ............................................. 36
• Displaying the menus
• Selecting from a menu or list
• Obtaining help
The Text Palette................................................. 38
• Understanding the text palette display
• How to input text
The Map Display ............................................... 40
• Understanding the map display
• Scrolling the map display
• Viewing detailed information
• Changing the map scale
Your First Destination ....................................... 44
Setting a Route to Your
Destination ....................................... 45
Setting a Route Using the Destination
History ............................................................
• Using the Destination history
• Working with the Destination history
Setting a Route Home or to the Stored
Location..........................................................
• Setting a route home
• Setting a route to the stored location
• Registering locations
Finding a Destination by Street/City Search.....
• Entering city/town and street information
• Selecting a city, town, or village
• Entering house number information
• Entering intersecting street information
Finding a Destination by Specific Post Code....
Setting a Route to a Specific Point of Interest ..
• Choosing a point of interest
• Working with points of interest
MAP SEARCH: Returning to the Map
to Find a Destination ......................................
Finding a Destination on the Map .....................
Settings..............................................................
46
50
55
62
64
70
71
72
Guidance to Your Destination ........... 73
About Screen Guidance and Voice Guidance ...
Initiating Guidance............................................
Voice Guidance .................................................
• When do you hear voice directions?
• What if you miss an instruction?
• What do you hear?
On-screen Guidance ..........................................
• Guidance modes
• Switching between on-screen
guidance modes
If you Stray from the Route ..............................
If You Take a Break ..........................................
Settings..............................................................
73
74
75
76
81
82
83
Using the Guidance Menu ................. 84
Displaying the Guidance Menu .........................
REROUTE: Setting a New Route
to Your Destination ........................................
• Choosing reroute parameters
• Rerouting to your destination
RESUME ORIGINAL ROUTE:
Returning to the Original Route .....................
DETOUR:
Avoid the Road Ahead ...................................
• Choosing the length of the detour
• Setting a detour route
Changing the Guidance Mode ...........................
Setting a Further Destination.............................
Locating Nearby Points of Interest....................
• Overlaying points of interest on the Map
or Arrow mode display
• Setting a route to a nearby point of interest
View Map ..........................................................
Cancelling a Route ............................................
Settings ..............................................................
85
86
88
89
91
92
93
96
97
98
Customising the System ................... 99
Changing the Factory Settings........................... 99
User Settings.................................................... 102
• Auto reroute
• Time turn restriction
• Street list on route
• Areas to be avoided
• Guidance voice
• Auto road hiding
• Vehicle type
• Map orientation
• Location status
• Tracking display
• Auto day/night background
• Cartografhic language
• Short menus
• Operation voice instruction
• Password
• Km/mile setting
• Language
• Home location
• Preferred destination
• Wide/normal display
• Volume control
• Demonstration
Operating the System by Voice ....... 117
Voice Operation .............................................. 117
Successful Voice Recognition ........................ 118
Using Voice Operation ................................... 119
Setting a Route and Displaying Points
of Interest by Voice ...................................... 120
• Activating voice recognition
• Routing home or to the stored location
• Routing to personal destinations
• Overlaying points of interest on the map
Using Voice Recognition while
Under Guidance ........................................... 124
• Activating voice recognition
• Rerouting to your destination
• Resume original route
• Detour
• Obtaining information about points of interest
Appendix ........................................... 129
Positioning Technology .................................. 129
• What is GPS?
• Dead reckoning
• How do GPS and dead reckoning
work together?
• Map matching
• Conditions likely to cause noticeable
positioning errors
About CD-ROM Map Discs ........................... 138
Handling and Care of CD-ROM Discs ........... 139
Resetting the System ........................................ 140
• When a reset is necessary
• Using the reset button
Troubleshooting .............................................. 141
Messages and How to React to Them ............. 145
Route Setting Information............................... 148
• Route Search Specifications
• How a Route Is Set
• Route Highlighting
• Intersection Enlargement
• Current Location
Other Information ........................................... 151
• Tracking
Specifications .................................................. 152
Glossary .......................................................... 153
Display Information ........................................ 155
,QWURGXFWLRQ
&RQJUDWXODWLRQVRQWKHSXUFKDVHRI\RXUQHZ3LRQHHU0RELOH1DYLJDWLRQ6\VWHP3OHDVH
UHDGWKLVLQWURGXFWLRQEHIRUHDWWHPSWLQJWRXVH\RXUQHZHTXLSPHQW
Licence Agreement
THIS IS A LEGAL AGREEMENT BETWEEN YOU, AS THE END USER, AND PIONEER
ELECTRONIC CORP. (JAPAN) ("PIONEER"). PLEASE CAREFULLY READ THE
TERMS AND CONDITIONS OF THIS AGREEMENT BEFORE USING THE SOFTWARE
ENCLOSED HEREIN AND INSTALLED ON THE PIONEER PRODUCTS. BY USING
SUCH SOFTWARE, YOU ARE AGREEING TO BE BOUND BY THE TERMS OF THIS
AGREEMENT. IF YOU DO NOT AGREE WITH THESE TERMS, PLEASE RETURN THE
PIONEER PRODUCTS (INCLUDING THE SOFTWARE AND ANY WRITTEN
MATERIALS) WITHIN [FIVE (5)] DAYS OF RECEIPT OF THE PRODUCTS, TO THE
PLACE FROM WHICH YOU PURCHASED THEM, FOR A FULL REFUND OF THE
PURCHASE PRICE OF THE PIONEER PRODUCTS.
*UDQWRIOLFHQFH
Pioneer grants to you a non-transferable, non-exclusive licence to use the software enclosed
herein and installed on the Pioneer products (the "Software") and the related documentation
solely for your own personal use or for internal use by your business, only on such Pioneer
products.
You shall not copy, reverse engineer, translate, port, modify or make derivative works of the
Software. You shall not loan, rent, disclose, publish, sell, assign, lease, sublicense, market or
otherwise transfer the Software or use it in any manner not expressly authorised by this
agreement. You shall not derive or attempt to derive the source code or structure of all or any
portion of the Software by reverse engineering, disassembly, decompilation, or any other
means. You shall not use the Software to operate a service bureau or for any other use involving
the processing of data for other persons or entities.
Pioneer and its licensor(s) shall retain all copyright, trade secret, patent and other proprietary
ownership rights in the Software. The Software is copyrighted and may not be copied, even if
modified or merged with other products. You shall not alter or remove any copyright notice or
proprietary legend contained in or on the Software.
You may transfer all of your licence rights in the Software, the related documentation and a
copy of this Licence Agreement to another party, provided that the party reads and agrees to
accept the terms and conditions of this Licence Agreement.
'LVFODLPHURIZDUUDQW\
The Software and related documentation are provided to you "AS IS". PIONEER AND ITS
LICENSOR(S) (for the purpose of provisions 2 and 3, Pioneer and its licensor(s) shall be
collectively referred to as "Pioneer") MAKES AND YOU RECEIVE NO WARRANTY,
WHETHER EXPRESS OR IMPLIED, AND ALL WARRANTIES OF
MERCHANTABILITY AND FITNESS FOR ANY PARTICULAR PURPOSE ARE
EXPRESSLY EXCLUDED. The Software is complex and may contain some
nonconformities, defects or errors.
Pioneer does not warrant that the Software will meet your needs or expectations, that operation
of the Software will be error free or uninterrupted, or that all non-conformities can or will be
corrected. Furthermore, Pioneer does not make any representations or warranties regarding the
use or results of the use of the Software in terms of its accuracy, reliability or otherwise.
/LPLWDWLRQRIOLDELOLW\
IN NO EVENT SHALL PIONEER BE LIABLE FOR ANY DAMAGES, CLAIM OR LOSS
INCURRED BY YOU (INCLUDING, WITHOUT LIMITATION, COMPENSATORY,
INCIDENTAL, INDIRECT, SPECIAL, CONSEQUENTIAL, OR EXEMPLARY
DAMAGES, LOST PROFITS, LOST SALES OR BUSINESS, EXPENDITURES,
INVESTMENTS, OR COMMITMENTS IN CONNECTION WITH ANY BUSINESS, LOSS
OF ANY GOODWILL, OR DAMAGES) RESULTING FROM THE USE OF OR
INABILITY TO USE THE SOFTWARE, EVEN IF PIONEER HAS BEEN INFORMED OF,
KNEW OF, OR SHOULD HAVE KNOWN OF THE LIKELIHOOD OF SUCH DAMAGES.
THIS LIMITATION APPLIES TO ALL CAUSES OF ACTION IN THE AGGREGATE,
INCLUDING WITHOUT LIMITATION BREACH OF CONTRACT, BREACH OF
WARRANTY, NEGLIGENCE, STRICT LIABILITY, MISREPRESENTATION, AND
OTHER TORTS. IF PIONEER’S WARRANTY DISCLAIMER OR LIMITATION OF
LIABILITY SET FORTH IN THIS AGREEMENT SHALL OR FOR ANY REASON
WHATSOEVER BE HELD UNENFORCEABLE OR INAPPLICABLE, YOU AGREE
THAT PIONEER’S LIABILITY SHALL NOT EXCEED FIFTY PERCENT (50%) OF THE
PRICE PAID BY YOU FOR THE ENCLOSED PIONEER PRODUCT.
,QWURGXFWLRQ
([SRUWODZDVVXUDQFHV
You agree and certify that neither the Software nor any other technical data received from
Pioneer, nor the direct product thereof, will be exported outside the country or district (the
"Country") governed by the government having jurisdiction over you (the "Government")
except as authorised and as permitted by the laws and regulation of the Government. If the
Software has been rightfully obtained by you outside of the Country, you agree that you will
not re-export the Software nor any other technical data received from Pioneer, nor the direct
product thereof, except as permitted by the laws and regulations of the Government and the
laws and regulations of the jurisdiction in which you obtained the Software.
7HUPLQDWLRQ
This Agreement is effective until terminated. You may terminate it at any time by destroying
the Software. The Agreement also will terminate if you do not comply with any terms or
conditions of this Agreement. Upon such termination, you agree to destroy the Software.
0LVFHOODQHRXV
This is the entire Agreement between Pioneer and you regarding its subject matter. No change
in this Agreement shall be effective unless agreed to in writing by Pioneer. If any provision of
this Agreement is declared invalid or unenforceable, the remaining provisions of this
Agreement shall remain in full force and effect.
About Your Mobile Navigation System
• This product complies with the EMC Directives (89/336/EEC, 92/31/EEC) and CE Marking
Directive (93/68/EEC).
• This product does not work correctly in the areas other then Europe.
• Pay close attention to all warnings in this manual and keep this manual handy for future
reference.
• Should this product fail to operate properly, contact your dealer or the nearest authorised
Pioneer service facility.
• A "CLASS 1 LASER PRODUCT" label is affixed to the bottom of this device.
,QWURGXFWLRQ
Important Safety Information
Before using your Mobile Navigation System, be sure to read and fully understand the
following safety information:
• Read the manual completely before operating this Mobile Navigation System.
• This Mobile Navigation System is intended solely as an aid to you in the operation of your
vehicle. It is not a substitute for your attentiveness, judgement, and care when driving.
• Do not operate this Mobile Navigation System if doing so will divert your attention from the
safe operation of your vehicle. Always observe safe driving rules and follow all existing
traffic regulations.
• Use our navigation system in the area only where PIONEER permitted.
• Never allow others to use the system unless they have read and understood the operating
instructions.
• Never use this Mobile Navigation System to route to hospitals, police stations, or similar
facilities in an emergency. The map data may not include a comprehensive list of emergency
service facilities.
• Route and guidance information displayed by this equipment is for reference purposes only.
It may not accurately reflect the latest permissible routes, road conditions, or traffic
restrictions.
• Traffic restrictions and advisories currently in force should always take precedence over
guidance given by this product. Always obey current traffic restrictions, even if this product
provides contrary advice.
• Failure to input correct information about your vehicle type or the local time may result in
the product providing improper routing and guidance instructions.
• Never set the volume of your Mobile Navigation System so high that you cannot hear outside
traffic and emergency vehicles.
• Keep your password secure and confidential. Knowledge of your password can give
someone else access to personal information stored by the system, such as the history of
destinations you route to and your home address.
• To promote safety, certain equipment functions are disabled unless the handbrake is on.
• The data encoded in the Map disc(s) provided with this product is the intellectual property
of the provider, and the provider is responsible for such content.
• As with any accessory in your vehicle’s interior, you should not allow this Mobile
Navigation System to divert your attention from the safe operation of your vehicle. If you
experience difficulty in operating the system or reading the display, please make adjustments
while safely parked.
What Is a Mobile Navigation System?
The word "navigation" refers to the act of finding a route to a particular location. Successful
navigation depends on a number of factors, but most important are knowledge of your
destination, knowledge of the territory between you and your destination, and knowledge of
your present location. On the basis of information you supply, such as an address or the name
of a town, this system helps you locate your destination precisely. It then assists in the other
two areas; sophisticated maps stored on CD-ROM provide detailed data about the road system
you will use to get there, while a combination of satellite technology and built-in sensors enable
your vehicle’s location to be tracked at all times and compared with the maps. Using this data,
detailed directions for reaching your chosen destination are given as you drive. This
combination of technology is what we call a Mobile Navigation System.
How does it work?
This Pioneer Mobile Navigation System relies on detailed map information stored on a CDROM. Before you begin a journey, the system helps you provide information about your
destination. A suggested route is then automatically calculated and then displayed. At the same
time, using a state-of-the-art global positioning system (GPS), the built-in gyrosensor, and the
speed pulse data, the system calculates exactly where your vehicle is. Your current position is
then displayed in the centre of the map. As soon as you begin to drive, the system gives you all
the directions you need to keep to the route and reach your destination; this guidance is clearly
shown on the display, but may also be given by voice. As you drive, all your vehicle’s
movements are traced, so not only does your navigation system know where you are; it can also
tell if you are keeping to the route or if you have strayed off it for some reason.
• For more information about GPS, see "Positioning Technology" on page 129.
,QWURGXFWLRQ
Features of Your Mobile Navigation System
This section gives you an overview of the most important features and functions of your
Pioneer Mobile Navigation System.
Voice route guidance
While under guidance, you receive voice navigation instructions.
Three on-screen guidance modes
Choose from Map mode, Arrow mode (in which your route is portrayed symbolically), and
Split Screen mode (a combination of both).
• These are just some of the features of your Mobile Navigation System. Refer to the relevant sections
of this manual for details of each function.
Operation Guidance
Voice guidance for operation is provided.
On-screen help
Descriptions of each item on the menu are available.
Remote control
The Navigation commander makes operation simple.
Map matching for increased accuracy
A processing technique known as map matching increases the accuracy with which your
current location is shown on the map.
Operate using voice commands
Your Mobile Navigation System accepts voice commands from the driver.
Route planning
Simply specify a final destination, and your Mobile Navigation System automatically sets a
route there from your current location.
Auto-rerouting
Make a wrong turn, and the route automatically adjusts to accommodate the change.
About This Manual
This manual provides all the information you need to make full use of your new Mobile
Navigation System. The first few sections give an overview of the system and explain how to
prepare it for use. The remainder is in the form of a function reference giving full details of
every feature. A comprehensive list of all sections of the manual is provided in the table of
contents at the beginning of this introduction.
How to use this manual
For reasons of safety, it is particularly important that you fully understand your Mobile
Navigation System before using it. However, you don’t have to read the whole manual before
obtaining guidance to your first destination. The following summary indicates which chapters
you should read now and which you can come back to later. (Read the chapters marked * before
attempting to obtain guidance to your first destination.)
1 Getting Started*
This chapter introduces the components of your Mobile Navigation System and takes you
through the initial setup process. You should read this chapter first.
2 Basic Operation*
Read this chapter after going through the setup process. It explains what you see on the display
and how to use the menus. You will then be ready to navigate to your first destination.
3 Setting a Route to Your Destination*
This chapter describes a number of ways to choose a destination. Choose the one that suits your
first destination and read that section; you can then come back and read the rest of the chapter
later.
4 Guidance to Your Destination*
Before actually setting out toward your chosen destination, read this chapter to learn how to
interpret the guidance given by your Mobile Navigation System.
5 Using the Guidance Menu
This chapter provides information about the various functions available while you are under
guidance. Read it to learn more about the useful features available to you while driving.
6 Customising the System
The behaviour of your Mobile Navigation System depends on a number of settings. If you need
to change any of the initial settings (default settings), read the relevant section of this chapter.
,QWURGXFWLRQ
7 Operating the System by Voice
This chapter gives details of the voice recognition capabilities of your Mobile Navigation
System. Read it when you are ready to begin giving voice commands while under guidance.
Appendix
Read the appendix to learn more about your Mobile Navigation System, the technology it uses,
and such information as the availability of after-care.
Terminology
Before moving on, take a few minutes to read the following information about the conventions
used in this manual. Familiarity with these conventions will help you greatly as you learn how
to use your new equipment.
• Buttons on your Navigation commander are referred to as:
N(NAVI) button, K button.
• Options in various menus are referred to like this: "DESTINATION HISTORY" and
"SETTINGS".
Cautionary remark
Actions that you
are to perform are
numbered.
The result of an
action is often
illustrated with a
picture of the
display.
Extra information,
alternative uses,
and other notes are
presented like this.
*HWWLQJ6WDUWHG
Your new Pioneer Mobile Navigation System relies on a combination of hardware and
software to provide you with accurate positional information and guidance. Data from global
positioning satellites and a built-in gyrosensor is processed by the software and compared with
maps stored on CD-ROM to accurately show your position on the display.
Before you can use the system, you must install the programme software (provided on a CDROM programme disc), insert the proper map disc (a separate CD-ROM), and complete a
number of settings and calibrations. This section describes the components of the system and
takes you step-by-step through this setup and calibration process. We suggest you spend a little
time reading and understanding the text that follows as an introduction to handling both the
hardware and software components of your new system.
Hardware Components
There are three main parts to the hardware: the main unit, the display, and a remote control unit
called a Navigation commander. The main unit and display should be properly installed in your
vehicle before you attempt to follow the instructions in this manual.
The Navigation commander
Once your Mobile Navigation System has been installed and set up for use, most operations are
carried out using the Navigation commander. In order to work properly, the commander must
be properly positioned with respect to the display. If you have difficulty issuing commands to
the equipment, make sure there is a clear line of sight from the commander to the display.
The commander has a joystick and a number of buttons. Their functions are explained below.
*HWWLQJ6WDUWHG
• ' (ON/OFF)button
This is the power switch for your Mobile Navigation System.
• Joystick/ - button
The joystick has eight directions of movement. Use it to make choices on the display and to
scroll the map. The joystick also acts as the -button; simply press it to select a location on the
map or choose an option displayed on the screen.
• N (NAVI) button
The N(NAVI) button is used to view the map or return to guidance mode. Its use is explained
in more detail in the relevant sections of this manual.
Press this button to repeat the last guidance message.
• K (MENU) button
The K (MENU) button is used to display a menu of options on the screen. The menu displayed
is contextual; that is, it depends on what mode the system is in. Its use is described in more
detail in the relevant sections of this manual.
• ( (RETURN) button
While using a menu, this button will cancel the present operation and take you back to the
previously displayed menu or list.
• ) button
This button is used to enlarge the scale of the displayed map, and also to cycle through multiple
items of information on the display.
• * button
This button is used to reduce the scale of the displayed map, and also to cycle backwards
through multiple items of information on the display.
• H (TALK) button
This button is used to initiate voice recognition, allowing you to give commands to the system
by voice.
• + (NEXT OPTION) button
This button is used to cycle through possible matches when a voice command is given.
• When you press a button on the Navigation commander, you will hear a confirmation "beep" from
the system speaker. You can be sure that your command has been accepted when you hear this sound.
Navigation commander batteries
The Navigation commander requires two batteries (supplied). Take note of the following
precautions when inserting or changing the batteries.
Supplied alkaline batteries
(UM-4, LR03 1.5 V)
CAUTION
• Take care to insert the batteries in the correct orientation as shown by the + and –
marks in the diagram.
• Do not mix new batteries with old.
• Do not mix different types of batteries. Even batteries of the same size may have
different voltages.
• Remove the batteries from the Navigation commander if it will be out of use for a
long period.
• If a battery leaks, completely clean any liquid or deposits from the battery
compartment before inserting new batteries.
• The supplied batteries cannot be recharged.
• We recommend using alkaline batteries as replacements.
The main unit
Reset button
AVIC
-505
CD-ROM slot
• CD-ROM slot
To open the cover and eject the CD-ROM, push the cover down at the "EJECT" mark.
