Research Projects - ASEM Aquaculture Platform
Transcription
Research Projects - ASEM Aquaculture Platform
Advances of the R & D in Aquaculture in China Mainland JH XIANG, SL DONG and QY WANG IOCAS, OUC & YSFRI Food safety issues in China!? Population accounting for 22 in total population of the world Population increase up to 1.6 billion by 2030 Land area of individual 0.008km2, 1/4 of average level of the world. Plantation area 7 of the world Fresh water resources 1/4 of the world average Food requirement: requiring 0.16 billion increasement by 2030 sea kelp scallop In China, the sequential successes of breeding for Laminaria in 1950’s, Chinese shrimp in 1970’s and bay scallop in 1980’s led to the three largest scale industries of mariFish shrimp culture in the world. Now the Fish culture is scaling up. 02 20 01 20 00 20 99 19 98 19 97 19 96 19 19 94 19 93 ¶ Ô Ï º 1990- 2002Ä ê Î ¹Ò ú Ï ¡º Ð ¢ ·Ñ ø Ö ²³ Á ú Ç ¿é ¿£ ö Í̈ ¶ ò £ Ö© Seaweed 2 1990- 2002Ä ê Í ¼ Î Ò ¹ ú º £ Ôå Ñø Ö ³Ç é ¿ö 02 20 01 20 00 20 99 19 98 19 97 19 96 19 95 19 94 19 93 19 92 19 91 19 90 140 120 100 80 60 40 20 0 19 4 º£Ôå²úÁ¿£¨X10t) Í 3¼ 19 92 19 19 19 91 60 50 40 30 20 10 0 95 Ï ¡º Ð ¢ À · à 90 4 ÑøÖ³²úÁ¿£¨X10t£© Crustacean 4 X10 t ) 400 Mussel Scal l op Lamar ck Cl am Li scheke Oyst er 7 350 300 250 200 150 100 50 0 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 4 1990- 2002 Í 5¼ 1990- 2002Ä ê Î ¹Ò ºú Ë £ ® Óã ÑÖ ø ²³ ú Á ¿ Çé ¿ ö 02 01 00 99 20 20 20 19 98 97 96 19 19 19 95 94 19 19 93 92 19 19 91 90 19 19 4 º£Ë®ÓãÑøÖ³²úÁ¿(X10 t) 60 50 40 30 20 10 0 Global aquaculture production 70 China vs Rest of Asia Production quantity (tonne x 106 ) 60 60 50 40 30 Asia China 40 20 0 1950 Rest of Asia 1970 1990 Year 20 10 Rest of World 0 1950 1960 1970 1980 Year 1990 2000 Fisheries Production of China in 2004 Aquaculture (32,087.000 t) 65.46% 35 30 25 20 Fishing (16,931,000 t) 34.54% 15 10 5 0 Total production of fisheries: 49 018 000 t The annual productions of mariculture in China Catch Culture 3000 X10,000 t 2500 2000 13 1500 1000 500 0 1996 1997 1998 1999 2000 2001 2002 2003 2004 Numbers of auaculture species Crustacea 10 Fish 60 Molluscs 20 Sea Weeds 10 Echinodermata (Sea cucumber, Sea urchin etc.) Percentages of different organonisms in aquaculture production Sea Weeds 11% others 2% 4% Crustacea 4% Crustacea Mollusc Sea Weeds others Mollusc 79% Aquatic Production’s Role in China Pruduction Year Products in SW 37% Hatchery environment Nutrition and Diet Management Disease control Parent stock Technology and technics Chain Effect The Major Diseases Problem and Resistant Mechanism of the Mariculture Organisms Chief Scinetist: Prof.Jianhai XIANG Budget: 29 million RMB From 1999 to 2004 founded by MOST Research Topics 1.Epidemiology of the major pathogens that causing damage of mariculture organisms 2. Comparative studies on defense systems of different types of host organisms 3. Genetic basis of resistance of organisms to disease 4. Influence of aquatic environment to hosts and/or pathogens 5. Control of disease The outbreak of disease depends on the interaction between host, pathogens and aquatic environment Host Environment Disease Pathogens Study on Etiology and Immunological Control of Critical Diseases in Mariculture Shrimp and Fish Chief Scinetist: Prof.Jianhai XIANG Budget: 28 million RMB From 2006 to 2010 founded by MOST Workpackages Key Processes and Sustainable Mechanism of Ecosystem Food Production in the Coastal Ocean of China Chief Scientist Qisheng TANG Budget: 30 million RMB From 2005 to 2010 founded by MOST Research Contents 1. 