641-456-2585 - Hampton Chronicle
Transcription
641-456-2585 - Hampton Chronicle
$1.25 Newsstand 3 DAY FORECAST WEDNESDAY THU MOSTLY FRI SAT SUNNY 75˚53˚ WEDNESDAY | AUGUST ST 7, 2013 | V Volume 136 | Number 32 LETS GET SOCIAL Like us on Facebook at facebook.com/hamptonchronicle.com Go to HamptonChronicle.com to view all of our newspaper publications. City council discusses snowmobiles, impoundment issues at workshop By Jeff Forward The Hampton City Council had a somewhat meaty workshop agenda on Monday evening, with seven items up for discussion including the city’s policy on snowmobiles in town, options for impounding vehicles for traffic violations and a dog swimming day at the city aquatic center. Although it came at the end of the meeting, the four council members present – Jim Davies and Steve Harms were not in attendance - and several people in the audience shared empassioned views on the issue of snowmobiles in town. The discussion of snowmobiles in town began several weeks ago when citizen Shirley Smith complained to the council about snowmobile riders damaging her property. Mayor Shawn Dietz asked city officials to meet with interested parties to develop a game plan for snowmobiles in the city. On Monday, Police Chief Bob Schaefer told the council that he does not want an outright ban on snowmobiles in town, but is in favor of limiting the areas where they can operate. “My initial thought is not to have snowmobiles on city streets,” Schaefer said. “It’s just tough to go in and enforce, that’s why my initial reaction was not to have them in city limits.” After several minutes of discussion, the council decided they would examine the issue further into the winter season in the event problems arose. City council members also heard from City Attorney Michael Cross about possible options to impound vehicles for traffic offenses. Cross told the council members that various state and federal laws prohibited or limited the ability of a city to impound personal vehicles except in certain situations. “There isn’t anything that allows a city to impound vehicles,” Cross said, noting state laws covered the issue. “We don’t have that authority. The city doesn’t have that authority.” Cross said technically, city police can impound a vehicle of a driver who has no proof of insurance, however the logistics of impounding vehicles – including a variety of factors that make it very hard on a small police department – almost make it prohibitive. Schaefer said that his staff – already short of an officer – would have to spend excessive time doing impoundment paperwork, waiting for a tow truck and then the city would City Council: See Page 3 77˚ Partly Sunny 77˚ Partly Cloudy | www.hamptonchronicle.com | Call 641-456-2585 or 1-800-558-1244 Halloran earns allstate honor Local man acquitted of sex abuse charges, found innocent Spencer Halloran of West Fork capped a record-breaking season with a second team all-state nod by the Iowa Newspaper Association. A Hampton man who was arrested in May on allegations of sexual abuse and burglary was found not guilty of all charges on Aug. 1 following a two-day jury trial. Sports, Page 11 77˚ Partly Cloudy Local News, Page 3 People in the Park Neighbors, Page 15 Mark your calendar: Sheffield’s annual BBQ Contest is quickly approaching. With entertainment for the whole family, you won’t want to miss this! Plethora of activities for all ages at this weekend’s Summerfest By Jeff Forward The last big community event of the summer is being held this weekend, as the annual Summerfest takes over Band Shell Park on Friday and Saturday with tons of activities for all ages. “This is our 16th annual event. We’re actually adding a little kicker this year,” said Hope Polk, from the Greater Franklin County Chamber of Commerce, which is putting on the event. “It’s the first year of the beer garden at Summerfest, on Friday night.” Polk said the two-day event will feature “adult-friendly” events and entertainment on Friday night before switching to a child and familythemed day on Saturday. “At Summerfest, the community all comes up,” Polk said. “It’s kind of like a last hurrah before school starts.” Festivities begin on Friday at 5 p.m., when the beer garden and food vendors begin service. This year’s beer garden is sponsored and run by D.T.’s Roadhouse of Dumont. The popular cover band, Standing Hampton, will be the main entertainment for Friday night. The band takes the stage at 8 p.m. and will play until midnight. Opening for Standing Hampton will be Jesse Allen Steward, at 5:30 p.m. “It’s going to take up most of the (Band Shell) park,” Polk said of Friday night’s beer garden. “So, if you want to see Standing Hampton or Jesse Allen Steward, you’re going to have to be inside the beer garden.” Friday night will also feature the wildly popular 60-mile classic car cruise through Franklin County. Car enthusiasts going on the cruise need to be at the Hampton-Dumont Community High School parking lot at 6 p.m.; the cruise will depart the high school at 6:30 p.m. Saturday, Polk said, is more of a family and child-friendly day. There will not be a beer garden on Saturday and instead, Band Shell Park will be filled with a classic car show, kids games, the same food vendors, and concerts by three different artists. The days activities begin at 9 a.m. with the classic car show, which will run until noon. At around noon, the KLMJ/KQCR Antique Tractor Parade is expected to wind into Hampton after beginning in Bristow earlier that morning. From noon until 3:30 p.m., the Whitesidewalls – a 1950s’ and 1960s’ tribute group – will rock the park with oldie tunes. At 6:15 p.m., Morgan Alexander will take the stage – opening for headliner Summerfest: See Page 3 Local favorite, musical artist Erica Nicole, is the headline act Saturday night at Summerfest. (Courtesy Photo). Members of the Hampton Fire Department did a controlled burn of an abandoned home on July 29 at 400 First St. SW. Photos by Jeff Forward, Hampton Chronicle. Intentional burning down of house a win-win for city By Jeff Forward A large crowd of fascinated Hampton residents gathered on July 29 in the south part of the city to watch local firefighters burn down an abandoned house as part of a training exercise. The controlled burn fire was conducted by members of the Hampton Fire Department at an abandoned house in the 400 block of First Street Southwest. The fire served two purposes for the city – as a training exercise on a live fire for members of the fire department but also as a way for the city to destroy an “eye-sore” condemned property it had taken possession of. “It’s probably about the best training you can get because it’s a real, live fire,” said Hampton Fire Chief Kent Wilkinson. “We get the older guys showing the younger guys what to do; it’s a lot of good training.” Wilkinson said fires such as the one on July 29 allow his firefighters to practice important techniques such as rescue in a burning structure, Local experts cautiously optimistic for a decent harvest By Nick Pedley Crops throughout Franklin and southern Cerro Gordo County are still playing catch-up following this spring’s heavy precipitation and late planting season. Local agriculture experts stressed the need for dry weather and warm temperatures throughout the month of August. Keith Pillatzki, agronomist at Agvantage’s Franklin County locations, said rainfall in May and June set up area corn and soybean plants for decent fall yields so long as precipitation stays at bay this month. Though many fields were planted late, Pillatzki felt most area crops were still on pace for a relatively productive harvest. “Most crops are progressing nicely. The late corn is doing the best it can. It’s playing catch-up right now, but some of it’s starting to tassel,” he said. Pillatzki estimated that only 5 percent of the Franklin County’s crop was in excellent condition. The large majority—60 percent or so—is average to slightly below average, he said. The rest, however, was below that. He felt 25 percent was well under average for this time of the growing season with the remaining 10 percent in very poor condition. “That’s not in any individual township. It’s pretty generalized throughout the county because of the late crop,” said Pillatzki. Heavy spring rain is the culprit behind another issue afflicting local corn and soybeans. According to Mark Bausch, agronomist at North Corn Crops: See Page 3 use of power saws and tools, and fire truck set-up and correct usage of water hoses to battle a residential blaze. “We send the guys in there with their airpacks on and the thermal imaging,” Wilkinson added. “We have one of the firemen go in there and hide in the fire and we find him and drag him out.” Wilkinson said about 20 of the department’s 23 volunteer firefighters took part in the practice burn. The fire was started at about 6 p.m. and the whole exercise was completed by about 8:15 p.m. “They get to see how everything goes and how fast it burns,” Wilkinson added. “Plus we have to run the trucks and the hoses and water.” Training Fire: See Page 2 County, city officials to meet, discuss dispatch services Council, and the county Emergency By Jeff Forward The ongoing saga of the fate of four city-employed emergency dispatchers continues this week when officials and attorneys from both the City of Hampton and Franklin County are scheduled to meet to try to hash out their differences. Representatives from the Franklin County Board of Supervisors, the Hampton City Management Commission were scheduled to meet with attorneys for all parties at 7 p.m. on Aug. 6 in the Law Enforcment Center conference room to discuss the issue of dispatchers. Hampton City Manager Ron Dunt said city officials wanted the meeting in order to “expedite the process” and bring clarity to the issue with everyone’s attorneys be Dispatch: See Page 15 2 LOCAL NEWS :HGQHVGD\$XJXVW Training Fire: From Page 1 The burning down of the house also served another purpose – eliminating an “eye-sore” property that had been abandoned and been acquired by the city. Hampton City Manager Ron Dunt VDLGWKLVLVQ¶WWKH¿UVWWLPHWKHFLW\KDV burned down an abandoned and condemned home and he wishes that the city had the money to do more. “The city owns it. It was an abandoned property and needed to be destroyed,” Dunt said of the 400 First St. 6:KRXVH³,W¶VNLQGRIDGXDOEHQH¿W ,W JHWV ULG RI DQ H\HVRUH DQG WKH ¿UH BUFFET! Steaks Pastas •Seafood Fresh Homemade Salad Bar Only $895 Seniors $795 HHours: Tuesday - Friday • 6:30 a.m. - 8:00 p.m. SSaturdays & Sundays • 7:00 a.m. - 8:00 p.m. 6641-456-5378 • Hwy 65 So., Hampton department gets training.” Dunt said that the burning of the home was approved by the Hampton City Council. The property was a foreclosed home and the city pursued ownership under Chapter 657 (a) of the Iowa Code, which allows for abandoned properties to be acquired by local cities. With an estimated 20 to 30 homes in similar condition, Dunt said he’d be happy to be able to burn all of them to the ground. “It’d be nice in a fantasy world to burn down all these down,” Dunt said. “Put in nice lawns and sell them. But in reality, it takes money. It costs money and it takes money away from the (city’s) general fund. You have to do them as you can afford it.” “We’d love to do what we can to remove these problem properties, but it does cost money,” Dunt added. “We just can’t afford to acquire these properties.” +DPSWRQ&KURQLFOH6HFWLRQ$ 7KHFRQWUROOHGKRXVHEXUQFRQGXFWHGRQ-XO\DOORZHG¿UH¿JKWHUVWRSUDFWLFHWKHLUVNLOOVDQGWHFKniques in battling a residential blaze. www.edwardjones.com In the Neighborhood? Let’s Get to Know One Another. New to the area? Unfamiliar with the Edward Jones way of doing business? Take an hour or so to learn how we work with millions of individual investors. Together, we can create and implement an investment strategy designed to help you achieve your long-term financial goals. We customize our recommendations based on our clients’ current situations, objectives and risk tolerance. Call today to schedule a no-cost, no-obligation portfolio review. John F Rowe, AAMS® Financial Advisor . 1202 4th Street Ne Hampton, IA 50441 641-456-4946 Member SIPC The home that was burned down was abandoned and ownership had been taken by the City of Hampton. This is one of several structures that have been burned down on purpose, removing an “eye sore” from the community, said City Manager Ron Dunt. Photos by Jeff Forward, Hampton Chronicle. ĞƩĞƌĨŽƌƵƐŝŶĞƐƐ͙ĞƩĞƌĨŽƌ>ŝĨĞ dŚĂŶŬƐƚŽ upgrad ŝŶŝŶƚĞƌŶĞƚ͕ƵƉŐƌĂĚĞĚ upgrades es ŚĞĂůƚŚĐĂƌĞĨĂĐŝůŝƟĞƐĂŶĚŶĞǁĂƋƵĂƟĐĐĞŶƚĞƌ͘ dŽůĞĂƌŶŵŽƌĞĂďŽƵƚǁŚLJǁĞĂƌĞďĞƩĞƌĨŽƌďƵƐŝŶĞƐƐĂŶĚůŝĨĞĐŽŶƚĂĐƚ<ĂƌĞŶΛ FCDA 5 1Ɛƚ^ƚ͘^t͘,ĂŵƉƚŽŶ͕/ϱϬϰϰϭͮϲϰϭͲϰϱϲͲϱϲϲϴͮĨĐĚĂĚŝƌĞĐƚŽƌΛĞŵĂŝů͘ĐŽŵ Your trusted healthcare partner for life. f 7KH¿UHZDVLQWHQWLRQDOO\VHWE\PHPEHUVRIWKH+DPSWRQ)LUH'HSDUWPHQWDWDERXWSPDQGFRQWLQXHG for several hours as a crowd of hundreds of onlookers gathered. TRUST ME FOR SPECIALIZED You + ECC + ISU/UNI/Iowa = A Bright Future! OB/GYN CARE 'U7DQLVRQHRIWKHWUXVWHGVSHFLDOLVWV UXVWHGVSHFLDOLVWV KROGLQJFOLQLFVDQGSHUIRUPLQJVXUJHULHV UIRUPLQJVXUJHULHV DW)*+/HDUQPRUHDWW )5$1./,1*(1(5$/&20 &20 You can be Dual Enrolled at Ellsworth Community College and Iowa State, UNI or Iowa. You’ll save about $35,000 by living at home and taking freshman and sophomore coursework at ECC. Then you can transfer your ECC credits seamlessly to complete a bachelor’s degree. While you’re dual enrolled, you’ll have all the rights and privileges of an ISU/UNI/Iowa student ...including an academic advisor, access to athletic events, and more. &HQWUDO$YH( +$03721,$ &DOOWKH(&&$GPLVVLRQV2IÀFHIRUGHWDLOV<RXGHVHUYH WKHEHVWDQG\RX·OOÀQGWKDWE\WDNLQJ\RXUQH[WVWHSDW Ellsworth Community College. ELLSWORTH Community College iowa valley community college district “Like” us on Facebook for updates al. on Franklin General Hospital. 'U7KRR7DQ 1100 College Ave., Iowa Falls, IA z Ph: 641-648-4611 or 1-800-322-9235 E-mail: [email protected] z Web: www.EllsworthCollege.com +DPSWRQ&KURQLFOH6HFWLRQ$ LOCAL NEWS :HGQHVGD\$XJXVW 3 City Council: From Page 1 Corn Crops: From Page 1 need an impound lot where vehicles would be under guard and safe from damage or theft. “The time it would take to do this would be immense,” Schaefer said. ³$W WKLV SRLQW LQ WLPH ZH GRQ¶W KDYHWKHSHUVRQQHORURI¿FHSHUVRQnel to do that.” In other items, the council heard options for use of the alley east of the Hampton Public Library, which could be affected by the library exSDQVLRQ DQG WKH ¿UH GHSDUWPHQW¶V efforts to sell a 1967 Plymouth Fury station wagon as a fund-raiser. Bradley Waddle, the manager of the city aquatic center, addressed the council about an idea put forth by Council Member Valerie Haugebak of having a designated dog day at the swimming facility. Waddle seemed sour on the idea, and told the council bluntly that if an event would occur, he would refuse to save a dog himself and would not allow members of his lifeguard staff to rescue a dog in distress. “There is going to be some issues of hair and other stuff,” Waddle said of having dogs swim in the pool. Waddle said the potential for a dog in distress biting a lifeguard was not a risk he wanted to take with his staff. ³,ZRQ¶WSXWDQ\RIP\JXDUGVLQ jeopardy,” Waddle added. The council also heard about options to changing the nuisance ordinance to punish repeat offenders. Cross went over various penalties and scenarios with the council for ¿QLQJ UHSHDW RIIHQGHUV DQG KRZ that would be handled in the event cases went to court. The issue of nuisance violations is a hot button for many members of the council, and at each city council workshop and formal meeting, updates in nuisance abatement efforts are given by Schaefer and City Public Works Director Doug Tarr. “One of the frustrations are the multiple times you have to go and serve a notice to the same person,” Schaefer said. 7KHFRXQFLOZLOOKROGLWVRI¿FLDO meeting where formal action can be taken on items on Thursday at 6 p.m. in the council chambers in City Hall. Iowa Cooperative in Thornton, unevenness amongst crops is common throughout much of the area. He said temperatures in the mid-eighties, warm nights and minor rainfall accumulation throughout August would be ideal conditions for crops to maintain their current path. Bausch said he felt area corn and soybeans were in decent shape considering the turbulent weather, but remained tentatively hopeful about harvest predictions. “I’ve never seen anything like this year—even older farmers have been saying that. The late planting was just so wide-spread everywhere,” he said. “I think the early-planted crops could produce 180-bushel (per acre) corn and between 45-50 bushels (per acre) for soybeans, but the late stuff is really up in the air.” Yield predictions for some local farmers aren’t even possible, however. Bausch estimated that WR SHUFHQW RI ÀHOGV DURXQG Thornton went unplanted because of heavy rainfall. Steve Abbas, Franklin County executive director for the Farm Service Agency, was unable to JLYH DQ H[DFW QXPEHU RI ÀHOGV WKDW fell victim to prevented planting. 6WDWHOHYHO )6$ RIÀFLDOV VHQW RXW D memo last week that instructed local agents not to give out prevented SODQWLQJÀJXUHVWRWKHSXEOLF “They said they don’t want the numbers to affect the market, and I said, ‘And they should affect the market!’ But I’ll say that it’s more than I expected. I thought it’d be around 5,000 acres, but it’s substantially higher than that,” said Abbas. Despite all this, not all local farmers are seeing lasting repercussion from spring’s rainfall. Rick Demaray, agronomist at Five Star Cooperative in Dougherty, felt 95-98 percent of the crop around the Rockwell area was planted within a reasonable timeframe. “We’ve been pretty fortunate around here. Our company’s territory stretches all the way up to the Minnesota border and my area is the one that got their crop in relatively on time,” said Demaray. He said most all of the corn is tasseled and felt that corn and soybeans were only one to two weeks behind where they should be at this time of the year. “Even though corn is behind, it will push itself to get where it needs to be. We saw that in July after it dried up. It’s versatile, where soybeans aren’t so much,” he said. Demaray felt crops around Rockwell were in better position than some throughout the area. The ÀHOGVKDYHEHHQUHFHLYLQJSHULRGLFDO rain showers throughout the summer, which will bode well for their longterm success. “Truthfully, I can see our corn being between 165-185 bushels (per DFUH 7KH\·OO EH D IHZ ÀHOGV RYHU 200, but those are going to be few and far between,” he said. “Beans Meetings & Events Mayor’s Coffee: 9-10 a.m., Saturday, Aug. 10 at city hall. )UDQNOLQ&RXQW\%RDUGRI6XSHUYLVRUV Monday, Aug. 12 at 8:30 a.m. in the courthouse basement. )DUPHUV0DUNHW 5-7 p.m. on Tuesdays and 5-7 p.m., Fridays in Main Street Square, Hampton. +DPSWRQ &LW\ &RXQFLO:RUNVKRS 6 p.m., Monday, Aug. 19 at city hall. $FNOH\&LW\&RXQFLO Wednesday, Aug. 14 at city hall. &RXOWHU&LW\&RXQFLO 6 p.m., Wednesday, Aug. 14 at city hall. /DWLPHU&LW\&RXQFLO 6 p.m., Wednesday, Aug. 14 at city hall. *HQHYD&LW\&RXQFLO 6:30 p.m., Wednesday, Aug. 14 at city hall. +DPSWRQ&LW\&RXQFLO 6 p.m., Thursday, August 8 at city hall. 'XPRQW&LW\&RXQFLO 7 p.m., Thursday, Aug. 15 at city hall. $UHGDOH&LW\&RXQFLO 7 p.m., Monday, Aug. 19 at city hall. )UDQNOLQ&RXQW\*HQHDORJLFDO6RFLHW\ 10 a.m., Saturday, Aug. 17 at the Franklin County Fair Grounds. Visitors are welcome, share family history. will probably be between 40-50 bushels. I think we’ll see some over 60, but those will be pretty scarce, too.” Local man acquitted of sex abuse charges, found innocent By Jeff Forward A Hampton man who was arrested in May on allegations of sexual abuse and burglary was found not guilty of all charges on Aug. 1 following a two-day jury trial. Isidro Lopez Lopez, originally arrested by Hampton Police on May 15 and who had been incarcerated in the Hardin County Jail, was found innocent of all charges said his attorney, James Larsen of Iowa Falls. “A jury trial was held,” Larsen said. “The jury, after deliberations, found him not guilty of all charges.” Larsen said the trial began on July 30 in Franklin County District Court and included testimony from the alleged victim as well as Lopez Lopez. The jury came to their verdict Thursday morning, much to the relief of Lopez Lopez, Larsen said. Larsen said there is some procedural paperwork to be completed before his client is released from the Hardin County Jail. ³+H¶V PDUULHG WR D FLWL]HQ´ Larsen said of Lopez Lopez. “We 7KLV¿HOGQHDU%HHGV/DNHZDVRQHRIPDQ\WKURXJKRXWWKHDUHDIRUFHGLQWRSUHYHQWHGSODQWLQJ$FFRUGLQJWR6WHYH$EEDVFRXQW\ anticipate if everything goes well, executive director for the Farm Service Agency, over 5,000 acres went unplanted in Franklin County. (Photo by Nick Pedley, Hamp- he should be back to his family soon.” ton Chronicle) Summerfest: From Page 1 act Erica Nicole. Nicole, who has performed many times in Hampton, will rock the par from 7 p.m. until the conclusion of the Summerfest at 10 p.m. Saturday will also feature street vendors, a beanbag tournament VSRQVRUHG E\ +DPSWRQ¶V 3LW 5RZ bar, and lots of fun activities and games for childen and families to enjoy. Standing Hampton usually gets the crowd on its feet, dancing to the tunes of classic rock. (Courtesy Photo). Popular 50s’ and 60s’ cover band the Whitesidewalls will be the afternoon musical act during the classic car show on Saturday. (Courtesy Photo). Standing Hampton, a popular classic rock cover band, will entertain the crowd Friday night at Summerfest. (Courtesy Photo) 4 :HGQHVGD\$XJXVW COMMENTARY +DPSWRQ&KURQLFOH6HFWLRQ$ Publisher’s Notebook FIRST AMENDMENT to the CONSTITUTION by Ryan Harvey Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably to assemble, and to petition the Government for a redress of grievances. A few random thoughts STATE of IOWA MOTTO Our liberties we prize and our rights we will maintain. A NATION OF LAWS Where the will of men exceeds the rule of law, there, tyranny prospers. HAMPTON CHRONICLE Postal Notice & Opinion Page Policies UNITED STATES POSTAL SERVICE REQUIRED NOTICE: The Hampton Chronicle is produced weekly and distributed on Wednesdays by Hampton Publishing Company, a division of Mid-America Publishing Corporation, +DPSWRQ,$3HULRGLFDOVSRVWDJHSDLGDWWKH+DPSWRQ3RVW2I¿FH Hampton, IA 50441. Send address changes to Hampton Chronicle, PO Box 29, Hampton, IA 50441. Postal Permit USPS 234-020. This is issue Volume 136, Number 32, on Wednesday, August 7, 2013. OPINION PAGE POLICIES: The Chronicle accepts letters. All such material should clearly and concisely express and opinion or solicit a call to action regarding a particular issue. Letters must include the name, address, and SKRQHQXPEHURIWKHDXWKRUIRUYHUL¿FDWLRQSXUSRVHV7KH&KURQLFOH¶VVWDQdard practice is to not publish unsigned or anonymous letters. The Chronicle has the right to edit all letters and guest editorials for length, clarity, taste and libel. All personal columns and letters on this page are the views of the auWKRUVDQGGRQRWQHFHVVDULO\UHÀHFWWKHYLHZVRIWKH+DPSWRQ&KURQLFOH Chronicle Editorial Washington bipartisanship still a pipe dream 'HVSLWH D UHFHQW VKRFNHU GRQ·W H[SHFW 'HPRFUDWV DQG 5HSXEOLFDQV WR ZDON KDQGLQKDQG GRZQ D SDWK RI ELSDUWLVDQ DOOLDQFHDQ\WLPHVRRQ 7KH86+RXVHODVWZHHNSDVVHGDQGVHQWDELOOWRWKH SUHVLGHQWWKDWÀQDOO\WRRNFDUHRIWKHRQJRLQJIHGHUDOVWXGHQWORDG KHDGDFKHWKDWDURVHDIWHU-XO\$SUHYLRXVELOOWKDWVHWLQWHUHVW UDWHVH[SLUHGODVWPRQWKHIIHFWLYHO\GRXEOLQJUDWHVIRUVWXGHQWV DQGSDUHQWVERUURZLQJVXEVLGL]HG6WDIIRUGORDQVWKLV\HDU7KH QHZ ODZ OHWV LQWHUHVW UDWHV ÁXFWXDWH ZLWK WKH HFRQRP\³UDWHV FOLPE DV WKH JRYHUQPHQW·V DELOLW\ WR ERUURZ PRQH\ EHFRPHV PRUHH[SHQVLYHZKHQWKHPDUNHWLPSURYHVDQGWKH\JRGRZQ LQWKHRSSRVLWHVFHQDULR 7KH ELOO ZKLFK ÀUVW SDVVHG WKH 6HQDWH WZR ZHHNV DJR ÁHZ E\ ZLWK D ²PDUJLQ LQ WKH +RXVH ,W ZDV D SUHGLFWDEOH VFHQH DPRQJVW &RQJUHVVLRQDO PHPEHUV IROORZLQJ WKHRYHUZKHOPLQJDSSURYDO5HSXEOLFDQVFODLPHGFUHGLWDVGLG 'HPRFUDWV%RWKVLGHVDOOHJHGWKHRWKHUZDVWREODPHIRUWKH GHOD\HGSDVVDJH+RZHYHUDQLQWHUHVWLQJVHQWLPHQWVHHPHGWR HPDQDWHIURPERWKFDPSV 'HPRFUDWV DQG 5HSXEOLFDQV UHSHDWHGO\ DVVHUWHG WKLV VLQJOH H[DPSOH RI ELSDUWLVDQ DJUHHPHQW FRXOG PDUN D WXUQLQJ SRLQWLQWKHRQJRLQJ:DVKLQJWRQGHDGORFN)URPDQREMHFWLYH VWDQGSRLQW WKHLU FODLPV VHHP WR KROG PHULW 7KH VWXGHQW ORDQ DJUHHPHQW LQFOXGHV D EHY\ RI FRPSRQHQWV WKDW UHODWH WR WKH FXUUHQW SROLWLFDO GLVFRXUVH³WKH JRYHUQPHQW·V UROH LQ OHQGLQJ WKHPLGGOHFODVVDQGWKHHFRQRP\+RZHYHUWKHVHJUDQGGUHDPV RI FRPSURPLVH DUH DOO IRU QDXJKW :DVKLQJWRQ·V XSFRPLQJ DJHQGDZLOOVRRQVKRZFDVHWKHPDVVLYHGLYLGHEHWZHHQWKHHDFK SDUW\·VSULRULWLHVDQGJRDOV &RQJUHVVKDGOLWWOHFKRLFHEXWWRSDVVWKHVWXGHQWORDQ ELOO)ROORZLQJDPRQWKRISROLWLFDOFKHVWSRXQGLQJDQGÀQJHU SRLQWLQJDIWHUWKH-XO\LPSDVVHLWZDVFOHDUDGHDOZDVRQWKH KRUL]RQ$IWHUDOOLIWKH\GLGQ·WÀQGFRPPRQJURXQGE\WKHHQG RIODVWZHHNWKH\ZRXOGKDYHKHDGHGKRPHIRUDPRQWKORQJ UHFHVV WR EH JUHHWHG E\ FRQVWLWXHQWV DOUHDG\ DQJHUHG E\ WKHLU SUHYLRXVLQHSWLWXGH0LGGOHDQGORZHUFODVVYRWHUV³WKHSULPDU\ ERUURZHUV RI IHGHUDO VWXGHQW ORDQV³ZRXOG KDYH ERPEDUGHG WKHVHSROLWLFLDQVZLWKXQUHOHQWLQJIXU\KDGWKH\IDLOHGWRPDNH DGHDO1RRQHLQ&RQJUHVVZDQWVWREHVHHQDVDQ´HQHP\µWR $PHULFD·VKDUGZRUNLQJPLGGOHFODVVKHQFHWKHRYHUZKHOPLQJ DSSURYDO 