• Reset button
In the event of a major malfunction of the system, use a ball-point pen or similar pointed object
to reset it using this recessed button (see "Resetting the System" on page 140).
*HWWLQJ6WDUWHG
Preparing the System for Use
A certain amount of preparation is necessary before you can use your new Navigation System.
If you are using the system for the first time, read and carry out the instructions in this section.
First, the appropriate software must be installed from the programme disc. Once the software
has been successfully installed, you must insert the map disc for your area. You may then want
to register the location of your home and perhaps set a password to limit use of the system.
Finally, it is necessary to calibrate the system’s built-in gyrosensor. Calibration requires that
you are on a level stretch of open road without tall buildings or large stands of trees nearby, and
you will need to be able to drive straight forward for about 100 yards (100 m). Please choose a
quiet location with no obstacles for this purpose.
1RWH
• The explanation that follows assumes that the system has been properly installed according to the
accompanying Installation Manual.
Inserting the programme disc
The programme disc holds the basic software needed by your system. In order to install the
software, you must first insert the programme disc into the main unit.
CAUTION
• Do not attempt to carry out this procedure while your vehicle is in motion. Do not
start driving while the programme is being installed.
• Follow this same procedure if you want to change the language used.
7XUQRQWKHLJQLWLRQDQGVWDUWWKHHQJLQH
0DNHVXUH\RXDUHVWDWLRQDU\DQGLQDVDIHORFDWLRQDQGWKDWWKHKDQGEUDNHLV
DSSOLHG
7XUQRQWKHSRZHUWRWKH0RELOH1DYLJDWLRQ6\VWHPE\SUHVVLQJWKH'EXWWRQRQ
WKH1DYLJDWLRQFRPPDQGHU
You are asked to insert the appropriate programme disc.
&OLFNRSHQWKH&'520FRYHUE\SXVKLQJGRZQDWWKHSRLQWPDUNHG(-(&7
,QVHUWWKHSURJUDPPHGLVFLQWRWKHVORWODEHOVLGHXS
AVIC
-505
As you slide the CD-ROM into the slot, it will be automatically drawn into the unit.
• Do not attempt to use discs other than a programme disc designed for use with this system. For
example, music CDs and other CD-ROMs cannot be used.
• Do not attempt to use discs which are cracked, scratched, bent or otherwise damaged.
&ORVHWKHFRYHUE\SXVKLQJLWJHQWO\XSZDUG
The screen indicates that you can now install the programme (see next section).
• Your CD-ROM discs should be treated with care. See "Handling and Care of CD-ROM Discs" on
page 139 for advice on proper handling and use.
*HWWLQJ6WDUWHG
Installing the programme
After inserting the disc as described in "Inserting the programme disc" above, you are presented
with a choice of languages.
&OLFNWKHMR\VWLFNWRWKHOHIWDQGWKHQFKRRVHDODQJXDJHE\FOLFNLQJXSDQGGRZQ
WRKLJKOLJKWLWLQ\HOORZ1RWHKRZHDFKODQJXDJHLVKLJKOLJKWHGLQ\HOORZDVLWLV
VHOHFWHG
If you select "SKIP" (by clicking the - button with the joystick while it is highlighted),
installation is aborted.
• If the programme has already been installed, the message "PLEASE EJECT THE DISC" is displayed.
If the programme has not yet been installed, "SKIP" has no effect.
&OLFNWKH-EXWWRQZLWKWKHMR\VWLFNWRLQSXWWKHFKRLFHDQGEHJLQLQVWDOOLQJWKH
SURJUDPPH
The programme is now installed automatically. Progress is indicated by a bar on the display.
• It is important not to switch the unit off while the software is being installed.
• Installation takes about two minutes.
When installation is complete, you are asked to remove the disc.
2SHQWKH&'520VORWE\SXVKLQJGRZQDWWKHSRLQWPDUNHG(-(&7
The disc is automatically ejected. You are asked to insert the appropriate disc (see next section).
• Take care to return the programme disc to its holder and store it in a safe place in case you need it
again for changing the language for example.
*HWWLQJ6WDUWHG
Inserting the appropriate map disc
The basic programme needed by the Mobile Navigation System has now been installed. The
map data that it needs is on a separate disc. You must now insert the map disc for your area.
• Refer to "About CD-ROM Map Discs" on page 138 for information on using map discs other than the
one supplied with your system.
,QVHUWWKHPDSGLVF
An opening screen giving a cautionary message appears.
• Read thoroughly the message on this screen.
• Do not attempt to use discs other than a map disc designed for use with this system. For example,
music CDs and other CD-ROMs cannot be used.
• Do not attempt to use discs which are cracked, scratched, bent or otherwise damaged.
&ORVHWKHFRYHUE\SXVKLQJLWJHQWO\XSZDUG
$IWHUUHDGLQJWKHFDXWLRQFOLFNWKH-EXWWRQWRGLVPLVVLW
You are asked whether you want to register your home location (refer to next section).
• From now on, the system will operate only if the appropriate map disc is in place.
• If you fail to click the - button, a special screen display appears after a few minutes.
Registering your home location
You are given a chance to register your home location with the system. Doing so will make it
very easy to route home from any location, and we suggest you take this opportunity to do so.
After inserting an appropriate map disc as described above, you are asked if you want to
register your home location.
7RUHJLVWHU\RXUKRPHORFDWLRQQRZXVHWKHMR\VWLFNWRFOLFNGRZQDQGKLJKOLJKW
12:LWVKRXOGWXUQ\HOORZDQGWKHQFOLFNWKH-EXWWRQ
The text palette appears.
• If you want to register your home location later, highlight "LATER" and click the - button. You will
be presented with this display again next time you start up. If you never want to register your home
location, choose "IGNORE." If you choose "IGNORE," you can register your home location at any
time from the Settings menu (see "Home location" on page 115).
• If you choose "LATER" or "IGNORE", the password registration display will appear (see next
section).
*HWWLQJ6WDUWHG
(QWHUWKHIXOOQDPHRUWKHILUVWIHZOHWWHUVRI\RXUFLW\WRZQRUYLOODJH'RWKLV
E\KLJKOLJKWLQJOHWWHUVRQHDWDWLPHZLWKWKHMR\VWLFNDQGFOLFNLQJWKH-EXWWRQ
:KHQILQLVKHGVHOHFW2.
A list of matching cities, towns, or villages appears.
• If you need further help with entering text using the text palette, see "The Text Palette" on page 38.
0RYHWKHMR\VWLFNGRZQWRKLJKOLJKW\RXUFLW\WRZQRUYLOODJHDQGFOLFNWKH-
EXWWRQ
The text palette appears again, this time for entry of your street name.
• If you need further help making a selection from this list, see "Selecting from a menu or list" on page
36.
(QWHU\RXUVWUHHWQDPHRUWKHILUVWIHZOHWWHUVRI\RXUVWUHHWXVLQJWKHMR\VWLFN
KLJKOLJKW2.DQGFOLFNWKH-EXWWRQ$OLVWRIPDWFKLQJVWUHHWVLVGLVSOD\HG
&KRRVH\RXUVWUHHWIURPWKHOLVWE\FOLFNLQJWKH-EXWWRQ
The text palette appears again, this time for entry of your house number.
• If the map disc has no house number information, a list of intersecting streets is displayed (for details
of entering intersecting street information, see "Entering intersecting street information" on page 61).
(QWHU\RXUKRXVHQXPEHUKLJKOLJKW2.DQGFOLFNWKH-EXWWRQ
A map showing the selected location is displayed.
&OLFNWKH-EXWWRQ
*HWWLQJ6WDUWHG
$IWHUWKHVFUHHQGLVSOD\V,67+,6<285+20("FOLFNWKH-EXWWRQ
The selected location is registered as your home, and you are next asked if you want to register
a password (see next section).
• If the number you input is invalid, a list of house number ranges is displayed (for details of entering
house number information, see "Choosing a house number range" on page 60).
•
< is displayed on the map to mark your home; only at the map scales of 25 m to 500 m (0.02 mile to
0.5 mile).
You can also search for your home location on the map by moving the joystick to the
right before inputting a house number. Scroll the map if the necessary to place 5
exactly on your home location, and click the - button.
See “Scrolling the map display” on page 41 for details how to sroll the map. You may
also enlarge the map if necessary to accurately locate your home; see “Changing the
map scale” on page 43.
Registering a password
You can limit use of this Mobile Navigation System to those who know a password. You might
choose to register a password if you do not want others to know what journeys you are making
or to keep your home location confidential. After registering a password, make careful note of
it in a form unlikely to be recognised. If you lose your password, you will not be able to use the
system.
You are next asked if you want to register a password.
7RUHJLVWHUDSDVVZRUGQRZXVHWKHMR\VWLFNWRFOLFNGRZQDQGKLJKOLJKW12:
&OLFNWKH-EXWWRQ
The new password display is shown.
• If you want to register a password later, choose "LATER." You can choose to register or change a
password at any time in the future (see "Password" on page 113).
• If you choose "LATER", move ahead to "Calibrating the built-in gyrosensor" below.
*HWWLQJ6WDUWHG
(QWHU\RXUSDVVZRUGXVLQJWKHMR\VWLFNDQGWKHQXVHWKHMR\VWLFNWRKLJKOLJKW
'21(&OLFNWKH-EXWWRQ
A message confirming registration of your password is displayed. The system also reads back
your password.
• Your password should be 6 to 23 characters long.
• See "The Text Palette" on page 38 for instructions on using the text palette.
• If you don’t want to use a password, enter the single character "*". Then move ahead to "Calibrating
the built-in gyrosensor" below.
• If you enter "*", you may change your mind and register a password later by choosing "PASSWORD"
from the Settings menu. When asked for the current password, enter "*"(see page 113).
+LJKOLJKW<(6DQGFOLFNWKH-EXWWRQLIWKHSURQXQFLDWLRQZDVFRUUHFW
The password is registered and the Destination menu is displayed.
• If you wish to hear the pronunciation again, select "REPEAT" instead. If the pronunciation is
incorrect, select "NO" and the text palette will appear once again for you to enter a new password. Be
sure to input a different password which is easy to pronounce.
• You can change your password at any time (see "Password" on page 113).
• Use one of the memo pages at the end of this manual to note down the password, then remove the
page and keep it in a safe place. Do not keep a note of your password in the vehicle.
• If you choose to register a password, you will have to enter your password every time the Navigation
System is turned on. Enter the password as you did above or say your password.
Calibrating the built-in gyrosensor
Your Mobile Navigation System contains a gyrosensor as part of the positioning system.
Before it will operate correctly, however, the gyrosensor must be calibrated. To prepare for
this, stop your vehicle on an open stretch of road free of tall buildings and clumps of trees. You
will need to proceed forward for about 100 m (100 yards) to complete the calibration, so make
sure there are not likely to be any obstacles in your path.
CAUTION
• You will not normally need to recalibrate the gyrosensor again. However, if you
reinstall the unit, install it in a different vehicle, or change tyres, you will have to
repeat this process. (See "Location Status" on page 108.)
• If you are just changing tyres temporarily, such as from summer tyres to winter
tyres, you do not have to go through this process. For these types of changes, just
switch the calibration memory. (See "Selecting a calibration memory" on page 111
for details.)
:LWKWKH'HVWLQDWLRQPHQXRQWKHVFUHHQSUHVVWKHN1$9,EXWWRQRQ\RXU
1DYLJDWLRQFRPPDQGHU
A map of your surroundings is displayed. Your vehicle’s present location should be shown in
the centre of the map by the C (red) or M.
• If C (black) is shown instead of C (red) or M and the map does not reflect your current location,
proceed as follows.
•Wait for C (red) or M to appear.
•If C (red) or Mfails to appear after five minutes, then it is likely that the GPS is unable to pick up
signals. Move to more open surroundings and stop your vehicle.
• The most probable reason for C(red) or Mfailing to appear is that your vehicle is surrounded by thick
foliage or high buildings.
*HWWLQJ6WDUWHG
3UHVVWKHK0(18EXWWRQ
The Destination menu is displayed.
8VLQJWKHMR\VWLFNVFUROOGRZQXQWLO6(77,1*6LVKLJKOLJKWHGWKHQFOLFNWKH
-EXWWRQ
The Settings menu is displayed.
+LJKOLJKW/2&$7,2167$786DQGFOLFNWKH-EXWWRQ
The location status display is shown.
+LJKOLJKW5(6(7&$/,%5$7,210(025<DQGFOLFNWKH-EXWWRQ
The reset confirmation message appears.
6HOHFW<(6DQGFOLFNWKH-EXWWRQ
The gyrosensor’s learning function memory is reset (see, "Positioning Technology" on page
129 for details of the learning function). This may take a little time; remain stationary until the
location status display appears once again.
• See "Selecting a calibration memory" on page 111 for more information about use of memories.
3UHVVWKHN1$9,EXWWRQ
:KHQCUHGDSSHDUVGULYHIRUZDUGRQDOHYHOURDGDWNPSHUKRXUPSK
RUPRUHIRUDERXWVHFRQGV
CAUTION
• Have someone drive with you to watch the display.
• Make sure you have chosen a level stretch of road, and drive straight ahead.
• If C (black) is still displayed, you must go through the calibration process again. Before doing so,
check that a vehicle speed pulse is being received by checking the "LOCATION STATUS" display
(as described on page 108).
• If for any reason you have to stop or avoid an obstacle while driving forward, repeat the calibration
process from the beginning.
*HWWLQJ6WDUWHG
&KHFNWKDWCUHGFKDQJHVWRM
Calibration of the gyrosensor is complete.
Registering your Mobile Navigation System with Pioneer
We recommend that you register your Mobile Navigation System with Pioneer.
Registration information can be obtained on screen. To see the information, select "SYSTEM
REGISTRATION" from the Destination menu and click the - button.
Safety-related Features
Handbrake interlock
Certain functions offered by this Mobile Navigation System could be dangerous if used while
driving. To prevent them being used while in motion, there is an interlock with your vehicle’s
handbrake. If you attempt to use these functions whilst driving, the message "You cannot use
this function while driving" will be displayed. Find a safe place to stop and apply the
handbrake.
Day and night map backgrounds
To prevent the normal display from appearing too bright and distracting you when driving after
dark or in dull conditions, the map background changes automatically to a darker colour when
you switch on your vehicle lights. You can, however, turn off this automatic switching (see
"Auto day/night background" on page 112).
Daytime display
Night display
The examples in this manual are illustrated using the daytime display. When driving at night,
the colours you see may differ from those shown.
• To use this function, the ILL lead to the Mobile Navigation Unit must be connected correctly.
*HWWLQJ6WDUWHG
What Next?
This completes the setup of your Mobile Navigation System. It is now ready for use. We
suggest you now switch it off, and read “Basic Operation” that follows before attempting to use
the system while driving.
%DVLF2SHUDWLRQ
<RXU3LRQHHU0RELOH1DYLJDWLRQ6\VWHPRIIHUV\RXWKHGULYHUDVRSKLVWLFDWHGUDQJHRI
IXQFWLRQVWRKHOS\RXSLQSRLQWDGHVWLQDWLRQRQWKHEXLOWLQPDSV2QFH\RXKDYHVSHFLILHG
\RXUGHVWLQDWLRQLWJLYHV\RXJXLGDQFHIRUJHWWLQJWKHUH:KHWKHU\RXLQWHQGWRPDNHIXOO
XVHRIDOOLWVIHDWXUHVRUVLPSO\ZDQWWROHDUQWKHEDVLFVVR\RXFDQTXLFNO\URXWHIURP$
WR%LWLVLPSRUWDQWWKDW\RXILUVWIDPLOLDULVH\RXUVHOIZLWKFRPPRQVFUHHQRSHUDWLRQVDQG
WKHW\SHVRILQIRUPDWLRQGLVSOD\HGRQWKHVFUHHQ,QWKLVFKDSWHU\RXZLOOOHDUQKRZWR
LQWHUSUHWWKHLQIRUPDWLRQSUHVHQWHGWR\RXKRZWRPRYHEHWZHHQWKHYDULRXVW\SHVRI
GLVSOD\DQGKRZWRHQWHUWH[WDQGRWKHULQIRUPDWLRQ
• The information in this section assumes that you are already familiar with the contents of “Getting
Started” and that you have completed the setup procedure that it describes.
%DVLF2SHUDWLRQ
When You Switch On
After your Mobile Navigation System starts up, you are presented with a cautionary message
and then asked to enter your password if one has been registered (see "Registering a password"
on page 25). What follows depends on the state of the system when it was last switched off.
• If you leave your Navigation System on when you turn off the ignition, then the next time you turn
on the ignition it will start up automatically. On the other hand, if you manually turn the system off
using the Navigation commander, you will need to switch it on manually next time.
• Using this system without starting the engine will run down your battery. Please make sure your
engine is running before you switch it on.
The first time you switch the system on, the Destination menu appears once you have dismissed
the opening screen and entered your password. You are presented with a list of options that help
you find or specify a destination in order to obtain guidance to it.
If you have used the system before and you were being guided to a destination when you last
switched it off (or turned off the ignition ), then guidance to your destination will resume as
soon as the system is switched on again. In all other cases, however, the first display you see
after dismissing the opening screen and entering your password is the Destination menu.
,I\RXZHUHQRWXQGHUJXLGDQFHZKHQWKHV\VWHPZDVVZLWFKHGRIIRULI\RXDUH
VZLWFKLQJWKHV\VWHPRQIRUWKHILUVWWLPH
The Destination menu is displayed. This menu gives access to various me-thods of choosing a
destination. You can also gain access to the various system settings from this menu.
• Full details of how to use the Destination menu are given in “Settng a Route to Your Destination”.
• If you were being guided to a destination when you last switched off the system.
Then guidance mode will resume. This means that if you stop at a service station, for example,
when you resume your journey the system will pick up where it left off and give you onward
guidance toward your destination. If you press the K (MENU) button on the Navigation
commander while in guidance mode, the Guidance menu is displayed. This gives access to the
various functions and features you need while under guidance. You can also gain access to the
various system settings from this menu.
• Full details of Guidance menu usage are given in “Guidance to Your Destination” and “Using
Guidance Menu”.
%DVLF2SHUDWLRQ
Basic Menu Usage
The Destination menu and Guidance menu provide access to most of the important functions
of your Mobile Navigation System. There is also a Settings menu, which you use to customise
the appearance and behaviour of your system. The various options presented in these menus
are selected using the joystick on your Navigation commander.
Displaying the menus
The Destination and Guidance menus are central to the operation of this navigation system, and
you can gain quick access to them at any time using the K (MENU) button on the Navigation
commander. If no destination has been set, pressing the K (MENU) button causes the
Destination menu to appear. On the other hand, if you are already being guided to a destination,
the Guidance menu is displayed. The Settings menu, which you can use at any time to change
certain basic settings, is reached by choosing "SETTINGS" from either the Destination menu
or the Guidance menu.
• "Selecting from a menu or list" below explains how to choose an item from a menu.
Selecting from a menu or list
Selecting from a menu is a two step procedure in which you first highlight an option and then
actually select it by clicking the - button. The same procedure is also used to select from any
lists or submenus which appear as a result of making choices from these main menus. You may
already have some experience with this procedure if you chose to register your home location
or a password in “Getting Started”.
0DNH\RXUFKRLFHE\VFUROOLQJXSRUGRZQWRLWXVLQJWKHMR\VWLFN
As each menu item is reached, it is highlighted in yellow. For certain items, the information
and map symbols may also appear to the left and right, respectively.
• If the menu contains more items than can be displayed on one screen, the presence of extra items is
indicated by green arrows at the top or bottom of the list. To view these items, simply scroll up or
down to them using the joystick.
• When a list is displayed, you can use the ) and * buttons to move up or down quickly.
,QSXWWKHKLJKOLJKWHGFKRLFHE\FOLFNLQJWKH-EXWWRQ
The selection is made and the screen changes accordingly.
Obtaining help
When certain menu items are highlighted, =appears to their left. This indicates that a help text
or other information is available about that item. View this information as follows.
,I=LVGLVSOD\HGWRWKHOHIWZKHQDPHQXLWHPLVKLJKOLJKWHGFOLFNOHIWZLWKWKH
MR\VWLFNWRYLHZWKHLQIRUPDWLRQ
The help information is displayed.
7RUHWXUQWRWKHPHQXFOLFNWKH-EXWWRQ
%DVLF2SHUDWLRQ
The Text Palette
It is sometimes necessary to key information into your Pioneer Mobile Navigation System.
Generally, you can choose to do this by directly entering the text. Whenever there is a need for
text to be input, you are presented with a text palette. You will most often see this text palette
when asked to enter a password and when you wish to search for a destination. You may
already have some experience with the procedure if you have chosen to register your home
location or a password in “Getting Started”.