2. 3. 4. 5. 6. 7. 8. A study on biogeochemical cycles of elements in food web Key process of biogenic substance exchanges on the main interfaces of coastal waters Physical mechanisms of biogenic element supply in the typical shelf sea ecosystems Role of microbial loop in food production process in coastal waters Trophodynamics of phytoplankton community growth and primary production processes Role of zooplankton function groups in food production process Functional diversity and food production process at high trophic levels Anthropogenic impact on food production process and sustainable yield models in the coastal seas We held the second meeting of IMMUNAQUA program which was one of FF5 projects at IOCAS. CCACACACTGGGCTCTTCTTCGTTTACAGCCAGGCTTCGTT T CCACACACTGGGCTCTTCTTCGTTTACAGCCAGGCTTCGTT T CCACGAAGCGGCCTCTACTTCGTCTACAGCCAGGCGTCGT TC *** ** * * * * * *** ***** ** GTTTACCTTAGTGCAGTGTTTCAGCTGAATGAAGGGGAC GTTTACCTTGGTGCAGTGTTCCAGCTGAACGAAGGGGAC 1 ATCTACCTGGGCGCAGTGTTCCAGCTGAACGAAGGGGAC * *** * * * ** * ****** * * ** ** … … … … QGGFELVDNHIIIPRGLFVYSQASFRSISHRVWLFTESLGTQVSLMS…. LGBP PGRP PGRP GBP TRAF6 Cactus GPx TEP Many genes showed different expression pattern when shrimp were challenged by bacteria or WSSV. From the data, we infer that different defense system was triggered by different pathogen (bacteria or WSSV). The interaction of these genes in shrimp defense course is underway now. Since 1997 marine biotechnology has been approved to be a Subject of the National High Technology Research and Development Program of China (863 ). In the first five years (1996-2000) and successively in the second five years (2001-2005), under the Subject of Marine Biotech, the research and development has been funded by Chinese government with 97.5million RMB, then more than 200 million RMB respectively. The objectives are to promote the development of key technologies for rational utilization of marine bioresource, and the environment protection technologies that related for social sustainable development. http://www.863.org.cn There are mainly seven R & D areas in the subject of marine biotechnology: 1. breeding engineering, 2. control of the disease, 3. production system and culture facilities, 4. marine medicine and bioproducts 5. functional genes and genomics 6. breeding of the salt-resistant plants. Research and Development on the Techniques of Polyploid Breeding and Sex Control in Maricultured Animals “Ö ¿ Ð ºÆ씺 Í£ É å ± È´ Argopecten irradians “Ö Ð ¹ ú º ì”Ö Îå ŠƱ Ì « Haliotis discus hannai Combined approach of traditional selection and marker-assisted selection (MAS) Porphyra Huanghai -1 Soul Sea horse Cobia Groupe r Sea cucumber Sea urchin More and more species aquatic animals have been successful bred and cultured ● Healthy SPF or SPR Shrimp Seeds ● Immunity Stimulating ● Biosecurity ● Water Quality Control ● Improving Husbandry Enhancing the resistant ability by Immuno-stimulator Hemocynin Serum protein Lysogenicity ACP PO SOD Le n t i n an Zymosa n PG de hri acc gos Oli Hemocyte counting New Production System for Shrimp Culture • Litopenaeus vanamei in South China – Higher location, covering the pond bottom by plastic membrane – Well aeration and good management – Over Over 50% 50% of of the the total total shrimp shrimp culture areas, 250,000 t/yr Production of Shrimp Culture in Mainland of China Tone) 600000 500000 500000 400000 300000 200000 100000 0 1977 1979 1981 1983 1985 1987 1989 1991 1993 1995 1997 1999 2001 2003 Many thanks!