7KHELOO·VSDVVDJHDOORZVPHPEHUVRI&RQJUHVVWRUHWXUQ KRPHDQGSUHVHQWFRQVWLWXHQWVZLWKDQLOOXVLRQRIELSDUWLVDQEULGJH ZRUN,QVSLWHRIDOOWKHJULGORFNWKHVWXGHQWORDQFRPSURPLVHLV WKHPRVWUHFHQWH[DPSOHRIDQDIIHFWLYHJRYHUQPHQW$PHULFDQV KDYHEHHQVXEMHFWHGWRIXWLOLW\RQDPDVVLYHVFDOHRYHUWKHSDVW HLJKWPRQWKV)URPWKLVZLQWHU·VVHTXHVWHUWRFRQWLQXHGGHEDWH RYHU EXGJHW FXWV LW VHHPV WKH RQJRLQJ VWDOHPDWH KDV QR HQG +RZHYHUWKHVWXGHQWORDQELOOSURYLGHVWKHRSSRUWXQLW\WRSXOO WKHZRRORYHUWKHH\HVRI$PHULFDQV7KH\·OOFODLPLQURDGVDUH EHLQJPDGHIRUPRUHSURGXFWLYHGLVFXVVLRQLQ:DVKLQJWRQEXW WKDWFRXOGQ·WEHIXUWKHUIURPWKHWUXWK 'LIIHUHQFHV EHWZHHQ 'HPRFUDWV DQG 5HSXEOLFDQV DUH YDVW DQG LQWHUSDUW\ VTXDEEOLQJ DOVR KDV JUHDW SRWHQWLDO WR FDXVH WXUPRLO LQ WKH FRPLQJ PRQWKV 7KH EHVW H[DPSOH RI WKLV LPSHQGLQJ URDGEORFN LV LPPLJUDWLRQ UHIRUP &RQJUHVV KDV EHHQ ZUHVWOLQJ RYHU SROLF\ FKDQJHV DOO \HDU EXW WKH\·YH EHHQGRLQJQRWKLQJEXWSRXQGLQJWKHLUKHDGVDJDLQVWWKHZDOO 1HJRWLDWLRQVKDYHFRQWLQXRXVO\VWDOOHGDIWHU5HSXEOLFDQ+RXVH OHDGHUVKLSIDLOHGWRUHDFKDFRQVHQVXVHYHQDPRQJVWWKHLURZQ SDUW\0RGHUDWHVDQGPRUHFRQVHUYDWLYHEUDQFKHVRIWKH*23 KDYHUHSHDWHGO\FODVKHGRYHUMXVWKRZIDUWKH\ZDQWWRJRZLWK UHIRUPPHDVXUHV7KLVLQWHUSDUW\GLVSXWHLVLQGHHGDVIUXVWUDWLQJ DVLWLVH[KDXVWLQJEXWWKHUHDOLW\RQO\SURPLVHVWRFRQWLQXHDV GHEDWHSURORQJV 7KH VWXGHQW ORDQ GHDO ZDV D UHIUHVKLQJ UHPLQGHU WKDW RXU ODZPDNHUV FDQ DFFRPSOLVK ZKDW ZH HOHFWHG WKHP WR GR +RZHYHU LW E\ QR PHDQV PDUNV D WXUQLQJ SRLQW LQ &RQJUHVV· RQJRLQJJULGORFN'LIIHUHQFHVDUHYDVWDQGFRPSURPLVHZLOOEH YHU\GLIÀFXOW$PHULFDQVVKRXOGSUHSDUHWKHPVHOYHVIRUWKHORQJ KDXORQFHODZPDNHUVUHWXUQWR:DVKLQJWRQLQDPRQWKEHFDXVH LW·VJRLQJWREHDEXPS\ULGH Reflections of Our Past by Mickey Ferris Geneva Part One 7KHÀUVWVHWWOHUVZKRFDPHWRWKH *HQHYDDUHDLQIRXQGMXVWZKDW WKH\ ZDQWHG LQ WKLV EHDXWLIXO DUHD ODQGZDWHUDQGZRRGV7LPEHUZDV IRXQGLQ)RXU0LOH*URYHDQG+LJKODQG *URYH DQG 0D\QHV &UHHN UDQ WKURXJK*HQHYD7RZQVKLS 2QH GD\ VKRUWO\ DIWHU DUULYLQJ LQ WKH *HQHYD DUHD 4$ -RUGDQ VDZ ZKDWKHWKRXJKWZDVHONLQWKHGLVWDQFH VR KH JUDEEHG KLV JXQ DQG PRXQWHG KLV ÁHHW IRRWHG PDUH DQG KHDGHG WRZDUG WKHP ,QVWHDG RI HON KH IRXQG D KRUVHPDQ OHDGLQJ DQRWKHU KRUVH 7KH PDQ ZKLSSHG KLV KRUVHDQGDWWHPSWHGWRJHWDZD\0U -RUGDQ RUGHUHG KLP WR VWRS DQG KH GLGQ·W VR KH VKRW DQG ZRXQGHG WKH PDQ$VKRUWWLPHODWHUDSDUW\IURP )RUW'RGJHDUULYHGDQGWRRNFKDUJH RIWKHKRUVHWKLHI 7KHÀUVWPDUULDJHELUWKDQGGHDWK ZDVDOOLQWKHIDPLO\RI+HQU\6PLWK ZLWK WKH ELUWK DQG GHDWK RI KLV ÀUVW FKLOGLQDQG0U6PLWK·VPDUULDJHWRKLVVHFRQGZLIHLQ 7KH ÀUVW VFKRRO ZDV WDXJKW E\ $QQD 6FRWW LQ WKH ZLQWHU WHUP RI DW WKH ORJ FDELQ KRPH RI 3HWHU5HLQKDUWZLWKÀYHVWXGHQWV,Q VFKRRO ZDV WDXJKW E\ $OYLUD -RKQVRQLQ'DQLHO7LOPDQ·VKRPH 7KHÀUVWVFKRROEXLOGLQJZDVEXLOW RQ VHFWLRQ LQ E\ VXEVFULSWLRQ 7KH ÀUVW WHUP ZDV WDXJKW E\ :LOOLDP+7KRPSVRQ2QHPRUQLQJ 0U 7KRPSVRQ DUULYHG DW VFKRRO WR ÀQG WKDW WKH ´ELJ ER\Vµ KDG ORFNHG KLP RXW DQG UHIXVHG WR OHW KLP LQ XQOHVVKHDJUHHGWR´WUHDWµWKHPWKH QH[W)ULGD\0U7KRPSVRQFOLPEHG RQ WKH URRI DQG SXW D ERDUG RYHU WKH FKLPQH\ FDXVLQJ WKH VFKRRO WR ÀOOZLWKVPRNH7KHER\VVWD\HGLQ WKH VFKRRO URRP VR 0U 7KRPSVRQ ZHQWKRPHDQGFDPHEDFNWKHQH[W GD\ WR ÀQG DOO ZHOO H[FHSW WKH ´ELJ ER\VµKDGUHGH\HVIURPWKHVPRNH $PRQJ WKH ELJ ER\V ZDV :LOOLDP +RULQH ZKR ODWHU VHUYHG DV D FRORU EHDUHUGXULQJWKH&LYLO:DUDQGKDG KLVIRRWVKRWRIIDWWKHEDWWOHRI*HWW\VEXUJ ,Q *HQHYD 7RZQVKLS KDG VFKRROV DQG FKLOGUHQ RI VFKRRO DJH$ERXWWKLVWLPHWKHVFKRROVHFWLRQ VHFWLRQ FDPH XS IRU VDOH WKLVLQFOXGHG)RXU0LOH*URYH7KH VHWWOHUV VWDNHG RII WKH *URYH LQWR DQG DFUH SORWV DQG GLG QRW ELG DJDLQVW HDFK RWKHU VR HDFK SLRQHHU ZRXOGKDYHDZRRGORWDWWKHUHDVRQDEOHSULFHRIDERXWSHUDFUH 7KH ÀUVW UHOLJLRXV VHUYLFHV ZHUH KHOGDWWKHKRPHRI0DUWLQ%RRWVLQ 7KH 8QLWHG %UHWKUHQ &KXUFK IRUPHG LQ DQG VHUYLFHV ZHUH KHOGLQWKHORJVFKRROKRXVHRQVHFWLRQ 7KH ÀUVW FHPHWHU\ ZDV ORFDWHG D PLOH HDVW RI )RXU 0LOH +LOO 7KLV VHUYHG *HQHYD XQWLO ZKHQ DOO LQWHUPHQWV ZHUH PRYHG WR JURXQGV QHDU WKH *URYH $QRWKHU FHPHWHU\ ZDV ORFDWHG DW +LJKODQG *URYH ZKLFK LQ ZDV UHPRYHG WR WKH *HQHYD&HPHWHU\ 7KH WRZQVKLS ZDV RUJDQL]HG LQ WKHVSULQJRIDQGWKHÀUVWHOHFWLRQZDVKHOGLQLQWKHORJFDELQVFKRROKRXVHRQVHFWLRQ ,Q WKH EHJLQQLQJ LW ZDV YHU\ GLIÀFXOWWRREWDLQDQ\QHHGHGVXSSOLHV RUJRRGVLQWKH´ZHVWµ,QWKH &HQWUDO ,RZD 5DLOZD\ FDPH WR *HQHYD XVKHULQJ LQ DFFHVV WR HDVWHUQ PDUNHWVPDNLQJVXSSOLHVPRUHUHDGLO\ DYDLODEOH ZLWK D VKRUWHU ZDLWLQJ SHULRG:LWKWKHUDLOURDGDJULFXOWXUDO SURGXFWV OLNH EXWWHU FRXOG EH VROG DQGVKLSSHGWRKHDYLO\SRSXODWHGDUHDVLQWKHHDVW ,Q*HQHYDZDVSODWWHGDQG+ &&ORFNHUHFWHGDWZRVWRU\EXLOGLQJDQGRSHQHGKLVJHQHUDOVWRUHZLWK VWRFN ZRUWK 0U &ORFN DOVR EXLOW WKH *HQHYD +RXVH KRWHO7KHÀUVWGUXJVWRUHZDVRSHQHG LQE\7LGG6LOHQFHDQGZDV LPPHGLDWHO\ERXJKWRXWE\'U7LGG ZKR ZDV DOVR WKHRQO\ SK\VLFLDQ LQ *HQHYD7KHUHIROORZHGDKDUGZDUH VWRUH ERRW DQG VKRH VKRS JURFHU\ VWRUHZDJRQVKRSEODFNVPLWKVKRS JUDLQHOHYDWRUDQGOXPEHU\DUG*HQHYDZDVEXVWOLQJLQDVKRUWWLPH 2YHUWKHSDVWIHZZHHNV,·YHKDG DIHZGLIIHUHQWLGHDVÁRDWLQJDURXQG DERXW FROXPQ WRSLFV + R Z H Y H U ÀQGLQJ WLPH WR ZULWH WKHP GRZQ DG H[SDQG XSRQ WKHP FDQ V R P H W L P H V EH GLIÀFXW WR FRPHE\ 6R,WKRXJKW ,·G WRXFK EDVH RQVHYHUDORIWKHPWKLVZHHN )LUVW DQG IRUHPRVW ,·G OLNH WR WKDQN 0D\RU 6KDZQ 'LHW] DQG FRXQFLOPHQ&UDLJ(FNKDUGWDQG-LP 'DYLHVIRUWKHLUVHUYLFHWR+DPSWRQ &LW\ JRYHUQPHQW LVVXHV DUHQ·W DOZD\VWKHPRVWIXQWKLQJWRGR 7KH\ FOHDUO\ DUHQ·W KLJK SD\LQJ JLJVHLWKHU 7KHJULHI\RXUHFHLYHFDQEHVXEVWDQWLDOEXWWKHLPSDFW\RXOHDYHEHKLQGFDQEHMXVWDVJUHDW ,Q UHDOLW\ WKH QHZ PHPEHUV ZLOO EHDEOHWRKDYHDQLPSDFWRQWKHYLVLRQRIWKLVFRPPXQLW\ZHOOLQWRWKH IXWXUHDVZHOO 1RW HYHU\WKLQJ KDV WR EH DERXW JOLW]DQGJODPRXUUDWKHUWKHLPSRUWDQFH LV PDLQWDLQLQJ ZKDW ZH KDYH DQGLPSURYLQJXSRQLW 0DMRU SURMHFWV OLH DKHDG VXFK DV WKH ZDVWHZDWHU WUHDWPHQW SURMHFW DV ZHOODVDPDMRUQHHGWRFRQWLQXHWR PDLQWDLQRXUFLW\VWUHHWV ——— 6DWXUGD\ HYHQLQJ·V HQWHUWDLQPHQW DW%DQG6KHOO3DUNWXUQHGRXWWREHD EXPPHURIVRUWV -DVRQ *UD\ ZKR ZDV VFKHGXOHG WR SHUIRUP ZDV IRUFHG WR FDQFHO GXHWRODU\QJLWLV%HQ$G\DQGDORFDO JURXS FRPSULVHG RQ PXVLFLDQV -$0VWHSSHGLQDSHUIRUPHGDGPLUDEO\ ——— ,·PDOVRJODGWRVHHWKDWWKH+DPSWRQ &LW\ &RXQFLO DQG WKH )UDQNOLQ &RXQW\ %RDUG RI 6XSHUYLVRUV KDYH DJUHHGWRVLWGRZQZLWKWKHLUDWWRUQLHVSUHVHQWWRVHHLIWKH\FDQKDPPHU RXWDQDJUHHPHQWRQWKHGLVSDWFKHUV , WKLQN LWV LPSHUDWLYH IRU DOO LQYROYHGWRFRPHWRDTXLFNUHVROXWLRQ UDWKHU WKDQ OHDYLQJ WKH GLVSDWFKHUV KDQJLQJRQWKHLUMREVHFXULW\ Ryan Harvey is the publisher of the Hampton Chronicle. He also serves as the president and CEO of Mid-America Publishing Corporation. Looking Back by Joyce Schomburg Fifty Years Ago August 15, 1963 Grand champion steer in the district baby beef competition at the North Iowa Fair was won by Mark Halfwassen, with his Angus. He is the son of Mr. and Mrs. Henry +DOIZDVVHQRI6KHI¿HOG+LVDQLPDO was reserve grand champion at the Franklin County fair. The grand champion was also an Angus, shown by Steve Showalter, also of 6KHI¿HOG +LV SDUHQWV DUH 0U DQG Mrs. Charles Showalter. His baby beef was grand champion at the Franklin County Fair. The Norman Roegner family of Geneva and Mr. and Mrs. Leland Roegner are vacationing in Salt Lake City, and area. John Patton returned home Saturday from a two weeks trip with Mr. and Mrs. Daryl Dillon and son of Hampton to the Black Hills and Yellowstone. They report a wonderful trip. Forty Years Ago August 9, 1973 Todd Schomburg of Hampton received the top market crossbred swine award in swine judging at the Franklin County Fair Monday morning. Mr. and Mrs. Bill Koenen and family of Hampton were Saturday evening visitors in the home of Mr. and Mrs. H.E. Cuvelier in Bristow and Sunday visitors in the Cuvelier home were Mr. and Mrs. Craig Cuvelier and daughter of Hampton, Mr. and Mrs. Harley Cuvelier of Dumont, Mr. and Mrs. Ivan Cuvelier of New Hartford and Mr. and Mrs. Burdine Hahn. Mr. and Mrs. Howard Smith recently returned from a visit to Washington D.C. and were accompanied by their daughter, Sue, who is employed there by the FBI. Thirty Years Ago August 11, 1983 Square Dancing was featured as one of the activities of the Monday night “In the Good Ole Summertime” Hampton Chamber of Commerce promotion. Members of the Dudes and Dolls square dancing group of Hampton put on an entertaining show for the large crowd that gathered north of the courthouse to watch them. Ko Tejimo of Tokyo, Japan stayed overnight last week at Beeds Lake State Park while on his bicycle ride from Boston to Los Angeles. A.J. and Mardy Schaefer of Latimer, who was camping at the park, invited him to camp with them for the night and provided him supper and breakfast. From left to right are Mardy, Matthew, A.J. and Brandon Schaefer and Tejimo. Jean Schermer and Roy Lubkeman of Hampton were among the 682 persons who received degrees at Iowa State University summer commencement on July 30. Schermer had a double major in economics and sociology and Lubkeman had a major in psychology. Twenty Years Ago August 12, 1993 Mr. and Mrs. Thayne Obrecht who will be celebrating their Golden Anniversary on August 14, 1993 will be the fourth generation on Thayne’s side and the third generation on Opal’s side to celebrate such an event. David and Judy Dannen of Chapin spent Tuesday and Wednesday of last week at Walnut and at Elkhorn to see the Danish windmill. Steve Graeser of Hampton won WKHJUDQGSUL]HDWWKH-XO\¿VKLQJ contest at Port Washington, Wis. He won a 15 hp Mercury boat motor after catching the largest Coho salmon, 8.2 pounds and 27 inches long. It was caught off a Seahawk Charter boat out of Lake Michigan. Ten Years Ago August 6, 2003 Jean Lukensmeyer stands in front of the Oosterdam, the newest ship in the Holland America Line, as it rests in Rotterdam Harbor in Holland. She returned July 31 from a trip she was invited on to celebrate the christening of the ocean liner. The storm last Thursday night lasted only 15 minutes, but that was all the time it needed to UHGXFHFRUQ¿HOGVEHDQ¿HOGVDQG gardens within roughly a one-mile radius around Dumont to shreds. “It hailed for 15 minutes, then the wind came up and it just howled,” reported Tim Harrison of the Harrison-Thornburgh Insurance Agency in Dumont. Katy Pralle, Adam Radcliffe and Michelle Swieter were part of the Wartburg College Jazz Choir that went on a memorable trip to Australia, Fiji and many other places. Five Years Ago August 6, 2008 Ask Franklin County Sheriff’s Deputy Leon Root why he’s spent the past 15 years helping young people get their lives started off right, and his answer is immediate: “The kids. Absolutely, positively the kids.” Root’s devotion to helping Franklin County students learn the perils of drugs, alcohol and tobacco as the sheriff’s department DARE (Drug Abuse and Resistance $ZDUHQHVV RI¿FHU KDV HDUQHG KLP the highest award that organization can bestow. He is the 2008 Iowa '$5($VVRFLDWLRQ¶V'$5(2I¿FHU of the Year. Bob and Gloria Zangel, Sharon Wilkson, Katrina and Taylor were here from Las Vegas Saturday to visit Pauline Arends in Alexander. Matt and Sherri Lampe of *DUULVRQ DUH ZHOFRPLQJ WKHLU ¿UVW child, Elisabeth Morgan. She was born on July 20, 2008 and weighed six pounds, one ounce and was 19 inches long. Grandparents are Gene and Marlene Lampe of Hampton and Jim and Deb Fleming of Garrison. Looking Back is compiled weekly by Joyce Schomburg. COMMENTARY/COMMERCE +DPSWRQ&KURQLFOH6HFWLRQ$ Pedley’s Ponderings Under the Golden Dome, Too by Nick Pedley by Linda Upmeyer Hittin’ the road back home Last weekend provided me the opportunity to make the trip back home to my old stomping grounds in northwest Iowa. It’s always great to get away for a few days and reset the senses. It seemed like quite a few folks skipped town recently for summer YDFDWLRQV VR , ÀJXUHG , KDG EHWWHU join them. My hometown is a threehour drive from here, so it wasn’t such a monumental expedition like some get-aways. I can’t think of a time in which I’ve gone home with no expectation of accomplishing something. When I was in school, I always brought some homework with me. Last week, I planned on writing a couple articles in my down time. Despite these productive intentions, I can’t think of a time in which I’ve actually accomplished what I set out to do while at home. I’m not griping, however. This weekend particularly stood out from past visits. The weather was beautiful and I was able to spend considerable time with my niece and nephew. Being away for four years really cut into my “uncle duties,” so to speak. There were many moments where I found myself thinking, “They’re growing up so fast…” Even so, I had lots of fun running around and playing with them. I’m still a young guy by most standards, but I still don’t have half the energy that these two whippersnappers possess. My four-year-old nephew was running circles around me all day and I’m not sure how he was still going at nine o’clock that evening. My mom asked him if he wanted a nap following lunch that afternoon, but he was resilient. That’s more than you can say about me. I was more than ready for naptime. I was able to take him out to a local pond and check out all the frogs that lined the shore. Many had just grown their land legs, so walking alongside the water was quite a spectacle. Dozens of those slippery devils were leaping into the water all around us. It was funny to watch my nephew trying to keep up with all of them. I was able to catch a couple so he could inspect the peculiar critters, but the frogs were always one step ahead of him. Maybe he’ll have his frog-catching skills honed by next year. I think they usually come fullFLUFOHDURXQGDJHÀYHDQ\ZD\ He was too shy to show me his new skill of riding a two-wheeled bike. However, we had fun playing baseball in the backyard. I don’t particularly remember whether or not I had any skill in the sport at his age. However, he seems pretty adept at throwing and hitting already. That is to say, throwing and hitting the ball at his uncle. I spent a majority of the time dodging and ducking line drives smacked directly up the middle. Such a talent is great, but it’s a rather nerve-wracking situation when you’re on the receiving end. I never knew plastic softballs could sting so much. I think I still have a few red marks on my legs and back. My two-year-old niece was also quite the character during my short visit. She has to keep up with her brother after all, and she certainly holds her own. She’s already an expert at instigating trouble and getting the blame thrown onto him. ,W·VKDUGWRVWD\PDGZKHQVKHÁDVKHV her big blue eyes in your direction. She’s learning to master the “big girl potty,” and she’s coming along MXVWÀQH6KHZDVERLVWHURXVO\SURXG to proclaim to the entire family that she was wearing, “Panties!” on Saturday evening, however, she’s not perfect. After using the toilet by herself and not telling anyone, I found her heading to the backyard without any pants on. They were turned inside out, and she needed her mom’s assistance and an apparent blast of fresh air. It was great to get back home, even if it was only for two days. I got to see friends, family and other folks I hadn’t visited in a while. Hopefully I’ll be able to make more trips now that I live closer than I did before, but sometimes it’s hard to get away from busy schedules and other things. They say distance makes the heart grow fonder, and I can certainly say that’s been true for me over the past few years. Fiscal discipline, restraint still in the plans By Linda Upmeyer It has been an exciting couple of weeks for high school softball and baseball, as state tournament time has arrived. I have been keeping a close eye on all of our teams and am so proud of our student athletes. Their passion and dedication to their respective sport during these hot summer months is truly admirable. There have been some nail biters, many victories, and some heartbreakers, but without a doubt a great deal of excitement and entertainment overall! Thank you to all of our student athletes and coaches for your hard work and enthusiasm! Since coming into the Majority in the House in January 2011, we have PDGHLWDWRSSULRULW\WRVKRZ¿VFDO discipline and restraint in order to promote a stronger Iowa- one that is prepared for unexpected emergenFLHVRQHWKDWLVLQDVWURQJ¿QDQFLDO position to pay our bills, and one that can return taxpayer dollars back to hardworking Iowans. In late July, the Tax Foundation, a D.C.-based, independent, nonpartisan organization providing research and analysis on federal and state tax policy, released a survey &DURO $UHQGV WRRN RYHU GXWLHV DV VXUJLFDO QXUVH PDQDJHU RQ -XO\ DW )UDQNOLQ *HQHUDO +RVSLWDO UHSODFLQJ RXWJRLQJ PDQDJHU.DUHQ0LOOHUZKRUHFHQWO\UHWLUHG$JUDGXDWHRI,RZD6WDWH 8QLYHUVLW\ $UHQGV KDV H[WHQVLYH RSHUDWLQJ URRP H[SHULHQFH GXULQJKHUFDUHHUDQGZLOOQRZPDQDJHWKHRSHUDWLQJURRPSRVW DQHVWKHVLD WKH UHFRYHU\ URRP VDPH GD\ VXUJHU\ DQG RXWSDWLHQWWUHDWPHQWVVXFKDVLQIXVLRQVDQGLQMHFWLRQV$UHQGVFRPHV to FGH from Mary Greeley Hospital in Ames and has also worked IRU\HDUVDVDVXUJLFDOQXUVHDW(OOVZRUWK0XQLFLSDO+RVSLWDO LQ,RZD)DOOV Call Barb to place your business on our directory today! 641-456-2585 Elaine Coonley, CPA Patricia Heilskov, CPA Coonley Office Building 121 1st Ave. NW Hampton, IA 50441 641-456-2441 JEFFREY A. JAACKS MEDICAL CENTER PHARMACY Licensed Public Accountant Phone 456-4146 Hampton Office West Side of City Park RICK'S PHARMACY 3 -1st Street SW Hampton, Iowa 50441 641-456-4125 STEVEN E. PEARSON Certified Public Accountant State Farm Insurance Building P.O. Box 61 Hampton, Iowa 50441 Bus. 641-456-4829 Richard Grote, R.Ph. Phone 456-3538 • Hampton After Hours Emergency Phone 456-3268 FUNERAL HOMES RETZ FUNERAL HOME Sheffield 892-4241 Meservey 358-6105 Thornton 998-2311 Call Collect DEADLINES: /HJDO1RWLFHV:HGQHVGD\VSP 6XEPLWWHGQHZV7KXUVGD\VSP 1HZVSDSHU$GV,QVHUWV)ULGD\VQRRQ &ODVVL¿HG$GV0RQGD\VDP 2ELWXDULHV0RQGD\VQRRQ &RYHUDJHUHTXHVWVKRXUQRWLFH TELEPHONE CALLS: 2XUWHOHSKRQHLVDQVZHUHGE\RXUDX WRPDWHGV\VWHP([WHQVLRQVIRUYDULRXVVHU YLFHVDQGFRQWDFWVDUHOLVWHGEHORZ /RFDO7HOHSKRQH 7ROO)UHH7HOHSKRQH )D[&RPPXQLFDWLRQ ADMINISTRATION: 3XEOLVKHU5\DQ/+DUYH\'LDOH[WHQVLRQ RUHPDLOU\DQKDUYH\PDS#JPDLOFRP CIRCULATION & SUBSCRIPTIONS: 'LDO H[WHQVLRQ RU HPDLO PDSFLUFXOD WLRQ#LRZDFRQQHFWFRP PAPER OR INTERNET ADVERTISING: %DUE6PLWK'LDOH[WHQVLRQRUHPDLO EDUEVPLWK#JPDLOFRP )UDQNLH$OLX'LDOH[WHQVLRQRUHPDLO KDPSWRQDGV#JPDLOFRP &/7HO3UHVLGHQW-DQ/RYHOODQG&/7HOHPSOR\HHVJDWKHURXWVLGHWKH&OHDU/DNHRI¿FHORDGHG ZLWKORFDOSURGXFWVWRGHPRQVWUDWHWKHLUVXSSRUWIRUORFDOIRRGLQ1RUWK,RZD3KRWR6XEPLWWHG DIRECTORY Pharmacists Bruce Whipple • Todd Wragge Wendal Speake • Katie Regan Erica Miller Professional Prescription Service 24 Hours a Day Every Day 641-456-2510 OFFICE LOCATION & INFORMATION: 3K\VLFDO SURGXFW GHOLYHULHV WR QG 6W 1:+DPSWRQ,$ 0DLO32%R[+DPSWRQ,$ 2I¿FHKRXUV0RQGD\WKUX)ULGD\ -REDSSOLFDWLRQV$YDLODEOHGXULQJUHJXODU EXVLQHVV KRXUV <RX PD\ DOVR DSSO\ RQOLQH E\ XVLQJ WKH IRUP DYDLODEOH DW WKH +DPSWRQ &KURQLFOHZHEVLWHKDPSWRQFKURQLFOHFRP PRINTING PLANT & MAILING: 3UHSUHVV'DQ5RGHPH\HU'LDOH[WHQVLRQ RUHPDLOKSF#LRZDFRQQHFWFRP BUSINESS & PROFESSIONAL KOERNER-WHIPPLE PHARMACY A Division of Mid-America Publishing Corporation CLASSIFIED ADVERTISING: 'LDORUHPDLOPDSFRS\#JPDLOFRP Nick Pedley is the regional news editor for the Hampton Chronicle, 7KH 6KHIÀHOG 3UHVV DQG 3LRQHHU Enterprise. PHARMACIES HAMPTON PUBLISHING COMPANY and the HAMPTON CHRONICLE BILLING & ACCOUNTING: 'LDORUSDPGHYULHV#LRZDFRQQHFWFRP CALL US! 641-456-2585 CPA'S ¿[WKHSUREOHPGRZQWKHURDGDQG returning unused tax dollars to Iowa taxpayers, we have truly turned this state around. When we came into the Majority, the state had a $900 million budget gap, we were relying heavily on onetime funding to pay for ongoing expenses, and the state’s reserve funds ZHUHQRW¿OOHGWRWKHLUUHTXLUHGOHYels. The state is now spending less than it collects for the third consecutive year, our budget reserves remain full, and through the Taxpayers Trust Fund, we are returning your taxpayer dollars back to you, the rightful owners. In order to keep our state in a reVSRQVLEOH ¿VFDO SRVLWLRQ DQG WR HQsure you have more money left in your pocket, you can be certain we will continue to stick by our core budgeting principles as we move forward. I appreciate hearing from you! Please don’t hesitate to provide me with your feedback and as always, feel free to contact me anytime with the issues you care about at: linda. [email protected] or 515 5 PRINTING, RETAIL & PHOTO SERVICES: /LVD )ODFN 'LDO H[WHQVLRQ RU HPDLO OLVDÀDFNPDS#JPDLOFRP :HRIIHUFRPSOHWHSULQWLQJIRUEURFKXUHV QHZVOHWWHUVEXVLQHVVFDUGVSRVWHUVSKRWRV FORWKLQJ VSHFLDOWLHV DQG PRUH 0DNH SKRWR UHSULQWV IURP RULJLQDOV RU GLJLWDO ¿OHV RQ RXU 6RQ\ 3LFWXUH 6WDWLRQ *HW IXOOFRORU FRSLHV 'HVLJQVHUYLFHVDYDLODEOH Ackley, Bradford, Dows, Bristow, Chapin, Popejoy, Rowan and Sheffield COONLEY & HEILSKOV, showing how much money each state has in their rainy day funds to deal with economic emergencies. The results of this study show Iowa as one of the nation’s leaders in terms RI¿VFDOSUHSDUHGQHVVUDQNLQJLQ the country. We are pleased to see that our core budgeting principles have put us in a responsible position to handle unexpected emergencies. Just as Iowa families must prepare for unforeseen events in their own budgets, so must the state, so that we are not scrambling to come up with additional revenue when the unanticipated occurs. Having a strong rainy day fund LV MXVW RQH LQGLFDWRU RI RXU ¿VFDO stability. Because we have stood by our core budget principles of not spending more than we take in, not using one-time money for ongoing expenses, not intentionally underfunding our commitments simply to Business Briefs CORRESPONDENTS NEEDED IN: ACCOUNTANTS :HGQHVGD\$XJXVW OPTOMETRISTS DR. CRAIG L. SEMLER Optometrist 402 12th Ave. NE Hampton Phone 456-4251 DR. M.W. SNELL Optometrist 1701 Washington Ave. Iowa Falls 641-648-2357 or 1-800-748-7408 CHIROPRACTORS HICKMAN CHIROPRACTIC Dr. Jay Hickman 820 Hwy 65 N. Hampton Phone 641-456-2280 KOENEN & COLLINS CHIROPRACTIC CLINIC Dr. James Koenen Dr. Chad Collins 303 Central Ave E. Hampton Phone 641-456-4142 ATTORNEYS REALTORS COONLEY & COONLEY ABBOTT REALTY Lawyers John E. Coonley 121 1st Ave. NW Hampton Phone 456-4741 Sheffield Office • By Appointment Dows Office • By Appointment Home is Where Our Heart Is! Ph. 641-456-4707 Downtown Hampton Kathy Stanbrough - 641-430-3821 Chuck Svendsen - 641-425-7159 HOBSON, CADY & CADY G.A. Cady III Megan Rosenberg Office West Side of City Park Hampton Phone 456-2555 RANDY D. JOHANSEN Lawyer 1562 200th St. Sheffield Phone 456-2970 MILLER AND MILLER, P.C. CASTLE, DICK & KELCH INSURANCE & REAL ESTATE 2 2nd St. NW, Hampton P.O. Box 299 Ph. 456-2578 Fax 456-2546 Duane Kelch Linda Campbell Tom Birdsell Terry Pecha Tonya Markwardt JASPERSEN INSURANCE & REAL ESTATE LTD 123 1st St. NW PO Box 296 Hampton 641-456-2266 www.jaspersenltd.com Attorneys at Law KRUKOW REAL ESTATE Highway 3 West Brian D. Miller 515 Central Ave. West, Hampton Andrea M. Miller 7 First Ave. NE Ph. 641-456-3883 Fax 641-456-5553 Yvonne Krukow - 641-425-0923 Hampton, IA Erran Miller - 641-456-2447 Phone 641-456-2111 Jerry Plagge - 641-430-7951 Michelle Sackville - 641-430-6305 DANIEL F. WIECHMANN JR. Ashley Tufte - 319-213-7307 Attorney at Law Tonya Kregel - 641-425-4993 114 3rd St. NE Don Plagge - 641-892-4893 Hampton STALEY REAL ESTATE Phone 456-4545 21 4th St. NE., Hampton TONY D. KRUKOW Ph. 456-3607 Fax 456-5910 Jerry Staley - 456-3607 Attorney at Law Brad Staley - 425-9400 P.O. Box 343 Susan Staley - 425-9431 515 Central Ave. W. Kent Brown - 456-4664 Hampton Kurt Thielen - 430-3659 Phone 641-456-5999 Jay Brower 641-580-4070 [email protected] www.staleyonline.com NEWSROOM: 1HZV(GLWRU-HII)RUZDUG'LDOH[WHQVLRQ RU HPDLO FKURQLFOHQHZV#LRZDFRQQHFW FRP 8VH WKLV FRQWDFW WR RIIHU VWRU\ WLSV RU VHQGOHWWHUVWRWKHHGLWRURUSUHVVUHOHDVHV 5HJLRQDO 1HZV (GLWRU 1LFN 3HGOH\ 'LDO H[WHQVLRQ RU HPDLO QLFNSHGOH\PDS# JPDLOFRP8VHWKLVFRQWDFWWRRIIHUVWRU\WLSV 5HJLRQDO6SRUWV(GLWRU.ULVWL1L[RQ'LDO H[WHQVLRQ RU HPDLO FKURQLFOHVSRUWV# LRZDFRQQHFWFRP 8VH WKLV FRQWDFW WR RIIHU VWRU\WLSV 1HLJKERUVQHLJKERUV#LRZDFRQQHFWFRP 8VHWKLVFRQWDFWIRUHQJDJHPHQWVDQQLYHUVD ULHV ZHGGLQJV QHZ DUULYDOV DFKLHYHUV DQG RWKHUVXFKLWHPV 2ELWXDULHV 6HQG LQTXLULHV SKRWRV RELW XDU\ FRS\ DQG ELOOLQJ LQIRUPDWLRQ WR RELWV PDS#JPDLOFRP'HDGOLQHLVQRRQ0RQGD\V SERVICES: (QJDJHPHQWV DQQLYHUVDULHV ELUWKGD\V ZHGGLQJVELUWKVDQGIDPLO\UHXQLRQVLQIRUPD WLRQLVSXEOLVKHGIUHHRIFKDUJH7KHUHLVD FKDUJH IRU HDFK EODFN DQG ZKLWH SKRWR DQG DFKDUJHIRUHDFKFRORUSKRWR%LUWKGD\ DQG %LUWK SKRWRV DUH SXEOLVKHG FROXPQ LQ ZLGWK$QQLYHUVDU\ DQG (QJDJHPHQW SKRWRV DUHSXEOLVKHGFROXPQVLQZLGWK2WKHUVXFK SKRWRVDUHSXEOLVKHGLQDZLGWKDSSURSULDWHWR WKHQXPEHURISHRSOHLQWKHSKRWR3D\PHQW LVH[SHFWHGDWWLPHRIVXEPLVVLRQHLWKHUYLD FUHGLWFDUGGHELWFDUGFKHFNRUFDVK 2ELWXDULHV :ULWWHQ DQQRXQFHPHQW RI EDVLF LQIRUPDWLRQ LQFOXGLQJ VHUYLFHV LV IUHH )DPLO\RELWXDU\LVDQGFDQEHZULWWHQE\ WKH IDPLO\ ([FHVVLYH YHUEDJH PD\ UHVXOW LQ H[WUD FRVWV 3KRWRV DUH SXEOLVKHG IUHH ZLWK SDLGRELWXDULHVLQDLQFKZLGHIRUPDWEODFN DQGZKLWH%LOOLQJLVWKURXJKIXQHUDOKRPHVRU SD\PHQW LV H[SHFWHG DW WLPH RI VXEPLVVLRQ HLWKHU YLD FUHGLW FDUG GHELW FDUG FKHFN RU FDVK HAMPTON STAFF MEMBERS: 5HJXODUHPSOR\HHVLQRUGHURIFRQWLQXRXV \HDUVRIVHUYLFH Joyce Schomburg, 5HFHS WLRQ 3URRIUHDGLQJ %RRNNHHSLQJ ³/RRNLQJ %DFN´ Deb Chaney, &LUFXODWLRQ 0DQDJHU Dan Rodemeyer, 2IIVHW 6XSHUYLVRU 3UH 3UHVVElaine Meyer, ,QVHUWHU0DLO3UHSDUD WLRQ&RRUGLQDWLRQ%LQGHU\Glenn Kew, ,Q VHUWHU0DLO3UHSDUDWLRQ'ULYHUBarb Smith, $GYHUWLVLQJ 6DOHV Ryan Harvey, 3UHVLGHQW &(23XEOLVKHUPam DeVries, 2I¿FH0DQDJ HU%RRNNHHSHU&KLHI)LQDQFLDO2I¿FHULynn Byrne, &LUFXODWLRQ$VVLVWDQWTom Johnson, 0DLO +DQGOHU Debbie Hansen, ,QVHUWHU %LQGHU\ Lisa Flack, &RPPHUFLDO 3ULQWLQJ &RRUGLQDWRU&RPSRVLWLRQ5HFHSWLRQDebbie Collins, ,QVHUWHU 'ULYHU Donald Vaughn, 3UHVV 2SHUDWRU Amy Wilkinson, ,QVHUWHU 0DLQWHQDQFHKathleen Fisher, %RRNNHHSLQJ 3URRIUHDGLQJ Jessica Birdsell, $GYHUWLVLQJ &RPSRVLWLRQ 3ULQWLQJ &RPSRVLWLRQ 5HFHS WLRQAnnette Harris, %RRNNHHSLQJLynnette Richardson, %RRNNHHSLQJ 3URRIUHDGLQJ Zach Wanken, 3UHVVPDQ Pia Carmona, $GYHUWLVLQJ &RPSRVLWLRQ 0DQDJHU 3ULQWLQJ &RPSRVLWLRQ 5HFHSWLRQ Terry Fielding, ,Q VHUWHU 'ULYHU Kristi Nixon, 5HJLRQDO 6SRUWV (GLWRU Gerald “Red” Haugland, ,QVHUWHU 'ULYHU Brittany Watt, $GYHUWLVLQJ &RP SRVLWLRQ 3ULQWLQJ &RPSRVLWLRQ 5HFHSWLRQ Frankie Aliu 0DUNHWLQJ 5HSUHVHQWDWLYH Jeff Forward,&RPPXQLW\1HZV(GLWRUCynthia Jones, ,QVHUWHU Miguel A. Gomez, Jr., 3UHVVPDQJerrad Robinson, ,QVHUWHU'ULYHU Nick Pedley, 5HJLRQDO1HZV(GLWRU +RPHWRZQ1HZV&RUUHVSRQGHQWVLoren Bier, $OH[DQGHU 1HZV Marie Teggatz, /DWLPHU 1HZV April Fiet, 'XPRQW 1HZV Openings exist for: $FNOH\ %UDGIRUG %ULV WRZ&KDSLQ'RZV&RXOWHU3RSHMR\5RZDQ 6KHI¿HOG&DOOIRUPRUHLQIRUPDWLRQ 6 RECORDS :HGQHVGD\$XJXVW +DPSWRQ&KURQLFOH6HFWLRQ$ From the Log Hampton Police Monday, July 29 7:56 a.m.: Assist with ambulance call; 600 block of First Avenue Southeast. 