Understanding the text palette display
The text palette consists of a text entry box and a palette of letters, numbers, and other icons
that you can select. A cursor (a small underscore) in the text entry box marks the position at
which the next character will be input. The icons that appear in the text palette vary according
to the type of information you are expected to input.
? Delete backward (deletes the previous character)
@ Space (moves the cursor forward)
D Lists recent results. (For example, if the text palette is asking for a city name, clicking this
icon will display a list of recently searched cities.)
E Choose this icon if you can’t provide the information requested; for example when input of
a street number is called for, choosing this icon sets a route to the nearest point along the
chosen road or street.
B Provides a list of streets that intersect with the chosen road or street.
How to input text
Follow these instructions to enter text using the text palette.
8VHWKHMR\VWLFNWRSRVLWLRQWKHFXUVRURYHUWKHOHWWHURUQXPEHU\RXZLVKWR
LQSXW
The character highlights in yellow to indicate that it has been selected.
&OLFNWKH-EXWWRQ
The selected character appears in the text box at the cursor position.
&RQWLQXHWRHQWHUFKDUDFWHUVLQDVLPLODUZD\XQWLO\RXKDYHHQWHUHGWKH
FRPSOHWHWH[W
• You will notice that your choice of characters is limited at each point to those matching locations on
the map. This helps to speed up the entry of text.
<RXFDQGHOHWHDFKDUDFWHUXVLQJ?
• Depending on the situation, other icons may appear in the text palette, and these can be selected in a
similar way with the joystick.
:KHQWKHWH[WLVFRPSOHWHVHOHFW2.DWERWWRPULJKWRIWKHWH[WSDOHWWHXVLQJ
WKHMR\VWLFN
• In some cases, "DONE" (at bottom left of the display) may replace "OK".
&OLFNWKH-EXWWRQ
Your text is input.
%DVLF2SHUDWLRQ
The Map Display
Much of the information provided by your Pioneer Mobile Navigation System is presented in
the form of maps. It is important that you become familiar with the map display and learn what
the various symbols on the maps mean.
Understanding the map display
The display is much like a conventional map, and shows roads of various designations as well
as geographical features such as rivers, parks, and woods. Learn to recognise these features by
scrolling the map to an area you know well (see "Scrolling the map display" below).
There are also a number of symbols associated with the map display. Some form a permanent
part of the map display, while others depend on settings made elsewhere.
:LWKWKH'HVWLQDWLRQPHQXGLVSOD\HGSUHVVWKHN1$9,EXWWRQRQ\RXU
1DYLJDWLRQFRPPDQGHU
The map display appears. Your current location is shown on the map.
The meaning of the various icons on the map display is as follows.
M
The current location of your vehicle. The arrow indicates your heading, and the display
moves automatically as you drive.
, Map scale indicator. The figure gives the distance represented by the red bar.
A
Radius mark. Circle around your current location with a radius equal to the red bar on
the map scale indicator.
F
Compass mark. The red arrow indicates north.
Tracking marks indicating the route you have travelled (displayed with dots); your
previous 200 km (120 miles) are shown.
Names of roads (shown at the bottom of the display)
• If you set "MAP ORIENTATION" to "HEADING UP" in the Settings menu, your current location is
displayed slightly lower than the centre of the screen. On the other hand, if "MAP
ORIENTATION" is set to "NORTH UP", your location is displayed at the centre of the display
(see page 99). The default setting is "HEADING UP".
• The information given on the map display changes once a route has been set (see "On-screen
Guidance" on page 76).
Scrolling the map display
Whenever you switch to the map display, your current position is shown just below the centre
of the display (or in the centre if "MAP ORIENTATION" is set to "NORTH UP"; see
"Changing the Factory Settings" on page 99). However, you can scroll the map in any direction
using the joystick; simply push the joystick in the direction you wish to scroll. Eight directions
of movement are possible.
• If you hold down the - button while scrolling the map, minor roads will be suppressed from the
display. This increases the scrolling speed.
To stop scrolling, release the joystick and allow it to return to the centre position. Scrolling will
stop immediately. To return the map to a display of your current location again, press the N
(NAVI) button on your Navigation commander.
Scrolled map showing cross hairs.
5
Scroll location. The cross hairs indicate a position on the map when you scroll away
from your current location. (A straight line connects your current location with the point
marked by the 5.)
9
Distance from your current location to the point indicated by the 5.
%DVLF2SHUDWLRQ
Viewing detailed information
As you scroll, you can obtain detailed information about any location. Click the -button;
"DESTINATION" appears on the display. If information is available details are shown at the
bottom of the display.
“DESTINATION” button
Detailed information
DESTINATION button
If you click the - button, the selected location (indicated by 5) is set as the destination.
Detailed information
The detailed information may include the following:
• Detailed street names
• Detailed city, town, or village names
• House number ranges
• The name of personal destination
• Information about points of interest overlaid on the map. (See "Working with points of interest" on
page 69.)
&OLFNWKH-EXWWRQ
"DESTINATION" and related information are displayed if available.
• If 5 is positioned over a road, the road is highlighted in light blue.
• More than one item of information may be available for a particular location.
6ZLWFKEHWZHHQPXOWLSOHLWHPVRILQIRUPDWLRQXVLQJWKH)DQG*EXWWRQV
&OLFNWKH-EXWWRQWRVHWDURXWHWRWKHVHOHFWHGORFDWLRQVHHVWHSRI)LQGLQJD
'HVWLQDWLRQRQWKH0DSRQSDJH
• Press the ( button to clear "DESTINATION" and the information.
Changing the map scale
The current map scale is indicated by the map scale indicator toward the bottom right of the
map. You can easily increase or decrease the map scale (zoom in or zoom out) using the ) and
* buttons on the Navigation commander. Each click steps the scale up or down in the following
order:
25 m/ 50 m/ 100 m/ 200 m/ 500 m/ 1 km/ 2 km/ 5 km/ 10 km/ 20 km/
50 km/ 100 km/ 200 km/ 500 km. (0.02 mi/ 0.05 mi/ 0.1 mi/ 0.25 mi/
0.5 mi/ 0.75 mi/ 1 mi/ 2.5 mi/ 5 mi/ 10 mi/ 25 mi/ 50 mi/ 100 mi/ 250 mi.)
Hold the button down to zoom in or out in smaller increments.
Your First Destination
You have now learned how to interpret the information shown on the display and are ready to
begin using your Mobile Navigation System to navigate to a destination. The next step is to use
the Destination menu to tell the system about your first destination. Depending on what you
know about your intended destination, and the type of place it is, read the appropriate section
of "Setting a Route to Your Destination" as follows.
Read section "Finding a Destination by Street/City Search" on page 55 if:
• You have the full address of your destination
• Your destination is the centre of a city, town, or village
• You don’t know the exact address, but can locate your destination manually once a map of the nearest
city, town, or village is displayed on the screen.
Read section "Finding a Destination by Specific Post Code" on page 62 if:
• You know only the post code of your destination
• You want to view a particular post code area on the map and then manually choose a nearby
destination
• You know the post code, street name, and house number of your destination.
Read section "Setting a Route to a Specific Point of Interest" on page 64 if:
• You want to route to a railway station, tourist information office, or similar point of interest in a
particular city, town, or village
Read section "Finding a Destination on the Map" on page 71 if:
You want to manually search for a destination because you have no other information about it
• Setting a route using the map is most useful if your destination is nearby, or if you are familiar with
the geographical area.
6HWWLQJD5RXWHWR\RXU'HVWLQDWLRQ
,QWKLVFKDSWHU\RXZLOOOHDUQKRZWRILQGDGHVWLQDWLRQIRUURXWLQJKRZWRVHWDURXWH
KRPHDQGKRZWRXVHWKHRWKHUURXWLQJIXQFWLRQVRIIHUHGE\\RXU3LRQHHU0RELOH
1DYLJDWLRQ6\VWHP7KHVHIXQFWLRQVDUHDYDLODEOHIURPWKH'HVWLQDWLRQPHQX7KH
'HVWLQDWLRQPHQXDSSHDUVZKHQHYHU\RXSXVKWKHK0(18EXWWRQXQOHVV\RXDUH
DOUHDG\LQJXLGDQFHPRGHLQZKLFKFDVHWKH*XLGDQFHPHQXLVGLVSOD\HGVHH³*XLGDQFH
WR<RXU'HVWLQDWLRQ´
The Destination menu allows you to set a route to:
• a previously visited destination
• back home or to a previously stored location (if they have been registered)
• a location identified by address, partial address, or post code
• a point of interest chosen from a list
• a specified point on the map.
• Some roads and streets have restrictions that limit access to certain types of vehicle. In order to set a
correct route, your Mobile Navigation System must know what type of vehicle you are driving. Make
sure you correctly select your vehicle type before attempting to set a route (see “Vehicle type” on
page 107).
• The “GO TO (registered location name)” item appears only after a stored location is registered. If no
stored location has been registered, it reads “ROUTE TO ...” - and you can register a location by
choosing it.
CAUTION
• Remember: do not operate your Mobile Navigation System while in motion if
doing so will divert your attention from the safe operation of your vehicle. To be
safe, pull over and come to a halt before using any of the functions in the
Destination menu. Always observe safe driving rules and follow all existing traffic
regulations.
Setting a Route Using the Destination History
The Destination history allows you to easily obtain guidance from your current location to any
previously visited location.
Using the Destination history
The Destination history is a convenient list of places that you have routed to in the past. Up to
98 previous destinations are stored in the list, and you can rename or delete particular listings
at any time. To set a route back to one of these listings, all you have to do is to select it from
the list.
• If you are using your Mobile Navigation System for the first time, the Destination history will be
empty and you cannot select your destination by this method.
CAUTION
• For safety reasons, this function is not available while your vehicle is in motion.
Stop and apply the handbrake before use.
8VHWKHMR\VWLFNWRVHOHFW³'(67,1$7,21+,6725<ÍURPWKH'HVWLQDWLRQ
PHQXDQGFOLFNWKH-EXWWRQ
The screen displays a list of your previous destinations.
• The number of destinations in the list is shown at top right.
• Listings that have been ticked (see “Working with the Destination history” on page 48) appear at the
top of the list (in alphabetical order), followed by the listings that have not been ticked.
• Destinations that have been renamed also display the 7 (voice operation) icon, and may be selected
by voice command (see “Routing to personal destinations” on page 122).
• If the list is too long to show on the screen, a green arrow at the top or bottom of the screen indicates
that there are more destinations in the list; you can scroll up or down to them using the joystick.
• Once the Destination history reaches 98 listings, each new entry will automatically displace the oldest
destination in the list. However, destinations with tick marks will not be erased (see “Working with
the Destination history” on page 48).
• If you have not yet obtained guidance to a destination, the Destination history will be empty and “NO
DESTINATION HISTORY AVAILABLE” will be displayed.
6HOHFWDGHVWLQDWLRQIURPWKHOLVWXVLQJWKHMR\VWLFNDQGWKHQFOLFNWKH-EXWWRQWR
VHWDURXWHWRLW
The screen displays “MOTORWAY PRIORITISED”.
Alternatively, if you wish to confirm the selected destination on the map before
setting a route, click right with the joystick to select the Map icon ;.
The map is displayed with the selected destination at the centre. See “Finding a
Destination on the Map” on page 71 for how to proceed.
,I\RXGRQRWKLQJIXUWKHUWKHQZLWKLQDVKRUWWLPH\RXU0RELOH1DYLJDWLRQ
6\VWHPZLOOEHJLQZRUNLQJRXWDVXJJHVWHGURXWHWR\RXUFKRVHQGHVWLQDWLRQ
0RWRUZD\VZLOOEHXVHGLIDYDLODEOH
Once found, the route appears as a bold green line on the map. Guidance begins immediately
(see “Guidance to Your Destination”).
• There may be instances where a motorway may not be used in a route that is set even though
“MOTORWAY PRIORITISED” is selected.
• By default, routes are set via motorways if appropriate.
• Various criteria are taken into consideration in setting a route, and it may take your system a short
time to find the suggested route.
,I\RXZDQWWRDYRLGXVLQJPRWRUZD\VWKHQFOLFNWKH-EXWWRQZKLOHWKHDERYH
PHVVDJHLVGLVSOD\HG
The screen displays “AVOID MOTORWAY”.
,I\RXGRQRWKLQJIXUWKHUZLWKLQDVKRUWWLPH\RXU0RELOH1DYLJDWLRQ6\VWHP
ZLOOEHJLQZRUNLQJRXWDVXJJHVWHGURXWHWR\RXUFKRVHQGHVWLQDWLRQZKLOH
DYRLGLQJPRWRUZD\V
Once found, the route appears as a bold green line on the map. Your current location is
automatically displayed, and guidance begins immediately (see “Guidance to Your
Destination”).
• There may be instances where a motorway may be used in a route that is set even though “AVOID
MOTORWAY” is selected.
• If the distance to the destination is very far, there may be times when the message, “The route could
not be found” will be shown and the route will not be set. When this happens, set the destination to
a location close to the present location and divide the route in to multiple parts.
Working with the Destination history
Whenever you set a route, your destination is automatically added to the Destination history
(up to a total of 98). However, you are free to make changes to any listing in the Destination
history at a later time. Follow these instructions to manage and personalise your Destination
history listings.
CAUTION
• For safety reasons, these functions are not available while your vehicle is in
motion. Stop and apply the handbrake before use.
6HOHFWDGHVWLQDWLRQIURPWKH'HVWLQDWLRQKLVWRU\XVLQJWKHMR\VWLFN
The listing is highlighted in yellow.
• Note the = which appears to the left of each listing as it is highlighted.
6HOHFW=E\FOLFNLQJWKHMR\VWLFNWRWKHOHIW
The screen displays a list of available options.
ADD TO PRIORITY LIST
Places a tick to the left of the listing in the Destination history. You are also given the
opportunity to name the listing.
A ticked listing:
• is sorted to the top of the Destination history alphabetical
• is shown on the map by the 8 icon; only at map scales of 25 m to 500 m (0.02 mile to
0.5 mile)
• is marked with the 7 (voice operation) icon and can be routed to with a voice command
(as long as it has been renamed).
1RWH
• You can mark up to 50 listings with ticks in the Destination history.
• If you choose a ticked listing from the Destination history, the name of this menu changes to
“RENAME THIS DESTINATION” and you will be asked to rename the destination. If you choose
to rename the destination, click the - button.
• If the Destination history exceeds the limit (98), listings are deleted beginning with the oldest.
However, ticked listings will not be automatically deleted.
DELETE FROM PRIORITY LIST
Removes the tick mark from the listing.
• This menu is only displayed when a destination that has already been marked with a tick is selected.
DELETE
Permanently deletes the listing from the Destination history.
DELETE ALL DESTINATIONS
Permanently deletes every listing from the Destination history.
• Use “DELETE” and “DELETE ALL DESTINATIONS” with great care. Once deleted, the
information cannot be recovered.
0DNH\RXUFKRLFHXVLQJWKHMR\VWLFNDQGWKHQFOLFNWKH-EXWWRQ
• If you choose “ADD TO PRIORITY LIST” you are asked if you want to rename the listing.
If you choose “YES”, the text palette is displayed and you can enter a name. The new name
appears with a tick mark. If you choose “NO”, the old name is retained and appears with a
tick mark.
1RWH
• You can give a name of 6 to 23 characters.
• See “ The Text Palette” on page 38 for details of text input.
• Once a listing has been renamed, it is available for routing by voice (see “Routing to personal
destinations” on page 122).
• Take care not to register a name that is already a voice command or point of interest category.
Doing so may lead to incorrect voice operation.
• If you choose “DELETE FROM PRIORITY LIST”, the tick mark is removed.
• If you choose “DELETE” or “DELETE ALL DESTINATIONS”, you are asked to confirm
that you want to delete. Choose “YES” to delete the listing(s).
After making a selection, the Destination history is displayed again.
Setting a Route Home or to the Stored Location
Use these functions to quickly set a route back home or to a particular “stored location” from
wherever you are.
• You can register a single stored location for easy and quick routing from any current location. One
use of this feature might be to store the location of your office, for example. Or you might enter a
favourite restaurant that you often visit.
Setting a route home
This sets a route to your home location if you have registered one.
8VHWKHMR\VWLFNWRVHOHFW³5287(%$&.+20(ÍURPWKH'HVWLQDWLRQPHQX
DQGFOLFNWKH-EXWWRQ
The screen displays “MOTORWAY PRIORITISED”. See step 3 to 5 of “Using the Destination
history” on page 46 for details of how to proceed.
• If you have not registered your home location, you will then be given the choice of registering it. For
details of how to register your home location, see “Registering your home location” on page 21.
Setting a route to the stored location
This sets a route to the stored location if you have registered one.
8VHWKHMR\VWLFNWRVHOHFW³*272UHJLVWHUHGORFDWLRQQDPHÍURPWKH
'HVWLQDWLRQPHQXDQGFOLFNWKH-EXWWRQ
The screen displays “MOTORWAY PRIORITISED”. See step 3 to 5 of “Using the Destination
history” on page 46 for details of how to proceed.
• If you have not registered a location, you will then be given the choice of registering one. For details
of how to register the stored location, see “Registering locations” below.
• Before a stored location is registered, this menu item reads “ROUTE TO...”. When you register a
location, it becomes “GO TO (registered location name)”.
Registering locations
Before setting a route home or to the stored location, you must register these locations. You
may have registered your home when you first switched on the system. You can change or
delete these registered locations at any time.
• If you try to set a route home or to the stored location without first registering its location, a message
is displayed asking if you wish to register the location now. Select “Now” and click the - button to
proceed to step 2 below.
6HOHFW³5287(%$&.+20(´RU³5287(72ÍURPWKH'HVWLQDWLRQPHQX
XVLQJWKHMR\VWLFN&OLFNOHIWZLWKWKHMR\VWLFN
• If a home address or stored location has already been registered, you can remove it by highlighting
“DELETE” with the joystick and clicking the - button. In this case, you will be asked to confirm
that you want to delete the location. Highlight “YES” and click the - button to delete. The registered
address or stored location is deleted and you are returned to the Destination menu. You will not be
able to use the “ROUTE BACK HOME” or “GO TO (registered location name)” feature again until
you register a new location.
7RUHJLVWHU\RXUKRPHORFDWLRQRUDVWRUHGORFDWLRQRUWRFKDQJHDSUHYLRXVO\
UHJLVWHUHGORFDWLRQVHOHFW³5(*,67(5´XVLQJWKHMR\VWLFNDQGFOLFNWKH-
EXWWRQ
)ROORZWKHSURFHGXUHLQ³)LQGLQJD'HVWLQDWLRQE\6WUHHW&LW\6HDUFK´RQSDJH
WRLQSXW\RXUKRPHDGGUHVVRUWKHDGGUHVVRIWKHORFDWLRQWREHVWRUHG
A map showing the selected location is displayed.
&OLFNWKH-EXWWRQ
Your home address or the address you have entered for the stored location is displayed.
,IUHJLVWHULQJWKHVWRUHGORFDWLRQFOLFNWKH-EXWWRQWRGLVSOD\WKHWH[WSDOHWWH
If you are registering your home address, simply click the - button to complete the process and
return to the Destination menu.
(QWHUDQDPHIRUWKHORFDWLRQDQGWKHQKLJKOLJKW³'21(´&OLFNWKH-EXWWRQ
A message confirming registration of the name is displayed. The System also reads back the
name.
• The name can be 6 to 23 characters long.
• See “The Text Palette” on page 38 for instructions on using the text palette.
+LJKOLJKW³<(6´DQGFOLFNWKH-EXWWRQLIWKHSURQXQFLDWLRQZDVFRUUHFW
The stored location is registered and the Destination menu is displayed.
You can now proceed to set a route home or to the stored location.
• If you wish to hear the pronunciation again, select “REPEAT”. If the pronunciation is incorrect, select
“NO” and the text palette will appear once again for you to enter a new name. Be sure to input a
different name which is easy to pronounce.
•
< appears on the map at your home location and G marks the stored location (at map scales of 25 m
to 500 m, 0.02 mile to 0.5 mile).
Finding a Destination by Street/City Search
If you know the address of your destination, you can set a route to it using the “STREET/CITY
SEARCH” function. Even if you only know the city, town, or village your destination is in, or
perhaps know only the street name and an intersecting street, you can locate the intersection on
the map and then route there. Other uses of this function are to route to any city or town centre,
or to find a route to a particular road or motorway.