11:40 a.m.: Request for extra patrol for criminal trespassing report; 100 block of Third Avenue Northeast. 1:46 p.m.: Harassment reported. SP 2IÀFHU UHFHLYHG WHOHphone call seeking information. 2:09 p.m.: Fingerprinting for employment check. 2:26 p.m.: Call for rescue and ambulance; 300 block of 16th Avenue Northeast. 2:56 p.m.: Request for ambulance; 800 block of Fourth Street Northwest. 3:55 p.m.: Fingerprinting for real estate license. SP 2IÀFHUV IRXQG VWUD\ ZKLWH and gray feline/cat. 4:28 p.m.: Report received of unknown civil matter. 5:04 p.m.: 911 hang-up call received; 100 block of First Street Northeast. 5:51 p.m.: Controlled house burn; 400 block of First Street Southwest. 6:07 p.m.: Report of a disorderly female; 500 block of First Street Northwest. 6:37 p.m.: Fingerprinting for employment check. 6:46 p.m.: Noise complaint; 700 block of First Street Northeast. 6:48 p.m.: Theft/larceny report of less than $200; 500 block of West Central Avenue 8:03 p.m.: Harassment report; 10 block of Second Street Northwest. 8:03 p.m.: Harassment report; 200 block of 12th Avenue Northeast. SP2IÀFHUVDVVLVWHGVKHULII·V deputies with booking of suspect Kentreil Deangelis Gainey, 22, of Forest City, on a warrant for arrest for suspicion of third degree sexual abuse. 8:41 p.m.: 911 hang-up telephone call received. SP2IÀFHUVDUUHVWHGVXVSHFW Jermey Bidwell, 39, of Hampton, on a Black Hawk County warrant for susSLFLRQRIGULYLQJXQGHUWKHLQÁXHQFH 9:56 p.m.: Received an animal complaint about a parrot. 10 p.m.: Harassment report received. 10:29 p.m.: Rescue; 400 block of Third Street Northwest. 10:32 p.m.: Report of vehicle reckless driving; First Street Northwest. Tuesday, July 30 DP&KDUJHVÀOHG 6:36 a.m.: 911 hang-up telephone call received. 10:21 a.m.: Report of a vehicle sideswiped on Interstate 35 at mile-marker 169. 10:37 a.m.: Vehicle parked over time; 400 block of 12th Avenue Northeast. 11:15 a.m.: Request for assistance needed; 10 block of Second Street Northwest. DP5HTXHVWVIRUÀQJHUSULQWing services. 12:23 p.m.: Nuisance/junk complaint; 500 block of Third Street Southwest. 1:30 p.m.: Request for child support issues. 1:58 p.m.: Telephone call received. 4:51 p.m.: Lift assist requested; 700 block of First Street Northeast. 5:05 p.m.: Departmental assist. 7:13 p.m.: Dead end sign found in road; 400 block of Second Street Northwest. 8:55 p.m.: Departmental assist; 1400 block of Olive Avenue. 9:23 p.m.: Report of a feline/cat acting strangely. 9:50 p.m.: Report of raccoons in a garage. 11:20 p.m.: Harassment report received. Wednesday, July 31 DP &KDUJHV ÀOHG DJDLQVW two suspects. Ryan Michael Ferris, 24, of Braham, Minn., arrested on suspicion of OWI; and Justin Ronald Servaty, 28, of Braham, Minn., arrested on suspicion of disorderly conduct and taken to Hardin County Jail. 2:45 a.m.: Report of loud music disturbance; 700 block of First Avenue Northwest. 8:44 a.m.: Strong smell reported; 400 block of Fourth Street Southeast. 11:26 a.m.: Hampton police arrested Brad Fielding, 30, of Hampton, on suspicion of burglary in the third degree and criminal mischief in the fourth degree. Fielding was placed in a holding cell to appear in court. 11:41 a.m.: Request for an ambulance; 400 block of North Second 6WUHHW6KHIÀHOG 11:42 a.m.: Report of items in the road; 300 block of First Avenue Southwest. 12 p.m.: Sex offense reported; 100 block of First Street Northwest. 12:52 p.m.: Parking issue; 400 block of First Avenue Southeast. 2:24 p.m.: Barking dog reported; 900 block of Third Street Northeast. 2:39 p.m.: Civil issue reported. 4:50 p.m.: Departmental assistance; 1600 block of North Highway 65. 5:20 p.m.: Juveniles reported. 5:51 p.m.: Juveniles reported in street; 600 block of Third Street Northeast. 9:50 p.m.: Juveniles reported; 10 block of Second Street Northwest. Thursday, Aug. 1 DP&KDUJHVÀOHG 12:29 a.m.: Dispatch call; northbound Interstate 35 near Clear Lake. 12:55 a.m.: Dispatch call; northbound Interstate 35 at mile-marker 157. 7:15 a.m.: Phone calls; Alden Exit on Highway 20. 10 a.m.: Miscellaneous civil issues; 300 block of Third Avenue Northwest. 10:40 a.m.: Found checkbook reported; 10 block of Fourth Street Southeast. 10:57 a.m.: Theft/larceny less than $200 reported; 1700 block of North Federal Street. 11:55 a.m.: Semi-truck parked illegally on residential street; 10 block of Sixth Street Southwest. 2 p.m.: Juveniles reported; Second Avenue Southeast. 2:30 p.m.: Fingerprinting done for board of education, 10 block of Second Street Northwest. 6:23 p.m.: Security patrol requested; 600 block of 12th Avenue Northeast. 11 p.m.: Request for an ambulance; 400 block of Third Street Northwest. 11:18 p.m.: Request for an ambulance; 1300 block of North Federal Street. Friday, Aug. 2 DP&KDUJHVÀOHG 8:10 a.m.: Departmental assistance; Intersection of First Avenue Southwest and Seventh Street Southwest. 8:44 a.m.: Funeral assistance; 1700 block of Central Avenue. 11:55 a.m.: Fire alarm; 100 block of 12th Avenue Northwest. 12:22 p.m.: Dispatch call; 12000 block of Hardin Road. 1:52 p.m.: Suspicious incident. 2:25 p.m.: Miscellaneous civil issue; 400 block of West Central Avenue. 2:37 p.m.: Harassment/threats reported. 3 p.m.: Open-ended 911 call received; 200 block of 85th Street, Latimer. 3:12 p.m.: Fingerprinting for coachLQJFHUWLÀFDWHEORFN6HFRQG$YHnue Northwest. 4:28 p.m.: Vehicle report; Northbound Interstate 35 at mile-marker 174. 6:22 p.m.: Assault reported; 1100 block of Fourth Street Northwest. 6:54 p.m.: Open-line 911 call received; 100 block of Second Street Northwest. 7:32 p.m.: Open-line 911 call received; 100 block of North Federal Street. 7:38 p.m.: Assisted other agency on Always Fresh, Always Affordable, Always Fareway USDA CHOICE BONELESS RUMP ROAST $2 USDA CHOICE NEW YORK STRIP STEAK $799 99 Lb. ALL NATURAL BONELESS PORK LOIN $1 99 Lb. Prices Good Wednesday, August 7, thru Tuesday, August 13, 2013 10LB. TUBES 93% LEAN 7% FAT GROUND BEEF Lb. CUT & WRAPPED FOR FREE USDA CHOICE SIRLOIN TIP STEAK $349 Lb. © 2006 FAREWAY STORES, INC. 456-2756, Meat 456-5253, Store HAMPTON, IOWA $299 Lb. CHICKEN HIND QUARTERS 79¢ Lb. Store Hours: 8 a.m. to 9 p.m. Monday thru Saturday Closed Sundays and Holidays miscellaneous civil issue. 9:16 p.m.: Vehicle complaint; Highway 65, Hampton. bulance and called Franklin General Hospital for medical; 1500 block WK6WUHHW6KHIÀHOG Saturday, Aug. 3 DP&KDUJHVÀOHG 10:11 a.m.: Miscellaneous civil issue reported; 10 block of Second Street Northwest. 10:12 a.m.: Rescue; 100 block of Ninth Place Northeast. 11:15 a.m.: Dispatch. 12:02 p.m.: 911 Hang-up; 300 block of 11th Avenue Northeast. 12:03 p.m.: Dispatch; Northbound Interstate 35 at mile-marker 172. SP 7UDIÀF VHUYLFHV block Second Street Northwest. SP7UDIÀFYHKLFOHVUHSRUWHG 300 block of Fifth Street Southwest. 14:07 p.m.: Juvenile behavior; 100 block of Fourth Street Northeast. 3:32 p.m.: Vehicle report, UPS truck; 400 block of Seventh Street Southwest. 4:32 p.m.: Driving complaint; 900 block of Glendale Park Drive. 4:58 p.m.: Loose dog complaints; 600 block of Eighth Avenue Southwest. 5:31 p.m.: Harassment/threat complaint; 600 block of First Avenue Southeast. 5:38 p.m.: Request for help getting up; 1300 block of North Federal Street. 6:34 p.m.: Open 911 call received; 100 block of First Street Northeast. 6:34 p.m.: Vandalism reported; 500 block of Second Avenue Southeast. 7:10 p.m.: Suspicious activity; Intersection of Third Avenue Northwest and Second Street Northwest. 7:21 p.m.: Miscellaneous civil issue; Franklin County Fairgrounds. 7:57 p.m.: Lost dog reported; 300 block of East Central Avenue. 10:08 p.m.: Public intoxication reported; 500 block of West Central Avenue. SP 8QDWWHQGHG ERQÀUH UHported; Second Street Southeast. Monday, July 29 6:51 a.m.: Prisoner transport; Hardin County. 8:32 a.m. Transport per court order; Mercy 5 East. SP 7UDIÀF FRPSODLQWV RI trucks not stopping; Highway 3, east RI'XGOH\·V&RUQHU 4:42 p.m.: Report of vehicle driving slow; 1200 block of Mallard Avenue. 5:25 p.m.: Request for welfare check; 1500 block of Balsam Avenue, Alexander. 8:24 p.m.: Prisoner transport; HanFRFN&RXQW\6KHULII·V2IÀFHWR+DPSton Police Department. Sunday, Aug. 4 DP&KDUJHVÀOHG DP 9HKLFOHWUDIÀF UHSRUW Seventh Street Southwest. 2:54 a.m.: Loud music disturbance report. 3:37 a.m.: Phone calls. 9:22 a.m.: Suspicious activity; 600 block of West Central Avenue. 10:08 a.m.: Dispatch. 1:27 p.m.: Miscellaneous civil issues reported; 100 First Street Northeast. 1:38 p.m.: Phone calls. 1:45 p.m.: Erratic driver reported; Northbound Interstate 35, mile-marker 174. 2:09 p.m.: Rescue; 200 block of 12th Avenue Northeast. 2:49 p.m.: Miscellaneous civil issues; Intersection of Northwest Federal and First Avenue. 3:25 p.m.: Theft/larceny of less than $200; 500 block of West Central Avenue. 4:08 p.m.: Theft/larceny of less thsan $200; gas drive-off, 10 block of Fourth Street Southeast. 4:55 p.m.: Miscellaneous civil issue; 19th Avenue Northeast. 5:57 p.m.: Open end telephone call; Hardin County. 6:33 p.m.: Harassment/threat via Facebook reported/ 7:24 p.m.: Dispatch for disabled vehicle; Southbound Interstate 35 at mile-marker 176. 8:53 p.m.: Nuisance/junk ordinance complaint; 700 block of First Street Northeast. 10:43 p.m.: Phone calls. 11:07 p.m.: Assault under investigation; 10 block of First Street Northwest. 11:44 p.m.: Dispatch call; Highway 65 in Cerro Gordo County. Franklin County Sheriff Friday, July 26 12:57 a.m.: Static 911 call; 2000 block Balsam Avenue, Alexander. 10:57 a.m.: Stray Dogs; 600 block of 250th Street. 5:57 p.m.: Suspicious person on highway; Westbound Highway 3 at Hansell Corner. 8:49 p.m.: Loud music reported; Hampton Golf Course. 9:15 p.m.: Report of dog harassing citizen; Hansell. 10:19 p.m.: Report of cow in area; Indigo Avenue, Cerro Gordo County. Saturday, July 27 DP0DQUHSRUWHGQHLJKERU·V dogs running loose night before and he found his cat dead next morning; 100 block of Front Street, Geneva. 8:30 a.m.: Report of stray dogs; 2100 block of Timber Avenue, Hansell. 9:06 a.m.: Report of vehicle in ditch; Intersection of 170th Street and Quail Avenue. 10:23 a.m.: 911 Hang-up call received; 1600 block of Highway 65. 9:16 p.m.: Report of suspicious vehicle; 900 block of Apricot Avenue, Dows. 10:02 p.m.: Mary Ann Young, 48, of Latimer, was arrested on suspicion of domestic abuse/assault; Intersection of Van Kirk and Charles, Latimer. Sunday, July 28 10:37 a.m.: Stray dog reported; 1100 block of Rail Avenue. 10:59 p.m.: Prisoner transport; Hardin County. 1:10 p.m.: Prisoner transport; Hardin County. SP7UDIÀFQXLVDQFHUHSRUWHG 400 block of Grant Street, Coulter. 7:29 p.m.: Report of trespassing at private pond; 500 block 160th Street, Latimer. SP 3DJHG 6KHIÀHOG DP- Tuesday, July 30 DP 7UXFN RQ ÀUH UHSRUWHG Crazy Acres Campground. 5:34 a.m.: Prisoner Transport, Hardin County. 1:22 p.m.: Prisoner transport; Hardin County. 1:24 p.m. Report of child locked inside camper bathroom, unable to get out; Crazy Acres Campground. %XWOHU&RXQW\6KHULII·V2IÀFH Monday, July 29 9:26 a.m.: Controlled burn; 20200 block of 190th Street. 9:46 a.m.: Alarm; 500 block of Main Street. 9:50 a.m.: Alarm; 500 block of Main Street. 10:48 a.m.: Controlled burn; 27300 block of 180th Street. 12:32 p.m.: Controlled burn; 31900 block of 235th Street. SP7UDIÀFVWRS,QWHUVHFWLRQ of Third Street and North Main Street. 2:17 p.m.: General police call; Intersection of Highway 3 and Keystone Avenue. 3 p.m.: Report of suspicious person/ vehicle/activity; Intersection of 300th Street and Liberty Avenue. 4:03 p.m.: Report of harassment by telephone/email/in-person; 200 block of First Street. SP7UDIÀFVWRS 6:14 p.m.: Motorist assistance; Intersection of Highway 14 and Highway 57. 6:37 p.m.: Falls; 500 block of Traer Street. 7:14 p.m.: Controlled burn; 21000 block of Keystone Avenue. 8:29 p.m.: Controlled burn; 20500 block of 280th Street. SP 7UDIÀF VWRS ,QWHUVHFtion of 11th Street and Caldwell Street. Tuesday, July 30 4:55 a.m.: Motorist assistance; Intersection of Highway 14 and 170th Street. 6:25 a.m.: Controlled burn; 18100 block of 230th Street. DP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 3 and North Public Road. 7:38 a.m.: Controlled burn; 25900 block of Newton Road. 8:13 a.m.: Controlled burn; 17100 block of Jay Avenue. 8:27 a.m.: Controlled burn; 26500 block of 130th Street. 10:51 a.m.: Theft of cabinets, an overhead door reported at foreclosed home; 29200 block of Butler Center Road. 1:33 p.m.: Property damage reported when farm equipment hit poles and WRUHRXWÀEHURSWLFZLUHV,QWHUVHFWLRQ of Beaver Valley Street and Butler Avenue. 1:42 p.m.: Controlled burn; 25300 block of Jay Avenue. 4:08 p.m.: Controlled burn; Intersection of Holly Avenue and West Brook Street. 4:29 p.m.: Controlled burn: 23000 block of 180th Street. SP7UDIÀFVWRS,QWHUVHFWLRQ of North Johnson Street and Wemple Street. 4:36 p.m.: General police call; 400 block of Sixth Street. 4:42 p.m.: Controlled burn; 21500 block of Highway 57. 4:54 p.m.: Controlled burn; 24400 block of 110th Street. SP7UDIÀFVWRSEORFNRI North Public Road. SP7UDIÀFVWRSEORFN of Highway 14. 6:24 p.m.: Controlled burn; 200 block of South Audubon. 7:36 p.m.: Report of person having trouble breathing; 900 block of North Cherry Street. 8:03 p.m.: General police call; 600 block of Highway 57. 8:33 p.m.: Convulsions/seizures reported; 100 block of West Weare Street. 8:38 p.m.: Report of trouble breathing; 300 block of Third Street SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 57 and North Johnson Street. 9:45 p.m.: General log call; Intersection of Highway 188 and Highway 3. Wednesday, July 31 7:13 a.m.: Controlled burn; 20400 block of Ridge Avenue. 9:16 a.m.: Vandalism/criminal mischief reported – windows shot out; 200 block of West Superior Street, Clarksville. 11:21 a.m.: Controlled burn; 17100 block of Jay Avenue. 11:25 a.m.: General log call; 20400 block of Floyd Line Street. 11:26 a.m.: Sick person; 900 block of 7th Street. 12 p.m.: Motorist assistance; Intersection of Highway 3 and Terrace Avenue. 1:09 p.m.: Theft of prescription medicine reported; 700 block of Parriott Street, Applington. 3:36 p.m.: Animal bites/attack reported; 300 block of Third Street. 3:51 p.m.: Controlled burn; 20400 block of 200th Street. 4:20 p.m.: General medical call; 100 block of North Hilton Street. 4:57 p.m.: General police call; 400 block of First Street. 5:47 p.m.: General police call; Intersection of Highway 218 and Highway 3. 5:58 p.m.: General police call; 400 block of Sixth Street. 6:40 p.m.: Controlled burn; 16500 block of Quarry Avenue. 6:44 p.m.: Harassment/threat by text message; 200 block of First Street, Parkersburg. 7:47 p.m.: Falls; 31400 block of Diagonal Road. 8:51 p.m.: General police call; 300 block of Allen Street. 9 p.m.: General police call; 700 block of Railroad Street. 9:19 p.m.: General police call; 10000 block of Vail Avenue. 9:24 p.m.: General police call; 500 block of North First Street. Thursday, Aug. 1 7:29 a.m.: Suspicious person/vehicle; Intersection of South Cherry Street and West Main Street. 7:47 a.m.: Controlled burn; 17100 block Jay Avenue. 8:48 a.m.: Suspicious vehicle/person; 1/2 mile south of APL/T55. 8:57 a.m.: Dog/deer/livestock; 00 block of MI north of Bristow. 9:53 a.m.: Sick person; 100 block of Saratoga Street. 10:17 a.m.: General log call; 27000 block of Upland Avenue. 10:19 a.m.: Dog/deer/livestock; 1/4 mile north of Highway 3 on Evergreen. 10:50 a.m.: Theft; 400 block of North Main Street, Allison. 11:52 a.m.: Controlled burn; 26100 block of 180th Street. 1:47 p.m.: General police call; Bickford Street, Dumont. 2:07 p.m.: Alarm; 600 block of North Johnson Street, Parkersburg. 2:57 p.m.: Controlled burn; 21600 block of 160th Street. 3:28 p.m.: Sick person; 400 block of Sixth Street. 4:17 p.m.: General police call; 27600 block of Temple Avenue. 4:28 p.m.: General police call; 700 block of Pine Street. SP7UDIÀFVWRSEORFNRI South Main Street. 6:19 p.m.: Controlled burn; 32500 block of Holly Avenue. 6:23 p.m.: Dog/deer/livestock; Intersection of Holly Avenue and West Brook Street. SP7UDIÀF6WRS,QWHUVHFWLRQ of Highway 3 and Grand Avenue. SP7UDIÀFVWRS,QWHUVHFWLRQ of Birch Avenue and Highway 3. 7:24 p.m.: Controlled burn; 16500 block of Quarry Avenue. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 14 and Highway 3. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 3 and South Main Street. 7:48 p.m.: General police call; 500 block of North Cherry Street. 8:13 p.m.: Controlled burn; 23300 block of Franklin Avenue. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 188 and Highway 3. 9:35 p.m.: General police call; 1400 block of West Broadway Street. SP7UDIÀFVWRSEORFNRI South Main Street. 9:37 p.m.: General police call; 14500 block of Packard Avenue. SP 7UDIÀF VWRS ,QWHUVHFtion of 150th Street and Highway 14. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 3 and Franklin Avenue. 11:05 p.m.: Suspicious vehicle/person reported; 200 block of West South Street. SP7UDIÀFVWRS,QWHUVHFWLRQ of Hickory Avenue and Highway 3. 11:14 p.m.: Burglary report taken; 400 block of West Superior Street. SP 7UDIÀF VWRS ,QWHUVHFtion of South High Street and West Traer Street. Friday, Aug. 2 DP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 3 and Main Street. 2:56 a.m.: General police call; 400 block of West Main Street. 3:58 a.m.: General police call; 1400 block of West Broadway Street. Saturday, Aug. 3 8:35 a.m.: Controlled burn; 33700 block of Grand Avenue. 10:21 a.m.: Controlled burn; 31400 block Keystone Avenue. 10:22 a.m.: Controlled burn; 15800 block of Kilpatrick Street. 10:37 a.m.: Controlled burn; 17500 block of Newell Avenue. 11:58 a.m.: Sick person; 1100 block of Ellis Street. 2:19 p.m.: Dog/deer/livestock; 30000 block of Douglas Avenue. 2:34 p.m. Committal for mental/ substance abuse; 400 block of Sixth Street. 2:43 p.m.: General police call; 400 block of Wemple Street. 5:34 p.m.: Missing person report; Intersection of Fourth Street and Colfax Street. 5:50 p.m.: Stroke; 500 block of North Kelly Street. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 57 and Newell Avenue. 6:29 p.m.: Harassment by phone/ email/in-person reported; 700 block of North Public Road. 6:30 p.m.: Controlled burn; 26300 block of Highway 3. SP7UDIÀFVWRS,QWHUVHFWLRQRI Highway 3 and Vintage. 7:07 p.m.: Controlled burn; 17000 block of Royal Avenue. Log: See Page 7 RECORDS +DPSWRQ&KURQLFOH6HFWLRQ$ :HGQHVGD\$XJXVW 7 Obituaries Earl G. Weber Walter Swieter Funeral services for Walter Swieter, 75, of Brighton, Colo., were held at 10 a.m. on Thursday, August 1, 2013, at Brockhaus-Harlan Funeral Home LQ7LOGHQ1HEZLWK&KDG0LQQHRI¿FLDWLQJ%XULDOZDVLQWKH7LOGHQ&LW\ Cemetery. The Brockhaus-Harlan Funeral Home in Tilden was in charge Walter Swieter of arrangements . Walter died Wednesday, July 24, 2013, at his home in Brighton. Funeral services were also held at 10:30 a.m. Monday, July 29, 2013, at the Fourway Baptist Church in Fort Lupton, Colo., under the direction of Tabor-Rice Funeral Home in Brighton, Colo. Walter Swieter, loving husband and father, was born December 9, 1937, in Hampton, to Donald and Lena (Meyer) Swieter. He was promoted into the presence of his Lord who he loved and faithfully served on July 24, 2013. He gathered with fellow believers at Gospel Hall in Bradford, and Brighton, Colorado. Walter grew up farming and worked with his dad on the family farm before graduating 1937-2013 from Geneva High School in 1956. Services: He enjoyed working on the farm and 10 a.m., August 1 continued to do so after his father’s death until he moved to Colorado in Brockhaus-Harlan Funeral Home Tilden, Neb. 1960. He worked for John Deere at &KDG0LQQHRI¿FLDWLQJ the Denver Parts Depot for 42 years as Burial: a forklift operator and really enjoyed Tilden City Cemetery his work. He also moonlighted for Northwest Truck Lines. After retireArrangements by: ment, Walter was able to resume one Brockhaus-Harlan Funeral Home of his passions by going back to Iowa Tilden for several years to help with harvest brockhausfuneralhome.com in the fall operating John Deere trac402-368-5300 tors and equipment. Walter enjoyed snowmobiling, four-wheeling, attending sprint car and NASCAR races, as ZHOODVDWWHQGLQJDXFWLRQVWR¿QGPRUH-RKQ'HHUHWUDFWRUVWRUHVWRUHDQG John Deere toys to collect. Walter also loved spending time in the mountains with his family hiking, sightseeing, and relaxing at his favorite cabins. He thoroughly enjoyed watching his son, Dwayne, crew Formula 1600, 2000, and Shelby road race series cars. One of his great joys was going to his son David’s home in the country and working on tractors and building projects and spending time outside with his grandsons. He enjoyed socializing with everyone and made many friends. Walter is survived by his wife of 53 years, Caroline (Grubb) of Brighton, and sons Dwayne of Brighton, Colo., and David (Ellen) and his two grandsons, Wesley and Benjamin of Keenesburg, Colo.. He is also survived by one brother, Clarence (Bonnie) of Dumont, and many nieces, nephews and friends. He was preceded in death by both of his parents and brothers, LaVerne of Geneva, and Larry of Los Angeles, Calif. Bessie and Ralph Terpstra Bessie Terpstra, 89, of Ackley, died on Saturday, August 3, 2013, and Ralph Terpstra, 86, of Ackley, died on Sunday, August 4, 2013, at the Presbyterian Village in Ackley. Funeral services will be 10 a.m. on Wednesday, August 7, at the Christian Reformed Church in Austinville. Burial will be in the Oakwood Cemetery in Ackley. Visitation will be from 5-7 p.m. on Tuesday, August 6, at the Sietsema Funeral Home in Ackley. The Sietsema Funeral Home in Ackley is in charge of arrangements. Shirley Plagge Shirley Plagge, 90, of Latimer, presently residing in Hampton, died on Friday, August 2, 2013, at the Franklin Country View Nursing Facility in Hampton. A Celebration of Life will be held at 11 a.m., on Saturday, August 10, 2013, at the Immanuel United Church of Christ in Latimer, with Pastor LindVH\%UDXQRIÀFLDWLQJ Visitation will be held from 4:30 p.m. to 7:00 p.m., Friday, August 9, 2013, at the Immanuel United Church of Christ in Latimer. Graveside services will be held at 10 a.m., prior to the service on Saturday, August 10, 2013, at the Marion Center Cemetery in rural Latimer. The Sietsema-Vogel Funeral Home of Latimer is in charge of the arrangements. Earl Glen Weber, 88, of Dows, died on Saturday, August 3, 2013, at the Franklin General Hospital in Hampton. Earl Weber was born on June 11, 1925, in Hampton, to Carl and Alma (Olson) Weber. Earl graduated from Dows High School. He was united in Earl Weber marriage to Verla Behrens on December 2, 1945, in Garner. Earl farmed from his youth up to adulthood, was a soil commissioner of Franklin County and worked for Northwestern Mutual Life for 49 years and had acquired his Chartered Life Underwriter (CLU) designation. He was an active member of the Presbyterian Church in Dows and the Scottish Rite of Free 0DVRQU\ (DUO HQMR\HG JROÀQJ JDUGHQLQJ ÁRZHUV DQG ZRUNLQJ +H was a volunteer EMT for the Dows Ambulance, was a 4-H leader, was an active volunteer in the Dows community and was a Grand Marshal of Dows Corn Days in the 1990s. Earl is survived by his wife Verla Weber of Dows, son Corky (Becky) Weber of Edina, Minn., and their daughters 1925-2013 Amanda Weber and Alicia Weber of Celebration of Life: Edina, Minn., daughter Pat (Lyle) 1-3 p.m. August 11 Hanson of Eden Prairie, Minn., and Dows Community Center their children Christine Hanson and Burial: Zach Hanson of Eden Prairie, Minn., At a later date sister De Elda Frodin of Gray Hawk, Arrangements by: Kent., sister Bernice Peterson of Waterloo, sister LaVonne Rastetter of Sietsema-Vogel Funeral Home Hampton Iowa Falls and sister Marie (Marv) Meyer of Iowa Falls. He was preced- sietsemavogelfuneralhomes.com ed in death by his parents Carl and 641-456-3232 Alma Weber, brother Seth Weber and twin sister Elaine Schroeder. ,W ZDV (DUO·V ZLVKHV WR GRQDWH KLV body to the University of Iowa Deeded Body Program in Iowa City. ,Q OLHX RI ÁRZHUV PHPRULDOV PD\ EH JLYHQ WR WKH 'RZV 3UHVE\WHULDQ Church. A Celebration of Life will be held from 1-3 p.m., on Sunday, August 11, 2013, at the Dows Community Center in Dows. Burial will take place at a later date. The Sietsema-Vogel Funeral Home of Hampton is in charge of the arrangements. Franklin County Deeds %Warranty Deed: Randy D. Huling & Brandy J to Del Ray w. McKee & -DQHW.²:IHHWRI/RWV%ON*LOPDQ·Vnd$GGWR6KHIÀHOG 131619 %Quit Claim Deed: David A. Baugh to Audrey E. Baugh – Lot 5 Blk 1 1RUWK·V$GGWR/DWLPHU %Warranty Deed: James Rankin & Kathryn to Rankin Bros. Partnership – Tr 31-90-20, 131635 %Warranty Deed: Glenn Schnabel & Edna to Justin Schnabel & Carol K – SW ¼ NW ¼ 26-93-21, 131645 %Warranty Deed: Pauline Parks to Brent M. and Anna M. Clausen – Tr SW ¼ 21-93-19, 131666 %Warranty Deed: Frances J. Seehusen to Frances J. Seehusen, Trustee – NW ¼ & NE ¼ SW ¼ ex. Tr 20-91-21, 131657 Douglas Lee Card Douglas Lee Card, 60, of Hampton, died on Sunday, July 28, 2013, at his home in Hampton, with his family by his side. Funeral services were held at 10 a.m., on Friday, August 2, at Faith Baptist Church in Hampton, with 3DVWRU'DYLG.RHQLJVEHUJRI¿FLDWLQJ%XULDOZDVLQWKH'XPRQW&HPHWHU\ ,Q OLHX RI ÀRZHUV PHPRULDOV PD\ EH JLYHQ WR 'RXJODV¶ IDPLO\ IRU IXWXUH disbursement. The Sietsema-Vogel Funeral Home of Hampton was in charge of arrangements. BEST PRICES OF THE SEASON! As low as each tĂǀĞƌůLJ͕/ 730 Technology Place (Business Hwy 218 South) (319) 352-9497 ͻ>ŝĨĞƟŵĞ&ŝůŵ/ŶƚĞŐƌŝƚLJ^ƚĞĞůtĂƌƌĂŶƚLJ ͻ&ĞĂƚƵƌŝŶŐŽŽƌƐ 800-373-5550 ClearyBuilding.com Hardin County Tire Tires Alignment Brakes 641-648-4229 1-800-698-4229 Hwy. 65 South Shocks Oil Change Monday-Friday 7:30-5:30 Saturday 7:30-12 Noon Iowa Falls, IA 50126 CHIROPRACTIC CLINIC Timothy Gibbons M. D. Offering a full range of Orthopaedic services including Total Hip Replacement, Hip Resurfacing, Minimally Invasive Total Knee Replacement and Sports Medicine ͻ&ƵůůLJŶŐŝŶĞĞƌĞĚďLJ>ŝĐĞŶƐĞĚůĞĂƌLJŶŐŝŶĞĞƌƐ Contact us today for a FREEĐŽŶƐƵůƚĂƟŽŶ͊ Assorted Cookies, Brownies, GOODIES Salted Nut Rolls, Scotch-a-Roos. 641-456-2585 9 • 2nd Street NW • HAMPTON Our goal is to provide the top-quality and safe orthopaedic care to our patient. Talk to your Family physician today or call our office today. ͻWĞƌƐŽŶĂů^ĞƌǀŝĐĞƚŽWƌŽǀŝĚĞƚŚĞĞƐƚ^ŽůƵƟŽŶĨŽƌzŽƵ All Freewill donation! Crew Sweatshirts: Youth & Adult $ 23 Dr. James Koenen & Dr. Chad Collins 303 Central Ave. E, Hampton Hours: M, W, Th 9-5 • T, F 9-7 • Sat. 9-12 PUBLISHING August 8 & 9 8 a.m. to 6 p.m. August 10 8 a.m. to 5 p.m. Come in for a FREE GIFT with every building designed in DreamMaker! Library T-Shirts: Youth $15 • Adult $ 18 as well as Children’s books, Hoodie Sweatshirts: Youth & Adult $ 28 puzzles and more… Koenen & Collins Dr. Gibbons • August Dates August 8 and 23 a.m. only CLEARY – Don't Settle For Anything Less BOOK & BAKE SALE AUGUST 10 This book sale will offer 9 a.m. - 5 p.m. Chilton’s Repair Manuals, FOR SALE Adult Fiction & Non-Fiction, MID-AMERICA OPEN HOUSE SALE e Hampton Public Library SATURDAY Call 456-4142 Seeing patients @ Franklin General Hospital n Softwar Monday, Aug. 5 12:34 a.m.: Convulsions/seizures reported; 200 block of South Elizabeth Street. 6:36 a.m.: Burglary report; 400 block of North Main Street, Clarksville Koenen & Collins will once again be offering Sports Physicals for the 2013 school year. Make an appointment during August and $5 of the $30 fee will be given back to H-D Sports Booster Clubs! STOP IN & SAVE! 3D Desig Sunday, Aug. 4 12:56 a.m.: 1050 Property damage reported – vehicle hit trailer; 200 block of West Traer Street, Greene. DP7UDIÀFVWRS,QWHUVHFWLRQ of Third Street and Main Street. 11:11 a.m.: General police call; 300 block of North Traer Street. 12:16 p.m.: 1050 Property damage reported; Intersection of Fourth Street and Pine Street, Allison. 12:35 p.m.: Motorist assistance; Highway 3 at the ethanol plant. 12:57 p.m.: Controlled burn; 21600 block of 160th Street. 1:46 p.m.: General log call; 100 block of West Adair Street. 2:25 p.m.: Controlled burn; 20800 block of Terrace Avenue. 2:43 p.m.: Controlled burn; 24600 block of 130th Street. 3:18 p.m.: Domestic/family issue reported; 300 block of York Street. 3:23 p.m.: Controlled burn; 30100 block of Highway 14. 3:54 p.m.: Trouble breathing reported; 200 block of West Prospect Street. 6:28 p.m.: Controlled burn; 29500 block of Highway 14. SP7UDIÀFVWRSEORFNRI West Willman. 8:36 p.m.: General police call; 2400 block of 220th Street, Hampton. 9:28 p.m.: Suspicious person/vehicle/activity reported; 22500 block of Willow Avenue. SP7UDIÀF6WRSEORFNRI North Main Street. 9:45 p.m.: Dog/deer/livestock; Intersection of North Lori Street and East Mark Street. Print your own photos from any digital device in just seconds! Larry Kinney Larry Kinney, 71, of Iowa Falls, died on Monday evening, July 29, 2013, at the Mercy Medical Center, Mason City. Funeral services for Larry Kinney were held at 10:30 a.m. on Friday, August 2, at the Immanuel Lutheran Church, Iowa Falls. Memorials may be directed to the family c/o his wife: Marilyn Kinney, 1621 Ellis Avenue, Iowa Falls, Iowa 50126. The Linn’s Funeral Homes Iowa Falls was in charge of arrangements. 7:07 p.m.: Controlled burn; 18100 block of Superior Road. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 3 and Quail Avenue. 7:23 p.m.: General police call; Riverside Apartments. 7:32 p.m.: General police call; Intersection of 150th Street and Birch Avenue. SP7UDIÀFVWRS,QWHUVHFWLRQ of 11th Street and Parriott Street. 8:26 p.m.: Controlled burn; 32000 block of Forest Avenue. 8:41 p.m.: Broken bones reported; 23600 block of Highway 57. 9:25 p.m.: Controlled burn; 16400 block of 200th Street. 10:03 p.m.: Controlled burn; 16600 block of Jay Avenue. SP7UDIÀFVWRS,QWHUVHFWLRQ of Highway 57 and Lincoln Street. 10:34 p.m.: General police call; 200 block of Water Street. SP 7UDIÀF VWRS ,QWHUVHFtion of First Street and Main Street. Mason City Clinic Department of Orthopaedics 250 South Crescent Drive, Mason City, IA 50401 Phone 1-800-622-1411 ext 5210 čĆęǯĘĔėĚēĈčǫ CONGREGATE MEALS Monday, August 12: Chicken/Noodles, brussel sprouts, apricots, coconut cr. des’t. 1:00 Bingo Tuesday, August 13: Taco salad, corn, plums, royal brownies, t-juice. 12:45 Cribbage Wednesday, August 14: Fish, parslied pots., cr. peas, fruit pudding. %OG3UHVV0HG0LQV&DUGV Thursday, August 15: Meatloaf, potatoes, beets, cookies. 1:00 Bingo Friday, August 16: Goulash, spinach, garlic bread, oat/fruit bar, OJ.µ<RXWHOOMRNHGD\µ0H[7UDLQ SPONSORED BY H AUSER F INANCIAL G ROUP Philip F. Hauser, CLU Phone: 641-456-5255 Website: KDXVHUÀQDQFLDOJURXSFRP WEALTH ACCUMULATION PLANNING, RETIREMENT AND ESTATE PLANNING, LIFE, HEALTH, LONG TERM CARE INSURANCE, ANNUITIES, INVESTMENTS 16 4 TH671(+$03721,$ PHILIP F. HAUSER REGISTERED REPRESENTATIVE: SECURITIES OFFERED SOLELY THROUGH AMERITAS INVESTMENT CORP. (AIC). MEMBER FINRA, SIPC. AIC AND HAUSER FINANCIAL GROUP ARE NOT AFFILIATED. ADDITIONAL PRODUCTS AND SERVICES MAY BE AVAILABLE THROUGH PHILIP F. HAUSER OR HAUSER FINANCIAL GROUP THAT $5(1272))(5('%<$,&6(&85,7,(6(0$,/3+$86(5#$,&,19(67&20 8 FAITH AND WORSHIP :HGQHVGD\$XJXVW +DPSWRQ&KURQLFOH6HFWLRQ$ Area Church Activities Baptist Faith Baptist Hwy. 3 E., Hampton Senior Pastor David Koenigsberg, Associate Pastor of Connecting Brad VanHorn 6XQGD\$XJXVWDP3UD\HU DP:RUVKLS6HUYLFHDP.LQJGRP.LGV :HGQHVGD\$XJXVWDP :RPHQ·V3UD\HUDP0HQ·V3UD\HU Catholic St. Mary’s Catholic $FNOH\Rev. Mike Tauke 6XQGD\VDP0DVV St. Patrick’s Catholic )HGHUDO6W1+DPSWRQ Rev. Mike Tauke 1)HGHUDO6W 6DWXUGD\VSP0DVVLQ6SDQLVK 6XQGD\VDP0DVV Christian Church (Disciples of Christ) First Christian Pastor Alan Berneman WK6W1(+DPSWRQ IFFKDPSWRQLRZDRUJ :HGQHVGD\$XJXVWDP :RUVKLS0HHWLQJSP9%63RWOXFNDQG3URJUDP 6DWXUGD\$XJXVWDP&KULVWLDQ 0HQ·V)HOORZVKLS 6XQGD\$XJXVW)RRG3DQWU\6XQGD\DP:RUVKLSDP3DVWRUDO 5HODWLRQV0HHWLQJ 7XHVGD\$XJXVWSP)LQDQFH 0HHWLQJ :HGQHVGD\$XJXVWSP%RDUG 0HHWLQJ Episcopal St. Matthew-by-the-Bridge Episcopal Rev. Elliot Blackburn 5DLOURDG6W,RZD)DOOV 6XQGD\VDP%LEOH6WXG\ DP)DPLO\:RUVKLS6HUYLFH Latter Day Saints The Church of Jesus Christ Of Latter Day Saints +DPSWRQMiguel Sosa Garcia, Branch President 6XQGD\VDP:RUVKLS6HUYLFH 6SDQLVK$FWLYLWLHV Lutheran Church of the Living Word, LCMC VW$YH1(+DPSWRQ ZZZFOZKDPSWRQRUJ Jacob Rahrig, Pastor 7RUHVHUYHDXGLWRULXPRUJ\PFRQWDFW .D\+LQULFKVDWRUDWND\KLQULFKV#JPDLOFRP 6XQGD\VDP6XQGD\6FKRROIRU 3UH6FKRRO6L[WK*UDGHDQG$GXOWV DP&HOHEUDWLRQ6HUYLFH 7XHVGD\VDPQRRQ0LQLVWHULDO &ULVLV&HQWHU :HGQHVGD\VSP%RG\%\ -HVXV3UHVFKRRO)RXUWK*UDGH SPWK*UDGHV 7KXUVGD\$XJXVWSP*RVSHORI -RKQ6WXG\6WDUWV Our Savior’s Lutheran 3URVSHFW$FNOH\ Pastor Gary Burkhalter 6XQGD\VDP6XQGD\6FKRRO DP'LYLQH6HUYLFH&RPPXQLRQQG WKWKDP)HOORZVKLS 7XHVGD\VSP7XHVGD\6FKRRO Nazareth Lutheran &RXOWHUPastor Dave Bernhardt 6XQGD\$XJXVWDP:RUVKLS 6HUYLFHDW8&&ZLWK9%6SURJUDP St. John’s Lutheran ,QGLJR$YH+DPSWRQ Pastor Dave Bernhardt :HGQHVGD\$XJXVWSP&RXQFLO 0HHWLQJ 7KXUVGD\$XJXVW6WDWH)DLUWKWK )ULGD\$XJXVW&RPPXQLW\%LEOH 6FKRRO&DPSDW8&& 6DWXUGD\$XJXVW&RPPXQLW\%LEOH6FKRRO&DPSDW8&& 6XQGD\$XJXVWDP:RUVKLS 6HUYLFHDW8&&ZLWK9%6SURJUDP 0RQGD\$XJXVWDP4XLOWLQJ :HGQHVGD\$XJXVWSP6W -RKQ·V:(/&$0HHWLQJ+RVWHVV%HY .DURO\Q-RKDQVHQ3URJUDP'HE6FKUHFN St. Paul Evangelical Lutheran Pastor Steve Winsor QG6W1(+DPSWRQ &KXUFK2IÀFH+RXUV0) 6XQGD\VDP:RUVKLS6HUYLFH 7XHVGD\V'RUFDV&LUFOH0HHWV7KLUG 7XHVGD\RI(DFK0RQWKDWDPDW WKH&KXUFK :HGQHVGD\VDPQRRQ4XLOWLQJ *URXSDP&RIIHH+RXU³(YHU\RQHLV:HOFRPHSP:2: SP<RXWK*URXS 7KXUVGD\V3ULVFLOOD&LUFOH0HHWV 7KLUG7KXUVGD\RI(DFK0RQWK St. Paul’s Lutheran :0DLQ/DWLPHU Pastor Travis Berg, Pastor 7KXUVGD\$XJXVW+RPH9LVLWIRU 1HZ)DPLOLHVWK²WK )ULGD\$XJXVW3DVWRURXURIWRZQ 6DWXUGD\$XJXVW3DVWRURXWRI town 6XQGD\$XJXVWDP:RUVKLS ZLWKFRPPXQLRQ St. Paul’s Church /DUFK6W7KRUQWRQ Pastor Johnson 6XQGD\VDP6XQGD\6FKRRODW 80&DP:RUVKLSDW6W3DXO Trinity Lutheran Church WK$YH1(+DPSWRQ The Rev. Karl Bollhagen, Pastor Vicar Michael Kearney 6XQGD\$XJXVWDP/XWKHUDQ+RXURQ./0-DP:RUVKLS 6HUYLFHZLWK+RO\&RPPXQLRQ DP:RUVKLS%URDGFDVWRQ./0- DP:HOFRPHIRU1DWKDQ6FKLHEHU 7XHVGD\$XJXVWDP:RPHQ·V%LEOH6WXG\SP6HZLQJ'D\ SP(OGHUV0HHWLQJ Methodist Ackley United Methodist Jerry Kramer, Pastor +DUGLQ6W 7KXUVGD\$XJXVWSP%LEOH 6WXG\DW3UHVE\WHULDQ9LOODJH 6XQGD\$XJXVW)RRG3DQWU\ 6XQGD\DP/HJLRQ2PHOHW%UHDNIDVW ´1RLV\2IIHULQJµIRUVFKRRONLWV DP:RUVKLSDP)HOORZVKLS :HGQHVGD\$XJXVWSP%LEOH 6WXG\DW/LEUDU\SP2USDK&LUFOH First United Methodist 7KRPSVRQ6W6KHIÀHOG Sandi Gobeli, Pastor 6XQGD\VDP:RUVKLS Geneva United Methodist )URQW6W Harry Imlay, Pastor 6XQGD\VDP:RUVKLS Hampton United Methodist Pastor Corby Johnson &HQWUDO$YH( 7KXUVGD\$XJXVWDP3UD\HU %UHDNIDVWDW6WDUV 6DWXUGD\$XJXVWSP:RUVKLS 6XQGD\$XJXVWDP7HDFKHUV 6WXG\DP:RUVKLSDP )HOORZVKLSDP5DGLR%URDGFDVW RQ./0 0RQGD\$XJXVWSP*RG·V )/2&. 7XHVGD\$XJXVWSP2XWUHDFK :HGQHVGD\$XJXVWSP(GXFDWLRQ0HHWLQJSP)LQDQFHPHHWLQJ SP:RUVKLS&RPPPHHWLQJSP /HDGHUVKLS&RXQFLOPHHWLQJ West Fork United Methodist 7XOLS$YH6KHIÀHOG Sandi Gobeli, Pastor 6XQGD\VDP:RUVKLS New Hope United Methodist Parish: Aredale, Bristow, Dumont Ann Donat, Pastor $UHGDOH&HQWHU6XQGD\:RUVKLS a.m. 'XPRQW&HQWHU6XQGD\6FKRRO DP:RUVKLSDP United Methodist Church 0RUJDQ/HH&HQWHU%UDGIRUG Erling Shultz, Pastor 6XQGD\VDP:RUVKLS% Parson to Person Water damage Pastor David M. Koenigsberg Senior Pastor of Faith Baptist Church -HUU\ D SDVWRU IULHQG RI PLQH IURP (ULFVRQ 1HEUDVND ZULWHV DQ HPDLO GHYRWLRQZKLFK,UHFHLYHHYHU\ZHHN7KHDUWLFOHKHZURWHDIHZZHHNVEDFN GHVFULEHVWKHHIIHFWRIVLQLQRXUOLYHV Jerry writes: “I don’t remember if I mentioned we bought a used camper last fall. When we got it, we knew it had some issues with water damage. 8SRQIXUWKHUH[DPLQDWLRQWKHUHZDVPXFKPRUHGDPDJHWKDQÀUVWDSSHDUHG What we saw on the surface did not prepare us for the internal damage that had been done. I had planned to do the work myself, but we decided to take it to the camper repair place. They are doing a great job of restoring our “bargain” to usable condition.” ,VQ·WWKDWMXVWZKDWKDSSHQVZKHQZHDOORZDVPDOODPRXQWRIVHOÀVKQHVV WRFUHHSLQWRRXUOLYHV",WGRHVQ·WVHHPWREHDELJGHDORQWKHRXWVLGHEXW OHIWDORQHLWFDQVSUHDGXQWLOLWGHVWUR\VHYHU\WKLQJIURPWKHLQVLGHRXW Jerry continued, “In a spiritual sense, sin has the same effect on our lives as the water did that crept into the walls of our camper. Whether it is jealousy, envy, anger, bitterness, immorality, profanity, or any number of things I could mention, it starts out small and seemingly harmless. It then begins to spread until it takes over completely. There is no way we can get rid of it without help. The only one who can bring about restoration of the soul contaminated by sin is the Lord Jesus Christ. “Jesus Christ, who gave himself for us to redeem us from all wickedness and to purify himself a people that are his very own, eager to do what is good” (Titus 2:14). If someone had taken steps to prevent the water from entering the camper walls, much damage could have been prevented. We, as Christians, also need to take preventive measures against sin creeping into our lives. Here are a few suggestions from Scripture: Flee from evil desires (2 Timothy 2:22). Resist the devil (1 Peter 5:8-9). Keep away from temptation (Galatians 6:1). Be in prayer (Mark 14:38). $QGLIZHÀQGWKDWVLQKDVFUHSWLQWRRXUOLIHKHUHLVWKHUHPHG\´,IZH confess our sins, he is faithful and just and will forgive us our sins and purify us from all unrighteousness” (1 John 1:9). Faith in Christ is the remedy for removing the stain and guilt of sin in our lives. There is no other. 7KDQNV-HUU\IRULOOXVWUDWLQJDJDLQWKHHIIHFWRIVLQLQRXUOLYHVDQGKRZWR FRPEDWLW0D\DOORIXVFRQWLQXHWRZRUNWRSUHYHQWVLQLQRXUOLYHVDVPXFK DVZHZRUNWRSUHYHQWZDWHUIURPHQWHULQJRXUKRPHV Monday Night Buffet 5 - 8 pm In town delivery starting at 5 p.m. Dan Schipper - Manager Hwy. 3 West, Hampton Call 641-456-2303 641-456-3355 B & C KITCHEN 641-456-2788 7 1 AVE. NW • HAMPTON ST FUNERAL HOME AND MONUMENT SALES Iowa Falls, 641-648-2569 Toll Free 1-800-464-2569 Living Well Fellowship +RZDUG6W)LUVW3UHVE\WHULDQ &KXUFK$SOLQJWRQ 0RQGD\VSP&RQWHPSRUDU\:RUVKLS([SORULQJ5HGHPSWLRQDQG+HDOLQJ &RPH(DUO\IRU+RW&KRFRODWHRU&DSSXFFLQR Sovereign Grace Church 1(VNULGJH6W'RZV 'RZVZZZVJFGRZVFRP Doug Holmes, Pastor 6XQGD\VDP6XQGD\6FKRRO DP:RUVKLSDW)LUVW3UHVE\WHULDQ LQ'RZV Church of Christ VW6W1(+DPSWRQ Rocky Woolery, Pastor 6XQGD\VDP:RUVKLS*DWKHULQJ :HGQHVGD\VSP%HOLHYHUV*DWKHULQJ Sixth Street Church of Christ (Acapella) WK6W6:+DPSWRQ Jim Zacharias, Minister 6XQGD\VDP6XQGD\6FKRRO DP:RUVKLSSP:RUVKLS :HGQHVGD\VSP%LEOH6WXG\ Lighthouse of Life WK6W6(+DPSWRQ 7KXUVGD\VSP6SDQLVK6HUYLFH ZLWK3DVWRUV$QWRQLRDQG-HDQQHWH3LFKDUGR Neighborhood Bible +Z\1+DPSWRQ Joel Anderson, pastor Darren Chipp 6XQGD\VDP6XQGD\6FKRRO DP0RUQLQJ:RUVKLS :HGQHVGD\VSP%LEOH6WXG\ 641-456-3232 Seven Stars Family Restaurant 119 North Akir St Latimer, IA 641-579-6240 Member FDIC Non-Denominational Abundant Life Chapel )DLUYLHZ6W'RZV Bruce Klapp, Pastor 6XQGD\VDP6XQGD\6FKRRO IRUDOODJHVLQFOXGLQJDGXOWV DP:RUVKLS6HUYLFHZLWK1XUVHU\DQG &KLOGUHQ·V0LQLVWU\DYDLODEOHSP $GXOW%LEOH6WXG\ZLWKFKLOGFDUHDYDLODEOH :HGQHVGD\VSP$GXOW%LEOH 6WXG\ZLWK1XUVHU\&KLOGUHQDQG<RXWK 0LQLVWU\ Allison • Dumont • Hampton • Latimer First Citizens National Bank Chef Jeffrey Ho Chinese Cuisine DINE IN • TAKE OUT • CATERING United Methodist & Presbyterian 'RZV²$OH[DQGHU Shawn W. Hill, Pastor 6XQGD\VDP$OH[DQGHU0HWKRGLVW:RUVKLSDP'RZV6XQGD\ 6FKRRODP'RZV-RLQW:RUVKLSDW 3UHVE\WHULDQ&KXUFKRQÀUVWWZR6XQGD\V HDFKPRQWKDQGDW8QLWHG0HWKRGLVW &KXUFKRQUHPDLQLQJ6XQGD\V 7KXUVGD\VDP3UHVE\WHULDQ:RPHQ Sietsema-Vogel Funeral Homes and Monument Sales Godfather’s Pizza Serving All of Central Iowa From Hampton! DP:RUVKLS/&DP:RUVKLS 0 7XHVGD\VSP1$$$%LEOH6WXG\SP%%LEOH6WXG\ Hwy 65 So. 641-456-5378 Open 6:30 am-8 pm Tues. thru Fri. Sat. & Sun. 7 am-8 pm www.firstcitizensnb.com DQG3UD\HU (YHU\RQH:HOFRPH&RPH$V<RX $UH3DUWQHULQJZLWK(YDQJHOLFDO)UHH &KXUFKRI$PHULFD Reformed Dumont Reformed UG6W Pastors April and Jeff Fiet 6XQGD\VDP&RPH$V<RX $UH:RUVKLS1R6XQGD\6FKRROIRU 6XPPHU :HGQHVGD\VSP+LJK6FKRRO <RXWK)HOORZVKLS First Reformed %URZQ6W$OH[DQGHU Pastor Philip Arnold 6XQGD\VDP3DVWRU3KLO·V5DGLR 0LQLVWU\RQ.4&5DP:RUVKLS SP3DVWRU3KLO·V5DGLR0LQLVWU\RQ ./0Zion Reformed -RQTXLO$YH6KHIÀHOG Rev. Arthur Zewert 7KXUVGD\$XJXVWDP%XOOHWLQ 'HDGOLQH 6XQGD\$XJXVWDP:RUVKLS DP6XQGD\6FKRRO 0RQGD\$XJXVWSP9HVSHU &LUFOH 7XHVGD\$XJXVWDP6HZLQJ *URXSSP)*+3URJUDPSP-R\ &LUFOH :HGQHVGD\$XJXVWDP6XQULVH &LUFOHSP'HDFRQV(OGHUVSP &RQVLVWRU\ Seventh Day Hampton Seventh Day Adventist 32%R[+DPSWRQ Jose LaPorte, Pastor 6DWXUGD\VDP%LEOH6WXG\ DP:RUVKLS United Church of Christ First Congregational U.C.C. VW$YH6:+DPSWRQ Pastor John Byrne 6XQGD\$XJXVWDP:RUVKLS 7XHVGD\$XJXVWDP6HZLQJ Immanuel U.C.C. (6RXWK6W/DWLPHU The Rev. Lindsey Braun, Pastor :HGQHVGD\$XJXVWSP335& )ULGD\$XJXVWDP9DFDWLRQ %LEOH6FKRRO 6DWXUGD\$XJXVWDP9DFDWLRQ%LEOH6FKRRO 6XQGD\$XJXVWDP&RPPLQLW\:RUVKLSVHUYLFHIRU9%6SP :RUVKLSDW6KHIÀHOG1XUVLQJ+RPH St. Peter’s U.C.C. %5DYHQ$YH*HQHYD 6W3HWHUV,$8&&#JPDLOFRP Rev. John Hanna, Pastor )ULGD\$XJXVWDP%LEOH 6FKRRO 6DWXUGD\$XJXVWDP%LEOH 6FKRRO 6XQGD\$XJXVW%LEOH6FKRRO6XQGD\DP:RUVKLSZLWK&RPPXQLRQ 1280 Imperial Rd., Hampton 641-456-2500 Global Appraisal Service Real Property Appraisals: Specializing in Commercial & Eminent Domain Appraisals Call 641-456-4477 Steven E. Pearson, CPA CERTIFIED PUBLIC ACCOUNTANT Hansell Ag Repair, Inc. State Farm Building, P.O. Box 61 General Tractor & Lawnmower Repair 104 Federal St. N, Hampton 1612 Vine Ave., Hampton 641-456-4829 641-456-2034 Visit our website @ www.krukowrealestate.com Hwy 3 W., Hampton, IA 641- 456-3883 515 Main St., Dumont, IA 50625 FRANKLIN CO. AUTO BODY, INC. “Serving Hampton Area for over 40 Years” 16 4th St. N.E. HAMPTON, 641-456-5255 “We Meet By Accident” 401 1st St. SW - Hampton, IA 50441 505 E. Gilman St., Sheffield, IA 50475 Phone: 641-892-8080 641-456-5293 Phone & Fax: 641-456-4124 Hwy 3 & Hwy 65 641-456-2594 Mon.-Fri. 7:30 - 5:30 • Sat. 7:30 - 12:00 Syngenta Seeds, Inc. “Wapping your Communication Needs in Service” 1274A Olive Ave. - Hampton 641-456-2592 641-857-3211 BELEN KRABBE Retz Funeral Home Investment Advisor Representative 11 First Ave. N.W. • Hampton, IA 50441 Sheffield - Meservey - Thornton 641-456-4644 Grocery 641-456-5253 Meat 641-456-2756 Hampton, Iowa “Please Worship with Your Family” or Toll Free 877-599-4644 [email protected] Securities offered through ING Financial Partners, Inc. Member SIPC 641-892-4241 www.retzfh.com 24-HOUR TOWING SERVICE After hours 641-456-3744 Auto, Truck Repair & Welding 641-456-5608 24 1st St. NW - Hampton, IA 50441 Jeffrey A. Jaacks, LPA 641-866-6866 Toll Free 1-877-667-8746 Sheffield Care Center [email protected] Noon Buffet Monday - Friday P.O. Box 400 1451-A Gull Ave. Latimer, IA 50425 Hwy 65 South, Hampton 112 1st Ave NW Hampton, IA 50441 Stitch It - Print It - Wear It “Your One Stop Water Shop” Auto Parts, Inc. 641-456-3242 641- 456-3473 Mike and Gwen Thornburgh Mort’s Incorporated Crossroads of Hampton 120 1st Street NW, Hampton 641-857-3287 “Offering A Great Selection Of Floor Covering & Expert Installation” Stihl Products Midwest Meter MID:COM Highway 65 North, Hampton, IA E&E RepairGene Elphic 641-456-4264 “Your Liquid Metering & Pumping Specialist” owner 641-456-4802 1410 Olive Ave., Hampton, IA • 3/4 mile N. of Fairground corner Licensed Public Accountant Dumont Implement Co. 3 - 1st St. SW, Hampton 641-456-4125 641-857-3216 Highway 3, Dumont, IA www.dumontimplement.com Corn Belt Power Cooperative To help sponsor this page, call Barb at 641-456-2585 ext. 120 100 Bennett Drive Sheffield, Iowa 50475 641-892-4691 “Skilled Nursing and Outpatient Rehab. Respite Stays” Allison Pharmacy “Your Hometown Pharmacy” 305 N. Main St. Allison, IA 319-267-2505 BURESH BUILDINGS Brian Buresh President 641-456-5242 808 Central Ave. W., Hampton Keith’s Auto & Truck Clinic “The Power of Human Connections” 808 1st St. NW - Hampton Humboldt • Hampton Emmetsburg • Spencer 641-456-3573 FROM YOUR NEIGHBORS +DPSWRQ&KURQLFOH6HFWLRQ$ Hampton Country Club Couple’s Invitational Tournament Saturday, August 3, 2013 Afternoon Session - 18 Holes Championship Flight Dan and Carlene Bergeson - Ackley Bill and Elaine Schultz - Oelwein Bill Burman and Jane Heilskov - Hampton 73 74 75 First Flight *DU\5RRQH\DQG$QJLH+DUSHU6KHI¿HOG Mike and Tracy Viet - Ackley 81 Second Flight Butch and Becky Jansonius - Ackley Max Koster and Kara Pralle - Hampton 84 84 Third Flight Bill and Pam Moore - Hampton &OLIIDQG/RXLVH&DPHURQ6KHI¿HOG 87 Fourth Flight Doug and Jaimie Keninger - Iowa Falls Mike and Kathy Atkinson - Hampton Fifth Flight 5RQDQG'HH6FKHUPHU+DPSWRQ 7RPDQG0DUOHQH6HYHUH6KHI¿HOG New Arrival Jesse and Sarah Westaby of Alexander are parents of a second son, Jonas Jeremiah, born at Hamilton Hospital in Webster City on July 31, 2013. He weighed 8 lbs. 2 oz., and joins siblings Micaiah and Hadassah. Grandparents are Kevin & Colette Westaby, Belmond; and Ann & Vince Harned, Oskaloosa. Great grandparents are Marlo & Gloria Westaby, Alexander; Wesley & Mabel Meyer, Hampton; Harold Harned, Newton; and Peggy Klein, Oskaloosa. The next Candle-Stick Chapter DAR meeting will be held at 1:30 p.m. on Tuesday, August 13, 2013, at the home of Jo Ann Petersen, located at 7885 Spruce Avenue in rural Rockwell. Our hostess, Jo Ann Petersen will give the Conservation Program on a “Tour of Garden and Collectibles”. Make sure to wear casual clothing and comfortable shoes or tennis shoes for the tour! Please let Jo Ann know if you are planning to attend the meeting. Kim Bosch, Secretary Candle-Stick Chapter DAR Jesse Bunge, the new director of the Franklin Chorale, has announced audition information for the 2013-14 Franklin Chorale. Bunge reported that auditions will be held Aug. 12 and Aug. 13, from 7-8:30 p.m. each day in the vocal music room at Hampton-Dumont Community Hospital. All area vocalists are invited to audition for the chorale, however high school students are not eligible and cannot audition. Auditions will include vocal range, voice quality, and sight reading ability. Vocalists may bring a prepared solo if they wish; an accompanist will be provided. The audition is open to former members of the Franklin Chorale. For those who are selected to be in the chorale after auditions, rehearsals for performances will be held following area church activities on :HGQHVGD\ HYHQLQJV7KH FKRUDOH¶V Christmas concert is scheduled for December 8, 2013. Questions about the auditions or anything related to the Franklin Chorale can be sent to Bunge via email at: [email protected]. Fire & Water—Cleanup & Restoration Nationally Known—Locally Owned CARPET CLEANING Area Rugs • Furniture Upholstery or any other cleaning task We move the furniture for you! 90 91 641-456-3633 1-866-950-3633 Our Local Carpet Care Professionals 9 Franklin Chorale 2013-2014 audition and rehearsal information released Candle-Stick Chapter DAR Jonas Jeremiah :HGQHVGD\$XJXVW Call today to schedule your Carpet Cleaning Floor Covering Sales & Installation Latimer News ❚ ❚ %\0DULH7HJJDW] ❚ ❚ /DWLPHU ZLOO DJDLQ VSRQVRU D ODGLHV¶ FDUG PDUDWKRQ beginning in September. If you would like to play in the marathon please call Mildred Menning at 579-6346 by August 15. The marathon is open to all ladies and newcomers are very ZHOFRPH<RXZLOOQHHGDSDUWQHU There will be open quilting at the Latimer Community Center on Saturday, August 10 and anyone is welcome to join us. Bring your own projects to work on and have fun socializing and seeing beautiful projects stitched by fellow quilters. Newcomers are especially encouraged to visit. If you spend the day quilting with us the only cost is $5 to help pay for the rental of the center. Doors will open at 8:00 and you can work all day. ❚ Jacob Jungck Carpet Vinyl Ceramic wood Laminate ❚ Olberding ❚ Floors Installer Owned Great Floors Since 1968 641-648-2520 www.olberdingfloors.com Showroom Open Monday-Friday 9 a.m.-5 p.m. SEE US AT OUR NEW LOCATION! • 619 Washington Ave., Downtown Iowa Falls, IA Sales & Service Darren & Jeanene Chipp, Owners P.O. Box 31 • Coulter, IA 50431 Servicing: • Lawn Mowers (All kinds) • ATVs • Go-Karts • Snowblowers • Leaf Blowers • Cars • Vans • Light Duty Trucks • Small Engine Repairs Community Notes the Bradford Methodist Church. $$2OG7LPHUV*URXSDQG$O Hampton Rotary Club meets Wednesdays at 12:05 p.m. at Godfa- Anon, Tuesdays, 7 p.m., Franklin ther’s Pizza. Ed Butler, song leader; County Alcoholism Service Center. $$:HGQHVGD\VSPDWWKH Dave Heuberber, invocation; Jack /DLSSOH ÀQH PDVWHU $O 0HQQLQJ FCASC in Hampton. Warren Smith, and Jay Van Wert, /DWLPHU&RPPXQLW\&OXE program committee. 