CAUTION
Entering city/town and street information
The first step in using this function is to tell the system which city, town, or village your
destination is in, and the name of the street or road.
6HOHFW³675((7&,7<6($5&+ÍURPWKH'HVWLQDWLRQPHQXXVLQJWKHMR\VWLFN
DQGFOLFNWKH-EXWWRQ
The city/town text entry palette appears.
8VHWKHWH[WHQWU\SDOHWWHWRHQWHUWKHQDPHRIWKHFLW\WRZQRUYLOODJHWRZKLFK
\RXZDQWWRVHWDURXWH<RXPD\HQWHURQO\WKHILUVWIHZOHWWHUVKLJKOLJKW³2.´
DQGWKHQFOLFNWKH-EXWWRQWRYLHZDOLVW
A list of cities, towns, and villages that match your input appears below the text palette.
• See “ The Text Palette” on page 38 for instructions on using the text entry palette.
• If you don’t know which city, town, or village your destination is in, select E. In this case, the street
input display appears (go directly to step 4 below).
• As an alternative, you can obtain a list of recently searched cities, towns, and villages by selecting D.
&OLFNWKHMR\VWLFNGRZQWRHQWHUWKHOLVWDQGWKHQKLJKOLJKW\RXUFKRLFHLQ\HOORZ
• Scroll quickly up and down using the ) and * buttons.
• You can also click to the left (toward =) to get more information about the highlighted city, town, or
village.
Alternatively, you can view the highlighted city, town, or village on the map, adjust
the location if desired by scrolling the map, and then set a route directly to it. To do
this, click right with the joystick (toward ;) and follow the instruction for “Finding
a Destination on the Map” on page 71 below.
&OLFNWKH-EXWWRQ
The street input display appears.
You can continue entering more details about your destination, such as a road or street name.
8VHWKHWH[WSDOHWWHWRHQWHUWKHQDPHRIWKHVWUHHWRUDPRWRUZD\GHVLJQDWLRQLH
0<RXFDQLI\RXOLNHHQWHURQO\WKHILUVWIHZOHWWHUVRIDQDPH+LJKOLJKW
³2.´DQGWKHQFOLFNWKH-EXWWRQ
A list of matching motorways, roads, and streets appears.
• In some cases, you should enter the root name of a street only. For example, in the case of “Upper
Bond Street” , input only “Bond”.
• Alternatively, if you don't know the name of the street, or if you wish to route to the centre of the city,
town, or village you selected above, simply choose E instead of “OK”. In this case, you will be asked
whether you want to use motorways or not, and then route setting to the city, town, or village centre
will begin immediately (see steps 3 to 5 of “Using the Destination history” on page 46).
8VHWKHMR\VWLFNWRFOLFNGRZQDQGKLJKOLJKWDURDGRUVWUHHWIURPWKHOLVW&OLFN
WKH-EXWWRQWRVHOHFWWKHKLJKOLJKWHGOLVWLQJDQGFRQWLQXHHQWHULQJLQIRUPDWLRQ
DERXW\RXUGHVWLQDWLRQVXFKDVDKRXVHRUEXLOGLQJQXPEHULQWKHFDVHRIDQ
XUEDQVWUHHWRUDQLQWHUVHFWLRQ
• You can also click to the left (toward =) to get more information about the highlighted road or street.
Alternatively, you can search for a street on the map and immediately set a route to
it. To do this, highlight it, click right with the joystick, and follow the instructions for
“Finding a Destination on the Map” on page 71 below.
If you clicked the - button above, the next step depends on what information you entered.
• If you did not enter the name of a city, town, or village, and if there is more than one street
matching the name you have input, you will now see a list of choices that match the name
you entered.
• If you did enter a city, town, or village, and your street choice was a motorway or major road
without house numbers, you can now search for its intersection with another road or street;
go to “Entering intersecting street information”.
• On the other hand, if the street you entered has house numbers and the data is available in
the map disc, you can choose a number as your destination; go to “Entering house number
information”.
Selecting a city, town, or village
If you failed to give a city, town, or village in “Entering city/town and street information”
above, or if there is more than one street matching the name you have input, then you will be
presented with a list of cities, towns, and villages that have a matching road or street. The next
step is for you to choose which of these matching places you want to make your destination.
A list of cities, towns, or villages with matching streets is displayed.
+LJKOLJKWDFLW\WRZQRUYLOODJHDQGFOLFNWKH-EXWWRQWRVHOHFWLW
• Click left with the joystick to obtain more information about the highlighted city, town, or village.
• If you input a city, town, or village street at the street input display and now choose “NEAREST
CITY”, you are asked if you want to route using motorways or not. Route setting then begins to the
closest point on the selected street (see steps 3 to 5 in “Using the Destination history” on page 46).
• If you selected a motorway at the street input display and choose “NEAREST CITY”, route setting
then begins at the nearest junction on the selected motorway.
• If you have chosen a road with house numbers, read the section “Entering house number
information”.
Alternatively, you can view the selected street on the map and then set a route directly
to it; to do this click to the right (toward ;) and follow the instructions for “Finding
a Destination on the Map” below.
Entering house number information
If the road or street you selected is one with house numbers and the map disc includes this
information, then you can specify a particular house number as your destination.
The house number input display appears.
,QSXWWKHKRXVHQXPEHURI\RXUGHVWLQDWLRQXVLQJWKHWH[WHQWU\SDOHWWHKLJKOLJKW
³2.´DQGFOLFNWKH-EXWWRQ
You will be asked whether to route using motorways or not, then a route will be set to the
location corresponding to the selected house number (as in steps 3 to 5 in “Using the
Destination history” on page 46).
• Use of the text palette is described in “The Text Palette” on page 38.
• You can highlight E to route to the closest point on the street.
• You can highlight B to choose an intersecting street as your destination (see “Entering intersecting
street information” below).
• If the house number you input is invalid, a list of house number ranges is displayed (see “Choosing a
house number range” below).
Choosing a house number range
If the house number you input is invalid, a list of house number ranges will be displayed.
+LJKOLJKWWKHUDQJH\RXZLVKWRVHWDVDGHVWLQDWLRQE\VFUROOLQJGRZQWKHOLVW
ZLWKWKHMR\VWLFNDQGFOLFNLQJWKH-EXWWRQ<RXZLOOEHDVNHGZKHWKHUWRURXWH
XVLQJPRWRUZD\VRUQRWWKHQDURXWHZLOOEHVHWDVLQVWHSVWRLQ³8VLQJWKH
'HVWLQDWLRQKLVWRU\´RQSDJH
As an alternative, you can view the chosen section of road on the map and
immediately set a route to it. To do this, highlight it, click right with the joystick, and
follow the instructions in “Finding a Destination on the Map” below.
Entering intersecting street information
If the road or street you have selected does not have house numbers or if there are no house
numbers in the map data, you may specify an intersection as your destination.
The intersecting street display appears, showing a list of all streets and roads that intersect with
the one previously entered.
6FUROOGRZQWKHOLVWWRKLJKOLJKWDQLQWHUVHFWLRQ&OLFNWKH-EXWWRQWRVHWDURXWH
WRWKHKLJKOLJKWHGLQWHUVHFWLRQ
You will be asked whether to use motorways or not (as described in steps 3 to 5 of “Using the
Destination history” on page 46).
• You can obtain more information about the intersection by clicking left on a highlighted entry.
As an alternative, you can view the intersection on the map and immediately set a
route to it. To do this, highlight the name of the intersecting street, click right with
the joystick, and follow the instructions for “Finding a Destination on the Map”
below.
Finding a Destination by Specific Post Code
You can choose a post code as your destination. A post code defines a particular geographical
area consisting of a number of streets. After entering a post code, you can view a map centring
on the post code area, or narrow your search by continuing to enter street and street number
information. If you know the post code of your destination, this may be the quickest way to
locate it for route setting.
CAUTION
8VHWKHMR\VWLFNWRVHOHFW³3267&2'(6($5&+ÍURPWKH'HVWLQDWLRQPHQX
DQGFOLFNWKH-EXWWRQ
The post code text palette appears.
8VHWKHWH[WSDOHWWHWRHQWHUWKHSRVWFRGH:KHQ\RXKDYHILQLVKHGKLJKOLJKW
³2.´DQGWKHQFOLFNWKH-EXWWRQ
A list of matching post codes is displayed.
• Select the D icon to display a list of recently selected post codes.
• When entering the post code, for instance, enter “SL2 4” instead of “SL2 4QP”.
)URPWKHOLVWRISRVWFRGHVKLJKOLJKWRQHDQGFOLFNWKH-EXWWRQ
The street input display appears. Proceed as in steps 4 and 5 of “Entering city/town and street
information” on page 55.
A right click with the joystick will display a map view of the post code area. Click
the - button to route to the 5 mark in the centre of the map or reposition the 5 mark
to a desired location in the post code area, then press - to set the 5mark as your
destination.
Setting a Route to a Specific Point of Interest
The map information on the CD-ROM includes the location of many points of interest. These
range from railway stations to amusement parks and restaurants. You can use this function to
quickly locate and route to any one of these points of interest. You can, for example, look for
a particular type of cuisine within a certain distance of your present location and set a route
there. Or you can choose museum from a list and route there. It is also possible to overlay
certain points of interest on the maps, so you might, for example, choose to always show hotels
offering a particular chain.
CAUTION
Choosing a point of interest
8VHWKHMR\VWLFNWRVHOHFW³6($5&+%<32,1762),17(5(67ÍURPWKH
'HVWLQDWLRQPHQXDQGFOLFNWKH-EXWWRQ
A list of point of interest categories appears in alphabetical order. Each is illustrated with an
icon; this icon will appear on the map if you choose to display a particular type of point of
interest.
• For instructions on displaying points of interest on the map, see “Working with points of interest”
below.
• The point of interest categories shown on the list being displayed will vary depending on the Map
Disc in use.
+LJKOLJKWDFDWHJRU\XVLQJWKHMR\VWLFNDQGFOLFNWKH-EXWWRQ
• If the category you choose is a service station or another type of chain point of interest category, you
are presented with a list of chain names. If you choose restaurants, you are presented with a list of
types of cuisine, such as “CHINESE” or “FRENCH”. Choose the chain or cuisine type you are
interested in.
You are then given the choice of listing all points of interest of the chosen type, searching for
one by name or searching the list for those within a particular city, town, or village or within a
certain distance of your present location.
• If you wish to search for all categories at once, select “CATEGORY TYPE UNKNOWN” from the
bottom of the list.
• If you select “CATEGORY TYPE UNKNOWN” from the list, “SEARCH BY NAME” and “LIST
ALL” will not appear on the menu.
&KRRVHKRZ\RXZLVKWRYLHZWKHPDWFKLQJSRLQWVRILQWHUHVWDQGFOLFNWKH-
EXWWRQ
Search by name
You are presented with a text palette where you enter the name of the point of interest.
8VHWKHWH[WSDOHWWHWRHQWHUWKHQDPHRIWKHSRLQWRILQWHUHVW:KHQ\RXKDYH
ILQLVKHGKLJKOLJKW³2.´DQGFOLFNWKH-EXWWRQ
A list of matching points of interest is displayed.
+LJKOLJKWDSRLQWRILQWHUHVWDQGFOLFNWKH-EXWWRQWRVHWDURXWHWRLW
You will be asked whether to avoid motorways or not (as described in steps 3 to 5 of “Using
You may highlight a point of interest, then click right with the joystick to view it on
the map (see “Finding a Destination on the Map” on page 71).
Search by distance
You have the choice of listing matching points of interest in the distance ranges 0-5 km, 0-10
km, or 0-15 km (0-3 miles, 0-6 miles, or 0-9 miles).
+LJKOLJKWDUDQJHDQGFOLFNWKH-EXWWRQ
A list of matching points of interest is displayed.
• If no points of interest in the chosen category are available within the distance specified, “The
specified type (chain category) is not in this area” is displayed.
• The direction to each point of interest from the current location is shown by an arrow.
• Up to 30 points of interest in order of distance from your present location are displayed. If you wish
to modify the chosen distance range, simply highlight a different one and click the - button; the list
will change to reflect your new selection.
+LJKOLJKWDSRLQWRILQWHUHVWIURPWKHOLVWDQGFOLFNWKH-EXWWRQWRVHWDURXWHWR
LW
You will be asked whether to avoid motorways or not (as described in steps 3 to 5 of “Using
You may highlight a point of interest, then click right with the joystick to view it on the map (see
“Finding a Destination on the Map” on page 71).
Search by city
The city/town display appears.
8VHWKHWH[WSDOHWWHWRLQSXWWKHQDPHRIDFLW\WRZQRUYLOODJH
+LJKOLJKW³2.´DQGFOLFNWKH-EXWWRQ
A list of cities, towns, or villages matching your input is displayed.
+LJKOLJKWDQDPHRQWKHOLVWDQGFOLFNWKH-EXWWRQ
You are presented with another text palette where you enter the name of the point of interest
you wish to route to.
You may highlight a city, town, or village then click right with the joystick to view
it on the map (see “Finding a Destination on the Map” on page 71).
List all
A list of all points of interest in the selected category appears. See “Search by name”.
Working with points of interest
You can choose to permanently display certain categories of point of interest on the map.
&KRRVH³6($5&+%<32,1762),17(5(67ÍURPWKH'HVWLQDWLRQPHQX
A list of point of interest categories is displayed.
+LJKOLJKWDFDWHJRU\DQGFOLFNOHIWZLWKWKHMR\VWLFN
A list of options displayed.
Overlay this category
The category is Marked with a tick and icons indicating the location of points of interest in this
category appear on the map.
• A tick appears to the left of the category on the list.
Specific chain
The category is marked with a tick and a display allowing selection of a chain type appears.
Select a chain type and click the -button to show the map view of the category selected. (You
can select only one chain type.)
Eliminate this category
The tick to the left of the category is deleted and the icons representing points of interest in the
category are removed from the map.
• Up to two categories can be marked with a tick at any one time.
• Icons representing the chosen categories are displayed only at map scales of 25 m to 500 m
(0.02 mile to 0.5 mile).
&KRRVHRQHRIWKHWKUHHRSWLRQVDQGFOLFNWKH-EXWWRQ
You are returned to the list of point of interest categories.
MAP SEARCH: Returning to the Map to Find a Destination
In Map mode you may switch to Destination menu and return to the map without losing your
last map position. This is useful in searching for a destination on the map.
&KRRVH³0$36($5&+ÍURPWKH'HVWLQDWLRQPHQX
The map appears. The map displayed is the one shown when it was last used. Go to step 2 of
“Finding a Destination on the Map” below.
• If the map was left in scroll mode when it was last used, it appears again in scroll mode.
• If the N (NAVI) button was used to display your current position when the map was last used, your
current position is displayed.
Finding a Destination on the Map
There are many occasions when you might want to view a possible destination on the map
before setting a route to it. Whenever you see ; to the right of a highlighted listing, you can go
directly to a map display showing the listed item in the centre. It is then an easy matter to scroll
the map to a nearby location if required, and set a route to it.
&OLFNWKHMR\VWLFNWRWKHULJKWZKLOHDOLVWLQJLVKLJKOLJKWHG
A map will be displayed. The selected location is marked in the centre of the display with 5.
• If the location you have selected is a city, town, or village, then
town/village.
5
indicates the centre of the city/
,I\RXZDQWWRURXWHWRDORFDWLRQQHDUE\VFUROOWKHPDSXVLQJWKHMR\VWLFN
• You can also use the ) and * buttons to increase or decrease the scale of the map.
:KHQ\RXDUHVDWLVILHGZLWKWKHORFDWLRQDQGZDQWWRVHWDURXWHWRLWFOLFNWKH-
EXWWRQ
“DESTINATION”and related information are displayed if available.
• If you press the N (NAVI) button, the map will return to a display of your present location, shown
by M. All destination information you have input will be lost, and you will have to begin the process
of finding your destination once again.
6HWDURXWHWRWKHORFDWLRQLQGLFDWHGE\FOLFNLQJWKH-EXWWRQ
The screen displays “MOTORWAY PRIORITISED”. For other options follow steps 3 to 5 in
“Using the Destination history” on page 46).
Settings
You can use the Settings menu to customise the appearance and behaviour of your Mobile
Navigation System. Display it by selecting “SETTINGS” in the Destination menu. Full details
of the various settings are given in “Customising the System”. The settings related to this
chapter, “Setting a Route to Your Destination”, are listed below.
TIME TURN RESTRICTION:
Allows you to specify whether access restrictions that vary with time are taken into account
when setting a route. The default setting is “OFF”. You are responsible for setting the correct
time when using this function.
AREAS TO BE AVOIDED:
Allows you to specify areas that will be avoided when setting a route to your destination. This
feature allows you to avoid congestion-prone areas.
VEHICLE TYPE:
Allows you to specify the type of vehicle you are driving. This is important, since accurate
route setting depends on the system knowing your vehicle type. The default setting is
“SALOON CAR”.
HOME LOCATION:
Allows you to register your home for easy routing. (This can also be done from the Destination
menu; see “Registering locations” on page 52.)
PREFERRED DESTINATION:
Allows you to specify a stored location for easy routing. (This can also be done from the
Destination menu; see “Registering locations” on page 52.)
SHORT MENUS:
Allows you to reduce the menu to a short list of the most-used items.
*XLGDQFHWR<RXU'HVWLQDWLRQ
,QWKHSUHYLRXVVHFWLRQ\RXOHDUQHGKRZWRILQGDGHVWLQDWLRQDQGWKHQVHWDURXWHWRLW
2QFH\RXKDYHVHOHFWHGDGHVWLQDWLRQ\RXU0RELOH1DYLJDWLRQ6\VWHPZLOOZRUNRXWWKH
EHVWURXWHIRU\RX7KLVPD\WDNHVHYHUDOVHFRQGV,WWKHQGLVSOD\VWKHVXJJHVWHGURXWHRQ
WKHPDS$V\RXEHJLQGULYLQJLWSURYLGHVDOOWKHJXLGDQFH\RXQHHGWRUHDFK\RXU
GHVWLQDWLRQE\WKHFDOFXODWHGURXWH7KLVFKDSWHUJLYHVGHWDLOVRIWKHJXLGDQFHIXQFWLRQV
RIIHUHGE\WKHV\VWHP
CAUTION
• This Mobile Navigation System is intended solely as an aid to you in the operation
of your vehicle. It is not a substitute for your attentiveness, judgment, and care
when driving. Do not use the Navigation commander or look at the display if doing
so will divert your attention from the safe operation of your vehicle. Always
observe safe driving rules and follow all existing traffic regulations.
About Screen Guidance and Voice Guidance
Your Mobile Navigation System provides you with directions as you drive toward your
destination. As well as screen instructions, you will hear voice directions.
Initiating Guidance
Your Pioneer Mobile Navigation System automatically switches to guidance mode once a route
has been set. Once route setting is completed, the map appears on the display and your current
location is shown by M. The suggested route appears as a bold bright green line leading away
from your vehicle’s position as marked by M.
%HJLQGULYLQJLQWKHGLUHFWLRQLQGLFDWHGE\M
• As you drive, the Mmark showing your vehicle's position moves accordingly.
Voice Guidance
Your Mobile Navigation System provides voice directions simultaneously with on-screen
guidance. This feature allows you to concentrate on driving, eliminating the need for you to
continually monitor the display.
When do you hear voice directions?
Once under guidance, you will hear directions telling you what to do at each upcoming turn.
What if you miss an instruction?
If you want to hear a repeat of the latest guidance, simply press the N (NAVI) button on the
Navigation commander. You will hear the directions for the upcoming turn once again.
What do you hear?
As you drive in guidance mode, the system will provide you with a range of information about
upcoming turns and the streets you are passing. It also warns you when you are nearing your
destination. You will hear:
• Distance to the next turn or other instruction
• The turn direction
• Names of motorways
• Final destination
• Guidance is available using three different voices, two recorded (female or male) and the other
synthesised. You choose between them using the “GUIDANCE VOICE” setting on page 107.
On-screen Guidance
Guidance is also given through on-screen instructions whenever the system is in guidance
mode. Here you will learn how to interpret the various information presented to you on the
screen, and how to customise the display of guidance information.
Guidance modes
You can obtain on-screen guidance in three different forms, or modes. “Map mode” indicates
your progress on the map with M. “Arrow mode” displays a simple representation of upcoming
intersections, indicating which way you should turn. “Split Screen mode” combines both
methods of guidance on the display.
Map mode
This is the mode that is displayed when guidance begins. In this mode, the position of your
vehicle is superimposed on the map. It provides an easily understood view of progress toward
your destination. The route is marked by a bold bright green line, and the direction in which
you are heading is clearly shown by M.