2SHQ PHHWLQJV RI WKH /DWLPer Community Club are held the 1st Hampton Kiwanis Hampton Kiwanis Club meets Monday of every month at 7 p.m. at Tuesday, August 13 at Godfather’s the Latimer Golf Course. Pizza with Dennis Borcherding, program; Phil Hauser, invocation/ )UDQNOLQ &RXQW\ 7HD 3DUW\ pledge; Kent Mollenbeck, greeter; 0RYHPHQW The Franklin County Tea ParCharlie Wilms, good news. ty Movement meets 6:30 p.m., Wednesday, August 14 in the Godfa+DPSWRQ/LRQV Hampton Lions Club meets ther’s Pizza meeting room in HampThursday, August 8 at Godfather’s ton. Pizza. Program by Craig Semler and )UDQNOLQ &RXQW\ +LVWRULFDO Jim Davies. Hampton Rotary Call: 641-430-0701 (Cell) Jacob Jungck Returns from SOA European Concert Band Tour O M N U T D 3XEOLF+HDOWK&OLQLFV :HGQHVGD\ $XJXVW )RRW Clinic, 1:00-3:00 p.m. at Hampton Senior Center 7KXUVGD\$XJXVW)RRW&OLQic, 8:30-10:00 a.m. at EMS BuildLQJ6KHIÀHOG )ULGD\$XJXVW %ORRG 3UHVsure, 8:30-9:30 a.m. at Franklin County Public Health, walk-in :HGQHVGD\$XJXVW %ORRG Pressure and Med. Minutes, 10:0011:00 a.m. at Hampton Senior Center, walk-in 7236 TOPS #272 (Take Off Pounds Sensibly) meets every Tuesday, with weigh-in at 5:30 p.m. and the meeting at 6 p.m. Anyone interested can visit a meeting. For information, call Elaine Wilcox at 641-430-4308. The PHHWLQJLVDWWKHSXEOLFKHDOWKRIÀFH at 1600 Central Ave. E., Hampton. Hampton Jaycees +DPSWRQ5RWDU\&OXEPHHWVÀUVW Monday of every month at 7 p.m. at Godfather’s Pizza in Hampton. I would like to thank everyone that supported me for this trip with the Sound of American National Honor Band and Choir. I saw many things and met many people I will never forget. From being at the top of the Eiffel Tower to being surrounded by the Alps I thank you. The people were nice to 0XVHP Regular Hours are 2-4 p.m. us and we gave them great Monday; 9-12, 1-4 Tuesday; 1-4, Wednesday, Thursday, and Friday; concerts. We gave thanks to and 1-4 Sunday Memorial Day our fallen soldiers during our through Labor Day. If no car in trip at the Luxembourg Amerfront, the museum is closed. ican Cemetery and Memorial. I will never forget. 6KDUH\RXUPHHWLQJ Email time, date and place of your non-church group meeting to [email protected] for inclusion here. Meetings run the prior week unless otherwise requested. (Church activities go on the Religion page.) ✁ CLIP & SAVE riday! Starting Fith w w No ďĊĈęĎĔē ėĔ DĎČĎęĆđ P TURBO AUGUST 9 - 15 $$$O$QRQ STARRING: Ryan Reynolds %UDGIRUG $$ DQG $O $QRQ meets Sundays starting at 7 p.m. at TURBO PG SHOWTIMES 7:00 p.m. Nightly (Closed Monday Nights) 1:00 p.m. Matinee on Sunday ******* TICKET PRICES $3.00 for youth (16 & under); $4.00 for adults Senior Sunday's $2.00 (50 & up) Tues. & Thurs. ALL $2.00 August 9 - 15 FRI. - THURS. 7:30 P.M. Mon., Sept. 2nd, 2013 • 6 - 9 p.m. AUGUST 16 - THE WOLVERINE - PG-13 AUGUST 23 - RED 2 - PG-13 AUGUST 30 - THE SMURFS 2 - PG Adults - $2, 15 & Under - $1 Main Street - Belmond 641-444-7225 SALES PHONE 857-3216 Do it best with DUMONT SERVICE HARKEN LUMBER DUMONT, IOWA 50625 641-857-3842 • Dumont, IA HARRISON-THORNBURGH INSURANCE 119 1st St. N.W. HAMPTON 456-3773 All Lines of Insurance 641-857-3413 Oblivion or 1-800-757-3413 517 Main St. Dumont, Iowa The Place Beyond the Pines ALLISON PHARMACY The Sapphires "Your Hometown Pharmacy" PG-13 NEW! TW OFER TUESDA Y ! 319-267-2505 305 N. Main Street Allison, Iowa MARSHALL & SWIFT Dry cleaning & Laundry Tuesdays & Fridays PICK-UP & DROP OFF ALLISON Main Street Ph.319-267-2650 Mon. thru Sat. 7:30 a.m.-7:00 p.m. Sun. 10:00 a.m.-2:00 p.m. Jamie Winkowitsch, Owner/Stylist By Appointment Only 11235 Hwy. 3 Dumont, IA 50625 M-G FLOOR DECOR Rent a top hit movie and get one FREE! RENT A NEW RELEASE AND GET A CATALOG MOVIE FOR 50¢. DUMONT 611 Main Street Ph. 857-3285 Mon. thru Sat. 8:00 a.m.-6:00 p.m. We have AT&T phones. Check our prices for Residence or Business Phone Equipment. 641-857-3211 • Dumont, IA FLOOR COVERING EXPERT INSTALLATION Mike & Gwen Thornburgh 515 Main Street, Dumont 641-857-3287 ******* PG New Lyric Theatre DUMONT IMPLEMENT COMPANY, INC. FOR MORE INFO: WWW.WINDSORTHEATRE.COM OR FIND US IN FACEBOOK AT WINDSOR HAMPTON ✁ CLIP & SAVE YOUR tan any way YOU want it! • Tanning Beds • Mystic Spray Tan • Sunless Tanning Products 3 ways to get your summer tan! Hours: Mon.-Thurs. 10-9; Fri. & Sat. 10-10; Sun. Noon-9 Linda Shear - owner Specializing in Silk Floral Creations and Home Decor. Hours: Tues.-Fri. 1-5 or by appointment. 820 Broadway St., Dumont 641-857-6238 Dumont Wellness Center UG6WUHHW'XPRQW,$ ZZZDEFPFRUSFRP Enhancing Relationships Let these businesses serve your needs in Dumont! 10 :HGQHVGD\$XJXVW FROM YOUR NEIGHBORS +DPSWRQ&KURQLFOH6HFWLRQ$ ISU Extension News County/ Community Receives Grant to Support Special Program A $1000 grant has been awarded to Franklin County Extension to implement Together for a Better Education (Juntos Para Una Mejor Educación) in Hampton. This six (6) session workshop series brings together Latino parents and youth, school staff, and community partners to promote high school graduation among Latino youth and explore possible paths to higher education. Juntos helps parents and youth gain knowledge, skills and resources to prevent 8-12th grade students from dropping out of school and to encourage families to work together to gain access to college. Grants were awarded to Franklin County, Wright County, Marshall County and Pottawattamie County (Council Bluffs). A private donation IURP-LPDQG'LDQH3DWWRQRI5RFNZHOO&LW\,$PDGHWKLVIXQGLQJSRVsible. National Farmers Market Week National Farmers Market week is celebrated this year the week of August 4-10, 2013. The local growers who operate your farmers market represent one of the fastest growing segments of agriculture in Iowa. Every dollar spent at farmers market helps create new jobs, income, and opportunities for Iowans. By shopping at the farmers market you are PDNLQJDQLQYHVWPHQWLQ,RZD¶VIXWXUH$QGZKHUHHOVHFRXOG\RXJHW produce that is fresh and be able to talk with the person who grew it as well? This enables you to ask about chemicals, insecticides, etc. that have been used in growing the produce. :KLOH QRQH RI RXU JURZHUV WR P\ NQRZOHGJH DUH FHUWL¿HG RUJDQLF farmers, I do know that many of them use few or no chemicals to produce their crop. In addition, because the crops are picked ripe rather than green and brought for sale soon after picking, vitamins and minerals present in the fruits and vegetables are at their highest levels. Canning and freezing quantities are available for anyone who wants to take the time to preserve them. order ahead also to be sure that what you want is available to you. The Franklin County Farmers Market provides two additional services to families. The WIC and Senior program checks are available for our county and accepted at our market by most fruit and vegetable vendors. This program is available in limited counties. Franklin County has been LQWKHSURJUDPVLQFHLWZDV¿UVWH[SDQGHGEH\RQGWKHRULJLQDOHLJKWRU nine large counties because the vendors here were very interested in participating. Food Stamps are also accepted at our market by two vendors who sell food or garden plants. While it is not widely used, we feel this VHUYLFH EHQH¿WV IDPLOLHV RQ IRRG VWDPSV DQG HQFRXUDJHV WKHP WR EX\ more healthy foods. Stop in on Tuesday or Friday evenings from 5:00 to 7:00 PM at Main Street Square and help us celebrate Farmers Market week. Friday evening, August 9, there will be free samples available and reusable market bags will be given away. A drawing will be held for a free market bag of goodies to be given away on Tuesday August 6. Franklin County Farmers Market celebrates its thirty-second anniversary this year and has been sponsored by Iowa State University Extension - Franklin County since it began in the summer of 1982. August 28 Field Day to Highlight Fall Preparation of Late Planted Spring Crops NASHUA -- ISU Extension Specialists emphasize crop production and management of a late maturing crop during the Annual Fall Field Day at WKH,681RUWKHDVW5HVHDUFKDQG'HPRQVWUDWLRQ)DUPQHDU1DVKXD The program will run from 1:00 to 4:00 p.m. on Wednesday, August WKIHDWXULQJ¿YHVSHDNHUV.HQ3HFLQRYVN\,685HVHDUFK)DUP6XSHULQWHQGHQWZLOOEULHÀ\UHYLHZVHDVRQDOZHDWKHUDQGWULDOVRQWKHUHsearch farm. Charles Hurburgh, Grain Quality and Handling Specialist, will follow Ken and address the key management strategies and consid,QDGGLWLRQWR¿QGLQJWKHIUHVKHVW,RZDJURZQSURGXFHRXUIDUPHUV erations to be aware of when handling, drying, and storing grain that has market also provides lots of home produced fresh baked goods, plants for a potential of being wetter than average at harvest. Chad Hart, Economist \RXUKRPH\DUGDQGJDUGHQKRQH\IUHVKHJJVÀRZHUVGULHGKHUEVDQG and Crop Markets Specialist, will highlight the market trends of 2013 and jams & jellies. Most of these products will be available all season. For SUHGLFWLRQVJRLQJLQWRWKHQHDUIXWXUH5RJHU(OPRUH&RUQ3URGXFWLRQ the best selection it is necessary to come early, however, a good selection Specialist, will discuss crop growth and development from the planting is available throughout the market. Customers always have the option to date trials and expectations on maturity. Dan Huyser, Agricultural EnJLQHHUZLOOUHÀHFWRQWKLVSDVWZHWVSULQJDQGGLVFXVVWKHSDUDPHWHUVRI planning, lay out, and economics of cost and maintenance of tile drainage. Mohawk, Shaw, Beaulieu, Kraus & Barrett Carpet Karndean & Armstong Commercial Flooring ◆ Solid & Engineered Hardwood Floors ◆ Laminate Wood Flooring ◆ Nafco Permastone Vinyl Tiles ◆ Congoleum Vinyls, Durastone and DuraCeramic ◆ %LUWKGD\V 8-5 Monday-Thursday, Friday 8-4, or by appointment Stop in our showroom located in the King Construction building! ◆ Iowa Falls ◆ 641-648-5575 NOW OFFERING 95 21 Open 2 Sat.po8in-1 tment by ap Blossom-end rot is probably responsible for the blackish spots on the tomato fruit. Blossom-end rot is a common problem on tomatoes. It appears as a brownish black spot on the blossom-end (bottom) of the fruit. Secondary organisms invade the brownish black spot and cause the fruit to rot. Blossom-end rot is most common on the earliest maturing fruit that ripen in July and early August. %ORVVRPHQGURWLVFDXVHGE\DFDOFLXPGH¿FLHQF\LQWKHGHYHORSLQJIUXLW :LGHÀXFWXDWLRQVLQVRLOPRLVWXUHOHYHOVLPSDLUFDOFLXPXSWDNHE\WKHURRW system of the tomato plant. Excessive nitrogen fertilization also may contribute to blossom end rot. To reduce blossom-end rot, water tomato plants on a weekly basis during dry weather to provide a consistent supply of moisture to the plants (tomato plants require about 1 to 1½ inches of water per week during the growing season). Mulch the area around tomato plants to conserve soil moisture. Avoid over-fertilization. There is no need to apply calcium to the soil, as most Iowa soils contain more than adequate levels of calcium. 641-456-5297 Brent Kotenbrink, Owner 1683 B HWY. 65 NORTH • HAMPTON, IOWA 'RORUHV%XWWMHU Buttjer 90th Greg Giddings - Owner State Licensed Electrical Contractor Welcome Gautam Kakade, M.D., to the Hampton Clinic The fruit on my zucchini squash begin to grow, but quickly turn brown and rot. Why? For squash fruit to develop fully, bees and other pollinators must transport SROOHQIURPPDOHÀRZHUVWRIHPDOHÀRZHUV,IIHPDOHÀRZHUVDUHQ¶WSROOLnated properly, the fruit begin to grow and then suddenly shrivel up and die. Bees and other pollinators are less active in cold, rainy or windy weather. Fruit production may be poor during periods of unfavorable weather. Fruit production also may be adversely affected by the use of insecticides in the garden. Insecticides may kill bees and other pollinators visiting the garden. To avoid harming bees and other pollinators, apply insecticides in the garden only when necessary. Also, apply insecticides in the evening when bees are less active. Startin $ A blackish spot develops on the bottom of my tomato fruit. What is the problem and how can it be prevented? The rotting of the small squash fruit could be due to poor pollination or blossom-end rot. BRENT’S AG & AUTO REPAIR ge Oil Chan l Specia g at +$037217KHUH¶VVRPHWKLQJURWWHQLQWKHJDUGHQDQG'HQQLV&DUOVRQ Franklin County Extension Horticulture Program Assistant, 641-456-4811, [email protected] and horticulturists with Iowa State University Extension and Outreach answer questions about what may be causing those black or brown spots on tomatoes, zucchini and other garden produce. The horticulturists are available through the ISU Hortline to answer additional questions. Contact them at [email protected] or 515-294-3108. 7KH¿HOGGD\LVIUHHDQGRSHQWRWKHSXEOLF,WVWDUWVDWWKH%RUODXJ Pick and discard fruit affected with blossom-end rot. The removal of the /HDUQLQJ&HQWHURQWKH,681RUWKHDVW5HVHDUFK)DUPQHDU1DVKXD'L- affected fruit allows the tomato plant to channel all of its resources into the UHFWLRQV )URP 1DVKXD DWWKH-FWRI +Z\ ([LW DQG &R 5G growth and development of the remaining fruit. B60, go west on B60 1.1 miles to Windfall Ave., then south 1 mile to 290th St., then east 0.2 miles to the farm. For more information about the Blossom-end rot also can occur on pepper, eggplant, summer squash and event, call Terry Basol at 641-426-6801. watermelon. ◆ 1205 N. Oak Yard and Garden: Rot on Tomatoes and Zucchini Come help us celebrate Dolores (Cerwinske) Buttjer’s 90th Birthday with an open house on Saturday August 17, 2013 at the Hampton Community Housing 1309 North Federal from 1-3 p.m. If unable to attend send a card to Dolores Buttjer 1309 North Federal Apartment # 12, Hampton, Iowa 50441. Donald C. Ahrens Ahrens 90th Donald C. Ahrens will celebrate his 90th birthday on Sunday, August 18th. If you would like to send birthday greetings to Don, he would enjoy hearing from you. His address is 1720 Central Ave. East, Room 32, Hampton IA 50441. Blossom-end rot is a physiological disorder that occurs on tomato, pepper, eggplant and summer squash. On zucchini and other summer squash, the blossom end of the fruit begins to rot and within a short time the entire fruit has rotted. Blossom-end rot is caused by a lack of calcium in the developing fruit. In most cases, there is no need to apply calcium to the soil. Try to maintain an even moisture supply by watering once a week during dry weather. Also, do not over-fertilize plants. Uneven moisture supplies and excessive nitrogen inhibit calcium uptake. Reader of the Week Orthopedic Surgeon Now seeing new patients in Hampton. Call (641) 812-1094 for an appointment today. 700 2nd Street Southeast, Suite 101 Hampton, IA 50441 www.IowaSpecialtyHospital.com Kara Raisch 5HDGHURIWKH:HHNDWWKH+DPSWRQ3XEOLF/LEUDU\LV.DUD5DLVFKDJH and going into the 4thJUDGH.DUDLVWKHGDXJKWHURI.ULVWLQD'DQLHO5DLVFK and her favorite books are about kittens, wolves and horses. 5HDVRQ:K\\RXU/LEUDU\LVWKHPRVWLPSRUWDQWSODFHLQWRZQ/LEUDULHVFKDPSLRQSURPRWHDQGUHÀHFWLPSRUWDQWGHPRFUDWLFYDOXHVZKLFKDUH SDUWRIWKHFRPPXQLW\¶VSROLWLFDOOLIH/LEUDULHVSOD\DQLPSRUWDQWUROHLQWKH political life of a community. For example, Banned Books Week displays which combat the perils of school and community censorship efforts. Libraries are pivotal in encouraging informed political involvement. Libraries also help citizens learn how to become advocates for themselves and their communities. SPORTS +DPSWRQ&KURQLFOH6HFWLRQ$ :HGQHVGD\$XJXVW 11 Halloran earns all-state honor By Kristi Nixon DES MOINES – Spencer Halloran of West Fork capped a record-breaking season with a second team all-state nod by the Iowa Newspaper Association announced Tuesday morning. Halloran, a junior, was voted to the Class 2A second team as a catcher. RBI (29). Defensively, Halloran set three more marks, including six wins, 95 strikeouts and tied the record for saves with one. He helped an offensive-minded Warhawk squad to several team records this season. West Fork earned the most wins at 17, runs (189), hits (213), RBI (150), stolen bases (52) and in pitching, they recorded 179 strikeouts and three saves. Halloran was the lone area player recognized by the INA in Class 2A. 2013 Iowa Newspaper Association All-State Baseball CLASS 2A First Team Pitchers – Chris Halbur, sr., Carroll Kuemper; Jacob Hadaway, sr., North Polk; Joey Lehmann, sr., Dyersville Beckman. Catcher – Jake Lewis, sr., Council Bluffs St. Albert. First Base – Jared Manternach, sr., Cascade. ,Q¿HOGHUV – Casey Berg, sr., IKM-Manning; Dylan Preston, Spencer Halloran jr., Clayton Ridge-Central; Alec A versatile player, the Warhawks Sorensen, sr., Treynor. used him in several capacities this 2XW¿HOGHUV – Jimmy Hawk, sr., VHDVRQ LQFOXGLQJ SLWFKHU RXWÀHOGHU Council Bluffs St. Albert; Tanner and shortstop in addition to his best Felton, jr., Monticello; Kolby Hilgenberg, sr., Carroll Kuemper. position, behind the plate. +H VHW ÀYH RIIHQVLYH UHFRUGV Utility – Cole Crawford, sr., for coach Chris Rogne’s squad, Wilton; Justin Shaffer, sr., Durant. 6HFRQG7HDP including batting average (.541), runs (36), hits (46), doubles (14) and Pitchers – Korey Kuhlman, so., Maple Valley-Anthon-Oto; Zach Hovick, jr., Roland-Story; Hunter %HUJ¿HOGVU&DVFDGH Catcher – Spencer Halloran, jr., West Fork. First Base – Gage Carpenter, sr., Wapello. ,Q¿HOGHUV – Ian Ross, sr., Dyersville Beckman; Jared Riemenschneider, sr., West Marshall; Christian Bambrook, sr., Eddyville-BlakesburgFremont. 2XW¿HOGHUV – Brett Leshen, jr., Albia; Reed Smith, jr., North Polk; Ben Chapin, so., Treynor. Utility – Jacob Webb, sr., Central Springs; Cole McDonald, so., New Hampton. 7KLUG7HDP Pitchers – Brandon Stoll, sr., Spirit Lake; Sawyer Doocy, sr., North Union; Isaac Tuttle, sr., Forest City. Catcher – Brandon Lincoln, sr., Wapello. First Base – Nick Gantt, sr., Council Bluffs St. Albert. ,Q¿HOGHUV – Jordan Rommes, so., South Winneshiek; Jake Alexander, sr., Colfax-Mingo; David Hogue, sr., Shenandoah. 2XW¿HOGHUV – Charlie Marcucci, jr., Northeast; Austin Croson, sr., Wilton; Jake Brinkman, so., Iowa City Regina. Utility – Austin Gehl, sr., Cascade; Grant Lang, jr., North Polk. Sietsema earns district, state honors DES MOINES – Following an outstanding senior golf season, Hampton-Dumont’s 0DGLVRQ 6LHWVHPD HDUQHG ÀQDO honors by the state. The Iowa Girls Golf Coaches Association selected Sietsema to second team all-state. The Iowa Girls Coaches Association also named Sietsema to the Class 3A North Central All-District team. Swieter track coach of year at Prairie Valley 7 SPENCER HALLORAN 2nd Team All State Catcher GOWRIE – Mike Swieter, a 1992 graduate of HamptonDumont High School, was named the 2013 Twin Lakes Conference coach of the year this spring. He led Prairie Valley to its ÀUVW FRQIHUHQFH DQG GLVWULFW championship and had 10 events advance to the state track meet. Swieter is the son of Dennis and Connie Swieter, Hampton. 2013 CAL Baseball 2013 (L-R) Front row: Karter Miller, Jessica Heiserman, Gabby Gomez, Jenna Johnson. Middle row: Clarissa Gomez, Emily Quinones, Sidney Turner, Rachael Arnold, Dianna Porzio, McKayla Drake. Back row: Head coach Mikyla Hefti, Stephanie Thielen, Kaylea lyn y Arthur,, Hannah Lohrbach Lohrbac and assistant coach Shannon Muhlenbruch. Rew, Katlyn Members of the CAL Baseball Team are: Juan Carlos Calles, Juan Trinidad, James Yerman, Matt Miller, Miguel Calles, Juan Gomez, Zach Vanness, Hunter y Moricz. Schleisman, Logan Woolery, Eli Dohrmann, Ben Fahrmann,, Dylan Member FDIC IC LATIMER • 579-6240 Alexander 641-692-3258 8 579-6146 LATIMER INSURANCE HAMPTON C AN H IOWA R NEWSPAPER O N ASSOCIATION I AWARD C WINNING L E NEWSPAPER 9 2nd St. NW • www.hamptonchronicle.com • 641-456-2585 PRALLE’S W ASH C ITY HAMPTON 2 LOCATIONS | COULTER PRALLE’S M ACHINE & W ELDING COULTER • 641-866-6889 SOFTBALL TEAM INFORMATION: Overall record: 3-19 Conference record: 2-11, tied for eighth First team all-conference: Karter Miller, infielder Second team all-conference: Jenna Johnson, infielder Honorable mention: Jessica Heiserman, catcher BASEBALL TEAM INFORMATION: Overall record: 2-20 Conference record: 2-13, tied for eighth Second team all-conference: Ben Fahrmann, outfielder Honorable mention: Eli Dohrmann, utility FRIENDS SERVING FRIENDS DUGGER FUNERAL HOMES LATIMER • 641-579-6278 LA L DOWS • 515-852-4134 BELMOND • 641-444-3248 FARMERS COOPERATIVE COMPANY DOWS & ROWAN E. Ellsworth • Dows 515-852-4136 641-579-6199 664 204 AKIR LATIMER Corner Market LOCALLY OWNED Hours: Mon.-Fri. 6:30 a.m.-6:30 p.m. • Sat. 7:30 a.m.-2 p.m. • Sun. 10 a.m.-2 p.m. 579-6314 Latimer Muhlenbruch Insurance 515-852-4156 WATER AND SEWER SYSTEM SPECIALISTS KENT MORTON - OWNER 1-800- HEY MORT 641-579-6500 • Well & Pump Systems • Backhoe ~ Trenching • Sewer Systems • Water Conditioning • Plumbing www.kinetico.com www.mortsonline.com LATIMER, IA 12 SPORTS :HGQHVGD\$XJXVW +DPSWRQ&KURQLFOH6HFWLRQ$ Miller to first team all-Iowa Star $VKOH\ 6LFDUG DQG (OOD )UD]LHU ULJKW KLJK ¿YH LQ EHWZHHQLQQLQJVDWWKHVWDWHVRIWEDOOWRXUQH\ LATIMER – CAL shortstop .DUWHU 0LOOHU HDUQHG ÀUVW WHDP all-conference in the Iowa Star announced recently. Miller, who batted second in WKH OLQHXS ÀQLVKHG ZLWK D batting average with 10 RBI and KDGDÀHOGLQJSHUFHQWDJHRI Second team honors went to LQÀHOGHU -HQQD -RKQVRQ ZKR started all 22 games for the Cadets 0DULR3HxDVHWVDQHZ+'EHQFKSUHVVUHFRUGDWSRXQGV6XEPLWWHGSKRWR with a .295 batting average. Catcher Jessica Heiserman earned honorable mention. 2013 Iowa Star Conference Softball First Team Pitchers – Kimberly Wedeking, 6U&ODUNVYLOOH0ROO\*UHHQ¿HOG Sr., Northeast Hamilton*. Catchers – Megan Backer, Sr., Clarksville*; Jennifer Williams, Sr., Northeast Hamilton*. ,Q¿HOGHUV – Isabella Vance, Jr., Clarksville*; Emily Mennenga, Jr., Clarksville; Mary Hovenga, Jr., Janesville*; Jenn Jeffers, Sr., Northeast Hamilton*; Karter Miller, Jr., CAL. 2XW¿HOGHUV – Hannah Faust, So., Clarksville*; Victoria Leyh, Jr., Janesville; Bailey Epling, So., Dunkerton. Utility – Kendyl Sorge, So., Janesville. 6HFRQG7HDP Pitcher – Aubrey Duncan, Jr., Dunkerton*. Catcher – Katy Harp, So., Janesville. ,Q¿HOGHUV – Alecia Kimbell, Fr., Dunkerton; Leah Meyer, So., Northeast Hamilton*; Destiney Christopher, Jr., Janesville; Jenna Johnson, Jr., CAL. 2XW¿HOGHUV – Kayla Mennenga, Sr., Clarksville; Dani Reicherts, Fr., Dunkerton; Katie Watson, Sr., Janesville. Honorable Mention Brittney Litterer, Clarksville, Fr.; Morgan Boeschen, Sr., Dunkerton; Shelby Schnurstein, So., Janesville; Jaidyn Timm, Jr., Northeast Hamilton; Jessica Heiserman, Sr., CAL. * denotes unanimous selection AGWSR Peña,Wenzel lead H-D Hardcores in weightlifting meet at Prairie Valley GOWRIE – Hampton-Dumont’s Mario Peña and Justin Wenzel HDUQHG ÀUVW SODFH IRU WKH +DPSWRQ Dumont Hardcores weightlifting team at the Annual Prairie Valley Open Weightlifting championships. The event, which took place on Saturday, March 16, included 25 Bulldogs. Peña, competing in the 275-pound class, headlined the day for the Bulldogs with a 300-pound bench press, setting a new H-D record previously held by Dan Knipfel (290 pounds). :HQ]HO WRRN KRPH ÀUVW SODFH honors in the 242-pound class with a trap bar dead lift of 475 pounds. Another record was set in the bench press as Derek Juhl set a new freshman record with a 230-pound lift, receiving runner-up in the 220-pound class. Also earning runner-up honors in bench press were Trevor Craig at the 123-pound class, Wenzel, 242-pound class; and Cody Anderson, heavyweight. Six Bulldogs took home runner-up honors in the trap bar dead lift, including Craig, Levi Pratt (148-pound class), Brandon Westendorf (165-pound class); Juhl, Peña and Josh Knipfel, heavyweight. Host school Prairie Valley were the team champions in the bench press with H-D and Cherokee tying for second. Prairie Valley also won the trap bar dead lifting team championship. All H-D Hardcores had personal best lifts in both the trap bar dead lift and bench press. Wenzel was voted Mr. Intensity of the meet for the second consecutive year. Coaches Dennis Swieter and Jerry Shafrath would like to thank Matt Abbas, team statistician; Dan Hoy, announcer; Jerry Kaldenberg, battery to all-district team ACKLEY – The AGWSR battery of Ashley Sicard and judge; Andrew Benning, team Janna Winters and Connie Swieter, Ella Frazier were recently named captain who didn’t lift because of meet statisticians and Colt Powers, to the Iowa Girls High School Athletic Union Class 2A allinjury; Jeff Winters, videographer; manager. district team. Sicard, a pitcher, and Frazier, catching, were the only area nods by the IGHSAU in the Central District. The two led the Cougars to the Class 2A consolation championship, won the NICL West and a record of 29-8. While batting .346 offensively, Sicard kept hitters at bay in the circle with a 29-5 record. She recorded an ERA of 0.72 and struck out 246. 7KH+'+DUGFRUHVLQFOXGHGIURQWURZIURPOHIWFRDFK'DQ6ZLHWHU 'UHZ$EEDV-XVWLQ:HQ]HO$QGUHZ%HQQLQJ/HYL3UDWW0DULR3HxD Frazier, a senior, was &KDFH.OHLQ6HFRQGURZMXGJH-HUU\.DOGHQEHUJ.\OH2¶%ULHQ formidable behind the plate, %UDQGRQ:HVWHQGRUI'HUHN-XKO.HQGULFN6XQWNHQ$LGDQ&DUU7KLUG catching six-of-seven would-be URZ&ROH0LOOHU7UHYRU(LNOHQERUJ,VDLDK1RHOFN&ROHWRQ%DU]%HQ 9DQ+RUQ&KDUOLH)OLFNLQJHU/RJDQ&KLSS)RXUWKURZ&KULV&DUVWHQV base stealers against her – the &RUELQ-REH+XQWHU*UDQW-RVK.QLSIHO-RKQ.UXOO&RG\$QGHUVRQ only successful attempt coming %DFNURZ&RDFK-HUU\6KDIUDWKWHDPVWDWLVWLFLDQ0DWW$EEDV7UHYRU in the state tournament against &UDLJ&ROW3RZHUVDQGPDQDJHU&ROW3RZHUV6XEPLWWHGSKRWR Treynor. Offensively, Frazier hit .388 for the Cougars, driving in 25 this will be the last Run/Ride/Walk/ DYDLODEOH IRU SXUFKDVH IRU IRU runs from the lead-off spot in the DGXOWVL]HVDQGIRU\RXWKVL]HV :DJ5DIÁHHYHQW order. Registration on event day will be “We will continue to support Terry Wedmore Memorial Run, Ride, Walk or Wag to be held Aug. ROCKWELL – The 10th annual Terry Wedmore Memorial Run, Ride, Walk or Wag will be held on Saturday, Aug. 31 at Zeidler Park in Rockwell. This year’s theme is “We’ve Fought For 10 … We’ll Fight ‘Til We Win.” This event is organized to honor and remember Terry Wedmore, a former Mercy Medical Center – North Iowa associate. Proceeds raised from the event will support Mercy Cancer Center services, cancer research and education. The event has activities for everyone in the family – a 5K race, 2-mile walk or wag, a 10-mile bike ride, a children’s fun run for children under the age of 8, a general store with home baked goods for sale, and D EDVNHW UDIÁH IRU QXPHURXV WKHPH baskets. Pre-registration by Friday, Aug. 16 is recommended to ensure an event T-shirt. It is with mixed emotions that the Wedmore Family announced that WEEKLY PRO RACING UPDATE Racing News, Stats & Trivia cancer patients, education and research in other ways,” the family said. “Thank you so much for your VXSSRUW DQG NLQGQHVV LQ RXU ÀJKW against cancer the past 10 years.” Registration forms can be found on Mercy – North Iowa’s website www.mercynorthiowa.com under View All Services, then Cancer Center. 7LFNHWVIRUWKHUDIÁHDUHHDFK RU IRU VL[ DQG FDQ EH SXUFKDVHG by calling Mercy Foundation at 641428-7740 or the Wedmore Family at 641-822-3225. Event T-shirts are held from 7:45-8:30 a.m. with the bike ride beginning at 8:45 a.m. and the walk or wag following. Everyone has a family member RUIULHQGÀJKWLQJDFDQFHUGLDJQRVLV and this is an opportunity to have IXQZKLOHVXSSRUWLQJWKHLUÀJKWDQG offering hope against a horrible disease. Contributions for the event may be made to Mercy Foundation and mailed to: Marsha Wedmore, P.O. Box 109, Rockwell, Iowa 50469. For more information on this event, contact Marsha Wedmore at 641822-3225. 2013 Standings Cheez-It 355 at The Glen 2013 Sprint Cup Series 1) Jimmie Johnson Points: 772 Wins: 4 Top 5: 9 Top 10: 14 2) Clint Bowyer Points: 695 Wins: 0 Top 5: 7 Top 10: 11 3) Carl Edwards Points: 688 Wins: 1 Top 5: 6 Top 10: 10 4) Kevin Harvick Points: 675 Wins: 2 Top 5: 5 Top 10: 11 5) Dale Earnhardt Jr. Points: 656 Wins: 0 Top 5: 5 Top 10: 12 Track Details Location: Watkins Glen, N.Y. Shape: Road Course Distance: 2.45 miles Banking: None Last Year’s Pole Winner: Juan Montoya 127.020 Last Year’s Winner: Marcos Ambrose 6) Kyle Busch Points: 646 Wins: 2 Top 5: 9 Top 10: 13 7) Matt Kenseth Points: 638 Wins: 4 Top 5: 5 Top 10: 11 8) Kasey Kahne Cheez-It 355 at The Glen Preview Watkins Glen International is a 2.45 mile road course located near Watkins Glen, New York, at the south end of Seneca Lake. With its rise from ragged infancy in 1948 to its position as America’s premier racing facility, the Glen is an astounding success story which continues sixty five years later. In addition to holding major NASCAR and SCCA events, Watkins Glen also hosts one of the nation’s premier vintage events, the Zippo U.S. Vintage Grand Prix. Current points leader, Jimmie Johnson, finished second in last year’s race. Last weekend’s winner, Kasey Kahne, finished 13th. Points: 612 Wins: 2 Top 5: 7 Top 10: 9 9) Jeff Gordon Points: 602 Wins: 0 Top 5: 5 Top 10: 9 2013 Nationwide Series Driver 1) Austin Dillon 2) Regan Smith 3) Sam Hornish Jr. 4) Elliott Sadler 5) Brian Vickers 6) Kyle Larson 7) Justin Allgaier 8) Brian Scott 9) Trevor Bayne 10) Parker Kligerman Racing News Last week NASCAR announced an expansive 10-year media partnership with NBC Sports Group that will begin in 2015. The deal takes over for ESPN and ABC, which had the rights to most of the late-season NASCAR races. NBC will air seven Sprint Cup races per season beginning in 2015, and it has already been hinted that those races will air on football Sundays. They also won the rights to the second half of the Nationwide Series season and NBC will air four of those races per year. NBC Sports Network will air the other 13 Sprint Cup races and 15 Nationwide Series races per season. Racing Trivia 10) Greg Biffle Points: 599 Wins: 1 Top 5: 3 Top 10: 8 11) Tony Stewart Points: 594 Wins: 1 Top 5: 5 Top 10: 8 12) Brad Keselowski Points: 592 Wins: 0 Top 5: 6 Top 10: 10 Points 698 684 684 679 670 651 648 641 627 617 Which driver won the first NASCAR event at the Glen? a) Buck Baker b) Fireball Roberts ? c) Richard Petty d) Darrell Waltrip Answer : a) Buck Baker won the 1957 race at Watkins Glen. Baker went on to win the driving title that season as well. August 11th, 1:00 pm ET Watkins Glen International Class 2A Central All-District Kendall Scurr, Jr., BCLUW; $VKOH\6LFDUG6R$*:65 Delany Bice, Fr., WoodwardGranger; Hope Connor, Sr., Van Meter; Maddie Wagner, So., Des Moines Christian; (OOD)UD]LHU 6U$*:65 Bailey Richards, Fr., Van Meter; Taylor Bell, Sr., Madrid; Allie Oberg, Sr., Fort Dodge St. Edmond; Lexie Miller, Sr., Eagle Grove; Sarah McCoy, Sr., BCLUW; Nikki Boomgarden, Sr., North Butler; Ana Angel, Jr., Van Meter; Taylor Hoffman, Sr., Panorama; Kassidy Rewoldt, Sr., South Hardin; Taylor Flamme, Sr., Gladbrook-Reinbeck; Maggie Harvey, 8th grade, Fort Dodge St. Edmond; Brittany Nicholson, Sr., South Hamilton; McKenna Hotopp, Sr., West Marshall; Emma James, Jr., Des Moines Christian; Julia Evans, Sr. Woodward-Granger. Last Weekend’s Race: Kasey Kahne wins GoBowling.com 400 at Pocono Raceway Driver Start Finish Points/Bonus Kasey Kahne 18 1 48 Jeff Gordon 22 2 43 Kurt Busch 5 3 42 Ryan Newman 4 4 41 Dale Earnhardt Jr. 25 5 40 Brad Keselowski 11 6 39 Joey Logano 6 7 37 Kyle Busch 2 8 36 Tony Stewart 20 9 36 Greg Biffle 7 10 34 Taking advantage of a caution, Kasey Kahne buried his car into Turn 1 with two laps left and grabbed a win from Hendrick Motorsports teammate Jeff Gordon in Sunday’s GoBowling.com 400 atPocono Raceway. Kahne picked up his second victory of the season, all but assuring a berth in the Chase for the NASCAR Sprint Cup. It was his second at Pocono and the 16th of his career. Gordon ran second, 1.392 seconds behind his teammate, followed by Kurt Busch. Kahne gained one position to eighth in the Cup standings. The second victory gives him a substantial degree of comfort, given that no driver in contention for a Wild Card spot has more than one victory. Pro Racing News is brought to you by: Auto Parts Wholesale 641-456-2594 Northland Oil • Wix Filters • Raybestos Brakes 621 4th St. SE • Hampton Driver of the Week Kasey Kahne #5 Born: April 10, 1980 Crew Chief: Kenny Francis Car: Chevrolet Year 2013 Career Wins 2 16 Top 10s 9 130 Avg. Finish 15.6 17.3 Scan this QR code to get more race results and news 6WRFNFDUUDFHUV$OH['RKUPDQQ-HUHP\&KULVWHQVHQDQG.XUW:LONLQVRQVWDQGE\WKHFKHFNHUHGÀDJDIWHU WKHUDFHDW2VDJHRQ)ULGD\QLJKW Alex Dohrmann wins stock race at Osage OSAGE – Hampton’s Alex Dohrmann won the stock car race at the Figure 8 races held at Osage on Friday night. Hampton nearly made it a 1-2-3 sweep at Kurt Wilkinson took third in the event. Jeremy Christensen of Nashua was the runner-up. Other winners at Osage were Ed Putney of Charles City in the small car race, Ron Hillegas of Charles City in the pro stock event, Don Wauters of Altoona in the open class and Clarksville’s Jeff Wedeking and Trevor Vance in the cruiser division. The next races are Saturday, Aug. 10 at Allison. Osage Figure 8 Results Small Car – 1. Ed Putney; 2. Adam Hanson; 3. Derek DeZarn. Stock Car – 1. Alex Dohrmann; 2. Jeremy Christensen; 3. Kurt Wilkinson. Pro Stock Car – 1. Ron Hillegas; 2. Ed Johnson; 3. Anthony Marshall. Open Class – 1. Don Wauters; 2. Duane Zander; 3. Rich Akin. Cruisers – 1. Jeff Wedeking/ Trevor Vance; 2. Megan Furman/ Jesse Mollenbeck; 3. Nate O’Neil/Nick Aswegen. 2013 H-D Members off the th H H-D D Softball Team are: (L-R) First row: Kate Meader, Crystal Peterson, Caitlin Dombrowski, Amanda Mast, Taryn Kline, Taryn Barz, Catie Corsello, Charlie Ann Meyers, Mallory Wohlford. Back row: Gabby Brown, Shelby Tidman, Whitney Ringleb, Lexi Sorenson, Katie Moritz, Morgan Kalkwarf, Maddie Mason, Macy Scheideman, Ashlyn Hansen. Members of the H-D Baseball Team are: (L-R) First row: Cole Miller, Dalton Hanson, Drew Heuberger, Anthony Schnabel, Mitch Vetter, Spencer Tidman, Eduardo Zamora, Brett Janssen, Charlie Flickinger. Back row: head coach Matt Lokenvitz, Michael Vicente, Kyle Kent, Levi Pratt, Bailey Miller, Cesar Baez, Brandon Westendorf, Nate White, Trevor Eiklenborg, assistant coach Mike Holm. SOFTBALL TEAM INFORMATION: 641-857-3211 506 Pine Street RICK’S QUALITY PHARMACY SERVICE 641-456-3538 INTEGRITY HAMPTON MILLER’S ALIGNMENT Brian Miller, Owner 8 2ND ST. SW HAMPTON 641-456-5776 HOURS: MON.-FRI. 8 A.M.-5 P.M. JASPERSEN Insurance & Real Estate, Ltd. 641-456-2266 www.jaspersenltd.com HAMPTON • SHEFFIELD • THORNTON • BELMOND • GARNER 641-456-2827 www.franklinwellness.com Overall record: 9-15 DUMONT Franklin Wellness Center 1514 Central Ave. E HAMPTON North Central Conference record: 6-12, seventh HAMPTON SHEFFIELD 641-456-2372 641-892-4791 Second team NCC: Madison Mason, infielder Third team NCC NCC:: Taryn Barz & Taryn Kline BASEBALL TEAM INFORMATION: Overall record: 12-16 Hours: Mon.-Wed.-Fri. - 8:30 - 12:00 • 1:00 - 6:00 Tues. - Thurs.- Sat. - 8:30 - 12:00 820 Hwy 65 N. HAMPTON 641-456-2280 Koenen & Collins North Central Conference record: 5-13, ninth Chiropractic Clinic Dr. James Koenen, Dr. Chad. A. Collins 303 Central Ave. E. HAMPTON 641-456-4142 SEVEN STARS FAMILY MILY RESTAURANT BREAKFAST • LUNCK • DINNER Open 6:30 am-8 pm Tues. thru Fri. Sat. & Sun. 7 am-8 pm HWY 65 SO. 641-456-5378 Member FDIC HAMPTON MPTON www.ubtc.net MEMBER FDIC United in YOUR Success 641-456-4793 • firstbankhampton.com Alden Hampton Dougherty 6KHI¿HOG Dows JEFFREY A. JAACKS, LPA Dumont Implement nt Licensed Public Accountant HWY. 3, DUMONT HAMPTON 456-2737 641-857-3216 7-3216 3 - 1st St. SW HAMPTON 641-456-4125 HAMPTON C A Division of Winfield Solutions 1280 Imperial RD. HAMPTON AN 641-456-2500 6-2500 641-857-3842 2 HAMPTON Fire & Water—Cleanup & Restoration Nationally Known—Locally Owned CARPET CLEANING 1-866-950-3633 or 641-456-3633 improving the quality of your life John F Rowe, AAMS® Financial Advisor 1202 4th Street NE Hampton, IA 50441 Hwy 65 N. www.franklinrec.coop Hampton www.edwardjones.com 515 Main St. Dumont 641-857-3287 nd 116 2 Ave. NW 641-456-4580 E 641-456-2534 • 1-800-568-4156 HWY 65 N. HAMPTON 641-456-4465 13 1st St. SW HAMPTON Steven E. Pearson C.P.A. HAMPTON 641-456-4829 For all your buildings supplies... Pole Buildings, New Homes, Additions, Roofing, remodels... We do it all! HWY. 65 N. Roger & Kaye Peters 641-456-4711 or 1-800-595-4711 801 4th St. S.E. HAMPTON HAMPTON Sackville Insurancee www.Sackvilleinsurance.net M-G Floor Decor Mike & Gwen Thornburgh L NEWSPAPER 641-456-5205 (MID:COM) 641-456-4802 (MIDWEST METER) 641-456-4946 Toll free 877-456-4946 C WINNING Midwest Meter/MID:COM M 641-456-5521 MAKING SENSE OF INVESTING We move the furniture for you! I AWARD DUMONT T 641-456-2594 Drapes • Area Rugs • Furniture Upholstery or any other cleaning task N DUMONT HARKEN LUMBER 641-456-3242 621 - 4th St. SE O ASSOCIATION Do iit best with Highway 3 & 65 Kent Wheeler Store Manager R NEWSPAPER 9 2nd St. NW • www.hamptonchronicle.com www.ham • 641-456-2585 Crossroads of Hampton ton AUTO PARTS, INC. H IOWA Keith’s Auto & Truck Clinic 808 1st St. NW HAMPTON 641-456-3573 Retail Store 641-456-3171 Pharmacy 641-456-2510 Grocery 456-5253 Meat 456-2756 56 HAMPTON, IOWA WELDIN’S AUTO BODY DY Chad Robertson - Owner We Do Paintless Dent Repair! Full Auto Glass Service ervice 641-456-4444 “Full Line Pharmacy” FGH Pharmacy • 641-456-4146 104 1st St. NW DOWNTOWN HAMPTON Appliance • TV Sales & Service Traeger Grills • Electrolux Vacuums 641-456-2503 14 1st St. N.W. HAMPTON MON.-FRI.: 9 A.M. TO 6 P.M.; SAT.: 9 A.M. TO NOON FROM YOUR NEIGHBORS Flag pole gets a new paint job 14 +DPSWRQ&KURQLFOH6HFWLRQ$ :HGQHVGD\$XJXVW /RFDOWUDFWRUULGLQJOHJHQG5D\%DOWHVVKRZQKHUHDWWKH )UDQNOLQ &RXQW\ )DLU ORYHV VKRZLQJ RII KLV DQWLTXH WUDFWRUV while cruising the roads of Franklin County. Chances are, he'll EHLQWKH./0-.4&5$QWLTXH7UDFWRU3DUDGH6DWXUGD\VWDUWLQJ LQ%ULVWRZ -LP6WDDWVRI&ROXPEXV-XQFWLRQ¿QLVKHVXSSDLQWLQJWKHPDLQ ÀDJSROH RXWVLGH WKH )UDQNOLQ &RXQW\ &RXUWKRXVH RQ -XO\ Photos by Jeff Forward 6WDDWV VDLG KH SDLQWV WKH ÀDJSROH ³ZKHQ LW QHHGV LW´ ZKLFK LV usually every couple of years. APPLIANCES Samsung • Frigidaire Speed Queen Bosch • Panasonic Traeger Grills Electrolux Vacuums Appliance • TV Sales & Service Traeger Grills • Electrolux Vacuums CONSTRUCTION PHOTOGRAPHY ALL TYPES OF GENERAL CONSTRUCTION ADAMS CONCRETE & CONSTRUCTION Larry Adams, Owner STUDIO, INC. 641-456-2503 BEAUTY SALONS Box 416 CHAPIN, IA 50427 (319) 347-5518 Phone 641-892-4487 ELECTRICAL www.vossstudio.com We Make Memories TREE TRIMMING & REMOVAL CRAIGHTON ELECTRIC Kari Behn - Owner, Stylist Sarah Behn - Stylist 641-456-4465 13 1st St. SW •HAMPTON COMPUTER SALES & SERVICE RESIDENTIAL, AG & COMMERCIAL INSTALLATION AND REPAIR 1446 220th Street Sheffield, Iowa 50475 Kevin Craighton Phone: (641) 892-8038 Owner Cell Phone: (641) 425-2606 Licensed & Insured • Tree & Stump Removal • Trimming - Firewood • Building Repair • 65’ Aerial Reach • Fully Insured “Let Us Reach Out For You!” TROPHIES & AWARDS WORLD DATAQUEST OF TROPHIES Computer Sales & Service Upgrades • Software On Site Training 641-456-5525 [email protected] Delbert Hamilton Latimer, IA Phone: 641-579-6246 End Your Quest With Dan Grell 1223 Mallard Ave. Hampton, IA WEDDINGS FAMILIES CHILDREN PETS • FRAMES WEDDING SUPPLIES INSTANT PASSPORTS Austinville, Iowa 50608 Mon.-Fri.: 9 a.m. to 6 p.m.; Sat.: 9 a.m. to Noon 14 1st St. N.W. HAMPTON Antique tractor parade slated for Saturday morning ALL AWARDS THELMA DONALDSON 409 2nd Ave. S.E. Hampton, IA Phone & Fax 456-2013 Open Mon. - Fri. 10 a.m. - noon & 1 p.m. - 5 p.m. Appointment only Sat. & Sun. COMPUTER SALES & SERVICE WATER • SEWER • PLUMBING • HEATING • A/C Butler County Computers Kent Morton Owner For All Your Computer Needs!!! • New & Used Computers • Maintenance • Repairs • Upgrades • Training • Networking 303 N. Main, Allison, IA 50602 Phone: 319-267-2508 Fax: 319-267-2515 E-mail: [email protected] 1410 Gull Ave. • Latimer, Iowa 505 Industrial Rd. • Iowa Falls, Iowa 641-579-6500 641-648-2595 www.mortsonline.com www.kinetico.com Your Local Authorized Independent Kinetico Dealer 1-800-HEY MORT www.geocomfort.com 800-579-MORT By Jeff Forward ,W¶VQRVHFUHWWKDWIRONVLQ+DPSton and all over Franklin County love their tractors. :KHWKHU LW¶V D )DUPDOO D -RKQ Deere, or another brand of reliable machinery used for working the ¿HOGV RU MXVW GULYLQJ DURXQG WRZQ IRU IXQ OLNH WKH LQGRPLQLWDEOH 5D\ %DOWHVLW¶VVDIHWRVD\WUDFWRUVDUHELJ time in this area. 7KDW¶V ZK\ WKLV 6DWXUGD\¶V $Qtique Tractor Parade, sponsored by UDGLRVWDWLRQV./0-DQG.4&5ZLOO be so fun. Craig Donnelly, of KLMJ and .4&5 VDLG WKH HYHQW KDV JURZQ each year and, now in its 11th year, will likely feature more than 100 different tractors. ³:H¶UHH[SHFWLQJRYHU5LJKW now, we have 94 pre-registered,” Donnelly said on Monday. “Guys can still sign up that day. We have drivers from four states – Wisconsin, Arizona, Iowa, and Minnesota – and we have drivers from 22 counties.” The parade is slated to begin in Bristow, after a breakfast open to the public that is being held from 6-8:30 a.m. The tractor parade will depart Bristow and head to Aredale and then Hansell, where a break will be taken from 10 a.m. to 10:30 a.m. The tractor parade will continue and eventually wind around Beeds Lake before stopping for lunch at the annual SummerFest in Hampton between noon and 1:30 p.m. After that break, the parade will continue on through Geneva and 'XPRQW EHIRUH ¿QLVKLQJ EDFN LQ Bristow – going an estimated 57 miles or so, Donnelly said. The parade is open only to tracWRUVPDGHSULRUWRDQGLW¶VH[pected the oldest tractor will be a 1940 John Deere “L” model driven by Keith Traeger of Eagle Grove. ³,W¶VDELJGD\´'RQQHOO\VDLG Applications will be taken up to the morning of the parade and are available at www.klmj.com; or at tractor parade sponsors Countryside Turf and Timber in Iowa Falls; Dumont Implement Company; FC Elevators; Franklin County Farmers Mutual Insurance Association in Hampton; Center One; Latham HiTech Seed in Alexander; North Central Millwright and Buresh Building Systems; the North Iowa Cooperative in Thornton; and MidwestMeter/Mid:Com in Hampton. For more information, contact ./0-.&45 $QWLTXH 7UDFWRU 3Drade Coordinator Mandy Strother at 641-456-5656 or email mandy@ klmj.com. NEIGHBORS/PUBLIC NOTICES +DPSWRQ&KURQLFOH6HFWLRQ$ :HGQHVGD\$XJXVW 15 People in the Park on Aug. 24 in Sheffield 0DUN \RXU FDOHQGDU 6KHI¿HOG¶V annual BBQ Contest is quickly DSSURDFKLQJ 7KLV \HDU 6KHI¿HOG Betterment Foundation and Shef¿HOG $UHD &RPPXQLW\ &OXE DUH joining forces; Saturday Aug. 24 has been set aside for People in the Park. City park will feature an entire day of activities, including an omelet breakfast, parade, bean bag tournament, kids activities and an evening concert featuring The Hepperly Band and ending the HYHQLQJ ZLWK D ¿UHZRUNV GLVSOD\ Highlights of the afternoon will be face painting by Joan Estland, if you remember last year she does some amazing painting and anyone wanting to have their face painted will need to get signed up as early as possible. Also the Iowa National guard will be here with a climbing wall and jousting, fun for kids of all ages. Also returning will be the pig and chicken catching for the kids. Another very popular activity is the BBQ grilling contest. Contestants grill and smoke their favorite PHDWVWKHQDUHMXGJHGRQWKHLU¿Qished products. There are also categories for salsa and chili. Teams of judges sample various entries and cash prizes are awarded to the winners. All contestants provide free samples to anyone attending People in the Park. The samples are very generous: no one will leave WKHJULOOLQJDUHDKXQJU\ Contestants are urges to reserve their place in the grilling contest early. There is no cost to participate. Call Deb Hartman at 641892-4723 for more details and to register for the grilling contest. This year the proceeds from the Bean Bag Tournament will go towards the West Fork Fitness CenWHU:HVW)RUN:HLJKW5RRP7KH West Fork Fitness Center will be holding an open house on Saturday Aug. 24 from 9:30 a.m. – 12 p.m. to showcase the new equipment that has been purchased. 7KH6KHI¿HOG %HWWHUPHQW)RXQdation was founded in 2009 by area residents with the Mission 6WDWHPHQW ³7KH 6KHI¿HOG %HWWHUPHQW¶V )RXQGDWLRQ¶V JRDO LV WR fund community projects through grants, donations, and fundraisers. Our sole purpose is to make our UHVLGHQWV KDSS\ WR FDOO 6KHI¿HOG KRPH´$QG 6KHI¿HOG$UHD &RPmunity Club has been on organi]DWLRQVXSSRUWLQJ6KHI¿HOGDQGWKH NLGVRI6KHI¿HOG The city and county had seemingly had an agreement earlier in the spring to join forces on the dispatching front – currently operated out of the Hampton Police station – but a dispute about the hiring and EHQH¿WVRIWKHGLVSDWFKHUVDWWKHQHZ dispatch center led to an agreement being called off. Because the new dispatch center would be housed in the county Law Enforcement Center and the dispatchers would be employees of the Emergency Management Commission – which is funded by the county – they would become county employees instead of city employees. 2I¿FLDOVIURPWKHFLW\RI+DPSton and members of the Hampton City Council wanted the four city dispatchers to merely transfer from their jobs at the city directly to coun- ty employment with their seniority in place as far as salary, vacation WLPHDQGEHQH¿WV That is where the discussions stalled, as members of the Franklin County Board of Supervisors were unwilling to guarantee hiring of the four. Instead, the supervisors claimed they needed to follow state law regarding hiring practices and advertise the new positions, hold interviews, and hire the best candidates. Supervisors were also not willing – if they did hire a city dispatcher – to transfer their seniority in VDODU\ EHQH¿WV DQG YDFDWLRQ WR WKH county payroll. These decisions seemingly irritated many members of the Hampton City Council, who want the four dispatchers hired automatically and be JLYHQ WKHLU VDPH OHYHOV RI EHQH¿WV vacation and pay as they currently have at the city. “The city has its viewpoint and the county has its viewpoint,” Dunt said of the dispute. “They obviously DUHQ¶WPHVKLQJ7KHLGHDRIDPHHWing with the attorneys is to get the Schedule of events 7:00 a.m. Omelet Breakfast @ Sheffield Inn (Library Foundation) 7:00 a.m. City Park Opens for Grillers to Begin 8:00 a.m. Tractor Plowing 10:30 a.m. Parade 11:30 a.m. Lunch/Dignitary Awards/Little Miss & Mister Sheffield 12:00 p.m. Begin Bean Bag Tournament, Terry Nierengarten 641-425-2083 (Pro ceeds will go towards updates to the West Fork Weight Room) Beer Garden Opens Vendors Selling: Bars, Godfathers Pizza, Corn Dogs, Funnel Cakes, Pick les, cotton Candy, Popcorn, Pop, Water, Hand Squeezed Lemonade. 1:00-4:00 p.m. Games & Activities for kids: Climbing Wall, Nickel pitch, Greased Pig, Chicken catching, bean bag toss, fishing, hole-in-one. 5:00 p.m. Grillers will begin serving 6:00 p.m. The Hepperly Band 10:30 p.m. Fireworks (at the football field) Admission for the day: Adults: $10, 6-20 years: $5, 5 years and under: FREE Includes entrance to the park for lunch, afternoon activities, BBQ tasting & the band You can come and go throughout the day! Dispatch: From Page 1 ing present to help solve the dispute. “It just seems like recently, when we meet, everybody had talked to their attorneys already and when we did meet, we would just stall,” Dunt said. “It reached a point where we needed the attorneys present to clarify right on the spot.” The issue under discussion is actually a joint agreement – called a 28E agreement - between the city and county to house emergency dispatch services in the Law Enforcement Center. There, all dispatching would be done for the city police, FRXQW\VKHULIIDUHD¿UHGHSDUWPHQWV Iowa Highway Patrol, and local medical responders. PUBLIC NOTICE Probate NOTICE OF PROBATE OF WILL, OF APPOINTMENT OF EXECUTOR AND NOTICE TO CREDITORS PROBATE NO. ESPR500761 THE IOWA DISTRICT COURT FRANKLIN COUNTY IN THE MATTER OF THE ESTATE OF Harold R. Dodd, Deceased. To All Persons Interested in the Estate of Harold R. Dodd, Deceased, who died on or about July 10, 2013: <RXDUHKHUHE\QRWL¿HGWKDWRQWKHth day of July, 2013, the last will and testament of Harold R. Dodd, deceased, bearing date of the 20th day of September, 1994, *and First Codicil thereto dated October 14, 2004 was admitted to probate in the above named court and that Dean Dodd was appointed executor of the estate. Any action to set aside the will must be brought in the district court of said county within the later to occur of four months from the date of the second publication of this notice or one month from the date of mailing of this notice to all heirs of the decedent and devisees under the will whose identities are reasonably ascertainable, or thereafter be forever barred. Notice is further given that all persons indebted to the estate are requested to make immediate payment to the undersigned, and creditors havLQJFODLPVDJDLQVWWKHHVWDWHVKDOO¿OHWKHPZLWK the clerk of the above named district court, as provided by law, duly authenticated, for allowDQFHDQGXQOHVVVR¿OHGE\WKHODWHUWRRFFXURI four months from the second publication of this notice or one month from the date of mailing of this notice (unless otherwise allowed or paid) a claim is therefore after forever barred. Dated this 21st day of July, 2013. Dean Dodd Executor of Estate WK6WUHHW +DPSWRQ,$ *$&DG\,,,,&,63,11R$7 Hobson, Cady & Cady, PLC Attorney for Executor 9 First Street SW 32%R[ +DPSWRQ,$ PUBLIC NOTICE Probate NOTICE OF PROBATE OF WILL, OF APPOINTMENT OF EXECUTOR AND NOTICE TO CREDITORS PROBATE NO. ESPR500759 THE IOWA DISTRICT COURT FRANKLIN COUNTY IN THE MATTER OF THE ESTATE OF Nile E. Rollene, Deceased. To All Persons Interested in the Estate of Nile E. Rollene, Deceased, who died on or about June 19, 2013: <RXDUHKHUHE\QRWL¿HGWKDWRQWKHth day of July, 2013, the last will and testament of Nile E. 5ROOHQHGHFHDVHGEHDULQJGDWHRIWKHth day of December, 2012, was admitted to probate in the above named court and that Jo Nette Rollene was appointed executor of the estate. Any action to set aside the will must be brought in the district court of said county within the later to occur of four months from the date of the second publication of this notice or one month from the date of mailing of this notice to all heirs of the decedent and devisees under the will whose identities are reasonably ascertainable, or thereafter be forever barred. Notice is further given that all persons indebted to the estate are requested to make immediate payment to the undersigned, and creditors havLQJFODLPVDJDLQVWWKHHVWDWHVKDOO¿OHWKHPZLWK the clerk of the above named district court, as provided by law, duly authenticated, for allowDQFHDQGXQOHVVVR¿OHGE\WKHODWHUWRRFFXURI four months from the second publication of this notice or one month from the date of mailing of this notice (unless otherwise allowed or paid) a claim is therefore after forever barred. Dated this 22nd day of July, 2013. Jo Nette Rollene Executor of Estate 481 Finch Avenue 'RZV,RZD Robert A. VanOrsdel Attorney for Executor :DOQXW6WUHHW6XLWH 'HV0RLQHV,RZD 'DWH RI VHFRQG SXEOLFDWLRQ th day of August, 2013. ____________________________________ 'DWH RI VHFRQG SXEOLFDWLRQ th day of August, 2013. ____________________________________ Published in the Hampton Chronicle on July 31 DQG$XJXVW ____________________________________ Published in the Hampton Chronicle on July 31 