The following information is presented in this mode:
Name or designation of the next road or street on your route
(Name of motorway or motorway junction)
• If the information is too long to display in full, it is truncated with “...”
Distance to the next way point
Destination icon (if your destination is on the map)
Your route (in bright green.)
Remaining distance to your destination
Name or designation of current road or street
Way point icon
Compass icon
Origin icon (if your origin is on the map)
• As you approach a intersection, an enlarged map of the intersection is displayed. This makes it much
easier to navigate your way around complex intersections. If you scroll the map while in this enlarged
view, the normal map reappears.
• With “AUTO ROAD HIDING” turned on, minor roads are not displayed as long as you are on the
correct route and the street is a major street (see page 107).
Arrow mode
This mode presents you with a simple representation of upcoming intersections on your route.
It gives a clear indication of which way to turn. Although it provides no visual clue as to your
present position on the map, in contrast with “Map mode”, it provides simple and precise
directions for each turn as you approach it.
In this mode, the following information is presented on the display:
Name or designation of the next road or street on your route
(name of motorway or motorway junction)
• If the information is too long to display in full, it is truncated with “...”
Distance to the next way point
Your route (in bright green)
Your present position and direction (displayed by M as you approach an intersection only)
Name or designation of current road or street
Compass icon
Points of interest in the vicinity of you, current location (as selected for overlay on the map,
see “Working with points of interest” on page 69)
• Point of interest icons have three background colours:
No background: point of interest nearby
Green background: along regular route
Blue background: along motorway on the route
Remaining distance to your destination
Estimated time to your destination (up to 99 hours and 59 minutes)
• The actual time required to reach your destination may differ from that displayed depending on actual
vehicle speed and traffic conditions.
• If you are not on the correct route (such as in a car park or have just left the set route), a map is
displayed.
Displaying upcoming intersections
In Arrow mode, you can also view upcoming intersections.
:KLOHLQ$UURZPRGHFOLFNXSZLWKWKHMR\VWLFN
The display divides into two sections. The usual information about the next intersection is
shown to the left. On the right is information about intersections beyond the next one.
7RUHWXUQWRWKHQRUPDO$UURZPRGHGLVSOD\SUHVVWKHN1$9,EXWWRQ
Split Screen mode
In this mode, both the map and arrow guidance displays appear side by side. Although less
additional information is available on the screen, this mode is convenient because it gives
precise directions regarding upcoming turns while also allowing you to see your progress on
the map.
Switching between on-screen guidance modes
You can switch between the three guidance modes at any time without interrupting the flow of
directions.
&OLFNWKH-EXWWRQ
• As you click the - button, the mode cycles through the sequence: Map mode → Arrow mode → Split
Screen mode → Map mode.
• You can also set the guidance mode from the Guidance menu; see “Changing the Guidance Mode”
on page 91.
If You Stray from the Route
If for any reason you stray away from the suggested route, your Mobile Navigation System will
help you get back on track.
• If the “AUTO REROUTE” function is ON, it will automatically calculate a new route to your
destination within a short time of your vehicle leaving the set route.
• The “AUTO REROUTE” function can be turned off in the Settings menu; see page 102.
• If the “AUTO REROUTE” function is OFF and you are in Arrow mode or Split Screen
mode, the display automatically changes to Map mode. If you return to the set route, the
display will return to Arrow mode or Split Screen mode.
• If you fail to follow a route immediately after it has been first set, (such as if you leave in the
wrong direction when exiting a large car park, for example) the voice warning “Please
proceed to the highlighted route” will be given before rerouting takes place.
If You Take a Break
While being guided to your destination, you may need to stop to fill up with fuel or simply want
a rest. This poses no problem for your Mobile Navigation System; it will remember the
destination you have chosen. When you start your car up again, it will come on and resume
guidance where it left off when you stopped.
• When you start the engine after a break, the system may rebuild the route data. This may take a few
moments. Route guidance will begin when the process is finished.
• When you start the engine after a break, route guidance will begin in the same mode as displayed
when you stopped.
Settings
You can use the Settings menu to customise certain guidance characteristics. Display the
Settings menu by pressing the K (MENU) button while in guidance mode to display the
Guidance menu (see “Using the Guidance Menu”) and selecting “SETTINGS”. Full details of
the various settings are given in “Customising the System”. The settings related to this chapter
are explained below.
AUTO REROUTE:
Allows you to choose how the system behaves if you stray off the suggested route. Auto
rerouting is on by default.
GUIDANCE VOICE:
Allows you to specify whether one of the recorded voices (female or male) or the synthesised
voice is used to give guidance. The female recorded voice is the default setting.
AUTO ROAD HIDING:
Allows you to choose whether minor roads and streets are displayed or not. The default setting
is to hide minor roads and streets.
• If you are on the correct route and the route is along a major street, a simplified map is displayed.
8VLQJWKH*XLGDQFH0HQX
7KHUHDUHWLPHVZKHQ\RXPLJKWZDQWWRPRGLI\DURXWHWKDWKDVEHHQVHWE\\RXU3LRQHHU
0RELOH1DYLJDWLRQ6\VWHP2U\RXPD\HYHQZDQWWRDEDQGRQ\RXURULJLQDOGHVWLQDWLRQ
DQGFKRRVHDQRWKHURQH<RXUV\VWHPKDVDQXPEHURIIXQFWLRQVWKDWDOORZ\RXWRPDNH
VXFKFKDQJHVWR\RXUURXWHZKLOHLQJXLGDQFHPRGH<RXFDQDOVRORFDWHSRLQWVRILQWHUHVW
DORQJ\RXUURXWHURXWHDURXQGWUDIILFMDPVRUFDQFHOWKHURXWHDOWRJHWKHU7KHVH
IXQFWLRQVDUHDOODYDLODEOHIURPWKH*XLGDQFHPHQX<RXFDQGLVSOD\WKH*XLGDQFHPHQX
DWDQ\WLPHZKLOHLQJXLGDQFHPRGHE\SUHVVLQJWKHK0(18EXWWRQRQWKHQDYLJDWLRQ
FRPPDQGHU
The Guidance menu offers the following options:
• REROUTE — set an updated route to your destination
• RESUME ORIGINAL ROUTE — set a new route that returns to your original route after a
certain distance
• DETOUR — find a detour around a certain length of the road ahead
• Guidance mode - switch between Map mode/Arrow mode/Split Screen mode
• Set FURTHER destination — choose an onward destination to route to after your present
destination
• LOCAL POINTS OF INTEREST — locate (and route to) points of interest near your present
location
• VIEW MAP — display a map
• CANCEL ROUTE/NEW ROUTE — cancel routing altogether, or route to a new destination
CAUTION
• Remember: do not operate your Mobile Navigation System while in motion if
doing so will divert your attention from the safe operation of your vehicle. To be
safe, pull over and come to a halt before using any of the functions in the Guidance
menu. Always observe safe driving rules and follow all existing traffic regulations.
Displaying the Guidance Menu
The Guidance menu can be displayed at any time while under guidance by pressing the K
(MENU) button on the Navigation commander.
3UHVVWKHK0(18EXWWRQ
The Guidance menu is displayed.
• You can return to guidance mode by pressing the N (NAVI) button.
REROUTE: Setting a New Route to Your Destination
If you leave the set route, or for any other reason want to find a new route to your destination,
you can reroute from your present location using different parameters. The parameters you can
choose from are “SHORTEST ROUTE” and “FEWER TURNS”.
Choosing reroute parameters
REROUTE will find a new route to your destination that is either the shortest possible route or
a route with fewer turns.
CAUTION
Before choosing a reroute parameter, pull over when it is safe to do so and apply
the handbrake.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³5(5287(´DQGFOLFNOHIWZLWKWKHMR\VWLFN
WRZDUGWKH=LFRQ
The display gives you a choice of rerouting by the shortest possible route to your destination
or by a route using fewer turns.
0DNH\RXUVHOHFWLRQZLWKWKHMR\VWLFNDQGFOLFNWKH-EXWWRQ7KHQXVHWKH
MR\VWLFNWRKLJKOLJKW³'21(´DQGFOLFNWKH-EXWWRQ
The Guidance menu is displayed again.
• “SHORTEST ROUTE” means that reducing the route distance is a priority when you reroute.
• “FEWER TURNS” will set a route with the fewest possible turns when you reroute.
• Until you change this setting again, it will be used any time you choose to reroute as in “Rerouting to
your destination” below.
Rerouting to your destination
Once you have selected a reroute parameter, use the Guidance menu to actually reroute to your
destination from your present location.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³5(5287(´DQGFOLFNWKH-EXWWRQ
• The new route is calculated using the parameters selected in the “REROUTE” menu.
RESUME ORIGINAL ROUTE: Returning to the Original Route
If you stray from the route, you may want to find the quickest way back to the original route.
“RESUME ORIGINAL ROUTE” allows you to do this.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³5(680(25,*,1$/5287(´DQGFOLFN
WKH-EXWWRQ
• The shortest route back to the original route is calculated.
• Such settings as TIME TURN RESTRICTION and AREAS TO BE AVOIDED are ignored in finding
the way back to your original route.
DETOUR: Avoid the Road Ahead
As you follow the guidance provided by your Mobile Navigation System, you may wish to find
an alternative route that avoids a certain length of the road ahead. For example, you may hear
on the radio that the road ahead is heavily congested. In such a situation, “DETOUR” may be
able to find a route around the congestion by taking a less direct route at upcoming
intersections.
• Note that “DETOUR” cannot, in all cases, find an appropriate route, so it may not necessarily avoid
traffic congestion or other problems.
• Depending on the road layout, the detour function may not be able to begin a detour immediately.
Choosing the length of the detour
Before telling the system to plan a detour, you must decide how much of the route ahead to
detour. There are three options: 2 km, 5 km, or 10 km (1 miles, 3 miles, or 6 miles).
CAUTION
Before choosing the length of diversion, pull over when it is safe to do so and apply
the handbrake.
)URP*XLGDQFHPHQXKLJKOLJKW³'(7285´DQGFOLFNOHIWZLWKWKHMR\VWLFN
WRZDUGWKH=LFRQ
The display gives you a choice of distance settings.
0DNH\RXUVHOHFWLRQDQGFOLFNWKH-EXWWRQWRVHOHFWLW7KHQXVHWKHMR\VWLFNWR
KLJKOLJKW³'21(´DQGFOLFNWKH-EXWWRQ
The Guidance menu is again displayed.
• Until you change this selection, every time you choose “DETOUR”, the new route will be set for this
distance.
Setting a detour route
Once you have selected an appropriate length for detours, use the Guidance menu to actually
begin a detour from your present location.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³'(7285´DQGFOLFNWKH-EXWWRQ
A detour is calculated that returns you to the original route at the distance selected in the
“DETOUR” menu.
• Depending on the road layout, the actually length of the calculated detour may differ somewhat from
the specified distance. Also, the calculated detour may be longer than the original route.
• Depending on the road layout and road conditions, the DETOUR function may fail to find an
alternative route.
• In some cases, the detour route may overlap the original route for some distance.
Changing the Guidance Mode
You can change the Guidance mode from the Guidance menu.
CAUTION
Before choosing the length of diversion, pull over when it is safe to do so and apply
the handbrake.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³*8,'$1&(02'(´DQGFOLFNWKH-
EXWWRQ
You are presented with a selection of Map mode, Split Screen mode, or Arrow mode.
&KRRVHWKH*XLGDQFHPRGH\RXZDQWWREHGLVSOD\HGDQGFOLFNWKH-EXWWRQWR
VHOHFWLW7KHQXVHWKHMR\VWLFNWRKLJKOLJKW³'21(´DQGFOLFNWKH-EXWWRQ
• See “Guidance modes” on page 76 for details of these guidance modes.
Setting a Further Destination
You can add a further destination to your route. When your initial destination is reached, you
will receive onward guidance to the next destination you have chosen.
CAUTION
Before setting an onward destination, pull over when it is safe to do so and apply
the handbrake.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³6(7)857+(5'(67,1$7,21´WKHQ
FOLFNWKH-EXWWRQ
You are presented with a list of options very similar to those in the Destination menu. Once a
further destination has been set, the system will return to guidance mode, and you will continue
to receive guidance to your next destination.
• Use these choices to select a further destination in much the same way you set your original
destination. This menu allows you to set the following as your further destination:
* a previously visited destination
* your home or a previously stored location
* a location identified by address, partial address, or post code
* a point of interest chosen from a list
* a specified point on the map
• The “GO TO (registered location name)” item reflects the stored location only if one has been
registered. If no stored location has yet been registered, it reads “ROUTE TO...” (you can register a
stored location by selec-ting “ROUTE TO...”).
• For an explanation of these various choices, see “Settng a Route to Your Destination”. After choosing
a method, proceed to choose a further destination as described in “Settng a Route to Your
Destination”.
• The original destination cannot be set as a further destination.
• If you set further destination, a number indicating the number of consecutive destination is displayed
along with the Destination icon in Map mode (> for example).
• You can set one more destination only.
• If you set further destination, the route to the second destination only becomes highlighted after you
reach your first.
Locating Nearby Points of Interest
While travelling to your destination, you may want to locate restaurants, museums, or other
points of interest on or near your route. You can easily overlay such points of interest on the
map (if you are in Map mode or Split Screen mode). Or you can have them indicated on the
display (if you are in Arrow mode). Alternatively, if you want to view a point of interest of a
particular type, you can obtain a list of those within a certain range of your present location and
ask the system to set a route to one for you.
CAUTION
Before attempting to route to a nearby point of interest, pull over when it is safe to
do so and apply the handbrake.
Overlaying points of interest on the Map or Arrow mode display
You can choose to permanently display certain categories of point of interest on the map.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³/2&$/32,1762),17(5(67´DQG
FOLFNWKH-EXWWRQ
Disc in use.
+LJKOLJKWDFDWHJRU\DQGFOLFNOHIWZLWKWKHMR\VWLFNWRZDUGWKH=LFRQ
)ROORZWKHLQVWUXFWLRQVJLYHQLQ³:RUNLQJZLWKSRLQWVRILQWHUHVW´RQSDJH
• If the display is in Map or Split Screen mode, the points of interest are overlaid as icons at the
appropriate locations on the map. In Arrow mode, they appear on the right-hand side of the display
with an arrow indicating how far away they are and in what direction.
Setting a route to a nearby point of interest
You can obtain a list of points of interest in a particular category and within a certain distance
of your present location. It is then an easy matter to choose one from the list and set a route to it.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³/2&$/32,1762),17(5(67´DQG
FOLFNWKH-EXWWRQ
Disc in use.
+LJKOLJKWDFDWHJRU\DQGFOLFNWKH-EXWWRQ
If you have chosen a chain type of point of interest (meaning a point of interest category
characterised by chain establishments), or if it is a type of cuisine, a further list of choices is
displayed; choose a chain or cuisine type as appropriate and click the - button again.
You are presented with a list of points of interest of the selected type. The list includes those
within the distance range indicated above (up to 30).
• You can widen or narrow your choice by highlighting a different distance range and clicking the
button.
-
+LJKOLJKWDSRLQWRILQWHUHVWLQWKHOLVWDQGFOLFNWKH-EXWWRQWRVHWLWDVDQ
DGGLWLRQDOGHVWLQDWLRQ
The chosen point of interest is treated as an additional destination on the way to your
destination.
You are asked whether to route to the selected point of interest using motorways or not (see
steps 3 to 5 of “Using the Destination history” on page 46).
The system then works out a suitable route. Guidance to the point of interest then begins.
View Map
While under guidance, should you decide to view a map, you can select “VIEW MAP” from
the Guidance menu. You can scroll the map to see the area you want.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³9,(:0$3´DQGFOLFNWKH-EXWWRQ
The map displayed is the one shown when it was last used. Go to step 2 of “Finding a
Destination on the Map” on page 71.
• Your route is not highlighted on the map in this mode.
• If the map was left in scroll mode when it was last used, it appears again in scroll mode.
• If the N (NAVI) button was used to display your current position when the map was last used, your
current position is displayed.
• You can return to the Guidance menu at any time by pressing the K (MENU) button.
• You can return to Guidance mode by pressing the N (NAVI) button; guidance resumes in whatever
mode you were using prior to viewing the map.
• If you choose this function in Arrow mode and Split Screen mode a map also appears.
Cancelling a Route
You may want to stop routing to your selected destination, or stop receiving guidance before
you arrive. If you decide not to proceed to your destination, but fail to cancel the route, your
Mobile Navigation System will continue to give guidance. Choose “CANCEL ROUTE/NEW
ROUTE” to avoid this.
)URPWKH*XLGDQFHPHQXKLJKOLJKW³&DQFHOURXWH1HZURXWH´DQGFOLFNWKH-
EXWWRQ
The route is cancelled and no further guidance is given. The Destination menu is displayed.
• You can now set a new route as explained in “Settng a Route to Your Destination”.
Settings
You can use the Settings menu to customise the appearance and behaviour of your Mobile
Navigation System. Display the Settings menu by selecting “SETTINGS” in the Guidance
menu. Full details of the various settings are given in “Customising the System”. There is one
setting that relates particularly to use of the Guidance menu.
SHORT MENUS:
Allows you to reduce the menus to a short list of the most-used items.
&XVWRPLVLQJWKH6\VWHP
0DQ\IHDWXUHVRI\RXU0RELOH1DYLJDWLRQ6\VWHPFDQEHFXVWRPLVHGWRVXLW\RXU
SDUWLFXODUQHHGV$OWKRXJKWKHVHWWLQJVXVHGZKHQ\RXILUVWVZLWFKWKHV\VWHPRQWKH
IDFWRU\RUGHIDXOWVHWWLQJVKDYHEHHQFDUHIXOO\FKRVHQWRVXLWPRVWRI\RXUEDVLFQHHGV
VRRQHURUODWHU\RXZLOOZDQWWRPDNH\RXURZQVHOHFWLRQV<RXFDQIRUH[DPSOHFKRRVH
ZKHWKHUWRGLVSOD\GLVWDQFHVLQNLORPHWUHVRUPLOHVRUGHILQHDUHDVWKDWIRUVRPHUHDVRQ
\RXGRQRWZDQWWRURXWHWKURXJK+HUH\RXZLOOOHDUQZKLFKVHWWLQJVFDQEHFXVWRPLVHG
DQGKRZWRPDNHWKHFKDQJHV
Changing the Factory Settings
Access the factory settings from the “SETTINGS” menu. Display the settings menu by
choosing “SETTINGS” in either the Destination menu or the Guidance menu. To illustrate the
process of changing settings, an example is given here in which “MAP ORIENTATION” is
changed from “HEADING UP” (the factory setting) to “NORTH UP”. This refers to the
orientation of the map; “HEADING UP” causes the map to rotate on the display such that your
driving direction is always toward the top of the display, whereas “NORTH UP” puts north
permanently at the top of your display.
• If you set “MAP ORIENTATION” to “HEADING UP” in the Settings menu, your current location
is displayed slightly lower than the centre of the screen. On the other hand, if “MAP
ORIENTATION” is set to “NORTH UP”, your location is displayed at the centre of the display.
CAUTION
Before changing the factory settings, pull over when it is safe to do so and apply
the handbrake.
3UHVVWKHK0(18EXWWRQRQ\RXU1DYLJDWLRQFRPPDQGHUWRGLVSOD\HLWKHUWKH
'HVWLQDWLRQPHQXRUWKH*XLGDQFHPHQX
If a route has been set and you are under guidance, the Guidance menu will appear. If no route
has been set, the Destination menu will be displayed.
+LJKOLJKW³6(77,1*6´LQHLWKHUWKH'HVWLQDWLRQPHQXRU*XLGDQFHPHQXDQG
FOLFNWKH-EXWWRQ
The Settings menu is displayed.
+LJKOLJKW³0$325,(17$7,21´DQGFOLFNWKH-EXWWRQ
The “MAP ORIENTATION” setting display appears, and “HEADING UP” is highlighted.
8VHWKHMR\VWLFNWRKLJKOLJKW³1257+83´DQGFOLFNWKH-EXWWRQ
“NORTH UP” is selected and “DONE” is highlighted.
&OLFNWKH-EXWWRQWRUHJLVWHU\RXUQHZVHWWLQJ
The new setting is registered and the Settings menu is again displayed.
The procedure for changing other settings is similar. Details are given in “User Settings” on page
102.
User Settings
This section gives details of all the settings that can be customised. Some settings are simple
choices presented in the form of buttons; in this case just highlight the appropriate button and
click the - button. Others require text input and voice confirmation. A full explanation is
given.
Auto reroute
Your Mobile Navigation System can automatically reroute you to your destination in certain
situations. The default setting is “ON”.
• ON:
Rerouting will take place if you stray away from the route.
• OFF:
No automatic rerouting if you stray off the route. You must manually reroute (see
“REROUTE: Setting a New Route to Your Destination” on page 86) to obtain
guidance to your destination.
Time turn restriction
Certain streets and turns have restrictions that apply only at certain times of day, such as turn
restrictions and restrictions on direction. This setting allows these restrictions to be taken into
account when setting a route. The default setting is “OFF”.
• ON:
Roads and intersections with time restrictions may be considered in the route.
• OFF:
Roads and intersections with time restrictions are not considered from the route.
• The TIME TURN RESTRICTION setting will not be used if you set a route while in a car park or in
any other off-road location. (The route will be set as if TIME TURN RESTRICTION is set to OFF.)
Selecting “ON”
• The cursor moves to the clock display. The joystick can be moved up or down to make
adjustments. Set the current hour and click the - button when done. (Minutes cannot be set.)
• If the clock is not properly set, routing will not be reliable.
• Take care to adjust the clock for Daylight Savings time and for the time difference between
countries.
• Under certain conditions, time turn restrictions will not be taken into account when setting a
route. That is, roads and intersections with time turn restrictions may appear in the route.
• “AUTO REROUTE” is fixed “ON” and cannot be changed.
CAUTION
• Your route will be determined based upon the time of day at which you input your
destination and not when you actually make your turn. Always observe traffic laws
existing at the time you wish to make your turn.
Street list on route
This function displays a list of roads and streets along the route every time a route is set to a
new destination. By reading the list of streets, you can check the route. The default setting is
“OFF”.
• ON: A list of streets and roads is displayed
• OFF: No list of streets along your route is shown
• The list can include up to 20 streets.
• If the number of roads and streets along the route exceeds the limit, the top 20 are shown as ranked
by importance and distance travelled.
Selecting “ON”
• When a new route is set, a list of roads and streets is displayed before guidance begins.
• Only major roads and streets on route to the destination are listed.
• By selecting a road or street on the list and moving the joystick to the right, its location can
be confirmed on the map. Click the - button to return to the list.
• To initiate guidance, either click the - button or the N (NAVI) button.
• When “STREET LIST ON ROUTE” is turned on, route setting may take a little more time.
AREAS TO BE AVOIDED
This allows you to define areas which are to be avoided when setting a route. You might use
this feature to mark off areas that you know to be particularly prone to traffic jams, for example,
or city centre areas you want to avoid in your driving. Up to nine such areas can be defined.
Defining an area to be avoided
+LJKOLJKW³$5($72%($92,'('´LQWKH6HWWLQJVPHQXDQGFOLFNWKH-
EXWWRQ
A list of nine areas to be avoided is displayed.
• No areas are defined by default. Areas not yet defined are labelled “New area-1”, etc.
+LJKOLJKWWKHILUVWXQGHILQHGDUHD1HZDUHDDQGFOLFNWKH-EXWWRQ
You are presented with a list of possibilities for selecting an area: by post code, by street, by
point of interest, or by map.
0DNH\RXUVHOHFWLRQE\KLJKOLJKWLQJWKHPHWKRG\RXZDQWWRXVHDQGFOLFNWKH-
EXWWRQ
If you choose to select the area by post code, street, or point of interest, the selection process is
identical to that for setting a destination by these methods. (See “Finding a Destination by
Specific Post Code” on page 62 for selection by post code, “Finding a Destination by Street/
City Search” on page 55 for selection by street, and “Setting a Route to a Specific Point of
Interest” on page 64 for selection by point of interest.)
If you choose to select the area by map, the last displayed map appears.
A map showing the area selected is shown. The red highlight indicates the area that will be
avoided.
$GMXVWWKHDUHDWREHDYRLGHGE\HQODUJLQJUHGXFLQJRUVFUROOLQJWKHPDS
• The ) and * buttons increase and reduce the map scale, consequently enlarging or reducing
the shaded area. For example, pressing the ) button will increase the map scale so the actual
area represented by the shaded portion becomes smaller. The map scale cannot be increased
beyond 25 m (0.02 miles); further use of the ) button results in the red shaded area
shrinking.
• The joystick scrolls the map, thereby moving the shaded area to the desired position.
:KHQ\RXDUHKDSS\ZLWKWKHVHOHFWHGDUHDFOLFNWKH-EXWWRQ
+LJKOLJKW³5(*,67(5´DQGFOLFNWKH-EXWWRQWRDFFHSWWKHQHZDUHD
The new area is named according to a marker at or near its centre (a street name or point of
interest) and displayed in the list of areas to be avoided.
• Up to nine areas can be registered.
3UHVVWKHK0(18EXWWRQWRUHWXUQWRWKH'HVWLQDWLRQRU*XLGDQFHPHQX
Clearing or modifying an area to be avoided
+LJKOLJKW³$5($672%($92,'('´LQWKH6HWWLQJVPHQXDQGFOLFNWKH-
EXWWRQ
A list of the nine areas to be avoided is displayed.
+LJKOLJKWRQHRIWKHSUHYLRXVO\GHILQHGDUHDVDQGFOLFNWKH-EXWWRQ
You are given a choice of changing the area or deleting it entirely.
• The location (longitude and latitude) of each registered area and the map scale (indicating the size of
the area) can also be displayed. Highlight an item on the list and click left with the joystick to view
this information. (Return to the list by clicking the - button.)
• Before clicking the - button, you can view the area on the map by clicking right with the joystick.
(Return to the list by clicking the - button.)
6HOHFW³'(/(7(´DQGFOLFNWKH-EXWWRQ
A delete confirmation message appears.
+LJKOLJKW³<(6´DQGFOLFNWKH-EXWWRQ
The area is deleted and the updated list of areas to be avoided is displayed.
• If you choose to change the defined area, the procedure is the same as in “Defining an area to be
avoided”.
• All registered areas are avoided when setting a route.
Guidance voice
You have a choice of voices with which to receive guidance. The default setting is
“RECORDED VOICE” (FEMALE).
• RECORDED VOICE (FEMALE):A real female voice
• RECORDED VOICE (MALE): A real male voice
• SYNTHESISED VOICE:
A computer synthesised voice
Auto road hiding
This setting allows you to choose whether Map mode displays minor roads and streets while
you are under guidance and driving on a major road. The default setting is “ON”.
• ON:
Minor roads are not displayed
• OFF:
All roads and streets are displayed
Vehicle type
Since some roads restrict access to certain vehicle types, the accuracy of route setting and
guidance depends on the system knowing what type of vehicle you are driving. Choose your
vehicle type here. The default setting is “SALOON CAR”.
• SALOON CAR
• TRUCK
• DELIVERY VEHICLE
Map orientation
Allows you to choose between north at the top of the display or your vehicle’s heading at the
top of the display. Instructions for changing the setting are given in “Changing the Factory
Settings”on page 99.
Location status
This allows you to correct for errors in your vehicle’s position as shown on the map and to
select or reset the memory in which the built-in gyrosensor’s learning results are stored. At the
same time, the number of GPS satellites from which signals are currently being received is
displayed along with the speed pulse rate (indicating your vehicle’s speed) and your calculated
longitude and latitude. You can use this display to check correct operation of the GPS and
proper connection of the speed pulse cable.
Displaying the location status
+LJKOLJKW³/2&$7,2167$786´LQWKH6HWWLQJVPHQXDQGFOLFNWKH-EXWWRQ
A list of four options is displayed along with the following location status information.
1 Present longitude and latitude
2 GPS positioning mode (--, 2D, or 3D)
For “2D” and “3D” definitions, please refer to “What is GPS?” on page 130.
3 Speed pulse rate
Number of pulses per second (allows verification that pulses are being properly picked up)
3UHVVWKHK0(18EXWWRQWRUHWXUQWRWKH6HWWLQJVPHQX
CAUTION
• Releasing the handbrake while the “LOCATION STATUS” screen is being
displayed will enable the options shown on the screen (“MODIFY CURRENT
LOCATION”, “GPS STATUS”, “SELECT CALIBRATION MEMORY”,
“RESET CALIBRATION MEMORY”). For safety reasons, the driver should not
attempt any of these operations while driving. (If a passenger is present, the
passenger should carry out these operations.)
Adjusting an error in your vehicle’s position
If for any reason your vehicle’s position is displayed incorrectly on the map, you can correct
this. (Your vehicle must be stationary.)
+LJKOLJKW³02',)<&855(17/2&$7,21´DQGFOLFNWKH-EXWWRQ
The map is displayed.
8VHWKHMR\VWLFNWRPRYH5WR\RXUFRUUHFWSRVLWLRQDQGFOLFNWKH-EXWWRQ
0RYHWKHMR\VWLFNULJKWRUOHIWWRWXUQMWRWKHFRUUHFWRULHQWDWLRQ\RXUYHKLFOH¶V
FXUUHQWKHDGLQJDQGFOLFNWKH-EXWWRQ
Checking the GPS status
You can check the reception of signals from the GPS satellites.
+LJKOLJKW³*3667$786´DQGFOLFNWKH-EXWWRQ
1
4
2
3
A display of GPS status appears. At the same time, a graphical representation of the following
information is shown:
1 The average strength of the GPS signals from the satellites (level 0 to 3 as indicated by the
satellite icon at the top left of the screen)
•
If no signal is indicated, check the GPS aerial and locate it such that the signal strength is a
maximum.
2 Your present longitude and latitude (calculated by the GPS)
3 GPS positioning mode (--, 2D, or 3D)
•
For “2D” and “3D” definitions, please refer to “What is GPS?” on page 130.
4 Coloured satellite icons representing the approximate position of the GPS satellites in the
directions of the compass
•
The colour of the icons indicates the signal reception status. Gray is a known satellite from which
no signal is being received; red represents a satellite whose signals are actually being used for
positioning; yellow means that signals are being picked up but are not currently in use for
positioning.
&OLFNWKH-EXWWRQWRUHWXUQWRWKH³/2&$7,2167$786´GLVSOD\
Selecting a calibration memory
The built-in gyrosensor incorporates a learning function (see “Positioning Technology”, page
129) and you can choose to store the learning data in one of two memories. The default is
“MEMORY-1”.
+LJKOLJKW³6(/(&7&$/,%5$7,210(025<´DQGFOLFNWKH-EXWWRQ
• MEMORY-1:
• MEMORY-2:
The gyrosensor learning results are usually stored in Memory-1. If you use
the same tyres throughout the year, you don’t need to change this setting.
The learning results can also be stored in Memory-2. You can use this when
you change to winter tyres or any other tyres of different size that you use
on occasion.
• Be sure to reset MEMORY-2 before using it for the first time. See also “Calibrating the built-in
gyrosensor” on page 27.
Resetting the calibration memory
Resetting the calibration memory clears all gyrosensor learning data from the memory
(Memory-1 or Memory-2) currently in use. See “Calibrating the built-in gyrosensor” on page
27 for details.
Tracking display
You can set the system to display tracking dots that show the route you have driven. You can
choose to show these dots for the current journey, for all routes since you last cleared the dots,
or not at all. The default setting is “ON (PERMANENTLY)” for all journeys.
• ON (PERMANENTLY):
Display tracking dots for all journeys
• ON (CURRENT JOURNEY): Display tracking dots but erase them when the Navigation
System is turned off
• OFF:
Do not display tracking dots
• When “ON (PERMANENTLY)” is selected, tracking dots for all subsequent journeys are shown.
You can reset the display by choosing “ON (CURRENT JOURNEY)”.
Auto day/night background
The map background colour is optimised for daytime driving. Automatic switching to a slightly
darker background colour suitable for night driving is possible; the night-driving background
is then displayed whenever you turn on your vehicle’s headlights. The default setting is “ON”.
• ON: Automatic switching to night-driving background when headlights are switched on
• OFF: Always use daytime background colour
• To use this function, the ILL lead to the Mobile Navigation Unit must be connected correctly.
Cartographic language
Depending on the map disc you are using, various languages may be available for the display
of street names and other information on the map. You can choose the language you prefer. The
default setting is “AUTOMATIC”.
• When “AUTOMATIC” is selected, the text on the map is usually displayed in the same
language as used by the menus (and which is also used for voice guidance). However, if the
language used by the menus is not available on the map disc currently in use, the map disc’s
default language (which differs according to the map disc) is used for text on the map instead.
• Choosing a language from the list will cause the map text to display in that language.
However, if the language used by the menus is not available on the map disc currently in use,
the map disc’s default language (which differs according to the map disc) is used for text on
the map instead.
Short menus
Short versions of the Destination menu and Guidance menu are available. These give only the
most frequently used functions. Here, you can set these short menus to be displayed. The
default setting is “(A) AND (B) STANDARD”.
• SHORT DESTINATION MENU(A): Use the short Destination menu only
• SHORT GUIDANCE MENU(B):
Use the short Guidance menu only
• (A) AND (B) STANDARD:
Use both standard menus
• (A) AND (B) SHORT:
Use both short menus
• The short menus include a “SHOW STANDARD MENU” item. Selecting this allows you to return
to the standard menu at any time.
Operation voice instruction
You can choose to receive voice information about menu selections when available.
• ON: Voice instruction given
• OFF: No voice instruction given
Password
You can place a password in the system to prevent unauthorised use. This may be necessary if
you are driving a commercial vehicle with many drivers, but you want to restrict use of this
Mobile Navigation System to certain people. In a private vehicle, you can register a password
to prevent others gaining access to your Destination history and home location. You are given
an opportunity to register a password when you first switch on the system. If you choose not to
register one at that time, or if you want to change the password later, follow the directions in
“Registering a password”on page 25.
In order to register a new password, you must first enter the old password.
• Use one of the memo pages at the end of this manual to note down your password, then remove the
page and keep it in a safe place. Do not keep a note of your password in the vehicle.
Km/mile setting
You can choose the units used to display distances. The default setting is “AUTOMATIC”.
• AUTOMATIC: Setting changes automatically depending on local usage
• KM:
Always display in kilometres
• MILE:
Always display in miles
• MILE/YARD: Always display in miles and yards
Language
You can select the language used in menus and for voice guidance and voice recognition.
+LJKOLJKW³/$1*8$*(´DQGFOLFNWKH-EXWWRQ
You are instructed to eject the map disc and insert the appropriate programme disc.
(MHFWWKHPDSGLVFDQGLQVHUWDSURJUDPPHGLVF
• See “Inserting the programme disc” on page 16.
6HOHFW\RXUFKRLFHRIODQJXDJH
• See “Installing the programme” on page 18.
Home location
You can register the location of your home. By doing so, you can use the “ROUTE BACK
HOME” function in the Destination menu to quickly set a route home from wherever you are.
You are given an opportunity to register your home location when you first switch on the
system (see “Registering your home location” on page 21). If you chose not to register it at that
time but decide to register your home location later, or if you want to make a change to the
registered location, you can do it here. Follow the instructions given in “Registering your home
location” on page 21.
• If you have already registered your home location, then upon selecting “HOME LOCATION” you
will be given a choice of “DELETE” or “REGISTER”. If you choose “DELETE”, you will be asked
to confirm that you want to delete the location. Highlight “YES” and click the - button to delete. If
you choose “REGISTER”, proceed as in “Registering your home location” on page 21.
Preferred Destination
You can register the location of one particular location for quick and easy routing. Details of
how to register a location are given in “Registering locations” on page 52.
• If you have already registered a stored location, then upon selecting “PREFERRED DESTINATION”
you will be given a choice of “DELETE” or “REGISTER”. If you choose “DELETE”, you will be
asked to confirm that you want to delete the location. Highlight “YES” and click the - button to
delete. If you choose “REGISTER”, proceed as in “Registering locations” on page 52.
Wide/normal display
You will be able to connect to a wide range of displays to this system as they become available.
(This setting should reflect the type of display you are using.) The default setting is “NORMAL
(TYPE A)”.
• NORMAL (TYPE A): Choose this setting when COLOR DISPLAY
AVD-505 is used.
• NORMAL (TYPE B): Choose this setting when AV SYSTEM MONITOR
AVX-505 is used.
• WIDE:
Choose this setting when 7 INCH WIDE AV SYSTEM DISPLAY
AVX-P7000CD or AVX-7000 is used.
• The width-to-height ratio in the Normal setting is 4:3; it is 16:9 in the Wide setting.
Volume control
This allows the volume to be set if you are using a display without its own volume control. This
setting is provided for future functionality.
+LJKOLJKW³92/80(&21752/´DQGFOLFNWKH-EXWWRQ
The volume control display appears, showing the current volume setting.
0RYHWKHMR\VWLFNOHIWRUULJKWWRDGMXVWWKHYROXPHDQGFOLFNWKH-EXWWRQ
+LJKOLJKW³'21(´DQGFOLFNWKH-EXWWRQ
If you have a display with its own volume control, two volume controls are available. In this
case, set the “VOLUME CONTROL” to level 9 (the maximum) and use the volume control on
the display to obtain the volume you desire.
Demonstration
This setting allows the system to be demonstrated. If “DEMONSTRATION” is turned on, the
drive to your destination will be simulated as soon as a route has been set. (This is particularly
useful for dealers, who can set up demonstrations to run in their stores; it should always be set
to “OFF” in normal use.)
• ON (REPEATEDLY):
• ON (ONCE):
• OFF:
Simulates the drive repeatedly after a route has been set.
Simulates the drive only once after a route has been set, returning
to display the vehicle position in normal Guidance mode when the
destination is reached.
The standard setting. No demonstration is displayed.
2SHUDWLQJWKH6\VWHPE\9RLFH
<RXU3LRQHHU0RELOH1DYLJDWLRQ6\VWHPLVHTXLSSHGZLWKWKHODWHVWLQYRLFHUHFRJQLWLRQ
WHFKQRORJ\<RXFDQXVHYRLFHFRPPDQGVWRRSHUDWHPDQ\RILWVIXQFWLRQV+HUH\RXZLOO
OHDUQZKHUH\RXFDQXVHYRLFHFRPPDQGVDQGDOVRZKDWLQVWUXFWLRQVWKHV\VWHPDFFHSWV
E\YRLFH
Voice Operation
Voice operation allows you to concentrate on the task of driving your vehicle. Combined with
voice guidance, it means that while actually driving there is little need to use the Navigation
commander nor to continuously monitor the display. The result is greatly enhanced safety.
Most of the functions that you need while driving can be activated with voice commands.
• Routing to a previously visited location using the Destination history
• Routing home or to the stored location
• Overlaying a specific category of point of interest on the map
• Re-routing from any location while under guidance
• Stopping at a specific point of interest while under guidance
Successful Voice Recognition
In order for your voice commands to be correctly recognised and interpreted, you need to take
certain steps to ensure that conditions are suitable for recognition. These are outlined below.
• 5HGXFHWKHYROXPHVHWWLQJRQ\RXUFDUDXGLRV\VWHP
The voice recognition system may have problems differentiating your voice commands if
there is too much extraneous noise. Turn down your audio system and remember that voices
on the radio might be interpreted as commands.
• &ORVHWKHYHKLFOHZLQGRZV
Just as the audio system may interfere with voice operation, so can wind noise caused by
open windows and sounds entering from outside. If you have problems with voice
recognition, try closing the vehicle windows.
• 3RVLWLRQWKHPLFURSKRQHFDUHIXOO\
For optimum pick-up, the microphone should be fixed at a suitable distance directly in front
of the driver. Make sure that you do not need to alter your position when giving voice
commands; not only is this awkward, but it can also compromise driving safety. Bear this in
mind when choosing where to attach the microphone.
• 3DXVHEHIRUHJLYLQJDFRPPDQG
After pressing the H (TALK) button on the Navigation commander, pause for a moment
after the confirmation “beep” before giving a voice command. Speaking too soon may cause
recognition to fail. If you experience recognition problems, leave a slightly longer interval
before giving a command.
• 3URQRXQFH\RXUFRPPDQGVFDUHIXOO\
Speak slowly and deliberately with clear annunciation. Fast or mumbled commands are
easily misinterpreted. If the microphone is properly positioned, there is no need to raise your
voice when giving commands.
• $YRLGVSHDNLQJZKLOHYRLFHGLUHFWLRQVDUHEHLQJJLYHQ
Do not give commands while voice navigation directions are being given by the system, as
these may interfere with recognition.
•
,I\RXKDYHD3LRQHHUFDUDXGLRV\VWHPZLWKDPXWLQJIXQFWLRQ (which has an MUTE lead), the
volume will automatically be reduced when you give a voice command.
Using Voice Operation
Follow these basic instructions to make use of the voice recognition functions.