DQG$XJXVW ____________________________________ PUBLIC NOTICE Probate NOTICE OF OF APPOINTMENT OF ADMINISTRATORS, AND NOTICE TO CREDITORS PROBATE NO. ESPR500763 THE IOWA DISTRICT COURT FRANKLIN COUNTY IN THE MATTER OF THE ESTATE OF ARLIN D. TRIPP, Deceased. To All Persons Interested in the Estate of Arlin D. Tripp, Deceased, who died on or about December 21, 2012: <RXDUHKHUHE\QRWL¿HGWKDWRQWKHrd day of July, 2013, the undersigned were appointed administrators of the estate. Notice is hereby given that all persons indebted to the estate are requested to make immediate payment to the undersigned, and creditors KDYLQJFODLPVDJDLQVWWKHHVWDWHVKDOO¿OHWKHP with the clerk of the above named district court, as provided by law, duly authenticated, for alORZDQFHDQGXQOHVVVR¿OHGE\WKHODWHUWRRFcur of four months from the second publication of this notice or one month from the date of mailing of this notice (unless otherwise allowed or paid) a claim is therefore after forever barred. Dated this 29th day of July, 2013. Brittney Tripp, Administrator of Estate 6HPLQROH'ULYH &RPDQFKH2. Tonya McDaniel, Administrator of Estate 3UHVWRQZRRG&RQZD\$5 -DPHV-/RFKHU,&,63,11R$7 Attorney for Administrators Locher Law Firm (DVW6WDWH6WUHHW6XLWH 0DVRQ&LW\,$ Date of second publication 14th day of August, 2013. ____________________________________ Published in the Hampton Chronicle on August DQG$XJXVW ____________________________________ wording to mesh.” ³+RSHIXOO\ZH¶OOEHDEOHWRZRUN something out,” Dunt added. “If not, ,JXHVVZH¶OOVHHZKHUHLWJRHV,¶P KRSHIXOZH¶OOUHDFKDQDJUHHPHQW´ The attorneys representing the city and county are from the same ODZ¿UPLQ'HV0RLQHV'XQWQRWHG Dunt said that the city and county had reached a verbal agreement to XVH WKH VDPH ¿UP DQG ERWK SDUWLHV will have to sign a legal disclaimer DOORZLQJWKHVDPH¿UPWRUHSUHVHQW both on the issue. The meeting comes at a crucial time in the discussions of the new dispatching set-up. In light of the current refusal to join forces with the city, members of the Franklin County Supervisors scheduled an exploratory meeting with Cerro Gordo County Sheriff Kevin Pals to look into the possibility of having the Cerro Gordo County 6KHULII¶V2I¿FHGLVSDWFKFRQGXFWDOO dispatching services for the Franklin &RXQW\6KHULII¶V2I¿FH¿UHGHSDUWments outside of the city of Hampton but within Franklin County, Iowa Highway Patrol and medical services outside the city of Hampton. “We met one time on July 8 in WKH VKHULII¶V RI¿FH XS KHUH :H discussed the possibility of what it would take to share dispatching duties,” Pals said in a voicemail message. “And, how the costs would be split up with Franklin. We left that meeting doing some investigating on the cost of equipment at Cerro Gordo dispatch.” PUBLIC NOTICE Probate NOTICE OF PROBATE OF WILL, OF APPOINTMENT OF EXECUTOR, AND NOTICE TO CREDITORS PROBATE NO. ESPR500757 THE IOWA DISTRICT COURT FRANKLIN COUNTY IN THE ESTATE OF Ruth Wright, Deceased. To All Persons Interested in the Estate of Ruth Wright, Deceased, who died on or about June 18, 2012: <RXDUHKHUHE\QRWL¿HGWKDWRQWKHst day of July, 2013, the undersigned was appointed administrator of the estate. Notice is hereby given that all persons indebted to the estate are requested to make immediate payment to the undersigned, and creditors KDYLQJFODLPVDJDLQVWWKHHVWDWHVKDOO¿OHWKHP with the clerk of the above named district court, as provided by law, duly authenticated, for alORZDQFHDQGXQOHVVVR¿OHGE\WKHODWHUWRRFcur of four months from the second publication of this notice or one month from the date of mailing of this notice (unless otherwise allowed or paid) a claim is therefore after forever barred. Dated this 22nd day of July, 2013. Becky J. Lohrbach Executor of Estate 403 South Akir Street /DWLPHU,$ Richard A. Allbee, ICIS PIN Number:122 1320 4th Street NE +DPSWRQ,$ 'DWH RI VHFRQG SXEOLFDWLRQ th day of August, 2013. ____________________________________ Published in the Hampton Chronicle on July 31 DQG$XJXVW ____________________________________ NOTICE OF PUBLIC HEARING Franklin County Proposed Secondary Road Iowa DOT 5-Year Program Amendment A hearing on the proposed amendment to the )UDQNOLQ &RXQW\¶V 6HFRQGDU\ 5RDGV <HDU Construction Program will be held by the FrankOLQ&RXQW\%RDUGRI6XSHUYLVRUVLQWKHLURI¿FH Franklin County Courthouse, Hampton, Iowa DW$0RQ$XJXVW7KH plan may be reviewed and comments submitted DWWKH)UDQNOLQ&RXQW\(QJLQHHU¶V2I¿FH Olive Avenue, Hampton, Iowa or persons may appear and comment at said hearing. Hearing will consider grading and paving of 90th Street between Lark Avenue and Mallard Avenue. /s/ Michelle S. Giddings Michelle S. Giddings Franklin County Auditor ____________________________________ Published in the Hampton Chronicle on July 31, 2013. ____________________________________ PUBLIC NOTICE Franklin County Board of Supervisors PROCEEDINGS OF THE BOARD OF SUPERVISORS July 29, 2013 %H LW GXO\ QRWHG WKHVH PLQXWHV RI are UNOFFICIAL minutes. The Board of Supervisors met in regular session at 8:30AM with Board members Corey Eberling-Chairman and Michael Nolte present, Jerry L. Plagge present via Skype (due to continued illness). Motion by Plagge, seconded by Nolte, approves the agenda as submitted. All ayes, motion carried. Motion by Nolte, seconded by Plagge, approves the minutes of July 22, 2013. All ayes. Motion carried. The Board opened the meeting to public comment: Present was: Jim Davies and Tom Berry-Veterans Affairs were present on behalf of the GAR Memorial Hall Historic Preservation Development Grant for $32,000. The total proSRVDOIRUWKHZRUNLVZLWKWKH9HWHUDQV Affairs and Historic Preservation hoping to obtain donations to match the $32,000 required to receive such Grant. Davies and Berry are asking if the Board will agree to sign the Grant with the understanding that the remainder dollars ($32,000) be earned through donations. Davies also asked if donations raised could be run through the Franklin County Charitable Foundation for tax exemption status. The Board agreed to run donations through the FCCF; this is what the Foundation was intended for. Also present was Ron Dunt-Hampton City Administrator, Shawn Dietz-Hampton Mayor, Dyanne Pralle and Jim Davies-Hampton Council. Mayor Dietz requested the Board agree to setting up a meeting with Franklin County, the City of Hampton, Franklin County Emergency Management Commission and each entity’s legal counsel to work through dispatch/communications. A tentative meeting, upon all entity and legal counsel scheduling has been set up for 7XHVGD\$XJXVW30DWWKH/DZ Enforcement Center to discuss and work out dispatch/communications. Russell Wood-CPC updated the Board on the mental health regionalization and the demographics of the region. The Board reported on committee meetings throughout the week: Conservation meeting postponed; Public Health meeting postponed due to no quorum and will meet again in August; and Mental Health Center in Cherokee renovating a building wing and update on committals in the mental health system. Motion by Plagge, seconded by Nolte, approves a Franklin County Secondary Road Department Application to Perform Work Within Franklin County Highway Right-of-Way for Al Froning to mow and bale hay west of Geneva DORQJ&$OOD\HVPRWLRQFDUULHG Motion by Nolte, seconded by Plagge, approves a Proposal for Design Services with Calhoun Burns and Associates to design FHWA %ULGJH 1R QHDU WKH VRXWKZHVW FRUQHU of Section 24, Ingham Twp. All ayes, motion carried. Motion by Nolte, seconded by Plagge, awards a Contract for culvert replacement–twin box DORQJ 7KUXVK $YHQXH EHWZHHQ +Z\ DQG WK6WUHHWWR3&,RI5HLQEHFN,RZDWRWDOFRVW $OOD\HV0RWLRQFDUULHG At 9:30 AM Sandy Eckhardt-Drainage Clerk met with the Board to discuss a possible cleanout of tree roots and crushed tile in Joint DrainDJH 'LVWULFW 6HFWLRQ +DUGLQ7RZQVKLS Hardin County. The Board was asked since repairs were located in Hardin County and Franklin County being the Control County, would the Board expect an Investigation of Drainage Districts per Requests- Resolution 2010-23 be signed by those requesting the investigation. The Board agreed that those requesting should ¿OORXW5HVROXWLRQWRLQLWLDOL]HWKHLQYHVtigation per their request. No action taken. Motion by Plagge, seconded by Nolte, accepts the Franklin County Funds with Excess Balance as of June 30, 2013 as was submitted by the County Auditor based on the 2012/2013 Cash Report and the Intended Use for Surplus ReSRUW$OOUHSRUWVDUH¿OHGLQWKH&RXQW\$XGLWRU¶V RI¿FH$OOD\HV0RWLRQFDUULHG Motion by Plagge, seconded by Nolte, opens at 10:00 AM a Public Hearing to amend the County’s FY13/14 Budgeted expenditures as ZDVSXEOLVKHGLQRI¿FLDOFRXQW\QHZVSDSHUVRQ 5HVROXWLRQ$OOD\HV0RWLRQ carried. Motion by Nolte, seconded by Plagge, closes WKH3XEOLF+HDULQJDW$0$OOD\HV0Rtion carried. Motion by Plagge, seconded by Nolte, adopts Resolution 2013-33: Amend FY 13/14 Budgeted Expenditures as was published in the July WK HGLWLRQ RI WKH RI¿FLDO FRXQW\ QHZVSDSHUV +DPSWRQ&KURQLFOHDQG6KHI¿HOG3UHVV Said Resolution reads as follows: RESOLUTION #2013-33: Amend Fiscal Year 2013/2014 Franklin County Budget WHEREAS, RESOLUTION #2013-33 Amends Fiscal Year 2013/2014 Franklin County Budget adjusting amounts from original budget pubOLVKHGLQRI¿FLDO&RXQW\QHZVSDSHUV+DPSWRQ &KURQLFOHDQG7KH6KHI¿HOG3UHVVRQ)HEUXDU\ WR DXWKRUL]H DQ DPHQGPHQW DQG appropriation of funds to the appropriate deSDUWPHQWVDVVSHFL¿HG WHEREAS, changes in Revenues are: NonDepartmental General Fund: +$4,000 Hotel/ Motel Tax receipts increase; WHEREAS, changes in Expenditures are: &RXQW\ $WWRUQH\ *HQHUDO )XQG 6HFretarial Wages, General Supplemental Fund 6HFUHWDULDO+HDOWK,QV),&$,3(56 Non-Departmental General Fund +$4,200 payPHQWVWR&KDPEHURIWD[FROOHFWHGGXHWR increased tax receipts from Hotel/Motel Tax; County Assistance Department Local Option IXQG IRU +HDOWK +DUYHVW 1RQ'Hpartmental Whispering Willow Projects Fund EXGJHWHG WR SD\ LQ ¿VFDO EXWQRZWRSD\LQFXUUHQW¿VFDO\HDUGXH to weather delays pushing back deadlines; BE IT DULY ADOPTED this 29th day of July, 2013, with the vote thereon being as follows: Eberling-Aye, Nolte-Aye, Plagge-Aye. Resolution duly adopted. Motion by Nolte, seconded by Plagge, approves a Region 2 Transit System: Contract for Transportation Services between NIACOG and Franklin County Community Services to arrange for public transit services for the period from July 1, 2013 through June 30, 2014. All ayes, motion carried. Motion by Plagge, seconded by Nolte, approves a Provider and Program Participation The Aug. 6 meeting was schedXOHGRQ-XO\ZKHQRI¿FLDOVIURP the city went to the Board of Supervisors meeting to ask for a joint meeting on the issue. Members of the Franklin County Supervisors did not return repeated calls for comment on the issue from the Chronicle staff. Agreement Extension between Mary Greeley Medical Center and Franklin County for In-patient services. All ayes, motion carried. Motion by Plagge, seconded by Nolte, approves Attachment A of the Agreement between Covenant Clinic Psychiatry and Franklin County for the Franklin County Outpatient Psychiatric services. All ayes, motion carried. Motion by Plagge, seconded by Nolte, adopts Resolution 2013-32: Subdivision Waiver requested by Schlichting Farms for 14 acres located in the NW corner of NE ¼, Section 3, Wisner Township. Said Resolution reads as follows: RESOLUTION 2013-32: A RESOLUTION OF THE BOARD OF SUPERVISORS OF FRANKLIN COUNTY APPROVING A SUBDIVISION WAIVER WHEREAS, The Franklin County Subdivision 2UGLQDQFH DOORZV ZDLYHUV WR WKH UHTXLUHments set therein, and WHEREAS, Schlichting Farms has asked for a sub-division waiver on approximately 14 acres in the NW corner of NE ¼, 3-93-22, Wisner township; BE IT RESOLVED that The Franklin County Board of Supervisors approves the Subdivision Waiver subject to receipt of survey to divide the parcel out. PASSED AND ADOPTED this 29th day of July, 2013. Eberling-Aye, Nolte-Aye, Plagge-Aye. Resolution duly adopted. Motion by Plagge, seconded by Nolte, reappoints Robert Grant to the Franklin County %RDUGRI$GMXVWPHQWIRUD¿YH\HDUWHUPH[SLULQJ$OOD\HVPRWLRQFDUULHG Motion by Nolte, seconded by Plagge, approves a Contract between Covenant Clinic Psychiatry and Franklin County for out-patient services from July 1, 2013 through June 30, 2014. All ayes, motion carried. At 10:30 AM Tom Porter-Head Custodian met with the Board to request direction on: LED Courthouse lights. The company recommended installing the line of lights with a crane and the new lines would stay permanently. The Board would like a demonstration of lights displaying the whole courthouse and clocktower. They asked for an evening display set up to demonstrate the display of lights on the courthouse. Tom Porter will line this up. Window insulation in the Courthouse. The FUHZKDV¿QLVKHGWKHEDVHPHQWDQG5HFRUGHU¶V RI¿FH DQG ZLOO ¿QDOL]H DOO ZLQGRZV EHIRUH WKH end of the year. Downspouts- haven’t found anyone to make WKHPRXWRIVPRRWKPHWDOFDQRQO\¿QGFRUUXgated. Still checking on them. Courthouse statues rusting problem. Appears to be holes in some of the statues and with water penetrating through these holes it is causing UXVWWRUXQRYHUWKHEDVH5HQDLVVDQFH5RR¿QJ will be contacted again. The Board acknowledged receipt of a Construction Permit CP-A2013-109, The Good (JJV6LWH)UDQNOLQ&RXQW\)DFLOLW\,' The Board acknowledged receipt of the Franklin County Ag Extension Reconciliation Statement-Education Operating fund as of June 30, 2013. The Board acknowledged receipt of the Franklin County Environmental Health and Weed Commissioner Report from May 20, 2013 through July 20, 2013. The Board acknowledged receipt of the December 31, 2012 and 2011 Auditor’s Report DQG&RQVROLGDWHG¿QDQFLDO6WDWHPHQWVIRU,RZD Health System and Subsidiaries and Berryhill Center for Mental Health. The Board acknowledged Manure Management Plan Renewals for: 1) McCord Finisher )DUPRZQHU0LNH$OGLQJHUVLWHORFDWHG WK6W,RZD)DOOV6HF/HH7RZQVKLS Motion by Nolte, seconded by Plagge, adMRXUQV DW $0 XQWLO$XJXVW $OO ayes. Motion carried. ATTEST: Corey Eberling, Chairman Michelle Giddings, Auditor & Clerk to Board ___________________________________ Published in the Hampton Chronicle on August ___________________________________ Legals are your RIGHT to know! PUBLIC NOTICE CAL Communtiy School CAL COMMUNITY SCHOOL BOARD OF EDUCATION SPECIAL MEETING JULY 25, 2013 The CAL Board of Education met for a special PHHWLQJRQ-XO\LQWKH6FKRRO'LVWULFW 2I¿FH 3UHVLGHQW 6WHYH 0XKOHQEUXFK FDOOHG WKHPHHWLQJWRRUGHUDWDP3UHVHQWZHUH Board members Steve Muhlenbruch, Beth Eddy, Austin Elling, Mitch Vanness, and Todd Mensing. Also present were Secretary Amanda Rapp and Superintendent Dwight Widen by phone. A motion to approve the agenda was made by Eddy, seconded by Mensing. All ayes. The agenda consisted of personnel contracts, authorization of credit cards, and consideration of sharing positions with Hampton-Dumont. A motion to approve a contract with Sean Farmer as Level II/Level III Special Education Teacher was made by Eddy, seconded by Vanness. All ayes. A motion to approve a contract pending licensure approval with Carolyn Duffy Patton as halftime Title I/Reading Teacher and halftime Teacher Associate was made by Vanness, seconded by Mensing. All ayes. A motion was made by Vanness, seconded by Mensing to accept the resignation of Dennis Knights as Middle School English Teacher. All ayes. A motion to approve a contract with Alexandra Vallebo as Middle School English Teacher was made by Eddy, seconded by Vanness. All ayes. A motion was made by Mensing, seconded by Eddy to approve Teacher Associate contracts with Rhonda Noelck and Abigail Rapp. All ayes. A motion was made by Vanness, seconded by Eddy to approve an Assistant Volleyball Coach contract with Abigail Rapp. All ayes. A motion to approve a Cheerleading Coach contract with Rhonda Noelck was made by Mensing, seconded by Vanness. All ayes. A motion was made by Eddy, seconded by Mensing to approve the application for school credit cards through First Citizens National Bank, giving Dwight Widen and Amanda Rapp the authorization to get the cards in their names. All ayes. The Board discussed sharing Nursing and Food Service Director positions with HamptonDumont. A motion to adjourn was made by Mensing, seconded by Vanness. All ayes. The meeting ZDVDGMRXUQHGDWDP ___________________________________ Published in the Hampton Chronicle on August ___________________________________ 16 Wednesday, August 7, 2013 CLASSIFIED ADVERTISING +DPSWRQ&KURQLFOH6HFWLRQ$ The Hampton Chronicle’s BONUS The Hampton Chronicle www.hamptonchronicle.com DELIVERED TO MORE THAN 5,600 HOMES PLUS INTERNET SHOPPERS! SUBMIT YOUR AD ONLINE AT WWW.HAMPTONCHRONICLE.COM OR CALL 641-456-2585 Ɣ TOLL FREE 1-800-558-1244 THIS PUBLICATION DOES NOT KNOWINGLY ACCEPT advertising which is deceptive, fraudulent or which might otherwise violate the law or accepted standards of taste. However, this publication does not warrant or guarantee the accuracy of any advertisement, nor the quality of the goods or services advertised. Readers are cautioned to thoroughly investigate all claims made in any advertisements, and to use good judgment and reasonable care, particularly when dealing with persons unknown to you who ask for money in advance of delivery of the goods or services advertised. FOR SALE Vinyl replacement window with 7/8” glass that tilts for easy cleaning. Avail. in 3 colors and wood grain. Call Coll. 648-5030, Mary Jo Mulford, Mulford Assoc. _________________________ctfpd FOR SALE GARAGE SALE GARAGE SALE 2005 Dodge Dakota XLT 2 wheel drive 95,000 miles, hard tonneau cover excellent condition $10,500. 507-236-0990, Lakota, IA ________________________c33pd RV Camper with stove, fridge, bathroom, $1000 OBO. Call 641-580-0004. ___________________________ ctf Heat your entire home, water and more with an OUTDOOR WOOD FURNACE from Central Boiler. Class One 319-830-6711. __________________________c32 670 Hwy 65, Friday and Saturday 8-4. Mowers, infant girls clothing all sizes, baby stroller, ladies clothing – Harley Davidson clothing. Sleep number bed, sweet corn, two Pepsi machines, and much more! ______________________c32pd 403 Grant St. Coulter. Lots of stuff! Saturday 8-2. ________________________c33 Koenigs' Acres Flea Market August 17th-18, 7 am - 4 pm 1510 110th street, Hampton, 641-456-4903. Looking for vendors - $10 to sell. Looking for buyers - $2/person. Expecting antiques, collectibles, livestock equipment, crafts, and much more. Simple food, portaSRWWLHV DQG ÀUHZRRG DYDLODEOH _________________________ctf Friday, August 9 – 4:00 to 7:00, Saturday, August 10 – 8:00 – 12:00. Lots of misc, home décor, games, jewelry, etc. 1015 6th St. S.W., Hampton, IA. ________________________c32pd REAL ESTATE 4 Beds, 1.5 baths, beautiful woodwork! Must see! $54,900. 215 2nd Ave SE 641-512-0352. ___________________________ctf ROCKWELL COMMUNITY NURSING AND REHAB Recruiting qualified Certified Nurse Aides for evening shift. Part or full time. Come work where we pride ourselves in taking care of our residents and our employees. Contact: Carol Ames, Director of Nursing 707 Elm Street, Rockwell, IA 50469 641-822-3203 E.O.E. OPEN POSITION - CDL DRIVER Centrum Valley Farms is seeking a part-time or full-time CDL driver for our Pullet Farms. Candidate will be responsible for the transportation of birds from the pullet sites to our layers site. Driver must have a valid Class A driver’s license and route will in the Wright and Franklin County. EQUAL OPPORTUNITY EMPLOYER Please apply at: CENTRUM VALLEY FARMS 100 Central Ave East; Clarion, IA 50525 BANK BOOKKEEPER UNITED BANK & TRUST COMPANY IS SEEKING A FULL-TIME BOOKKEEPER AT THEIR SHEFFIELD OFFICE. A qualified applicant must be comfortable with computer applications, have excellent bookkeeping skills, have a high attention to detail, and possess a professional appearance. Applicant must also be able to combine computer proficiency with basic accounting skills. Secondary tasks include bank teller duties. UBTC offers competitive pay and an excellent benefit package. Comparable work experience is a plus. Please send resume with cover letter to: Grant F. Petersen, Vice-President United Bank & Trust Company 202 Gilman Street, Box 647 • Sheffield, IA 50475 Member FDIC [email protected] It’s finally here! “What?” you ask. The opportunity to join an innovative company on the move. If you are highly motivated, skilled, and looking for a positive and friendly work environment, then now’s the time to check out Hagie Manufacturing Company. What are you waiting for? NOW HIRING—2nd shiŌ welders, 2nd shiŌ Painters Visit hagiecareers.com to view all openings Hagie Manufacturing Company 721 Central Ave. West Clarion, Iowa 50525 515-532-2861 Email: [email protected] DELIVERY DRIVER/INSERTER Mid-America Publishing Corporation is seeking a delivery driver/inserter for two routes. The successful candidate must have a clean driving record for WKHSDVWWZR\HDUVEHVHOIVXI¿FLHQWDQGLQGHSHQGHQWEHDFFRXQWDEOHDFFXUDWH and be able to lift up to 50 pounds repeatedly. Tuesdays: Driver leaves Hampton around 7:30 a.m. and makes delivery stops in Madrid, Ogden, Jefferson, Lake City, Sac City, Rockwell City, Eagle Grove, and Clarion before returning to Hampton around 3:30 p.m. Deliveries include the handling of mailing bundles and loading and stacking them in a fashion suitable for the postal service, making news stand and delivery stops at locations, and collecting payment at others. Wednesdays: Driver leaves Hampton at 2 a.m. and heads to Kalona, Keota, Sigourney, Fremont, and New Sharon before returning to Hampton around noon. Deliveries include the handling of mailing bundles and loading and stacking them in a fashion suitable for the postal service, making news stand and delivery stops at locations, and collecting payment at others. While one person LVSUHIHUUHGWR¿OOERWKURXWHVWKHVHURXWHVPD\EH¿OOHGVHSDUDWHO\ To apply for the position, complete an application at the Hampton Chronicle, apply online at hamptonchronicle.com under employment application, or send a resume and three references to ryanharvey.map@ gmail.com.,QWHUYLHZVZLOOEHJLQLPPHGLDWHO\ZLWKTXDOL¿HGFDQGLGDWHV HELP WANTED Hampton-Dumont Schools has the following opening for the 20132014 school year. Food Service (Dish Machine) at South Side Elem; 5 hours/day Apply in person or send letter of application and/or resume to: Mr. Todd D. Lettow, Superintendent FOR RENT 'LVWULFW $GPLQLVWUDWLRQ 2IÀFH Building front, approximately 12th Ave. NE Hampton, IA 504413000 square feet located at 113 1169 Employment offer pending 2nd NW Hampton, IA. May also background check. Deadline: include apartment at same location. Position will remain open until Contact Ron at 515-571-7004. ÀOOHG:HDUHDQ((2$$(PSOR\HU ____________________________ctf __________________________c33 2 BR apartment for rent $325/ Auditor needed to inventory tobacco mo., plus deposit. Available monthly in Hampton, IA. $25 per immediately. 641-425-0576. completed audit. Call 800-995-7494. ___________________________c31 __________________________c32 3URIHVVLRQDO 2IÀFH 6SDFH RQ +LJKZD\ )XOOWLPH RIÀFH assistant if needed. Call 456-4106. ____________________________ctf Operation/Accounting Department Team Effort, Inc. a leader in licensed golf accessories is looking for a highly motivated individual WR ¿OO D SRVLWLRQ LQ RXU$FFRXQWLQJ 'HSDUWPHQW &ROOHJH$FFRXQWLQJGHJUHHLVSUHIHUUHGEXWQRWUHTXLUHGEXW PXVW KDYH FRPSXWHU OLWHUDF\ DORQJ ZLWK JRRG FRPPXQLFDWLRQ VNLOOV 7KLV SRVLWLRQ ZLOO VXSSRUW PDQDJHPHQW ZLWK LQYHQWRU\FRQWUROFRPSOHWLRQRIDFFRXQWLQJUHSRUWVDFFRXQWV SD\DEOHPRQWK\HDUHQGFORVLQJSURFHVVLQFOXGLQJDQDO\VLV DQGUHFRQFLOLDWLRQVRIVSUHDGVKHHWDQGYDULRXV,7SURMHFWV 6DODU\FRPPHQVXUDWHZLWKH[SHULHQFHDQGZHRIIHUDFRPSOHWHEHQH¿WVSDFNDJH3OHDVHVHQGUHVXPHRUSLFNXSDQ DSSOLFDWLRQDW7HDP(IIRUW,QFWK6W6:&ODULRQ,$ $WWQ%UHQW8OYHQ HELP WANTED Laborers wanted for local tree service. Call 515-681-0423 for application. ___________________________c32 SERVICES Interior painting, wall papering, wood ÀQLVKLQJ6DQG\$DURQ ____________________________ctf Horseback riding lessons and pasture boarding available. Call Kelly at 641-425-0689. www. dragonfiredancinghorses.com. ___________________________c33 +DGZLJHU 5RRÀQJ DQG 6HDPOHVV *XWWHUV VKLQJOHV ÁDW URRIV VKDNHV and steel. Free estimates. 641648-9661 or 1-800-748-3883. ____________________________ctf 5RQ·V 5RRÀQJ – Insured, bonded, commercial, residential. Specializing in shingles, rubber WANTED membrane and metal coating. GO BOLD! You noticed this Allmet Metal Shingles., seamless FODVVLÀHG LQ SDUW EHFDXVH RI JXWWHUV 641-456-4670, Hampton. bold type. Use bold type in your ____________________________ctf House painting. Call Jeff for ad for just 15¢ more per word. Free Estimate. 