7RJLYHDYRLFHFRPPDQGILUVWSUHVVWKHH7$/.EXWWRQ
The voice recognition menu appears.
• When you press the H (TALK) button, the countdown lamps will light and change colour one by
one.
• Pressing the + (NEXT OPTION) button while the Voice Recognition menu is displayed returns you
to the previous display.
*LYHDFRPPDQGEHIRUHDOOWKHFRXQWGRZQODPSVKDYHFKDQJHGFRORXU
If the command is accepted, it is repeated on the display.
• If you fail to give a command before all the countdown lamps have changed colour, your command
will not be accepted. You must press the H (TALK) button again before attempting to give another
voice command.
,IWKHFRPPDQGGLVSOD\HGLVQRWWKHRQHLQWHQGHGSUHVVWKH+1(;7237,21
EXWWRQ
• Pressing the + (NEXT OPTION) button before all the countdown lamps have changed colour cycles
through commands with a similar pronunciation. Repeat until the desired command is displayed.
,IWKHGLVSOD\HGFRPPDQGLVFRUUHFW\RXQHHGGRQRWKLQJIXUWKHUWKHFRPPDQG
LVDXWRPDWLFDOO\FDUULHGRXWDIWHUDOOWKHFRXQWGRZQODPSVKDYHFKDQJHGFRORXU
• Pressing the H (TALK) button causes the command to be carried out immediately.
Setting a Route and Displaying Points of Interest by Voice
You can use voice commands to set a route in much the same way as described in “Settng a Route
to Your Destination”. You may also overlay a specific category of points of interest on the map
by voice.
• You can easily set a route home, to the stored location, or to any listing in the Destination history that
has been specifically named. (See “Settng a Route to Your Destination” for details of the Destination
history and the home and stored locations.)
Activating voice recognition
In a case where no route has yet been set, you can activate voice recognition whenever the
Destination menu or the map is displayed.
3UHVVWKHH7$/.EXWWRQRQ\RXU1DYLJDWLRQFRPPDQGHU
The Voice Recognition menu appears (countdown lamps light and change colour one by one),
giving a list of the available options.
The commands that can be given are the following:
• RETURN HOME
Find a route home from your current location. (This appears only if a home location has been
registered; see “Registering your home location” on page 27.)
• GO TO (registered location name)
Find a route to the stored location. (This appears only if a specific location has been
registered; see “Registering locations” on page 52.)
• DESTINATION HISTORY
Find a route to a ticked and named listing in the Destination history.
• DISPLAY POINTS OF INTEREST
Overlay a category of point of interest on the map.
• Remember to give your command before all the countdown lamps have changed colour.
• If you fail to give a voice command before all the countdown lamps have changed colour, the Voice
Recognition menu disappears and the Destination menu or Map display appears once again.
Routing home or to the stored location
You can set a route home or to the stored location with a single voice command!
:KLOHWKH9RLFH5HFRJQLWLRQPHQXLVGLVSOD\HGVD\5HWXUQKRPH!RU
*RWRUHJLVWHUHGORFDWLRQQDPH!
If accepted, the command appears on the display. After all the countdown lamps have changed
colour, you will be asked if you want to use motorways or not, and then a route will be set.
Guidance begins automatically (see steps 3 to 5 of “Using the Destination history” on page 46).
• If the command displayed is not the one you gave, press the + (NEXT OPTION) button repeatedly
until the desired command is shown (see “Using Voice Operation” above).
• If you have not yet registered your home or a stored location, see “Registering locations” on page 52.
Routing to personal destinations
You can set a route to locations in the Destination history for which you have given a name (see
“Working with the Destination history” on page 48). Such locations are called “Personal
destinations” in the Voice Recognition menu.
:KLOHWKH9RLFH5HFRJQLWLRQPHQXLVGLVSOD\HGVD\'HVWLQDWLRQKLVWRU\!
If accepted, the command appears on the display.
After all the countdown lamps have changed colour, a list of the named locations is displayed.
You are asked “Please request your personal destination.”
The options available here are as follows.
• Name of location
Find a route to the named listing in the Destination history.
• NEXT
Select the next listing.
• PREVIOUS
Select the previous listing.
• If you already know the name of your destination, simply say it while the Voice Recognition menu is
displayed. If accepted, the command appears on the display and routing starts immediately.
:KLOHWKHOLVWLVGLVSOD\HGSUHVVWKHH7$/.EXWWRQ6D\\RXUFKRLFHEHIRUH
DOOWKHFRXQWGRZQODPSVKDYHFKDQJHGFRORXU
colour, you will then be asked if you want to use motorways or not, and then a route will be set.
Overlaying points of interest on the map
You can overlay points of interest of a specified category on the map using voice commands.
:KLOHWKH9RLFH5HFRJQLWLRQPHQXLVGLVSOD\HGVD\'LVSOD\SRLQWVRILQWHUHVW!
After all the countdown lamps have changed colour, a list of the most useful point of interest
categories appears.
You are asked “Please request a point of interest category.”
• If you already know the category you want to overlay, say it while the Voice Recognition menu is
displayed. If accepted, the command appears on the display. Switch to the map to see the specified
point of interest category overlaid on the map.
:KLOHWKHOLVWLVGLVSOD\HGSUHVVWKHH7$/.EXWWRQDQGVD\WKHSRLQWRI
LQWHUHVWFDWHJRU\RI\RXUFKRLFHEHIRUHDOOWKHFRXQWGRZQODPSVKDYHFKDQJHG
FRORXU
If accepted, the command is repeated on the display. After all the countdown lamps have
changed colour, the map display then appears with an overlay of the selected point of interest
category.
Using Voice Recognition while Under Guidance
You can also use voice recognition while in guidance mode or when the guidance menu is
displayed. The functions available are essentially the same as those offered by the Guidance
menu (see “Using the Guidance Menu”).
Activating voice recognition
3UHVVWKHH7$/.EXWWRQRQ\RXU1DYLJDWLRQFRPPDQGHU
The Voice Recognition menu appears (countdown lamps lights and change colour one by one)
and you will hear “Please make your request”.
• REROUTE
Search for a new route to your destination.
• RESUME ORIGINAL ROUTE
Set a new route retuens to your original route after a certain distance.
• FEWER TURNS
Search for a new route to your destination with fewer turns.
• SHORTEST ROUTE
Search for the shortest route from the current location to your destination.
• DETOUR
Avoid a length of road (see “DETOUR: Avoid the Road Ahead” on page 89) and return to
the original route.
• POINTS OF INTEREST
Stop at to a specific point of interest while under guidance.
• Remember to give your command before all the countdown lamps have changed colour allowed by
the countdown on the display.
• If you fail to give a voice command before all the countdown lamps have changed colour, the Voice
Recognition menu disappears and the system either returns to the Guidance menu or to guidance
mode.
Rerouting to your destination
This command allows you to reroute to your destination (see “REROUTE: Setting a New
Route to Your Destination” on page 86).
$FWLYDWHYRLFHUHFRJQLWLRQDVGHVFULEHGLQ³$FWLYDWLQJYRLFHUHFRJQLWLRQ´DQGVD\
HLWKHU5HURXWH!)HZHUWXUQV!RU6KRUWHVWURXWH!GHSHQGLQJRQZKDWNLQG
RIURXWH\RXZDQWWRVHW
colour, you will be asked if you want to use motorways or not, and then a route will be set.
Resume original route
If you stray from the route, this command allows you to find the quickest way back to the
original route (see “Resume Original Route: Returning to the Original Route” on page 88).
5HVXPHRULJLQDOURXWH!
colour, a route will be set. Guidance begins automatically.
Detour
This command causes the system to search for a route that avoids a specified portion of the
route ahead (as long as you have previously specified a distance; see “Choosing the length of
the detour” on page 89).
'HWRXU!
colour, a route will be set. Guidance begins automatically.
Obtaining information about points of interest
You can obtain information about points of interest in a specific category near your current
location, and then choose whether to route to one of them.
3RLQWVRILQWHUHVW!
After all the countdown lamps have changed colour, a list of the most useful point of interest
categories appears. You are asked “Please request a point of interest name.”
• If you already know the category you want to overlay, say it while the Voice Recognition menu is
displayed. If the command is accepted, the name of the given category appears briefly on the display
and then information about the nearest point of interest in that category is displayed.
:KLOHWKHOLVWLVGLVSOD\HGSUHVVWKHH7$/.EXWWRQDQGVD\WKHSRLQWRI
LQWHUHVWFDWHJRU\RI\RXUFKRLFHEHIRUHDOOWKHFRXQWGRZQODPSVKDYHFKDQJHG
FRORXU
If accepted, the command is repeated on the display.
After all the countdown lamps have changed colour, information about the nearest point of
interest in that category is displayed. (If you say <Hotel> for example, the screen shown above
will be displayed.) You also hear the information: “There is one, in ** m (the distance from
your current location to the point of interest in question). Do you want to stop there?”
• YES
The system sets a route to the point of interest while under guidance.
• NO
The category is ticked and icons indicating the location of points of interest in this category
are overlaid on the map.
• NEXT
Information is given about the second-nearest point of interest in the chosen category.
• PREVIOUS
Provides information about the previous point of interest once again.
The information provided about a point of interest is as follows.
• Name of point of interest
• Distance to point of interest
• Direction to point of interest from your current location
• If there is no point of interest in the selected category in your present vici-nity, the category is simply
overlaid on the map.
:KLOHLQIRUPDWLRQLVEHLQJGLVSOD\HGDERXWDSDUWLFXODUSRLQWRILQWHUHVWSUHVV
WKHH7$/.EXWWRQDQGJLYHWKHDSSURSULDWHFRPPDQGEHIRUHDOOWKH
FRXQWGRZQODPSVKDYHFKDQJHGFRORXU
If accepted, the command is repeated on the display.
• If your response is “Yes”, the point of interest is treated as an additional destination on the way to
your (first) destination. After all the countdown lamps have changed colour, you will be asked if you
want to use motorways or not, and then a route will be set. Guidance begins automatically (see steps
3 to 5 of “Using the Destination history” on page 46).
• If your response is “NO”, the category is simply overlaid on the map. After all the countdown lamps
have changed colour, you are returned to Guidance mode. There is no change to your route.
$SSHQGL[
<RXU3LRQHHU0RELOH1DYLJDWLRQ6\VWHPPDNHVXVHRIWKHODWHVWWHFKQRORJ\WRSURYLGH\RX
ZLWKDFFXUDWHLQIRUPDWLRQDQGJXLGDQFHZKLOHGULYLQJ'HVSLWHWKLVUHOLDQFHRQDGYDQFHG
WHFKQRORJ\WKHV\VWHPLVVWUDLJKWIRUZDUGWRRSHUDWHDQGWKLVLQVWUXFWLRQPDQXDO
SURYLGHVDOOWKHLQIRUPDWLRQ\RXQHHGWRPDNHIXOOXVHRILWVDGYDQFHGIHDWXUHV7KLV
DSSHQGL[FRQWDLQVDGGLWLRQDOLQIRUPDWLRQWKDWPD\KHOS\RXUXQGHUVWDQGLQJDV\RXOHDUQ
DERXWWKHV\VWHP,QSDUWLFXODU\RXPD\ILQGWKH*ORVVDU\DQG7URXEOHVKRRWLQJVHFWLRQV
RILQWHUHVW
Positioning Technology
Recent advances in communications, computer technology, and engineering have made it
possible to determine a location on earth with remarkable accuracy. This Mobile Navigation
System brings together a number of these techniques to provide you with an accurate, and
constantly updated, indication of your vehicle’s position. Here, we provide an outline of the
technology used in the system.
$SSHQGL[
What is GPS?
The global positioning system, or GPS, depends on a network of artificial satellites encircling
the earth. Each of the 24 satellites, which orbit at a height of 21,000 km, continually broadcasts
radio signals giving time and position information. This ensures that signals from at least three
can be picked up from any open area on the earth’s surface.
GPS signals can be freely picked up by anyone with the appropriate equipment. By applying
sophisticated signal processing techniques to the data received, it is possible to determine a
location to within a few tens of metres. Advances in electronics mean that the computing power
needed to do this signal processing is easily fitted into aircraft, boats, and now even navigation
systems for vehicles.
How is it used?
GPS is used by this system to determine the absolute location of your vehicle. This enables it
to display your location accurately on a map. The accuracy of the information obtained with
GPS depends on how good the reception is. When the signals are strong and reception is good,
it is possible to determine latitude, longitude, and altitude for accurate positioning in three
dimensions (3D). On the other hand, if signal quality is low, only two dimensions (2D), latitude
and longitude, can be obtained and positioning errors are somewhat greater.
• The GPS satellites are administered by the United States Department of Defence; on occasion, the
data broadcast by the satellites may intentionally be reduced in quality. In such a case, positioning
errors will increase.
When is it used?
GPS is used to determine your position whenever adequate signals are available. However,
there are times when this is not possible and the system has to rely on an estimated position (see
“Dead reckoning” below).
• If signals can be picked up from no more than two GPS satellites, GPS positioning does not
take place.
• Under some driving conditions, signals from GPS satellites may not reach your vehicle. In
this case, it is not possible for the system to use GPS positioning.
In tunnels or enclosed
parking garages
Under elevated roads or
similar
When driving among
high buildings
When driving trough
dense forest or tall trees
• GPS reception may be lost temporarily if a car phone or cellular phone is used near the GPS
aerial.
Care of the GPS aerial
Do not obstruct the GPS aerial with spray paint or car wax, as this may block the reception of
GPS signals. Snow buildup may also degrade the signals, so keep the aerial clear.
$SSHQGL[
Dead reckoning
What is dead reckoning?
Unlike GPS, dead reckoning relies on sensors installed in your vehicle to gather data about your
movements. The built-in gyrosensor is able to detect the turning motion of your vehicle, and
combines this with distance information taken from speed pulse data, as used by the
speedometer, to approximately track your position.
• The speed pulse data comes from the speed sensing circuit. The location of this speed sensing circuit
depends on your vehicle model. In some cases, it is impossible to make a connection to it, and in such
a case we recommend that the ND-PG1 speed pulse generator (sold separately) be used.
How do GPS and dead reckoning work together?
For maximum accuracy, your navigation system continually compares GPS data with your
estimated position as calculated from the gyroscopic data. However, if nothing but gyroscopic
data is available for a long period, positioning errors are gradually compounded until the
estimate of your location becomes unreliable. For this reason, whenever GPS signals are
available, they are matched with the gyroscopic data and used to correct it for improved
accuracy.
Learning function for better accuracy
To ensure maximum accuracy, the dead reckoning system incorporates a learning function. By
comparing the position it estimates with your actual position as obtained using GPS, it is able
to correct for various types of error, such as tyre wear and the rolling motion of your vehicle.
As you drive, it gradually builds up more data, or learning, and the accuracy of its estimates
gradually increases; as a result, you can expect your position as shown on the map to show
fewer errors after you have driven some distance.
Handling large errors
If you use chains on your wheels for winter driving, or if you need to use the spare wheel, the
errors may appear to suddenly increase as a result of the different wheel diameter. To prevent
corruption of learning data that has been gradually built up about your vehicle, learning
automatically stops when such errors suddenly appear.
• If for any reason GPS signals cannot be picked up, learning and error correction are not possible. If
GPS positioning has been operating for only a short time, your vehicle’s actual position and the
current location mark on the map may diverge considerably. Once GPS reception is restored,
accuracy will be recovered within about two hours.
• There are two learning memories, so the system can learn about and compensate for two different tyre
sets, such as summer and winter tyres. (See “Selecting a calibration memory” on page 111 for details.)
Map matching
As mentioned, the GPS and dead reckoning systems used by this Mobile Navigation System
are susceptible to certain errors. Their calculations may on occasion place you in a location on
the map where no road exists. In this situation, the processing system understands that vehicles
travel only on roads, and is able to correct your position by adjusting it to a nearby road. This
is called map matching.
With map matching
With no map matching
$SSHQGL[
Conditions likely to cause noticeable positioning errors
Certain conditions are more likely to cause discrepancies between your actual position and the
location shown on the map display.
• If you make a slight turn
• If there is a parallel road
• If there is another road very nearby, such as in the case of an elevated motorway
• If you take a recently opened road that is not on the map
• If you drive in zig-zags
• If the road has connected hairpin bends
• If there is a loop or similar road configuration
• If you take a ferry
• If you are driving on a long, straight road or a gently curving road
• If you are on a steep mountain road with many height changes
$SSHQGL[
• If you enter or exit a multi-story car park lot or similar with a spiral junction
• If your vehicle is turned on a turntable or similar
• If your vehicle’s wheels spin, such as on a rough track or in snow
• If you put on chains, or change your tyres for some of a different size
• If trees or other obstacles block the GPS signals for a considerable period
• If you drive very slowly, or in a start-and-stop manner, as in a traffic jam
• If you join the road after driving around a large car park
• When you pass around a roundabout
$SSHQGL[
About CD-ROM Map Discs
Map discs covering other areas are available for your Mobile Navigation System. You can use
any map disc that is compatible with SDAL. To find out more, contact your nearest Pioneer
service facility. Before calling, you need to check the version numbers of your present
programme as described below; you may be asked for this information when you call.
7XUQWKH0RELOH1DYLJDWLRQ6\VWHPRQ
Version of SDAL standard
Pioneer programme reference code
A display similar to this is shown for a few seconds.
1RWHGRZQWKHYHUVLRQQXPEHUVIRUWKHSURJUDPPH
These are the SDAL and APL numbers on the display (SDAL V. 1 and APL:KNRNLA in the
example shown).
• The SDAL standard on the CD-ROM must match this SDAL standard.
• In the case of a CD-ROM meeting the specified version of the SDAL standards but covering an area
not authorised by Pioneer, the system may not operate correctly and could be very dangerous. Please
contact Pioneer to check which areas are authorised.
Handling and Care of CD-ROM Discs
Some basic precautions are necessary when handling CD-ROM discs.
• Do not touch the recorded surface of a CD-ROM. Carefully hold the disc by its outer edge
or by the hole in the centre, as shown.
• Do not attach sticky tape or similar to the surfaces of a CD-ROM. Avoid scratching the disc,
or damaging it in any other way.
• Keep CD-ROMs clean and free of dust. If it becomes necessary to clean a disk, use a soft,
lint-free cloth to wipe the surface from the centre outward, as shown.
• Never apply solvents such as benzene, thinner, commercial cleaners, or anti-static fluids
intended for vinyl records to your CD-ROMs.
• Keep your CD-ROMs away from direct sunlight, sources of heat, and sources of dust. Store
the discs in their protective cases to provide greater protection against warping.
Ambient conditions can affect the behaviour of discs and the operation of the system.
• Vibrations caused by driving may sometimes interrupt the reading of map data from the CDROM, causing slow screen changes.
• In cold weather, condensation may form on the optical lens used to read the CD-ROM or on
the disc itself, particularly when the vehicle initially warms up. This may render the disc
unreadable for up to an hour as the moisture evaporates naturally. You may wipe
condensation of a disc with a soft cloth (from the centre outward).
• At extremely high temperatures, a temperature cut-off protects the Navigation System by
switching it off automatically.
$SSHQGL[
Resetting the System
It may on occasion be necessary to reset your Mobile Navigation System.
When a reset is necessary
You should reset the system in the following situations:
• After installation of the hardware in your vehicle.
• If there appear to be problems with the operation of the system.
• If there are problems with the display.
Using the reset button
The reset button is recessed on the front of the main unit to prevent accidental use. Find it in
the bottom left corner of the front panel.
Reset button
,QVHUWDSRLQWHGLPSOHPHQWVXFKDVDEDOOSRLQWSHQLQWRWKHVPDOOKROHDQGSXVK
The system switches off.
• If the CD-ROM cover is open when you press the reset button, the disc is ejected.
6ZLWFKWKHV\VWHPRQDJDLQXVLQJWKH1DYLJDWLRQFRPPDQGHU
Troubleshooting
Refer to this section if you have problems operating your Mobile Navigation System. The most
common problems are listed below, along with likely causes and solutions. While this list is
not comprehensive, it should answer your most pressing problems. If a solution to your
problem cannot be found here, then contact your dealer or the nearest authorised Pioneer
service facility.
You cannot position your car on the map or the positioning error is large.
Possible causes:
7KHTXDOLW\RIVLJQDOVIURPWKH*36VDWHOOLWHVLVSRRUFDXVLQJUHGXFHG
SRVLWLRQLQJDFFXUDF\
Such a loss of signal quality may come about for the following reasons:
• The GPS aerial is in an unsuitable location
• Obstacles are blocking signals from the satellites
• The position of satellites relative to your vehicle is bad
• Signals from the GPS satellites have been modified to reduce accuracy.
(GPS satellites are operated by the US Department of Defence, and the US government reserves the
right to distort positioning data for military reasons. This may lead to greater positioning errors.)
6LJQDOVIURPWKHFDUVSHHGSXOVHDUHQRWEHLQJSLFNHGXSSURSHUO\
7KHPDLQXQLWPD\QRWEHPRXQWHGVHFXUHO\LQ\RXUYHKLFOH
Solutions:
• Check GPS signal reception using “LOCATION STATUS” (see page 108) and the position
of the GPS aerial if necessary, or continue driving until reception improves.
• Check that the cables are properly connected. If necessary, consult with the dealer that
installed the system.
• Check that the main unit is securely mounted and if necessary check with the dealer that
installed the system.
$SSHQGL[
The map continually reorients itself.
Probable cause:
7KHGLVSOD\LVVHWWR³+($',1*83´
Solution:
• Check the “MAP ORIENTATION” settings (page 107) and change the setting to “NORTH
UP”.
Tracking marks are not displayed.
Probable cause:
7KH³75$&.,1*',63/$<´LVWXUQHGRII
Solution:
• Check the “TRACKING DISPLAY” settings (page 111) and make sure “ON
(PERMANENTLY)” or “ON (CURRENT JOURNEY)” is selected.
The daylight display is used even when the car lights are on.
Probable cause:
7KH³$872'$<1,*+7%$&.*5281'´VHWWLQJLVWXUQHGRII
Solution:
• Check the “AUTO DAY/NIGHT BACKGROUND” setting (page 112) and make sure “ON”
is selected.
The system will not switch on/will not operate.
Probable cause:
,QVWDOODWLRQRUFRQQHFWLRQKDVEHHQFDUULHGRXWLQFRUUHFWO\
Solution:
• Check with your dealer.
The display is very dim.
Possible causes:
7KHFDUOLJKWVDUHRQDQGWKH³$872'$<1,*+7%$&.*5281'´VHWWLQJLV
³21´
7KHYHKLFOHFDELQWHPSHUDWXUHLVH[WUHPHO\ORZ
Solutions:
• Read about the “AUTO DAY/NIGHT BACKGROUND” setting (page 112) and select
“OFF” if desired.
• A liquid crystal display is used, and such displays tend to darken when cold. Wait for the
vehicle to warm up.
There is no voice guidance or the volume is low.
Probable cause:
7KHYROXPHVHWWLQJLVORZ
Solution:
• Check the volume setting on the display or turn the volume up according to “VOLUME
CONTROL” (page 118) and/or turn up the volume on the display.
$SSHQGL[
The Navigation commander fails to work.
Possible causes:
7KHEDWWHULHVDUHORZ
7KHEDWWHULHVKDYHEHHQLQVHUWHGLQFRUUHFWO\
7KH1DYLJDWLRQFRPPDQGHULVSRLQWLQJDWWKHIORRURUDVHDW
7KHVLJQDOUHFHSWRURQWKHGLVSOD\LVH[SRVHGWRGLUHFWVXQOLJKW
Solutions:
•
•
•
•
Change the batteries.
Check that the batteries are properly inserted according to the + and — markings.
Ensure that the Navigation commander has a clear line of sight to the display unit.
Move the Navigation commander closer to the receiver on the display unit.
Errors have increased.
Probable cause:
7KHEXLOWLQJ\URVHQVRU¶VOHDUQLQJIXQFWLRQLVQRWRSHUDWLQJFRUUHFWO\
Solution:
• Reset the gyrosensor to begin learning again (see “Calibrating the built-in gyrosensor” on
page 27).
Messages and How to React to Them
The following messages may be displayed by your Car Navigation System.
• There are occasions when you may see error messages other than those shown here. In such a case,
follow the instructions given on the display.
³<RXFDQQRWXVHWKLVIXQFWLRQZKLOVWGULYLQJ´
When:
What to do:
while trying to make a menu selection.
Pull over and come safely to a halt, apply the handbrake, and then try again.
³7KLVLVQRWWKHDSSURSULDWHGLVF3OHDVHLQVHUWWKHDSSURSULDWHGLVF´
When:
1. If you try to use a disc which is not compatible with this system.
2. If you insert a disc upside down.
3. If the disc is dirty.
4. If the disc is cracked or otherwise damaged.
What to do:
1. Insert a suitable disc.
2. Insert the disc with the label upward.
3. Clean the disc.
4. Consult your dealer.
³$QHUURUKDVRFFXUUHG3OHDVHSRZHURIIDQGRQDJDLQ´
When:
What to do:
if there is an internal problem.
Turn off the power and then switch the system on again.
³7KHROGHUYHUVLRQGLVFFDQQRWEHXVHG´RU³6RPHIXQFWLRQVPD\QRWZRUNZLWK
WKLVQHZYHUVLRQ´
When:
What to do:
if the map disc you insert is an older version or a newer version.
eject the disc and insert a suitable one.
³7KHVHOHFWHGORFDWLRQLVQRWFRQWDLQHGRQWKHGLVF´
When:
if you attempt to use the destination history to display a destination not covered
by the current map disc.
What to do:
insert the map disc that covers your destination.
³6HDUFKLQJIRUWKHPDSQRZ´
When:
if reading from the map disk takes excessive time.
What to do:
wait for the map to appear.
$SSHQGL[
³*36DQWHQQDLVGLVFRQQHFWHG&KHFNFRQQHFWLRQ´
When:
if the GPS aerial fails to pick up signals from GPS satellites.
What to do:
check that the GPS aerial is properly installed and move it to a suitable
position if required.
³,UUHJXODUVSHHGSXOVH&KHFNFRQQHFWLRQ´
When:
What to do:
if the built-in gyrosensor does not receive vehicle speed pulse.
consult with your Pioneer dealer.
³7KHURXWHFRXOGQRWEHIRXQG´
When:
What to do:
if the distance to the destination is too far and cannot be set.
change the destination to a location that is closer and divide up the route.
³7KHURXWHFRXOGQRWPHHWWKHURXWLQJFRQGLWLRQV´ZKHQDWWHPSWLQJWRPDNHD
GHWRXUDQGQRWRQDQPRWRUZD\
When:
What to do:
if there is no appropriate detour route using or avoiding motorways.
change the conditions and try setting the route again.
³<RXFDQQRWVHWPRUHGHVWLQDWLRQV´
When:
What to do:
if you try to set more than two destinations.
add the next destination after arriving at your first destination.
³7KHURXWHFRXOGQRWDYRLGWKHVSHFLILHGDUHD'R\RXZLVKWRWU\DJDLQZLWKWKH
JLYHQFRQGLWLRQV"´
When:
What to do:
if route setting cannot avoid a specified area to be avoided.
choose whether or not to try setting a route through the area.
³5RXWHJXLGDQFHKDVEHHQVWRSSHG´
When:
What to do:
when you choose to reroute.
wait until rerouting is completed.
³7KHURXWHKDVEHHQFKDQJHG´
When:
What to do:
when rerouting is complete.
begin driving when guidance begins.
³0RUHWKDQFKDUDFWHUVDUHUHTXLUHG´
When:
if you enter a name of five characters or less for a registered location or a
listing in the Destination history.
What to do:
use a name with more than five characters.
³<RXFDQQRWVWRUHPRUHORFDWLRQV´
When:
What to do:
if there are already 50 ticked items when you attempt to add a tick in the
Destination history.
remove the tick from some destinations as appropriate.
³7KHQDPHLVDOUHDG\LQXVH´
When:
What to do:
if a listing in the Destination history already has the same name.
choose another name.
³7KHVSHFLILHGW\SHFKDLQFDWHJRU\LVQRWLQWKLVDUHD´
When:
What to do:
if there is no point of interest in the specified category in the area.
choose another category or drive on a little before trying again.
³<RXFDQQRWUHJLVWHUPRUHW\SHVFKDLQFDWHJRULHV´
When:
What to do:
if you try to overlay more than two point of interest categories on the map.
remove another category from the map.
³7KHGHVWLQDWLRQLVQRWFRQWDLQHGRQWKHGLVF´
When:
What to do:
the destination is not available on the map disc you are using.
insert a disc that covers your choice of destination.
³:URQJSDVVZRUG3OHDVHVD\RUW\SHWKHFRUUHFWSDVVZRUG´
When:
What to do:
if you enter or speak the wrong password.
use the correct password.
³$KDUGZDUHHUURUKDVRFFXUUHG´RU³$QHUURUKDVRFFXUUHG3OHDVHQRWHWKH
IROORZLQJHUURUFRGHDQGSRZHURII´
When:
What to do:
in the case of a system failure.
note down the error code displayed on the screen, turn off the power, and then
contact your nearest Pioneer service facility.
³6\VWHPHUURU´
When:
in the case of system failure.
What to do:
do as instructed on the display.
$SSHQGL[
Route Setting Information
Route Search Specifications
Your Mobile Navigation System sets a route to your destination by applying certain built-in
rules to the map data. This section provides some useful information about how a route is set.
CAUTION
• Route-setting takes place automatically and guidance is based on the set route. The
system cannot take into account traffic restrictions and controls that depend on the
day. As you follow guidance, you must check the traffic restrictions for roads
along your route.
• The set route is not necessarily the shortest route to your destination.
• Route setting is limited to the range of the map disc in use. Additionally, if the destination is
too far, there may be instances where the route cannot be set.
• If you attempt to select a point on a motorway as a destination, a location on a nearby road
(such as below the motorway) may be chosen instead.
• During voice guidance, turns and junction from motorway are automatically announced.
(However, if you pass junctions, turns, and other guide points in quick succession, some may
not be announced.)
• Incorrect guidance may be given at motorway junctions if the exit lane is particularly long.
• If you choose a destination at a great distance from your current location, route setting may
take a long time.
How a Route Is Set
• In some cases, the set route may assume travel in the opposite direction to your current
heading.
• In some cases, a route may begin on the opposite side of a railway or river from your actual
current location. If this happens, try setting the route when closer to where you want to travel.
• Sometimes a route will unavoidably be set along roads in an area set to be avoided.
• It is possible that guidance may direct you off a motorway and then back on again.
• In some cases, guidance may direct you past your destination and then indicate a U-turn to
get back to it.
• If a route along a normal motorway passes near a motorway service area, the system may
mistake the service area for a motorway junction.
• If a suitable route cannot be set in compliance with the specified “DETOUR” parameter, an
area to be avoided, or your preference to avoid motorways, the setting or parameter may be
ignored.
• If your destination is a motorway junction, voice guidance may not announce the junction.
• There may be instances when the starting point and the destination point are not on the
highlighted route.
• When performing a “RESUME ORIGINAL ROUTE”, the shortest way back to the original
route is found. It may take you along winding roads, narrow city streets, and other nonoptimal roads.
Route Highlighting
Once set, the route is highlighted in bright green on the map (except in Arrow mode).
• On major motorways and wide roads, where a road is on multiple levels, or in mountainous
areas with many hills and curves, the highlighted route may not coincide exactly with the
map.
• The immediate vicinity of your starting point and destination may not be highlighted, and
neither will areas with particularly complex road layouts. Consequently, the route may
appear to be cut off on the display, but voice guidance will continue.
• If you set a further destination, the route to the second destination only becomes highlighted
after you reach your first destination.
$SSHQGL[
Intersection Enlargement
As you approach a intersection, the map scale is increased to show more detail.
• When the map scale increases, your vehicle direction immediately before reaching the
intersection is shown as “UP”. Thus, if you approach the intersection in a straight line, the
current location mark will come onto the map from the bottom of the display. If the road
curves into the intersection, the current location mark will enter the intersection from the
side.
• If the intersection is approached in a gentle curve, the map displayed may differ from the
actual road layout.
Current Location
Under certain conditions, map matching is unable to correct your position and your current
location may be shown incorrectly.
• If the vehicle has just been started or you turn on the Mobile Navigation System while
already in motion.
• When driving through tunnels, under motorways, among high-rise buildings, or wherever
reception of GPS signals is poor or multi-pass noise is present.
• Near a DAB (Digital Audio Broadcasting) station.
• When there is a road parallel to your route, such as an upper or lower level of a motorway,
and the two are displayed on the map as separate roads.
• On roads within industrial sites or on roads adjoining or in the vicinity of such sites.
• When negotiating multi-level intersection and Y intersections.
• On mountain roads with many sharp curves and numerous rises and falls.
• After a long stretch of straight or gently curving road.
• When using snow chains or if your vehicle’s wheels slip.
• After changing to tyres with different dimensions.
Other Information
Tracking
Your Mobile Navigation System marks your course on the map in certain increments (of
approximately 50 m (45 yards)). This is called tracking. It is handy when you want to check a
route travelled without guidance or if returning along a complex route.
A maximum of about 200 km (124 miles) is marked, and as you travel beyond this limit
tracking marks are erased in order from the most distant. Tracking can also be set for automatic
erasing whenever the Navigation System is switched off (“TRACKING DISPLAY” on page
111).
$SSHQGL[
Specifications
Main unit
GPS aerial
*365HFHLYHU
Aerial ...............................Microstrip flat aerial/right-handed
.......................................................... helical polarisation
Dimensions .............................51 (W) x 53 (H) x 16 (D) mm
Weight ........................................................................0.13 kg
System .................................................... L1, C/A code GPS
SPS (Standard Positioning Service)
Reception system
..................... 8-channel multi-channel reception system
Reception frequency........................................ 1,575.42 MHz
Sensitivity ............................................................. -130 dBm
Position update frequency ............. Approx. once per second
Commander
Dimensions ...........................38 (W) x 153 (H) x 33 (D) mm
Weight ........................................................................0.08 kg
&'520SOD\HU
Usable discs ..................... PIONEER Navigation CD-ROMs
&RPPRQ
Maximum current consumption ................................... 1.0 A
Power source .................. 14.4 V DC (10.8 - 15.1 V allowed)
Earthing system .............................................. Negative earth
Dimensions .........................277 (W) x 52 (H) x 175 (D) mm
Weight ......................................................................... 1.9 kg
1RWH
• The specifications and design are subject to
change without prior notice. Product purchased
may differ in detail from illustrations in this
manual.
Glossary
This glossary explains some of the terms used in the manual.
&'520
A disc much like an audio CD but used to store data.
&XUUHQWORFDWLRQ
The present location of your vehicle; your current location is shown on the map by M.
'HIDXOWVHWWLQJ
A factory setting which applies when you first switch on the system; you can change default
settings to suit your own needs in the Settings menu.
'HVWLQDWLRQ
A location you choose as the end point of your journey.
'HVWLQDWLRQKLVWRU\
A list of up to 98 previously visited destinations.
)XUWKHUGHVWLQDWLRQ
A location that you choose to route to after your destination; a journey can be built up from
multiple destinations.
*36
Global positioning system; a network of satellites that provide navigation signals for a variety
of purposes.
*XLGDQFHPRGH
The mode in which guidance is given as you drive to your destination; the system automatically
switches to this mode as soon as a route has been set.
*\URVHQVRU
The built-in sensor which enables the system to estimate your vehicle’s position. A learning
function increases its accuracy and two sets of learning data can be stored in memory.
+RPHORFDWLRQ
Your registered home location.
-R\VWLFN
The main control on the Navigation commander; it is used extensively to make selections from
menus and to scroll the map display.
$SSHQGL[
0DSGLVF
A CD-ROM containing map data for a particular area; map discs are available for many
different areas and countries; see “About CD-ROM Map Discs” on page 138 for details.
0HQX
A list of options shown on the display; choices are selected using the joystick.
0RELOH1DYLJDWLRQ6\VWHP
A system that provides a driver with guidance to a particular destination on the basis of builtin maps and positioning technology.
1DYLJDWLRQFRPPDQGHU
The remote control unit for the system (see “The Navigation commander” on page 13).
3RLQWRILQWHUHVW
Point of interest; any of a range of locations stored with the map data, including railway
stations, shops, restaurants, and amusement parks.
3URJUDPPHVRIWZDUH
The basic software needed by the system; it must be installed from CD-ROM before inserting
a map disc.
5RXWHVHWWLQJ
The process of determining the ideal route to a specific location; route setting is done
automatically by the system as soon as you specify a destination.
6HWURXWH
The route marked out by the system to your destination. It is highlighted in bright green on the
map.
6WRUHGORFDWLRQ
One particular location that you can register to allow easy routing.
7UDFNLQJ
Marks on the map indicating the route you have travelled.
9RLFHUHFRJQLWLRQ
The technology that allows the system to understand voice commands from the driver.
9RLFHJXLGDQFH
The giving of directions by synthesised or recorded voice while in guidance mode.
:D\SRLQW
These are important landmarks along your route, generally intersections. The next way point
along your route is indicated on the map by the yellow flag icon 0.
Display Information
Destination menu
on page 46
on page 50
on page 51
on page 55
on page 62
on page 64
on page 70
on page 99
on page 30
Guidance menu
on page 86
on page 88
on page 89
on page 91
on page 92
on page 93
on page 96
on page 98
on page 97
Setting menu(1)
on page 102
on page 102
on page 103
on page 104
on page 107
on page 107
on page 107
on page 107
$SSHQGL[
Setting menu(2)
on page 107
on page 108
on page 111
on page 112
on page 112
on page 112
on page 112
Setting menu(3)
on page 113
on page 113
on page 114
on page 115
on page 115
on page 115
on page 116
on page 116
Please read
We apologize for a mistake in the “SEARCH BY” screen on Page 64 of the Owner’s Manual.
It shows only four menu items: “SEARCH BY NAME”, “SEARCH BY DISTANCE”,
“SEARCH BY CITY”, and “LIST ALL”. The actual screen also contains the “SEARCH BY
NAME/DISTANCE” item. “SEARCH BY NAME/DISTANCE” is convenient when you want
to search for POIs near your current location and by name. When you select “SEARCH BY
NAME/DISTANCE”, you enter the name, then choose the distance range. For further details,
please see “Search by name” (Page 66) and “Search by distance” (Page 67).
7KHVFUHHQVKRZQLQWKHH[DPSOHPD\GLIIHUIURPWKHDFWXDOVFUHHQ
(VSHFLDOO\WKHGHSLFWLRQRIWKHPHQXPD\GLIIHUIURPWKHDFWXDOPHQX
7KHDFWXDOVFUHHQPD\EHFKDQJHGZLWKRXWQRWLFHIRUSHUIRUPDQFHDQGIXQFWLRQ
LPSURYHPHQWV
MEMO
:ULWH\RXUUHJLVWHUHGSDVVZRUGKHUHUHPRYHWKHSDJHIURPWKLVPDQXDO
DQGVWRUHLWLQDVDIHSODFH
&$87,21QHYHUOHDYHDQ\QRWHRI\RXUSDVVZRUGLQWKHFDU
France: tapez 36 15 PIONEER
PIONEER ELECTRONIC CORPORATION
1-4-1 MEGURO, MEGURO-KU, TOKYO 153-8654, JAPAN
PIONEER ELECTRONICS (USA) INC.
P.O. Box 1760, Long Beach, California 90801, U.S.A.
TEL: (800) 421-1404
PIONEER ELECTRONIC (EUROPE) N.V.
Haven 1087 Keetberglaan 1, 9120 Melsele, Belgium
TEL:(0) 3/570.05.11
PIONEER ELECTRONICS AUSTRALIA PTY. LTD.
178-184 Boundary Road, Braeside, Victoria 3195, Australia
TEL: (03) 580-9911
PIONEER ELECTRONICS OF CANADA, INC.
300 Allstate Parkway, Markham, Ontario L3R 0P2, Canada
TEL: (905) 479-4411
PIONEER ELECTRONICS DE MEXICO, S.A. de C.V.
San Lorenzo Num 1009 3er piso Desp. 302
Col. Del Valle, Mexico D.F. C.P. 03100
TEL: 5-688-52-90
Published by Pioneer Electronic
Corporation. Copyright © 1999 by Pioneer
Electronic Corporation. All rights reserved.
Printed in Belgium
<99C00F0V01>
OM-AVIC505-GB/B

AVIC - 505 - Pioneer Europe - Service and Parts Supply website

Transcription

Similar documents

Lotus Speculos

Sssisssend warm - Platinum Weekly Newspaper

International Offshore Powerboat Race 2012 (Sarnia)

3418 US Route 60 East Barboursville, WV

the jewish star - The Storch Agency

and Shrine of Saint John Vianney, Curé of Ars est. 1931 Rev

Worth Reading - Western Port Secondary College

East Side Mario`s

August 21, 2016 - St. Francis Xavier Parish