641-857-6637. ___________________________ctf ___________________________c32 CUSTOMER SERVICE TYPESETTER The Hampton Chronicle, a division of Mid-America Publishing Corporation, is seeking a full-time person to serve as a customer service representative and typesetter for the Hampton Chronicle and other newspapers within the company. The successful candidate must have strong customer service skills, good spelling and grammar skills, and the willingness to learn other aspects of the business, such as newspaper advertising layout and design. The ability to multi-task several duties at once is a must. To apply for the position, please complete an application at the Chronicle office, mail resume to Ryan Harvey, Publisher: HAMPTON Hampton Chronicle, P.O. Box 29, Hampton, Iowa 50441; or send a resume to [email protected] C AN H IOWA R NEWSPAPER O N ASSOCIATION I AWARD C WINNING L E NEWSPAPER MEDICAL HELP WANTED HOUSEKEEPER: Full-time position in Clarion. Primary responsibility is to clean the surgery department. Hours are primarily Mon. - Fri. 10:00 a.m. - 6:30 p.m. but will require flexibility. Position will be required to cross trained and fill in on all areas of the facility as well as other duties as assigned. Will be required to work at all Iowa Specialty Hospital locations as needed. CERTIFIED NURSING ASSISTANT/UNIVERSAL WORKER: Full-time position in Clarion Assisted Living. Will be required to work on a rotation of all shifts. Position requires a certified nursing assistant and working every other weekend and a holiday rotation. Will be required to work at all Iowa Specialty Hospital locations as needed. CERTIFIED NURSING ASSISTANT: Full-time day shift in Clarion. Hours are 7:00 a.m. - 7:30 p.m. Position requires working every third weekend, holiday rotation and may require working at both in Belmond and Clarion. Experience preferred. Will be required to rotate in Med-Surg, Ortho, Obstetrics. BLS required. CERTIFIED NURSING ASSISTANT: Full-time night shift in Clarion. Hours are 7:00 p.m. - 7:30 a.m. Position requires working every third weekend, holiday rotation and may require working at both in Belmond and Clarion. Experience preferred. Will be required to rotate in Med-Surg, Ortho, Obstetrics. BLS required. REGISTERED NURSE: Full-time day position in Clarion. This position is 7:00 a.m. - 7:30 p.m. (36 hours per week) in the Med-Surg Department. Position requires working every third weekend and a holiday rotation. Experience preferred. Will be required to work at all Iowa Specialty Hospital locations as needed. CERTIFIED NURSING ASSISTANT: Full-time day position in Belmond. This position is 7:00 a.m. - 7:30 p.m. (36 hours per week). Position requires working every third weekend and holiday rotation. Experience preferred. Will be required to work at all Iowa Specialty Hospital locations as needed. CERTIFIED NURSING ASSISTANT: Full-time night position in Belmond. This position is 7:00 p.m. - 7:30 a.m. (36 hours per week). Position requires working every third weekend and holiday rotation and a certification as a CNA. Experience preferred. Will be required to work at all Iowa Specialty Hospital locations as needed. PARAMEDIC: Full-time position for hospital based EMS Service in Belmond. Hours are 7:00 p.m. - 7:30 a.m. but will require flexibility. Position requires working every other weekend and holiday. Will cover 911 calls during shift, transfers and assist in the Emergency Department. Will be required to work at all Iowa Specialty Hospital locations as needed. REGISTERED NURSE: Full-time position in Clarion. Hours are 7:00 p.m. - 7:30 a.m. (36 hours per week). Position requires working every third weekend and a holiday rotation. Will work primarily in Emergency Department, but will be required to float to all areas of nursing department. Experience preferred. Will be required to work at all Iowa Specialty Hospital locations as needed. NURSING SERVICE UNIT SECRETARY: Full-time position in Clarion. This position will work 36 hours per week and include working every third weekend and a holiday rotation. Will be required to work at all Iowa Specialty Hospital locations as needed. AMBULANCE DRIVER: PRN position in Clarion. Requires a minimum of a Class D driver’s license in the State of Iowa, good driving record, requires assisting in getting supplies/equipment from ambulance as well as assisting with getting patients into ambulance and will need to be BLS certified. PARAMEDIC: Full-time position in Clarion. Hours are 7:00 a.m. - 7:30 p.m. but will require flexibility. Position requires working every third weekend and a holiday rotation. Will cover transfers and assist in the Emergency Department and include 911 calls if working in Belmond. Will be required to work at all Iowa Specialty Hospital locations as needed. SPECIALTY CLINIC ADMISSIONS CLERK: Part-time position available in Belmond Specialty Clinic. Hours are primarily Mon., Tues, Wed., & Fri. day shift and weekend coverage as needed. Basic office skills, customer service and computer skills, flexibility, personal demeanor, confidentiality and dependability required. Medical office experience preferred. Will be required to work at all Iowa Specialty Hospital locations as needed. PARAMEDIC: Full-time position in Clarion. Hours are 7:00 p.m. - 7:30 a.m. but will require flexibility. Position requires working every third weekend and a holiday rotation. Will cover transfers and assist in the Emergency Department and include 911 calls if working in Belmond. Will be required to work at all Iowa Specialty Hospital locations as needed. HOUSE SUPERVISOR: Full-time night position in Clarion and Belmond. This position is 7:00 p.m. – 7:30 a.m. (36 hours per week). Position will supervise all units of nursing service and other departments when nursing leaders/administration are absent. Demonstrates competence in management and leadership skills. This position requires working every third weekend and holiday rotation. This position will travel between both Belmond and Clarion during each shift. Requires current State of Iowa RN license, BLS, NRP, ACLS, PALS, TNCC and BSN preferred. Positions offer outstanding wages & fringe benefits. Please stop by and pick up an application, apply on-line at www.iowaspecialtyhospital.com or contact the Human Resources Department at 515-602-9801 to receive an application by mail. All positions are subject to criminal/dependent adult abuse background checks, pre-employment physical and drug testing. Specializing in You WWW.IOWASPECIALTYHOSPITAL.COM Belmond - 403 1st Street SE Clarion - 1316 S. Main Street 866-643-2622 866-426-4188 TELLER/IMAGING ASSISTANT Green Belt Bank & Trust is accepting applications for a part-time Teller/Imaging assistant in our Iowa Falls location. The responsibilities include all teller operations as well as assisting with our document imaging process. The position requires a well-organized, outgoing person with excellent oral and written communication skills. Must be able to work flexible hours including some Saturday mornings. Knowledge of Microsoft Word and Excel are very helpful. Previous teller experience a plus. Please submit application on line going to the careers portion of our website, via e-mail to [email protected] or fax to 641-648-3273. Applications are due by August 20, 2013. EQUAL EMPLOYMENT OPPORTUNITY-AFFIRMATIVE ACTION EMPLOYER AGRICULTURAL LOAN OFFICER Green Belt Bank & Trust in Iowa Falls, Iowa is a growing, progressive bank accepting resumes for an Agricultural Loan Officer in its Iowa Falls location. The responsibilities would include developing new agricultural business, underwriting, structuring, and closing agricultural loans, as well as maintaining and servicing an existing portfolio including collection duties as necessary. This position requires a detail oriented, community minded person with proven business growth history, willing to represent the bank in the local community through active participation in community affairs. 5+ years ag lending experience required. Competitive compensation package. Please send your resume to: Melanie Kulow, Green Belt Bank & Trust 616 Washington Avenue, Iowa Falls, IA 50126 or e-mail to: [email protected] If interested please respond by August 20, 2013. EQUAL EMPLOYMENT OPPORTUNITY-AFFIRMATIVE ACTION EMPLOYER MANPOWER IS HIRING IN THE HAMPTON/IOWA FALLS AREA! Manpower is having a job fair on Thursday, August 8th from 1:00 to 4:00 p.m. at the Hampton Library. We are looking to hire for GENERAL PRODUCTION WORKERS WAREHOUSE WORKERS AND FORKLIFT OPERATORS Previous experience is preferred. We are looking for a great candidate who prides themselves in doing a quality job every day, are you that person? If so, please attend the job fair at the Hampton Library. High School diplomas are required for these positions. Can’t make it to the job fair? No problem! Register with Manpower online at www.manpowerjobs.com Storage Units 1-800-353-0017 Gutters Need Cleaning? offers Lifetime NO-CLOG GUARANTEE. We also offer other guards and gutters without guards. Call for a free consultation. Steve Brekunitch, Owner 131 E. Rocksylvania Ave. • Iowa Falls 641-648-2755 or 1-877-965-9167 Over 40 Years of Quality Service PRODUCT FOR PRODUCT WE WILL NOT BE UNDERSOLD Windows • Siding Call collect for estimates 641-648-3918 Ask for Ben CLASSIFIED ADVERTISING +DPSWRQ&KURQLFOH6HFWLRQ$ LEMKEA sincere thank you to all who expressed their care and concern to our family in the loss of our loved one, Ardis. Virgil Lemke and Family. _______________________________________________________________c32 CUVELIERMy thanks to everyone who made my 90th birthday party a big success. It was a wonderful day to visit with all the friends and relatives who came to my party. I’ve thoroughly enjoyed all the cards, gifts and visits I’ve received. Thanks to Brenda and all the others who did such a good job of keeping it a secret. Ruth Cuvelier. _____________________________________________________________c32pd FECKERSThe family of Janscee Feckers would like to thank everyone that helped us in DQ\ ZD\ DW WKLV GLIÀFXOW WLPH:KHWKHU LW ZDV D NLQG ZRUG D KXJ WKRXJKWV DQG SUD\HUV FDUG ÁRZHUV PHPRULDO IRRG EURXJKW WR WKH KRXVH RU ZKDWHYHU LW may have been – it will never be forgotten. We want to express a big thanks to Pastor Fiet for the beautiful service for our daughter/sister. We would also like to thank the FGH Ambulance, Dumont Ambulance, staff at FGH and LG at Sietsema-Vogel for all of their help. Steve, Shellene, Jodi, Jacobi and families _______________________________________________________________c32 1 Bedroom Apt. Available Sunrise Homes, Inc. in Sheffield, Iowa • For Elderly or Disabled • 1 BR rent is $260 • Ground Floor Apartments • On-site laundry facilities • Appliances Furnished • Some utilities provided DONALDSON APPRAISAL SERVICES 221 3 Ave. NW - Hampton, IA Well maintained 2 bedroom home with new roof and fenced in back yard. $52,900 For more info contact: Murphy Realty & Mgmt. 208 E. State, P.O. Box 476 Algona, IA 50511 515-295-2927 515-681-0423 401 3rd St. SW, Hampton, IA A 4-BR, 2-Bath home with very open floor plan. Built in 2006 situated on a roomy lot in SW Hampton. Excellent for a family or investor. $64,900 FOR SALE BY OWNER Office: 202 12th Ave. NE, Hampton, Iowa 50441 Phone: 641-456-3395 • 641-398-2524 TT: 1-800-735-2942 Voice 1-800-735-2943 OAKBROOK APARTMENTS $44,900 Jerry Staley Kent Brown 456-3607 456-4664 Brad Staley Kurt Thielen 425-9400 STALEY REAL ESTATE 21 4th Street NE Susan Staley 425-9431 Office: 641-456-3607 430-3659 Hampton www.staleyonline.com Jay Brower 580-4070 CLASSIFIEDS WORK! 456-2585 AVAILABLE NOW: 1 & 2 BR APTS. 504 S. 4th St., Rockwell On site laundry, off street parking, water and trash provided, rental assistance available. 712-297-0058 A 3-BR, 2 story home with 2,340 SF of GLA located on an oversized lot. Steel siding. 422 Washington Street, GENEVA This 1½ story home sits on .38 acres m/l. 3 bedroom, 1 bath, laundry on main floor, central air, and 2 + stall detached garage. Enjoy the changing seasons in the 3 season room. Call for Details: 641-430-5866 Featuring, 1 and 2 bedroom apartments with water, sewer, and trash removal furnished. Laundry facilities and off-street parking available. Must meet income and occupancy guidelines. Applications are available 24 hours a day at: OPEN HOUSE Pheasant Ridge Rural Subdivision $200 MOVE-IN SPECIAL WITH SIGNED LEASE Friday, Aug. 9th • 5 - 8PM SUNDAY OPEN HOUSES! OPEN SUNDAY 1:00 - 3:00 OPEN SUNDAY 3:00 - 4:30 New Listing! 808 Cherry, Allison 11442 250th St., Dumont Very neat ranch home that is move in ready! 1,200 sq. ft. 2 BR, + Bonus room. No steps. Att. GA. Priced to sell! 3.11 A. m/l - Total peace & quiet! Immaculate ranch home w/ 1,400 sq. ft. 3 BR. Good, useable outbuildings! On a hard surfaced road! 3BR, 2 BATHS ACREAGE FOR SALE. New Construction, 1600 Sq. Ft., main floor with full walkout basement, 3 season porch and deck. Large 3 stall garage. Located 4 miles north of Hampton on the east side of Hwy. 65 just east of Chapin. $318,000 Check out more pictures at If you are buying or selling, give us a call! SCHUCK Realty Co. Joyce Harrenstein Broker/Owner Office 319-346-1364 Cell 319-404-1502 Tim Junker 319-240-9184 309 3rd Street, Parkersburg www.schuckrealtyco.com JASPERSEN Facebook.com/WirtjesConstruction Call 641-425-3631 for more information. HOME-AUTO-FARM BUSINESS-CROP-LIFE LAND AUCTION Call Today! (641) 456-2266 - Downtown Hampton :HGQHVGD\6HSWHPEHUDW30 $WWKH/DWLPHU&RPPXQLW\&HQWHU 1 Armony Lane - Hampton - $159,000 1000 4 St SE - Hampton - $325,000 104 North Akir Street in Latimer, Iowa REDUCED PRICE! Looking for storage? This 3BR, Whether retiring or downsizing, this 2BA apt-style living is attached to over maintenance-free townhome has vaulted 6,000 SF of shop/garage. ceilings, sun room, & deck. For Property Details, Contact: -HIIUH\72EUHFKW$JHQW$XFWLRQHHU “The Dirt Dealer” ™ Iowa Falls, Iowa (641) 648-5065 or (515) 689-1648 [email protected] L-1300699 Eric Christianson Realtor & Insurance ROCKWELL LIONS CLUB FARM MACHINERY CONSIGNMENT AUCTION SATURDAY, AUGUST 17TH, 2013 9:00 A.M. SPORTING EQUIPMENT: Gator 3 wheeler; Kawasaki 250 ATV; 91’ Polaris 250 ATV; 06’ Polaris 800 Sportsman ATV; 09’ Yamaha 450 Rhino. TRACTORS: JD 4450w/ MFWD 6679 hrs; JD 4440, 10,500 hrs; White 1655, 7260 hrs.; Oliver 880, 6909 hrs; JD 8430, 6400 hrs; 80’ JD 8440 3600 hrs; JD 8630 tractor, new 50 series motor; MF 135 tractor w/ full hyd, MF loader& ROPS, #9A177661; (2) 48’ Case SC tractors, none running. HARVEST EQUIPMENT: Case IH 1660 Combine; Case IH 820 Corn head; Case IH 1020 Grain Platform;99’ JD 9610 combine, duels, new motor, 3,000 sep hrs; JD 843 corn head low-tin, w/ Pixel rollers; Brent 672 grain cart; (2) Dakon 225 bu. wagons; 250 bu. wagon w/ JD running gear; 250 bu. wagon, seed auger, JD running gear; JD 634 Hi-Tin corn hd; JD 220 bean hd, black reel; (2) 250 bu. Wagons w/ JD running gear; 250 bu wagon; Farm Fans dryer fan; Mayrath 10x71 auger elect drive no motor; Westfield 8x71 pto auger; Rolfes fan &heater 1028, single phase; Farm Fans 1028 single phase fan; 5 hp single phase 24” aeration fan; (2) 12” aeration fans; 14” aeration fan; (2) grain spreaders. TILLAGE & MISC. EQUIPMENT: White 12ft Chisel Plow; Kraus 15ft Drill; Earthmaster 1165 5 shank ripper; Westendorf WL42 Loader; forks CC360; MF #222 tractor backhoe & loader ; Vermeer 9ft mower; Vermeer baler; Bestway sprayer w/ 60ft boom, and foamer; (4) wagons w/ pipe square LL for baler; Long 3 pt back hoe; 8 row ridge till dry fert applicator; MF 226 3pt blade; MF heat houser; 1300 gal water tank w/ 5hp Brigges motor, on wheels; JD 630 disk 18ft; IH fork lift, 3 mast, side shift. LAWN & GARDEN EQUIPMENT: Dixon 5425 industrial mower; JD 175 w/38’ deck lawn mower; JD 425 w/54” deck, 919 hrs; 94’ Brandt 425 w/ 54” deck 1003 hrs;’ 09’ JD 425 AWS w/ 54’ deck,1000 hrs; JD STX38 Hydro Lawn tractor; JD STX38 5 speed lawn tractor;JD STX38 lawn tractor; 06’190C 25hp Automatic w/ 54’ deck, 240 hr; 91’ F525 w/ 48” deck Front mower, 550 hrs; 00” JD LX279 Lawn tractor w/ 48” deck; 02’ JD LX279 lawn tractor w/ 48” deck, 979 hrs; SST 18 w/ 48 deck, 18hp; 04’ JD 475 w/ 48” deck, 610 hrs; 04’F525 w/ 54” deck, 432 hrs; 04’ JD LX289 w/ 48” deck, 432 hrs; Snapper RR w/ 30” deck; White mower w/ 42” deck; Many more mowers by sale time. Hay & LIVESTOCK EQUIPMENT: AG TEK 24ft stationary round hay feeder; 20 concrete bunks; Knight manure spreader; fencing equipment&supplies; Balzer 3350 honey wagon. TRAILER, VEHICLES, and BOATS: Aluminum grain trailer: 2 Steel grain trailers; Keifer 22 ft livestock trailer; Ford F900 semi tractor; Ford LF 8000 semi tractor; 93’ Volvo N14 semi tractor, cummings motor, day cab; Nevil Built steel grain trailer, 34ft, new tarp 03’; Freehaus 48ft semi van trailer; Ford C700 grain truck;78’ Ford single axel grain truck;Triple axel 30ft goose neck trailer; 99’ Chev C1500 Suburban, 2wd,19k,350, auto,like new tires; 91’ Chev C1500 pickup, 2wd,167k, 6 cylinder, standard trans; Misc school bus parts. BUILDING MATERIALS & MISC. EQUIPMENT: Winco 220v/15k generator; Builer 8ft snowblower; Hotsy 810 power washer; Victor wielder; 500 gal fuel barrel w/ Gasboy pump; 1000 gal fuel barrel w/ Gasboy pump; Loftness 6ft 3pt snowblower; Huskee 21 inch single stage snowblower; (2) gas powered paint sprayers on wheels; Floor scrubbers; Nobles floor buffer; misc cabinets&shelving; student desk; teacher desk; tab les; chairs; wheeled carts/computer tables; weight room equip. including racks &benches; folding metal chairs&cart; lockers; merry-go-round; file cabinets. PLUS VOUCHERS FOR 2013 CORN AND SOYBEAN SEED, CHEMICALS, LP & DIESEL FUEL: CONSIGNMENTS TAKEN UP TO FRIDAY AUG. 16TH 8:00 P.M. ANNOUNCEMENTS AT AUCTION TAKE PRECEDENCE OVER PRINTED MATERIAL. SEE WEBSITE LATER FOR FINAL BILL. FOR MORE INFORMATION CALL CURT STILLE 641-430-0328 OR TERRY THOMAS 641-430-8205 www.rockwellialions.com HOT summer savings are waiting for you! Will be offered as three individual tracts th Harley Krukow Realtor CHAMBER ACRES, ROCKWELL, IA $FUHV)UDQNOLQ&RXQW\,RZD Insurance & Real Estate Shelia Atkinson Insurance Melanie Harrison STATE CERTIFIED RESIDENTIAL PROPERTY APPRAISER FHA APPROVED 621 4th St. NE - Hampton, IA RENTAL ASSISTANCE AVAILABLE Call me directly or refer me to your local lender for a home or acreage appraisal. rd FOR RENT Lantern Park Apartments 17 NEED TO PLACE AN AD? 456-2585 For Rent Cards of Thanks Wednesday, August 7, 2013 Jim Davies Realtor Chelsey Wiseman Realtor & Insurance Rochelle Abbas Realtor ZZZ)DUPHUV1DWLRQDOFRP 5HDO(VWDWH6DOHV$XFWLRQV)DUPDQG5DQFK0DQDJHPHQW $SSUDLVDO,QVXUDQFH&RQVXOWDWLRQ2LODQG*DV0DQDJHPHQW /DNH0DQDJHPHQW1DWLRQDO+XQWLQJ/HDVHV E C I R P ½ GUST U A r o f stalls In • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT REALTY Home Is Where Our Heart Is! 2 - 1st St. NW Hampton, IA 50441 456-4707 Kathy Stanbrough, 641-430-3821 Chuck Svendsen 641-425-7159 106 8th St. SE - HAMPTON MOTIVATED - 4 BR, 1.5 BA SELLER! - Numerous Updates - Deck w/Hot tub - Great Location PRICE REDUCED TO $99,900 333 100th St. - DOWS - 2 BR, 2 BA - Living RM w/Fireplace - 3 Acres M/L - 2 Stall Garage ASKING PRICE $135,500 305 6th Ave. SE - HAMPTON - Commercial Building - Highway 65 Location - 4,344 SF Building - 236’ x 198’ Lot PRICE REDUCED TO $84,900 www.abbottrealty.us • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE ABBOTT SOLD MINE • ABBOTT SOLD MINE • ABBOTT SOLD MINE (641) 456-3883 HWY 3 W., 515 CENTRAL AVE. WEST, HAMPTON NEW PRICE 817 2nd Ave. SE, HAMPTON - $85,000 • 3 Bedrooms/ 2 baths/ 1 car att. garage • New floor covering & replacement windows • Fireplace in living room • Bedroom & bath in walkout lower level 808 2nd Ave. SE, HAMPTON - $114,000 • 5 Bedrooms/ 2 baths/ 1 car att. garage • Updated carpeting, ceramic tile, windows • New patio in rear of house • Plenty of space in this 2,300 sq ft home! High Speed Internet for only $26.95 +LJKVSHHGLQWHUQHW[WHFKVXSSRUW )UHHVSDPDQGYLUXVÀOWHULQJ 823 Pine Street, DUMONT - $49,900 • 3-4 Bedrooms/ 2 baths/ 1 car det. garage • Spacious rooms/some hardwood floors • Updated kitchen, appliances included • New metal roof (2010) 720 Front St., GENEVA - $72,000 • 4 Bedrooms/ 1½ baths • Main floor bedroom/bath • 3 car det. garage, great storage! • Charming house with small town living! WWW.KRUKOWREALESTATE.COM 3ULFHIRU/LIH3ODQV12&2175$&76 1RWKLQJWREX\RUOHDVH1RSKRQHRUFDEOHOLQHQHHGHG *UHDWFXVWRPHU6HUYLFH 1-866-DO WMTEL 6HUYLQJ+DPSWRQ/DWLPHUDQG&RXOWHU 18 FROM YOUR NEIGHBORS :HGQHVGD\$XJXVW +DPSWRQ&KURQLFOH6HFWLRQ$ See All Local Events in The Hampton Chroni cle! HAMPTON COMMUNITY CHRISTIAN DAYCARE HAS OPENINGS IN THE INFANT ROOM! We are also enrolling for 3 and 4 year olds Preschool. Storm season taking its toll on community 7KH VN\ DURXQG +DPSWRQ ZDV TXLWH DQ LQWHUHVWing sight following a rain storm Monday, July 22. The sunset illuminated these large puffy clouds as they made their way eastward. According to KLMJ, the storm dumped 3.37 inches of rain on Hampton late Monday afternoon. (Photo by Nick Pedley, Hampton Chronicle) Stop in at 104 12th Ave., Hampton for details. Fall will soon be here! Preschool Open House is August 20th SP HCCD Preschool starts August 26th For more information, call 641-456-4922 CO-ED YOUTH SOCCER Grade: Prep - thru 8th grade (no preschool) Registration: August 13th • 4:00 - 7:00 p.m. at Sackville Insurance. Practices begin in September. Games will be played in September & October. Forms can be returned to: Sackville Insurance 7 1st St. SW Hampton, IA 50441 641-456-5521 NO REGISTRATIONS WILL BE ACCEPTED AFTER TEAMS ARE PICKED. Cost: $15.00 for the first participant, $10.00 for each additional member of the family. Price includes a t-shirt for each participant. Make checks payable to Hampton Soccer. Late fee $5.00 after 8-16-13 Participant Name: ________________________________________________ Grade: (2013-2014 school year): _______________ Birth date: ____________ T-Shirt Size (circle one) YOUTH Small 6-8 Medium 10-12 Large 14-16 XL 18-20 ADULT Small Medium Large XL *Optional Adult T-Shirt: $10.00 Size_______________ 6KDUSVSOLQWHUVDQGMDJJHGHGJHVZHUHDOOWKDWUHPDLQHGRIWKLV large pine tree at Mickie Eckhardt and Les Yaw’s farm south of Chapin. Mickie was unsure of an exact age, but guessed the tree might be upwards of 100 years old. Powerful northwest winds during last Thursday’s storm were to blame for the destruction. (Photo by Nick Pedley, Hampton Chronicle) This fallen pine tree at the house of Mickie Eckhardt and Les Yaw south of Chapin nearly covered the entire length of the front yard. The tree snapped during last Thursday’s late-afternoon thunderstorms. Streamline winds from the northwest were to blame. (Photo by Nick Pedley, Hampton Chronicle) Wedding Parent/Guardian Name: ___________________________________________ Address: ________________________ City:_____________ Zip:__________ Phone number: ___________________ Nights of Conflict:________________ Youth soccer will not succeed without an adequate number of coaches and volunteers. Please sign up! Any parent who coaches will have their child’s participation fee waived as a Thank You for coaching Coach: YES NO Assistant Coach: YES NO I give my permission for my son/daughter to participate in the Hampton Soccer Program. The volunteers assisting with the program will not be held liable in case of any accident or injury that may result because of my son/daughter’s participation. Sign:___________________________________ Date__________________ Welcome to Ackley Class of 1952 reunion Medical Center Some members of the Hampton High School class of 1952, DQGVSRXVHVKDGDPLQLUHXQLRQDW*RGIDWKHU¶V3L]]DRQ)ULGD\ -XO\ )URP WKH OHIW ¿UVW URZ -HDQ DQG 5LFKDUG &UDZIRUG %RE%UXQV5RVHPDU\%HDFKDQG6\OYLD1HOVRQ6HFRQGURZ (OGRQ/LEE\%DUEDUD0XUUD\5RVDO\Q6\PHQV-LP6WDOH\DQG Merle and Karen Kaplan. DUST, MOLD Ryan Hurley and Emily Heeren Ryan Hurley and Emily Heeren were united in holy matrimony April 13, 2013 at the United Methodist Church in Hampton. The reception was held at the Hampton Country club. The newlyweds honeymooned in San Francisco and Napa Valley. The proud parents of the couple are Floyd and Mona Hurley of Marietta, Georgia and Dean and Vicki Heeren of Hampton. Emily and Ryan live in Marietta where Ryan is employed by ARROW as a Senior Sales Account Manager. Emily is a Vascular Interventional Technologist at Kennestone Hospital. AND POLLEN MAKING YOU UNCOMFORTABLE?? THIS SOLUTION IS NOTHING TO SNEEZE AT. Murphy’s Heating & Plumbing Inc can help you live smarter with a new Lennox® air purifier. Lee Carlson, ARNP-C Ackley Medical Center DANCE CENTER www.msninasdance.com RECEIVE UP TO $2,500 in rebates* and tax credits** Meet Lee, our newest AMC provider: • AANP Board-Certified in Family Medicine • Strong rural medical and emergency response background • Born and raised in Iowa ACKLEY MEDICAL CENTER 1000 10th Avenue Ackley, IA 50601 641-847-2625 www.emhia.com with the purchase of a qualifying Lennox® Home Comfort System. OR * Special Financing Available Murphy’s Heating & Plumbing Inc. Hampton (641) 456-2372, Sheffield (641) 892-4791, TOLL-FREE (877) 221-2372 Locally owned and operated Offer expires August 23, 2013 *Offer is valid only with the purchase of qualifying Lennox® products. System rebate offers range from $300 - $2,000. See dealer for details. **Visit www.energystar.gov for more information on the tax credit guidelines. © 2013 Lennox Industries, Inc. “If you want to be the best… dance only with the best!” ENROLL NOW BEGINNERS (3 yr. olds) THRU ADVANCED For INFO: (641) 892-4104 or Cell (641) 420-1316 Studio address: 214 1st St., SE in Hampton (2 blocks south of the Methodist Church) Classes resume Monday, August 19 NINA R. ESSLINGER DIRECTOR/CHOREOGRAPHER